2J7PD

Gmppnp-stabilized ng domain complex of the srp gtpases ffh and ftsy
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
282
structure length
265
Chain Sequence
IPWGGNLEEVLEELEMALLAADVGLSATEEILQEVRASGRKDLKEAVKEKLVGMLEPKPVEPKGRVVLVVGVNGVGKTTTIAKLGRYYQNLGKKVMFCAGDTFRAAGGTQLSEWGKRLSIPVIQGPEGTDPAALAYDAVQAMKARGYDLLFVDTAGRLHTKHNLMEELKKVKRAIAKADPEEPKEVWLVLDAVTGQNGLEQAKKFHEAVGLTGVIVTKLDGTAKGGVLIPIVRTLKVPIKFVGVGEGPDDLQPFDPEAFVEALLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SIGNAL RECOGNITION PARTICLE PROTEIN
publication title Structure of the Gmppnp-Stabilized Ng Domain Complex of the Srp Gtpases Ffh and Ftsy.
pubmed doi rcsb
source organism Thermus aquaticus
molecule tags Signal recognition
total genus 98
structure length 265
sequence length 282
chains with identical sequence E
ec nomenclature
pdb deposition date 2006-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00448 SRP54 SRP54-type protein, GTPase domain
D PF02881 SRP54_N SRP54-type protein, helical bundle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.140 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2j7pD01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2j7pD02
1G18A 1G5TA 4NYJR 4UXIA 3CRW1 1B0UA 1Q44A 3R9IA 3T34A 1QBKC 1WCV1 4EKDA 5K8TA 1RJ9B 2ZRMA 1ZU4A 4QC2A 1DO0A 4L15A 1DG1G 1J90A 1D2EA 1U0JA 4D0GA 2OZEA 1JQJC 1A5TA 2REOA 3VAAA 1AGRA 4HUQA 2IK8A 2ZM5A 4KHZA 5J47A 4MKHA 1HUQA 3KZ1E 3RS2A 1G5RA 2W2VA 5BN3A 5FL7A 1HT2E 2XB2A 2VHQA 2CJWB 2FJUA 1KZ7B 5JEDA 2YINC 1W36C 4BEBA 4LBVA 1VIAA 3VR6A 3I8XA 3OAAD 5DN6D 1E4YA 3X1WA 3FMPB 1ZJ6A 3T1TA 4CEIA 1FUUA 2VP5A 1UFQA 2JIZD 2ZRNA 5L3RA 4LBZA 4ZKDA 5GJVC 2J87A 2IS2A 1E9SA 1GG2A 3QBVA 1IJFA 1C4OA 1A4RA 3RDPA 4EPWA 1UJ2A 5JCZA 2P67A 2O5VA 5FPYA 2EYQA 3UIEA 3KTAA 1BMFD 3MWLA 2W2TA 3X2SA 2QROA 3V4RA 1RZ3A 2ORIA 4I1VA 3QXCA 3BFXA 2BKUA 2ZTSA 4D4MA 1MO4A 2Q9BA 3KUDA 3WYAA 4PSVA 1SVMA 2GZDA 1E9BA 2BKEA 2NO7A 3AGQA 4ZIRB 1Y63A 2N1BA 1Z6GA 3LXXA 3SJCA 2RAPA 4CZ2A 4EPVA 2O8CA 3LRPA 3G0HA 3DDCA 3TUJC 3TKLA 4BFYA 3AF0A 5BWMA 2UZIR 3IPXA 1ANKA 1PJRA 4FWTA 2OE2A 3VQTA 5J4LA 2ZUDA 2A5YB 4HUTA 4CEJB 4KVGA 4LWZA 2H16A 5AUOB 1XXHB 3NWJA 4JLDA 2ZJ8A 2VO1A 1Z8FA 4DDVA 3PCRB 2WIAA 1F2TB 4Q66C 2G3YA 4P32A 1G8PA 1L4YA 3BB4A 3QJYA 1HEIA 3RABA 3V9PA 3X1DA 4WA7A 3QF4A 1JI0A 1WB9A 2RGNA 4DLTA 1ZUHA 1I4LD 1EWQA 3KUCA 4EPXA 3AM1A 3GJXC 2A5JA 2G6BA 3B1YA 5C4GB 3LH5A 3QOFA 1U81A 3HU1A 1JJVA 3B1ZA 4A6XA 4ILEA 3EIEA 3TRFA 1J99A 1M1YE 5AJXA 3BB1A 2JJ8A 4PZYA 1XEWX 3OEHA 2VQSA 4FIDA 3REGA 4EAQA 3GP8A 3PFIA 2VF7A 2BEJA 2AHOA 2MSDB 2XNDA 5CITA 1RRGA 2OBNA 1BS1A 3WMGA 3ZVNA 3W9YA 1DAKA 2Q21A 1UM8A 3MSXA 1E3MA 3ND8A 4HDOB 4TYQA 4BLOA 2R65A 4DLUA 2QBYB 1G21E 1H8EA 3D3QA 2EWVA 3B1XA 4OHWA 5JS7A 1NVUQ 5TB5A 4D4JA 4M21A 1TF2A 1E1QD 2KWIA 3CPJB 3K70D 4DSNA 2FPMA 3AP2A 2ZUBA 4HLCA 3CPEA 4BFWA 2HEIA 1HA3A 1Z6XA 4ASUD 1YE8A 3UG7A 4B3BA 3GLGA 1Z06A 2GCOB 4KBFA 2REBA 3CIOA 2W6IA 4P0TA 4BLQA 1G4AE 3LW7A 2GILA 3GJ0A 2WWXA 4KJZA 4BRWA 1HY3A 1HURA 1QHGA 2ZS9A 4N0DA 5FI1B 2CNWA 1PLKA 1PUIA 2C99A 4Q9KA 4C7OA 2R44A 1G41A 1KGDA 3EARA 3GEEA 3EPHA 4EPRA 1W5SA 4HAWA 2Q3FA 2V9PA 2PLRA 1XMJA 1LNZA 2Z5FA 1OJLA 1EXMA 1HQCA 2EFCB 1U98A 5EE3A 5IK2A 1PLJA 1WP9A 2EFHB 2ZSDA 3DL0A 5IDVA 3IHWA 4MUBA 3QKRA 1GVNB 3EWAA 4V0OA 2YWEA 3Q7PA 2NO0A 3I73A 4TLEA 3E5HA 1BIFA 2QPOA 3BH7A 4DXAA 1PVOA 1VCNA 4DUGA 5KNCA 1N6RA 4TYPA 2NPIA 2V1UA 4DLZA 4D26A 1CJKC 2DCUA 4TT3D 3K1JA 2JLWA 1AZSC 3QY0A 2XGJA 3OHMA 1YZTA 1UBEA 2DWOA 2O0HA 1M34E 1BH2A 2GXQA 3JZMA 4N3NA 1N0VC 4OHVA 1Q12A 2AK3A 1AJEA 2ZVQX 5GJWC 2J3EA 3LO5A 3C15C 4I99A 1U8ZA 1DEKA 3CUEF 1ZP6A 5EE0A 3CRMA 3EAQA 3K9LA 3IIJA 5KU1A 1R5NA 4C2UA 2QTVB 1OFIA 4TTRA 1I2DA 2YOGA 4D82A 2RMKA 1FL9A 1SKYB 2J1LA 4DT1B 1G19A 4AG5A 3IBYA 3Q85A 1DAGA 5B30A 1GL9B 3HJNA 4JLBA 3BB3A 121PA 3REFA 4ESVA 4S35A 1G7RA 3KXKA 2QRNA 4M9XA 4TMTA 1OH8A 1X8LA 2JA1A 4P33A 3MRSA 3PV0A 2CL6X 3QE0A 2YNMA 5JRJA 1SVOA 1E9CA 2J46A 3N70A 1Q3HA 2WJYA 3R7WB 3BXZA 4LRWA 5KYKA 1TQ4A 1GSIA 1F48A 1OH6A 1OHHD 3JVUA 4D2IA 3FVQA 4A36A 4AYWA 1DG3A 3LY5A 3KQLA 3ASYA 4A82A 4QJ3A 4XIGS 1KK0A 2DFNA 2WWIA 4CEHB 4AY2A 2ODNA 1KI6A 3GLIE 4GZMA 2QTHA 3T5GA 5CB8A 1P60A 3MWJA 6Q21A 3SJAA 2QAGC 1YRBA 1ZUNB 5HKKA 1Q0UA 1SXJB 3M4YA 2ZR7A 4UQOA 1IN8A 1N6KA 1N25A 2VEDA 4EJSA 2KSQA 3TR0A 2X2FA 4KAXA 4GDFA 2WJHA 4JYBA 4WOPA 4J0QA 4G5GA 1I4TD 2D2EA 2I1QA 2JJ1A 3G82C 5JLJA 2FSFA 1P3JA 4W7SA 2HUPA 2ATXA 4QHSA 4PC1A 1S1MA 3U7EB 1YR7A 4BLSA 1GDDA 1GRRA 3L0SA 3L82B 4L5BA 5JJIA 4P4SA 5H1YA 3MWYW 1QF9A 2ZRBA 1KOFA 1JQLB 1YR9A 4PPGA 5FFMA 2QE7A 4V0KA 1UDXA 2KB0A 1T91A 3KXIA 2ZETA 3FWYA 4A0GA 2UZ3A 1Z0IA 2ZRLA 4E03A 3BJIC 3SQWA 2R6GA 1T8TA 2DWQA 2CDNA 2R6FA 2ZRKA 1KK3A 1XJCA 3KFVA 3PUYA 4YDSA 1VMAA 2F6RA 1IN7A 4JBXA 5JJKA 4Z8YA 3THYA 4Q1BA 4W5JA 4G5SA 3B82A 2HT6A 3K70B 2RGDA 1ETUA 4Y0AA 2QSYA 3CLVA 3U7HB 4M1WA 4GP6A 5FOXA 1LFDB 3K0FA 4PHGA 2NMVA 4Q18A 4M0LA 1KSHA 4MKGA 2J59A 4K8OA 3DZDA 3T1OA 2WWYA 4MRPA 4GBMA 4BECA 1QHSA 3QQ5A 4QGAA 4BGDA 1ELOA 5TARA 3IPYA 4Q47A 3T06B 5C4MA 4QNRA 4QFMA 2DWPA 1ZBDA 2RCNA 3CX8A 4Q5IA 4TSFD 4V02A 1S96A 2PCJA 3CZPA 2DFTA 2H8KA 2REXB 2OM2A 2XJ4A 3ZZ0A 1XRJA 1HYQA 3RS7A 3AF4A 1VG9B 3LQQA 3WY9A 3R8CA 4A6PA 3D6TB 1S1CA 1S9DA 2ANCA 4GMXA 2NZ8A 4YMSA 5EP2A 1PLLA 2ZRCA 2W6JA 3H84A 1QG2A 2WHXA 1HQYE 4M8NE 5C2JB 2EFEB 2V55B 3LAWA 1F5NA 2R6AA 4Q9JA 1JECA 5E7MA 821PA 1ZUIA 2A2ZA 4Q7JB 2J0QA 1AQYA 1GL6A 3U2QA 4BFUA 3TIFA 1XEWY 4IOMA 2OHFA 4XSGA 4OHYA 3LQRA 1NMXA 1GAJA 2RGXA 1CBUA 4AK9A 3IDQA 1U8AA 2VSXA 4HAZA 1TF5A 2HJGA 4DRZA 3I1FA 4Q4HB 1JR3E 3TJZA 2J0UB 5LB2A 2E1RA 3U7GA 1J7KA 1N5KA 1P5ZB 1Z47A 5BXQC 3U4QA 4L4UA 1JEDA 5L3SA 5LPNA 3GLFB 1E0JA 5JWOA 1KMHB 4UNQA 2VPPA 1KNQA 1TUEA 1II9A 5JBQA 3PENA 1G8YA 1K5DA 4LHZA 4OQXA 4Q21A 2ZE5A 3L43A 5EE1A 1VTKA 3LX8A 4U5XA 1G64A 1XFAA 2H5EA 1D8TA 1W46A 3IBGA 2AFHE 2YWGA 1XMSA 3W3ZB 4D80A 1KJZA 4LJYA 1P73A 2VHJA 2FZ4A 3HU3A 4CRWB 1UAAA 3NIBA 2P6NA 3A4LA 5DI9A 4DCSA 4EQ6A 1OF1A 3KKOA 3SOPA 1CIPA 5FL7D 3U3KA 2JLQA 1S4QA 1XCGB 3A4MA 3OE7D 5CM9C 4D0NA 4NPHA 1G3RA 1N6NA 1VECA 1NI3A 2YVUA 3IEVA 1T8UA 1SZPA 3NHAA 1K5GA 2G88A 1TMKA 1XD2A 5J5CA 1QHXA 3CH4B 1II0A 1IY0A 4KO8A 2GAAA 4TZ0A 1OFHA 1AS3A 4E07A 2AX4A 4OQNA 3W6NA 2Z0MA 5G3ZA 1L7VC 3RHFA 3GFPA 3OFNA 4DB2A 4HZUB 2IWRA 2IBMA 1BO6A 2F9LA 4PPQA 4BASA 3GJ6A 1NJFA 1E2QA 2QUZA 2FA9A 1JNYA 1ZNWA 2NO6A 3AF2A 1WGWA 1ZMXA 3KQKA 3W6PA 4DLWA 4OI2A 2CCJA 1OXXK 4BLTA 1GNPA 2CCKA 1JAIA 2QSZA 4HAXA 4JSYA 4ITRC 2WVJA 4G01B 4BFTA 3U6KA 1KKLA 4RD2A 1X6VA 521PA 3WYGA 1W0KA 5SZHB 1ZM7A 2ZSFA 3NBYC 4LUCA 2QORA 5A5GA 2AR7A 3TMKA 1GNQA 3MJHA 3OIUA 1VYTA 3R8FA 2EW1A 4WIAA 5UKDA 1MKYA 1OFUX 3FB4A 4OQLA 4R9UC 2ZSAA 1E2HA 2NTYC 3NBFA 5F9FA 2ODBA 1EX6A 3AV0B 2HCJB 3QVUA 2W83A 2OCYC 2PX3A 4LY6A 4M1YA 3QEJA 3QG1A 4RVCA 2P5SA 1KY2A 3ADDA 4PAMA 3T61A 4QG7A 1B23P 4RJLA 2A5DA 2O8FA 3ZQ6A 5B64A 2QMUA 2ZR0A 3AVOA 3U7FB 1DAEA 1G17A 1GP2A 2BV3A 2ZE7A 4BE7B 3K9NA 5TY0A 4R71A 4QM7A 2PT5A 2XEXA 3ECCA 4KXFB 1II8B 2D62A 2B7BA 4JL6A 2C9CA 4M53A 5IF9A 3HWSA 2RGEA 4Z8XA 1CJVC 3FYHA 4QGHA 3IO3A 2IS1A 1IY2A 2D06A 1ZNYA 3L0OA 4Y0VA 5D3MB 3RLFA 4LZZA 3RRYA 4JIMA 2O8BB 4EUNA 1G8HA 1CRPA 4C9BA 1JALA 1YR6A 3AEZA 4R2HA 4KODA 2P2LA 3OEHD 4B34A 3LV8A 5FOVA 3CPHA 3B78A 5LBIA 2BCJQ 2ZRFA 4ON9A 1L4UA 5IHPA 5G41A 4MA4A 3LWNA 4EFNA 5JSZB 4Q1FA 2JJ2A 4M1TA 1DOAA 1H8ED 3WMFA 4Z54A 1NRJB 2YWFA 2F43A 1Q1QA 1QVAA 1FOEB 2ZJ5A 3TAHA 2ZXUA 4XTCS 3B9PA 4ZCLA 2C8VA 3EZ9A 3MG9A 1GKYA 2ZREA 2FEMA 1TQ6A 2BMJA 2FNAA 4II7A 5KHOC 4HAUA 2W6ID 2VIIA 1I4DD 1AS0A 3DM9B 3AF3A 2IXEA 5EUQB 1XCPA 3M0EA 3SI7A 1XTKA 3ZVRA 4B2PA 1R7RA 2V7QA 1G7CA 5KOYA 4B33A 3PITA 1X8JA 3KKPA 1KO4A 1SVKA 4A0HA 1P75A 2LWIA 1J8MF 4GOKA 3LBIA 4NKRA 3QSYA 1YZKA 1A2KC 3ZS9A 3THWB 2QPAA 3K8YA 3QPWA 4PR0A 5AR1A 1P9WA 2C95A 4GOJA 2O0JA 4TL6A 2FH5B 3SDZA 1KJWA 4MDEA 3R20A 3HPRA 1P7CA 3RWOA 2F1IA 3BRWD 4GT1A 3I5XA 5ELXA 4AYTA 4EPYA 3CONA 4FCWA 3FHTA 3NBZC 4NU0A 3HDTA 1KY3A 2OCPA 2FZLA 4NONA 2CHGA 5JWRA 2QZ4A 5SZKB 1W4RA 2FX3A 1SVSA 2YWHA 1SVWA 2WBLC 3MCAA 1O87A 4V0ME 3NDPA 1IQPA 4JJZA 4XTRA 1LV7A 2D7CA 4YXWA 4N0EA 2ORVA 2GVZC 4KLZA 2VP4A 1KSJA 3H1TA 1D6JA 2QAGA 1TF7A 3NKVA 3DPUA 1V43A 1E0AA 2ZPTX 4L8GA 3RVBA 1XF9A 2VHTA 3Q8XB 5JHGB 4BUJA 2ODEA 2VH5R 4V0MA 1P9RA 3BFVA 5J40A 3TW8B 3DKPA 2FFBA 4FWIB 4R2IA 3FFBA 1T3SA 4PAOA 4FCVA 4DSTA 4D81A 2WSMA 2ATVA 2FE4A 4G5OA 1CJUC 2IYQA 1AA9A 4C0BA 4G3XA 5FBQB 2C98A 2F9MA 4JLOA 4GRAA 5CDFE 2V54A 3BOSA 1W4CA 3FHOA 4Q48A 3AP3A 3CRQA 4ZI3A 3W3AA 2O8DA 3UG6A 1D2MA 4JT2A 4HEJA 3U5ZB 2A5GA 5FBWB 3W5JA 2ZI7A 1LW7A 3TLXA 3ZVMA 2O8CB 1HH4A 2DB3A 1NN5A 1P4SA 2V1XA 3OF5A 3TUZC 4LJ9A 1NG1A 2XXAA 4HI0E 3TW4A 4FCTA 2OAP1 4TMVA 1H8HD 2W00A 3JVVA 3OIWA 1GL7A 2RGAA 4B35A 3BK7A 1IAQA 4PSAA 2PZGA 1Z6TA 4TMZA 4BZQA 4LV6A 3PIRA 3SBDA 2XTZA 3QF4B 4RD4A 4HLUC 5KUTA 1AKEA 4EFLA 4TL9A 1G3MA 1RYFA 3NVAA 2WWGA 4NCJA 1S9HA 4FMCB 4KBGA 5G53C 2WTUA 4WXRA 3GLHE 1XPUA 1CKEA 5FPSA 1XDBA 2BVNA 1YZQA 4ZDJA 4GL2A 2D3WA 4V03A 4XVUA 1ESNA 2R2AA 2OUKA 4LCBA 2MSEB 4M22A 1KI4A 4AD8A 1XB2A 2IYVA 5AJYA 4IOKA 3NH9A 2VLIA 3CNLA 3MGCA 3SJBA 5C46F 1O3YA 4C30A 2JLXA 4CT4B 1GIAA 1Z6AA 3TQCA 4TYYA 1R4AA 3FKSA 1G5PA 4IRUB 4QL3A 1DBSA 2F1JA 4KU4A 2HYIC 2EFDB 5K8UA 3RANA 4WZAE 4LI0A 5L3QA 2IYXA 5FPKA 1M7HA 3AVWA 4GI7A 2WWFA 4MRVA 4PC7A 5K8IA 3B1VA 1N6OA 3R9WA 3GLGB 1F2UA 2CLDX 2R8RA 1ZNZA 4I81A 4F93B 1PUJA 2OFXA 5DIFA 4AYXA 2VHCA 4TMKA 4MGYR 4LJ7A 4A2PA 4B76A 4M1OA 5EXPA 3EX7C 2QT1A 1OKKA 2X8AA 3K0SA 3EZ2A 4IHQA 1YJ5A 3FTQA 3SBEA 4C7OB 5B57C 1NN0A 1CU1A 5FOUA 1DAMA 1FPMA 1NVVR 4OK6A 1Q1ZA 5CK4A 4OK5A 2VP9A 1CTQA 2GJ8A 3ZIAA 1EESA 3QKRB 1AS2A 5JEEA 5HZKA 1R0WA 1FNMA 1KDTA 4DDWA 5G40A 2BM0A 1FX0A 4L9SA 5EXSA 4Q01A 3AKYA 1SXJD 4X8MA 3T15A 4AKGA 4E09A 2IYLD 5EQTA 1QG4A 1E2LA 1LS6A 3U44A 3O47A 3TSOA 3HYTA 3D31A 4F38A 3ASZA 4LJ5A 3BORA 4MGKR 3FFAA 4QNMA 3WP0A 1T6NA 1UKVY 1W0JA 1AKYA 4GFDA 3KKMA 4AURA 4D6PA 4D4LA 2YC4C 2DFLA 1S8FA 2QGNA 1E2GA 2JATA 3SQXA 3ZYCA 2QAJA 4UNPA 2GEVA 1ZD1A 1U0LA 5H68A 2C78A 1E0KA 1S2MA 3LBHA 2RKOA 1TQ2A 2ZJOA 3VU9A 2RB4A 1NG9A 4PC3A 2PEZA 4ZKEA 1JJ7A 4OI1A 2GCPA 2AK2A 1YR8A 4PX9A 3ZZUA 1DPFA 3SHWA 2OFOA 1D2NA 2IHBA 4DCVA 4X8OA 2ORWA 1D9XA 3MUFA 1T3LA 4P4TA 1VKJA 5DE3A 4A2QA 3EC2A 1NBMD 5C18A 1ESMA 4GSYA 3C8UA 4PO1A 1TQDA 1EGAA 5LD2B 2ZVPX 3Q7QA 2AL7A 1TX4B 3K0AB 4RZUA 4M1KA 4OHZA 3EZ6A 3A1UA 4OBEA 4OKSA 2GKSA 4UJ3A 3U3JA 5AK0A 3HR8A 3S1AB 1KI6B 1J70A 1D5CA 4CVNA 2JAQA 4QBIA 1X8KA 2OCAA 2P3SA 2GWHA 1TL7C 3BAFA 4PQRA 4HLQB 1S3GA 4YMWA 1Z2CA 2R9VA 1NLYA 3IQXA 1E6CA 1CXZA 2YJTD 3QXJA 2ZAOA 4PTLA 1E96A 5LB4A 1ZM9A 3TE6A 4EJSB 5G3YA 1E1RA 1VHTA 3EIQA 4ARZA 5HE8A 4CIDA 4Z1MD 1NMYA 1T4GA 3I72A 4B3FX 3DZ8A 4YMTA 3PUWA 1NMZA 3VR4A 3QI2A 4R98A 1KYIA 2J7PA 4QHTA 4BFVA 3IIKA 3PXGA 1T5LA 2BM1A 5AUPB 5JI3E 4X8HA 4DB4A 3EWSA 1W0KD 1Z29A 1W48A 4JL5A 2D7DA 3QPVA 2WJJA 2CXXA 1QHHB 3RAPR 5E3HA 1Q3TA 3U3OA 1P2UA 3BH6A 1ZD9A 1DELA 1ZNXA 2Q0HA 2J0VA 5FL3A 4B74A 4I1UA 2ZJAA 2JASA 1TADA 5KO2A 3GJ5A 1GKIA 2JDID 3SS8A 1XXHE 2OBLA 4F7WA 4UNNA 2QTFA 3EG5A 3VX4A 1OYWA 4F91B 3UMFA 1WE2A 4XVRA 3WBKA 1E2EA 3THYB 5FR1A 3CRVA 4HLDA 4BFXA 4PHHA 3SHFA 5LDDC 3AVXA 1VG8A 2ZE6A 1XP8A 4DVGA 3CWQA 3LXRA 5CLQA 2N46A 2WV9A 2WJVA 4RFSB 4V0LA 3K0FB 1FTNA 4MYTA 5KSPA 3HPQA 3VR3A 1F2TA 3A1TA 5HTKA 4LBYA 4Q00A 4XWAA 4AKHA 1DE0A 2I3BA 1G291 5FTJA 1QDEA 4AC9A 1DTSA 3O8DA 2B7CA 3F3YA 4URZR 3SC3A 3VR5A 2QPTA 3C7KA 4LJ6A 1OIXA 3SE0A 4JLNA 5KDDA 3CBQA 1CP2A 3W90A 4W5WA 4TYNA 1RVDA 3A36A 1KO5A 3KQUA 4O2RA 4IDNA 4M4SA 3FOZA 3K53A 2NZJA 4I4LA 1E2JA 1A7JA 4HDQB 4OI4A 3AVYA 1X1SA 4WAUA 4I1SA 4LV8B 2JLZA 4XWKA 2GF0A 2IF0A 2XX3A 2ODWA 4NCKA 1IN4A 1HE8B 4WW0A 4DWJA 4UXHA 4B3CA 1P2SA 3ZVLA 5EP4A 2Q3MA 1E2PA 4M9ZA 4FI3C 5DI3A 1P2TA 3K9HA 3VFDA 4XOIA 2ZJ2A 1QVRA 2IXGA 3WRYC 2DY1A 2EWWA 2IUSA 5EJEA 2AXPA 1OSNA 2GZAA 1VCOA 1W2HA 2VF8A 4URUR 3GLIA 3O8BA 2CLSA 2QEQA 3TBKA 3SYKA 3DOFA 4QOSA 3VHXA 2Z83A 1G3IA 1I2MA 1OIVA 1R8SA 2V7QD 3SJZA 1CJMA 1FMJA 1L8QA 3ADKA 2ZAMA 3PEYA 2GRJA 4C0HA 4CDGA 3RS4A 1GUAA 4AKEA 3M6AA 2KI5A 2CMKA 2OO7A 3U4QB 2YC2C 1XD8A 4MRRA 4ABYA 4LDJA 5L3SB 1NIPA 1RW4A 1ZU5A 4NCNA 4CGZA 2ZR9A 3O8RA 4TMXA 1KI2A 3LLMA 4XD7A 3UMRA 1VDZA 3KX2A 2QENA 3AF1A 3I61A 3KQHA 1G7SA 1X3SA 5KDLA 3KL4A 1EFRD 5E7JA 2WSSA 4LHXA 2BMFA 2CHVA 1TEXA 1IONA 3FMOB 3RS0A 2GA8A 4NE2A 4B75A 4GZLA 2OT3B 2IUTA 4PPNA 4DJTA 2IXFA 1XTJA 4EDHA 4IOJA 4RY2A 2WPDD 5CJ2A 4EQ6B 1YZGA 4LYHA 2VRWA 1BOFA 4PC2A 2WM9B 2FOLA 3OEED 4LPKA 3HR7A 4QXAA 3DMDA 1T0HB 1WDTA 2PT7A 3PR1A 4JKYA 1MABA 4HAYA 1G6OA 5CK5A 1RRPA 2QP9X 1ZW6A 4JLAA 4M2LA 1XD2B 4NYMR 1SKYE 2A78A 4QM6A 1KNXA 2GETA 4ZDWA 1Z0DA 1E2KA 4YXWD 4BFSA 2YOFA 3QXHA 4DEYA 3VR2A 5DN6A 3A37A 1IHUA 1WRBA 3IILA 3I5YA 3C16C 3P20A 4WBSA 1NKTA 4JLPA 2JIZA 2WAYA 2P0EA 1G1MA 3KXLA 1N6PA 1E2MA 5FPHA 2BDTA 1S0UA 3GJ4A 2AKAB 4JZKA 1XMIA 2DFKB 4P3YA 2IUUA 4K46A 3EPJA 3LFUA 4UKDA 4B3GA 2W0SA 4FMDF 2H18A 4IEIA 3C41J 3GPLA 2I4IA 2ZI3A 4HLUA 4KYUA 5JMTA 4KYIB 1DAFA 1M74A 3EASA 4RZ3A 4Q9IA 1MH1A 3RSLA 4IXNA 2IYZA 2EYUA 2JCSA 4BZXA 4D4KA 5AUNB 4Q9LA 5DYIA 4ESHA 4PO9A 3VKHA 3MMPA 3EPKA 3AGPA 1SXJE 1GRNA 621PA 1RPZA 4TTPA 4CEHA 3THXA 2PJRA 3TVTA 1UEIA 2IYTA 4JYCA 2ZRHA 2AD5A 5EXXA 2O8FB 1FZQA 4ACBA 4DBLC 3QEOA 4ZV4A 1CR0A 1QHNA 2J5XA 2XAUA 4KITB 3FE2A 3EZFA 4CW7A 1Q20A 4IEEA 4MGIR 1DARA 3L8YA 1N5JA 2RGBA 1JR3A 2D74A 1COWA 5L3VA 1CEEA 2FMXA 1EG7A 4MKFA 4CT5A 721PA 3SFZA 2HDNB 3U3RA 3GEHA 4A8JC 2MMCA 1ZIOA 3UWKA 5GADl 1P6XA 2Q9AA 2BCGY 2CL0X 1GITA 3CR8A 2A30A 3B8HA 3NBXX 4IOLA 5DGXA 2B8WA 2EVWX 3DO6A 1CRQA 2X2EA 3FKSD 3DOEA 5EXTA 1WF3A 3CX6A 4Q4JA 3PEVA 1OFTA 1US8B 4DC9A 4H1VA 4KFRA 3U6BA 2ZI5A 2RGCA 2F1HA 1K6MA 2XZOA 3B85A 3DM5A 2XB4A 5GVSA 1SULA 5KTYA 3T35A 1E1QA 2FWRA 3FMFA 4NP6A 3O8CA 1U90A 5JHHB 5FTNA 4DCNA 1RC8A 4LC1A 2VSFA 4RKFA 1UEJA 3L2OB 1U2RA 2VP0A 4WZ6A 1Q1EA 5DHFA 1VYVA 1MO3A 2CVHA 3QVVA 4FD2A 2P6RA 2IYUA 1OKKD 3PVSA 1EFUA 3H86A 1W4AA 3QBTA 2R6DA 2YHSA 3NC1C 5EE9A 5C1BA 1J8YF 3AVPA 2BIFA 2SHKA 4ZCMA 4BFZA 3C5HA 3CW2A 3UMSA 1WQ1R 3WNBA 2C2HA 2GDJA 4RFVA 5EP1A 2A3RA 3P27A 3KB1A 4X8LA 3I4LA 5AJZA 5HPYB 1KKMA 2XZLA 2BBOA 2ZS8A 3LLUA 4LYFA 4QKQA 4KFUA 2C9YA 2IX3A 1TEVA 4NCHA 2NG1A 2ZRIA 1LF5A 2B21A 3SYNA 3NDBB 4TT3A 3Q9LA 4LJ4A 2DR3A 4URVR 4AI6A 4P31A 2IHYA 4TL8A 1KI7A 2OEPA 3GLFE 1FW6A 3BIFA 4PHTA 1E9AA 3QKSB 4R7ZA 2GHIA 4GP7A 2O8EA 4IJMA 4Q4HA 3LA6A 4OJKA 1E94E 2QAGB 4JVSB 5K8LA 2ONKA 1CR1A 2O0KA 3WRXC 1G6HA 2YOHA 2XNDD 3GLFA 2XOKA 4RD1A 4FINA 4NYIR 1Z3IX 2V4ZA 3B5JA 3HP1A 3QNUA 4B73A 5KNDA 2W58A 1UBGA 2XNSA 4NDZA 3WYFA 2B6HA 1AM4D 2OXRA 4Q7MB 1XNJA 4A4DA 3NHBA 1VPLA 4IXMA 4TLDA 3K0CC 3B13B 4Q19A 2W0MA 3C5CA 2ZSEA 2OAQ1 2O8DB 2Q9CA 4YQFA 3RS5A 4F4CA 1BYUA 8OHMA 3KB2A 4XH9B 4JMPA 1C1YA 5J4HA 3IUYA 3EA5A 3CH5A 3VMFA 2CNWD 2XXAB 1MRSA 1ZC3A 3L0PA 3JZAA 1YRAA 3AP1A 1KJYA 3GJ3A 3KJHA 1SVIA 3RS3A 1Z83A 5F98A 1FQJA 4JVNA 3A58B 1E1RD 1N6IA 3N2EA 4IDOA 3SU8A 2ZUCA 4OL0A 5HR5A 4YONB 1U9IC 4F92B 4FW9A 1GZSA 1E99A 1NL3A 1W5TA 1XEXA 1UBFA 1FTSA 3I8SA 1IXSB 2YV5A 5IK2D 4V0NA 1CR4A 1E79A 1WBBA 3LVQE 1N5IA 2G77B 4JVLA 4PANA 221PA 2PL3A 3ZH9B 1OH5A 4A0RA 3GEIA 4DUGD 1IN6A 5KPDA 1PZNA 1W4BA 4LYJA 4HUQB 1XJQA 5HCIA 2HJVA 2VYFA 4MYUA 5JCPA 1NN3A 4DCUA 4OI0A 4POAA 4F4JA 3QUSA 1AGPA 4TL7A 2FF7A 2X77A 2GK7A 5BYKA 2F55A 1SHZA 5TVKA 4RKEA 5KSOA 2ZRPA 4Q4AA 2KBFA 4HAVA 2FU5C 1ZCBA 3N5CA 4QJ5A 5L3QB 4CEIB 4NHOA 4HB3A 2CL7X 4DHEA 2IW3A 3BWDD 4B71A 1UKZA 4RD3A 2FGKA 1VG0B 2IS4A 1S3SA 2OBMA 2PX0A 2OLKA 4UXJA 3W5IA 1R2QA 1ZCAA 3MD0A 2IF2A 1OXSC 1W7AA 4A15A 2GJ9A 2GJKA 2KBEA 2VTKA 4FXPA 2OFWA 4DEXA 1YZUA 5H8WA 4FN5A 1T9HA 2VP2A 1VYUA 2DHRA 3MFYA 5EZ5A 2ZI9A 3H2YA 3CB4A 2BEKA 3UPUA 1G9XA 3K9GA 3KTAB 1J2JA 1KZGB 4C3ZA 2ECKA 3UXMA 3E70C 1Z5ZA 4YLGA 5D3MA 1W49A 2CBZA 1G16A 2GCNA 4Q1CA 4WXPA 4CF7A 1EFTA 1XPOA 2GEDA 1N2CE 1Z28A 4TSFA 3EPLA 4I1OA 4JKIA 3W8NA 1W47A 2XJ9A 4M1SA 2Q6TA 1JPJA 3B6EA 4IW3B 1KSGA 1U8YA 2BOVA 2F3TA 4A2WA 1CULC 5HCNA 5CDFA 5GJCA 5HKKD 4NZYA 1F3OA 2LKDA 2H92A 2OILA 3KDSE 1AQUA 4QGGA 1N3BA 3NXSA 5CLLA 3U44B 3Q3JB 4GNKA 2C77A 2JJ1D 4O0MA 1MT0A 2BBTA 4OJQA 1JEEA 5JS8A 2ZRJA 1ZC4A 4CYMA 1ZINA 2I1VB 1W2GA 4LHVA 1SKQA 1NVXQ 4DKXA 4US2R 2G83A 4B2LA 3RRNA 1UF9A 1IN5A 4BQSA 5TMPA 4O2LA 5D3QA 2FPLA 1QHYA 2JLSA 2PH1A 2RHDA 3U3MA 5JJLA 1XEFA 4HB2A 2QE7D 4MYHA 1EWRA 3RRZA 1Q22A 3TR5A 4IDQA 3THWA 2RH5A 2WSSD 3GLHA 3QKUA 2ZYVX 4QGFA 3IGFA 3BE4A 3A1SA 4DLXA 4C0QC 2IYYA 2HF9A 3EC1A 1KO8A 2G0NA 1SXJC 4MGZR 4GPTA 4TMWA 1RRFA 2QM8A 4LK2A 2GXUA 1YVDA 3K0EA 4YMVA 4IVRA 2Z43A 2ZI6A 1H65A 2J7KA 2K5UA 2J45A 3FKQA 3D8BA 1NLFA 5GVRA 5IRCD 5EZ6B 1XJ0A 2EQBA 1EFHA 1Z07A 1ZVQA 2HLDA 3OE7A 2NOAA 1W1WA 2BJVA 1FP7A 4M9SA 4TLBA 4US1R 2JLYA 2QNRA 2R62A 1IBRA 4PSKA 4MUAA 1VIYA 3C4JA 4M1MA 2AN9A 2BMEA 3ICEA 3VTKA 3QIAA 4PQFA 5EE5B 2QQ0A 1XTSA 5BN5A 1W44A 5FOWA 1MR3F 2IL1A 4LHWA 1YQTA 4RCZA 3VR1A 3W8RA 4ARZB 1OH7A 3I92A 5KSZA 3D7MA 4EIWA 4AIIA 4ZCIA 3ZD6A 3WHLA 2ZE8A 1N6HA 4BLPA 4F4IA 2CHQA 2W6JD 4BZPA 3NEYA 1M8PA 4JBYA 1G4UR 4QHYA 4ZPXA 5JZVA 1IM2A 1GTVA 5SZJA 1LY1A 4DIEA 3K70C 3SR0A 2UVQA 5A4JA 3AUXA 4BEJA 4L16A 3ETLA 1CLUA 1N0WA 4BPBA 4A8JA 5FUYA 1E4VA 3QXSA 4PAQA 2FFQA 3P26A 3EIHA 2IYSA 3CKLA 1RIFA 2WKRA 4B44A 2OSBA 3ICQB 5J4VA 3RNLA 5EUMA 2ZSBA 2AD1A 4RZXA 1XD9A 2FSGA 1W36D 2PZFA 1P2VA 2ZIAA 1NSFA 1R8QA 3I3SR 5J4KA 1U94A 4Q1AA 3EZ7A 1RFLA 1TUIA 5FTKA 421PA 1GFIA 3E1SA 1DADA 3HU2A 3FMIA 4A9AA 5JRZA 4RZ2A 1DO2A 1JR3D 1COWD 4M9QA 4YMUA 4D25A 2GVDC 4QBHA 2CE7A 1RJ9A 4NYJQ 4MH0R 1YZNA 1U0HC 2E87A 1XTQA 2RHMA 1OV4A 4WVFA 3WXMA 3ONWA 2QMEA 1MRNA 2GBLC 1NY5A 3UANA 1E2IA 1R5OA 2C03A 4YC7A 3SNHA 4K81B 1FFHA 2ZITA 1XU4A 1NVWQ 3P1JA 3CO5A 3ADCA 4TZ6A 2C96A 3A1VA 3RC3A 2VBCA 4DIDA 3P4YA 3SFVA 2J41A 2P5TB 3B2EA 1DAIA 1QRAA 2CJWA 5FUXA 2P6UA 1OXTA 2VHUA 5DI3B 3GLGE 2QQEA 1TNDA 3DMNA 4Z51A 3CNOA 5CYPA 1KDPA 3OFND 2V6JA 1M7GA 1NJGA 5BN4A 2VA8A 1VHLA 4TLCA 2ZRAA 5KSYA 3GLIB 2WOJA 4C0LA 4KFSA 3WMEA 4URXR 1DS6A 4MDFA 2A9KA 1Z08A 1QHIA 5FOSA 2JGNA 3PG5A 2IT1A 2N42A 4US0R 5SZIA 1UBCA 2QN6A 3VNUA 1CR2A 1OT3A 2E9SA 2NO1A 4P4SB 2QP4A 1HV8A 4EPTA 1E32A 4PXAA 1L2TA 1PV4A 4OQFA 2GK6A 4B47A 2AFIE 3X1XA 4PFSA 2BBWA 2CK3A 1M7BA 3TAUA 2ANBA 1G3UA 3KJIA 2F1RA 5F9HA 1NP6A 1NVVQ 2EU8A 2ZJYA 3WHKA 3C14C 4ZIRA 1G8GA 1G3QA 3CM0A 1WBDA 2LCFA 1KSFX 4AG6A 4KSBA 4B48A 1N5LA 2NGRA 3AVTA 3RWMB 2ZYUX 4QJ4A 4DLYA 3K0CA 4HZIA 4ACAA 1OPXA 4CEJA 1E69A 1FP6A 2H57A 5DYGA 1MABB 3AVUA 1XXHA 2CE2X 3IIMA 5E95A 4IVQA 2XSZA 1E98A 2W2XA 3AKCA 3PUVA 3X1YA 3ADBA 3UWOA 3CZQA 4TYWA 2GF9A 3BGWA 4BWYA 4OYHA 1FMLA 1AZTA 3ZQJA 2V3CC 4ZDKA 4QBGB 3TUIC 2AWNA 2XTNA 4RD0A 1GM5A 1R0XA 1UKYA 2JEOA 2WKPA 2O52A 1KDOA 1ZD8A 2ZRDA 4C0JA 2PMKA 2GXSA 2XOKD 3OIYA 2WMNB 2QT0A 3KKNA 4TQ9A 5AJWA 1KI1A 4MQBA 2GESA 1LTQA 1U9IA 4LYAA 1E9FA 2G0TA 4QRHA 2JJ2D 5GJBA 4GOXA 4C4PA 1TU3A 3BBPA 1XZQA 1R6BX 2VL7A 1NLZA 4JLKA 4PZZA 1UADA 2WOOA 2QBYA 1GNRA 1M6NA 1NSTA 2D4HA 4IFBA 3H0KA 2FFHA 4IDPA 2JLRA 3TK1A 3LW8A 4PPFA 3R9XA 5CYOA 1KHTA 3PQCA 4OQMA 4MITA 3ZGXA 1ZM4A 2YYZA 1N6LA 3U61B 2QI9C 3K0AA 3PUXA 2KE5A 4JLVA 1G20E 2GCOA 4LHYA 3THXB 1UDWA 3WNCA 3S1AA 1CF4A 1EX7A 2BMDA 1MO5A 5CB6A 2Z4SA 1W36B 2Q3HA 2G1JA 2FDCA 1IY1A 2BHRA 2CLCX 2NQ2C 2PJZA 3QKTA 2PLFA 4Q7LA 4AWXA 4HDCA 1KK2A 2D2FA 5FUVA 2GAOA 2WIBA 1H8HA 3KFXA 3BFKA 4TLAA 5FI0B 3V00A 2QL6A 4LBWA 1OXUA 1ZAKA 1F60A 1JR6A 1R10A 3CF2A 1E79D 4L9WA 1OIWA 1NN1A 5DLQC 3AKEA 1JB1A 4S2EA 3BC1A 1KMQA 4G5RA 5JI2E 3W6OA 2ZS7A 3Q5DA 3K09C 4JL8A 2H1LA 3GMTA 5B2ZA 3NEJA 5DH9A 1KI3A 1DAHA 1QHHA 4Q9HA 2NO9A 4C2TA 2QGZA 1UKEA 3THOA 2FN4A 5B58C 2WWWA 3ZJYA 4DSUA 3J81k 4Q4JB 4G0NA 4B3XA 5TXGA 3EW9A 3P32A 2WWHA 4MRSA 4KSCA 4LSGA 5E7IA 1XPRA 4DCTA 1Z0AA 2RGGA 1OLOA 4URYR 4JS0A 3ZDQA 1T0JB 2QM7A 1OYYA 1X86B 1WMSA 3EA0A 3OAAA 2KJQA 1XX6A 1SGWA 4OHXA 4P4UA 5TV2A 5BQ5A 1MO6A 4BRUA 2OLJA 3B7GA 4IDHA 1G8FA 4WZBE 3IEUA 1HE1C 4HATA 4HYYA 4Q7KA 4RFSA 4DT1A 2GEUA 2WZQA 2ONJA 5A0FA 4ZDIA 1HT1E 5HE9A 2PBRA 4JSTA 1Q57A 2IEZA 1KIMA 2X1VA 4JLMA 1ZIPA 2QMHA 3VKGA 1Q1BA 3IHLA 4C0KA 3BS4A 4JLJA 3BD9A 1T3HA 2V6IA 4KCGA 3B60A 1BMFA 2C5LA 4LV5B 1GILA 2ZU6A 1OE0A 1Z22A 1Z6YA 4XVQA 3H4MA 3R7WA 4DZZA 2Y8EA 3MWKA 5CIQA 3E2IA 2YKGA 3GQBA 1OW3B 3QF7A 1VCMA 3LDAA 4KV9A 4JJKA 2FPKA 4ERNA 4N1AA 4A1FA 3QPUA 5TDHA 4PZLA 2PMDA 2P65A 3A4NA 1SHKA 4NBSA 2GTPA 1KI9A 1LS1A 3CF0A 3LX5A 3VX3A 1SXJA 3GD7A 5IT5A 3NH6A 3WNDA 1Z63A 4DLSA 4RD6A 2J0SA 2WKQA 4LGMA 1GWNA 1VCIA 3NTUA 1TTTA 2GJSA 1KDRA 2ZI4A 2G9NA 3DEFA 2O8EB 3DVLA 3KJEA 2A7QA 2OV2A 3V4FA 1Z0FA 3QG5A 5CM8B 4C0AC 2QRZA 4DDUA 1NKSA 1XTRA 3IKJA 4TWZA 3GCGA 2FSHA 2XZPA 4Q1EA 4MRNA 5J4YA 1NBME 2IYRA 1GRQA 4FMBB 5FBLB 4XWOA 1M2OB 1G7TA 1ZYUA 4FMCF 1E9RA 2QMOA 4LPSA 2QG6A 3TNFA 1XCMA 2NIPA 2F43B 3M1IA 3MLEA 1ZM3A 3L0IB 1YHNA 2F7SA 3A1WA 3W34A 3NC0C 3L8ZA 1E2DA 2UKDA 1NBMA 2G1KA 4PHFA 5JECA 2QU8A 4Q4LA 3Q72A 5BYJA 5F3WB 3A6PC 2ASEA 1K8RA 2BC9A 2HLDD 2ERXA 3PEUA 2RGNC 3QXXA 5H70A 4ASUA 1AN0A 3AVVA 1P9NA 2ZYWX 3GJ7A 1AK2A 1KK1A 4IFEA 4RSGA 2WJIA 4Q02A 4TN1A 1TPZA 1ZM2A 4JBWA 4NYMQ 4B3DA 4E5UA 1SVLA 2IYWA 1TAGA 1XBTA 4W9MC 3T1QA 1XEXB 2ZEJA 1ODFA 1IJEA 3ZIAD 5KNBA 2Z4RA 1FQKA 3G5UA 4Z1MA 4PO8A 3RRMA 1BKDR 1YZLA 5EP3A 3VHLB 3RSOA 1P72A 5KDOA 1KI8A 1LB1B 4B43A 1X1RA 4UNSA 1Z0JA 4KLNA 2GJAA 1V5WA 3AKDA 1RE0A 5E4FA 4KFTA 4HB4A 2V8OA 2EFGA 4IVPA 2IA5A 4BLRA 3LBNA 4LJAA 4B2IA 4PC6A 2NPFA 5KPJA 2GBLA 5FR2A 5P21A 5FUWA 3SYLA 1BYIA 4A0FA 3KQNA 3UKDA 5DHAA 3AVQA 1XZPA 1Z2AA 4Q4AB 1LVGA 1W0JD 2OXCA 1JPNA 2IS6A 2Z6VA 2JDIA 2QY9A 1E9EA 4LOAA 2A5FA 1JXMA 3CWZA 2VP6A 2DYKA 3AB3A 1DVRA 2FSIA 4Q03A 4MKIA 1E2FA 1XWIA 4RCYA 2J0UA 4NCIA 2ZROA 3F5FA 1KO7A 1N0UA 2FV8A 1XMVA 2C9OA 2OG2A 2IC5A 1FNNA 1HTWA 2HCBA 3AQ4A 3CF6R 2MSCB 3DKVA 1KMHA 3PUZA 3CR7A 2QA5A 1E2NA 4O3MA 4DSOA 1QZXA 1JAHA 5HZHA 3SZRA 1A2BA 5FBRB 3F8TA 2WAXA 2WMOB 2AWOA 1RKBA 3NG1A 4GMDA 3A8TA 3T1VA 1UPTA 2IEYA 3RC8A 2ZJBA 1F6BA 1EK0A 3TQFA 3BH0A 3GFTA 1R5BA 2AXNA 2LKCA 1IOZA 1Y3AA 1OHHA 3SN6A 5AWFC 1SQ5A 2JLUA 4MYCA 4TTQA 3T5DA 2ERYA 3TGPA 1CS4C 4OK3A 5AJVB 1OB2A 2F3RA 4B6FA 1RRCA 4G5QA 1US8A 1TU4A 3HYRA 1U99A 3B9QA 3OESA 1P62B 3Q5EA 5FTMA 3LD9A 1WA5A 2H17A 3TSZA 5BW8A 3T12A 3IO5A 2FG5A 3ZD7A 1GKUB 3EXAA 3X1ZA 1Z0KA 4D0LB 4EFMA 4HZUA 5CJPA 3TH5A 2HV8A 3UATA 2OESA 4A92A 2ZQ5A 1JXOA 1OXVA 3ZS8A 3B1WA 2J7PD 2MMGA 4G1UC 5FTLA 1NF3A 1A1VA 5AUQA 4O25A 3CNNA 4E22A 3FPAA 4U7DA 1D9ZA 2BBSA 3ND9A 4QBFA 3PJRA 4KVAA 4JVMA 2GNOA 5LD2C 3QENA 2GZHA 3RYTC 4KI0A 4H9GA 3N2IA 3SEAA 3ZLJA 3OIVA 2PEYA 4XJXA 5F2EA 1R0ZA 2CK3D 3AH8A 1LF0A 1YKSA 1NIJA 2X19A 4PQYA 2BWJA 1JBKA 3GLHB 4TQUS 2DBYA 2ZYTX 2GXAA 2YZ2A 3ZZTA 2OCBA 4TQAA 2C04A 2CEAA 2FGJA 3MJRA 5M04A 4UJ5A 1EFRA 3P4XA 1AIPA 1NY6A 1IXZA 1FUKA 4HSEA 5ANRB 4YDHB 4ZO4A 1KTVA 1R0YA 5DISB 4EJSC 3AUYA 2IWHA 3BERA 1NNEA 5DNYB 2WPDA 1F2UB 2ZJZA 3U60B 2XSZD 2HF8A 4B6EA 4LC0A 3FDIA 3OEEA 1ONBA 4DDTA 4DLVA 4HB0A 3I32A 4B32A 2QP3A 2B92A 2FEOA 3CRRA 3MAAC 4IKEA 1II8A 3GJ8A 2WICA 2FFAA 5JWHA 1P61B 1ZRHA 2HXYA 3LNCA 4DLRA 1KAOA 1E0SA 5FOTA 3VKWA 1YU9A 4FMDB 5L8VA 2ZRGA 3QKSA 4C0SA 2HT1A 2O8BA 2WJGA 5JFGA 1T5IA 1XTIA 5DO9A 4URWR 3DHWC 4LX0A 3LVRE 1KAGA 1Q21A 3WBJA 1OB5A 2J9RA 2PCLA 3TSWA 1CJTC 3VNVA 2B8TA 2HYDA 3OZXA 4NH0A 2XITA 2XTMA 5FBVB 2AKYA 3I62A 4NMMA 1FX0B 4NYIQ 5JSZA 4H1UA 2ZANA 3F0TA 4JT4A 2ZU0C 1MV5A 4ZI2A 2L0XA 3CX7A 5CIWA 3TVDA 1RYHA 2DPXA 2TMKA 1WXQA 2HXSA 1C9KA 3UK6A 4A8JB 1IXRC 3K09A 2H7VA 4U02A 5DSZA 3KKQA 1GOTA 4Q1DA 4W5HA 1MOZA 5FPTA 1EFCA 1E9DA 3FHCB 3GFOA 3PEWA 2VSOA 4XSHA 4LJ8A 1A82A 3IQWA 2JLVA 1KO1A 2PZEA 3WP1B 3FGNA 3KJGA 4NTZA 4AKIA 5FH9A 2BJWA 4XD7D 3VU9B 4UNRA 4U00A 2R6CA 1VG1A 2CVFA 4NL4H 2CCGA
chains in the Genus database with same CATH superfamily
1G18A 3ETGA 4UTNA 2Z56A 1VTMP 1Q44A 1WCV1 2HHLA 2P9HA 1J90A 4D0GA 4LLEA 3VAAA 3B2NA 4O4IA 2V26A 1GG8A 1KXZA 4LBVA 5CA0A 1ZJ6A 4IV8A 3PMRA 2H06A 1FE8A 2CJYA 2AT1A 5THKA 3ANTA 3BREA 5BSTA 3UIEA 3KTAA 3RROA 1LI7A 1Z7WA 2B9EA 3OJOA 3LUFA 4QQRA 1EDDA 4TTAA 3GT7A 1K6IA 4YJ3B 5KVSA 3DUFB 1F3LA 3PDMP 1XJWA 1XQ1A 5KNCH 4BJ6A 1TK3A 1VHWA 1D09A 2HJ9A 3N8KA 2O06A 1G38A 4GRDA 2NZ2A 4NRDA 3HKBA 4PZYA 1L8XA 3OEHA 3GGGA 1K6EA 1O97D 2Z5VA 3DS8A 1M2GA 3SYTA 2ZSKA 1PL8A 4AZTA 1J97A 1HA3A 4UTPA 1R00A 4LZLA 3TLGA 5A4AA 1G21A 1FP4B 2WWXA 4MP6A 2QLMA 4RZIA 1YFKA 4MDHA 3GEEA 3H2SA 2PYZA 2DUUA 2Q3FA 1MMAA 2Z5FA 1JKIA 1Y42X 2EFCB 1U98A 4FDMA 1EVKA 4M7PA 5T64A 2FZ5A 2JD1A 4DXAA 1Y1PA 4YLEA 3LT0A 3JZMA 4RS3A 2ZVQX 4LOLA 5G4LA 4I1YA 1MQVA 1GSHA 3CRMA 1OFIA 3ZDCA 1LRJA 5BQOA 2HPHA 4ZYWA 4AG5A 1SH7A 2QM0A 4JLBA 4FGLA 4JB0A 2QRNA 2QX7A 2Z6UA 2B1JA 1E9CA 3N70A 4AJLA 5LQNA 5IJ9B 1RWOA 3OE4A 1DG3A 1ZMRA 4FEGA 2ODNA 3S6JA 4FGUA 1SXJB 1T2UA 1IN8A 1N6KA 1JLLB 2WPNA 3GPDG 3RU9A 1NPYA 5IKXA 2HB6A 4G4SO 4QHSA 3UR3C 1S1MA 1DP4A 1HE3A 2H4YA 2ODAA 4GW3A 4BO5A 1P7VA 5F5LA 4F4DA 1SBNE 5SYNA 1G5FA 2IPXA 1GZ7A 3MS2A 4MW1A 2ZUFA 3KFVA 5BSWA 4JBXA 4OUDA 1SKMA 4DZTA 4OX9Y 1JJIA 4Q4ZF 4IIUA 2J59A 4FEAA 4GKKB 3M81A 4WKGA 4QGAA 1I94B 1YMQA 3T3EA 2FUCA 4LSMA 5IARA 2RCNA 3RUPA 4TSFD 4KXWA 2OM2A 2E5FA 3KPUA 1WMEA 3C3DA 2W6JA 5C2JB 3L8HA 2RH9B 1F5NA 3DZCA 1DRJA 4QDOA 2LDXA 3CA8A 1FPQA 5DHUA 4IOMA 3WV5A 2Z2ZA 4DRZA 1JR3E 3GNQA 1V54C 5CB4F 3U7GA 3DMHA 1XN4A 3U4QA 4PVDA 4C3BA 5HM6A 2FFJA 4LHZA 4YUXA 3L43A 5KEIA 1W46A 5C1IA 1PUXA 3FDZA 4M1ZA 4EQ6A 1OF1A 3KKOA 1VJGA 4H59A 3TS1A 1S4QA 4BGVA 1GNLA 3E0QA 3KEMA 1GL3A 2FZEA 2NUAA 3VR6D 1M0EA 4WESB 2CV0A 1U2GC 2QE9A 9LDTA 1IVSA 4P3PA 2L7AA 1L7AA 2VDNB 4BASA 2IH4A 2IEIA 4UUNA 3AO0B 3C8HA 1PX2A 2RCYA 4TVKA 1DJPA 2GOYA 2ZSFA 1GFSA 5C8XA 3NBFA 5AKIA 2BT4A 4LY6A 1QYVA 3T61A 4QG7A 2A5DA 1XRRA 4XPIA 5DRTA 4TS4A 5HYVA 2OHGA 1ZHHA 2YVAA 2AJ8A 3LC7O 1SXQA 2BCJQ 3TQOA 4ON9A 3WB1A 3DONA 1N2CB 4JU9A 3WMFA 3KKKA 3FPHA 1EVLA 1W34A 3R3ZA 2OSVA 5AIBA 4WHMA 1C1XB 2C9BA 3CKYA 3G5AA 1SQSA 2SECE 3LSTA 2DWCA 4Y9DA 3ZNPA 1XVVA 3HCOA 2XL6A 1X8JA 1RTTA 2ZQYA 3ESZA 1MVLA 4NKRA 2IIVA 4C6HA 4XUGB 4D3DA 3H6HA 3SF8A 5GMOA 3NO4A 4HNAA 1WY5A 3MF4A 1D07A 4N0MA 3RFUA 2FQQA 5ALYA 2MIIA 4ZYVA 4TMYA 2DPMA 3FYUB 2ZSIA 1W4RA 3FZYA 1IQPA 3FYDA 2I33A 1DCMA 1FRFS 5FCLA 2HA0A 1CB0A 4G37A 3S2IA 5GZ1A 4M36A 4L8GA 3I9NA 3H4IA 2CNDA 1GUYA 3GDHA 4PEVA 2F59A 3DKPA 4D43A 3IH5A 1CGME 2HMYB 3L1UA 1AB6A 4W8KA 4P5PA 2WU8A 3GA5A 1TB4A 3JW8A 3OU7A 1CE8B 4WDRA 1SWWA 5JH7A 4MRAA 1D2MA 3S68A 2CWDA 1UQUA 2G82A 3W2EA 1M0SA 2XMCA 4FYKA 1P4SA 2PGAA 4MW0A 3BTVA 2XXAA 4J1QA 4TMVA 1LW6E 1ULSA 4IH4A 1GQ2A 4AF8A 1ZXXA 1IAQA 1SCKA 3GLHE 3J7TA 4V03A 3VTFA 5M34A 5K9ZA 5FPPA 2IYVA 5AJYA 5CI8A 1E3JA 4DL9A 3Q3IA 4CFZA 4IRUB 1LPBB 4G5HA 1SIOA 1M7HA 2KC3A 5CX1B 4EG5A 3KT6A 1DUIA 2R8RA 3JQPA 1XNHA 1B8VA 4A2PA 4GX2A 1R4MB 2O57A 4ILKA 3ER9A 3UY4A 3FTQA 3JQBA 1H7IA 2XF2A 2IPLA 4IMJB 1YS9A 1DLIA 3JALB 4Z4EA 3WGJA 5K3BA 1NFQA 3EGVA 5JPIA 4UUQA 1R0WA 4F8EA 1XRSB 5K4AA 1QG4A 3GN2A 3U44A 1CPQA 4QNMA 1X1TA 2VYVD 2JBWA 4F5WA 3EZXA 2OYSA 3H83A 4LAFA 4YL0A 2YYSA 2GCPA 4I1IA 4AL1A 2IHBA 1D9XA 4UW9A 4EJFA 1K88A 2Y05A 5TX7A 2C1XA 4YRDA 2JAQA 4ZCQA 1K04A 1QQ7A 5F52A 3BF8A 1G4HA 2J3DA 5LB4A 2EPMX 3CISA 4NR0A 5DV9A 3K94A 4WXEA 1W0KD 3QPVA 4AP6A 5DYTA 2FYTA 2IU6A 3EZIA 1ADCA 1TADA 5EY5B 4CM7A 3M6IA 9MHTA 3HNRA 4DUPA 1PQ4A 2QW0X 1NXSA 4QBTA 3SGLA 3M4BA 4IQ0A 3CLSC 4WI1A 2Z9DA 1XWJA 2O9XA 1I1OA 4IHJB 1LBHA 1IK4A 2B7CA 3MOSA 4R2KA 1HKUA 4J7AA 4DABA 3KQUA 1VBMA 4QQKA 4RK4A 4DVYP 1RM4A 3W4KA 3LC1O 2O3QA 2FPSA 5K0BA 3SYMA 3K9HA 5E2AA 3ABSB 4TUYB 3PC3A 1L5WA 4PJNA 3WTBA 1W9HA 3GHYA 3LYAA 3GLIA 4P98A 1FW8A 4EHHA 4UARA 2RK4A 4OXNA 1I2MA 2AQIA 3D7SA 2FXVA 1WMFA 3BMQB 4D9JA 1D1CA 4Y2GA 4IJ6A 3UW3A 4FVTA 2RH4A 3NTXA 1IG3A 3AF1A 1F8UA 1PG2A 3FDQA 5GM2A 3GK3A 3MOIA 5ICCA 5DRYA 3TMAA 5FOQA 2WM9B 1JEOA 3HR7A 5CK5A 2V6BA 3LVBA 4NYMR 1B14A 5LQMA 3SLRA 5BSHA 3LPNA 1N8NA 1NKTA 2GM5A 1VLZA 1N6PA 3OFSA 4F97A 4N9QA 2NU8A 2GJ4A 2F1KA 4D92A 3I83A 3OZEA 1SMKA 1YJAA 3M1LA 4KYUA 4ARUA 1HLGA 3IMCA 4CBVA 2DP4E 4DIFA 3ETDA 2LXNA 4NBNA 4EBBA 1IUNA 1U0TA 1H3NA 3T9BA 1AF4A 3KPYA 1ZH8A 3SEZA 1EG7A 4CT5A 1CDOA 2Y1GA 1NE2A 3E3AA 1OBOA 4A5OA 1J21A 3NBXX 3VPDA 4Z7QB 4U6QA 2IE0A 3AETB 5KNDH 5AW1A 1IZ7A 5BV8A 3B85A 2VJNA 4CT0A 1Q0PA 3E15A 4DJFC 1U1DA 1Q19A 2I6SA 2FWRA 5J2TF 5CCXA 2IHUA 2IRWA 5LZ8A 1L8OA 2UZAA 2IYUA 2H7XA 4RHYA 1BZYA 4A8HA 5DYNA 3AVPA 4PACA 5JAIA 1AUOA 4P2BA 3NT2A 1KH3A 2HJ3A 3QX8A 3SZGA 4AY5A 2VJYA 5D86A 1CUCA 3TWOA 4NTAA 3TRJA 5KQRA 3V4SA 4XX1A 3LLUA 2O2CA 4AI6A 4CDRA 4R2MA 2HRRA 1B6RA 3BXHA 2ZVJA 3WQHA 1Z0UA 1QE3A 3EXG1 4MQFB 4FINA 1BVHA 3WL6A 1M2OA 3WGGA 1VPLA 3OO1A 2ID4A 2OPHA 2H7CA 3VV3A 4Q19A 4BX2A 1CZRA 4YQFA 2YXBA 4TT8A 3TLZA 2IZ1A 3NNDA 1NWHA 4JA2A 4I9NA 1SUSA 2R7TA 3LU1A 5F98A 1N6IA 3KSBC 3FMGA 2R7RA 5CW1A 1CR4A 4QYXA 4UDYX 1RQNA 1J0CA 1W4BA 4LYJA 4C6SA 4D98A 4F4JA 2FF7A 1FXUA 2XVMA 2EP5A 3BWEA 1TWHA 3NRJA 2CF5A 2IW3A 3PKIA 4KQWA 3BCUA 1ZA1A 4UXJA 2IM8A 2XLBA 3W5IA 1WU8A 1JDTA 3PKZA 4XEUA 4DNQA 4G5FA 1M2VB 1K3TA 2EHDA 4KR7A 1OTXA 4TKZA 1Z0SA 3K9GA 4QT0A 3VR5D 4MR7A 3BSSA 3QNWA 3CEMA 4YLGA 2GCNA 1KR2A 1FTYA 2Q6TA 4G0HA 3FNEA 1EDZA 3OJLA 5E4TA 3E1KA 3OKPA 4PXSA 4ECAA 1WB5A 1L5YA 2AG0A 2C77A 1C3OB 3RKUA 3RUAA 2VB6A 4RMGA 1L5OA 5CVEA 3A1NA 2I1VB 2VS1A 4ZZIA 3WK4A 5IT4A 1Z68A 2DKFA 4B2LA 1KRHA 3SSAA 1BVYF 5CAEB 3EVGA 1IWBB 2R1TA 1ZCZA 2IYYA 4GLJA 2I22A 5KBYA 4LK2A 4NQZA 1DQSA 4KX5A 1NC1A 5GVRA 4QYIB 1NYRA 3KXDA 4TKUB 1RKVA 1M3SA 1ESDA 4NF2A 2NOAA 4OMUA 4EHAA 3IUSA 4WDQA 4EHBA 4PQFA 3WC4A 2VHYA 1FRQA 4RCZA 3KZKA 4XM1A 1X1AA 1OTYA 2OORC 2ZZNA 4YAKA 1G9SA 1RKQA 5IJAA 4FSXA 2W6JD 4RS4A 1Y6GA 3GG9A 3LPLA 5JZVA 2DCMA 3R3HA 2PKEA 4N5HX 4RABA 1YYXA 1OC2A 3AHHA 3ZI7A 3MYFA 2ZUSA 4AZ0B 3O55A 4PX3A 3U0CA 1P2VA 2XQFA 2DRIA 1RMQA 4DZRA 2HSZA 3TOZA 1OXKA 3L4BC 5AVTA 1YZNA 1N2IA 1ML4A 4WUTA 1BXKA 3VRHA 3FIJA 1ZJ4A 1L5FA 4INZA 3RS9A 2QQEA 2X9NA 1N3IA 5GWXA 3B3GA 4TS3A 1KDPA 4DJ5X 2PUVA 2X13A 2AUMA 5BXYA 4BMCA 3RQIA 3L34A 3RUFA 3ESYA 2IT1A 4GYJA 4HQ6A 1OT3A 3EUAA 2CZQA 1BMDA 4FJ2A 2JCYA 1L2TA 4DR3B 1GDTA 2WC1A 4IM7A 3TSAA 2HXGA 4PG4A 4XQEA 3RC1A 4J1TA 1WXFA 1QHEA 5FD8A 3CM0A 3P2IA 3TNYA 4I7EA 3EF1A 1N5LA 3WI7A 1Z36A 5ADWA 4FYJA 3AVUA 2X0CA 1OX5A 3D2LA 2GF9A 2XE6A 2KLBA 3P8ZA 2GASA 2B4QA 1Z16A 2JAXA 4GMHA 2ID9A 3T3NA 1W73A 1JHMA 3N59A 2WL8A 4HE8D 4LMAA 1T5DX 1YARO 2CBXA 3A32A 3GMDA 2D1SA 2A9RA 3M5WA 1SG9A 1MBZA 3UENA 4BO6A 4P5EA 1ODCA 4EG7A 4EBJA 4R8MA 1CF4A 2JJQA 2IKQA 3L1MA 2B2XA 2D2FA 4BNKA 2O5RA 2BEWA 1OXUA 3FBWA 4HNSA 1E79D 3TLKA 1QV9A 4IXTA 2VPQA 4L4YA 2ZS7A 4XM0A 3Q5DA 3VUEA 5B2ZA 2QZZA 3JWPA 1E4OA 2WILA 1FYVA 1UBHS 1QKRA 1RXYA 1WVIA 2QF7A 4OHXA 5BQ5A 4IDHA 2QRJA 5D6OA 3TXAA 2FEXA 2ONJA 1YBMA 3QVYA 2PKXA 3U1BA 1ZIPA 1V71A 3IQHX 3Q7SA 2JNWA 2KHZA 5J1TB 2FP4B 2W42A 1GA1A 3N8DA 2PLAA 3O84A 3GQBA 5COFA 1SVUA 1KEKA 2PO5A 3DE3X 4CG3A 3QPUA 4EVQA 2I4TA 1SUAA 2GTPA 1BQEA 1ZUNA 4CM8B 4MQ9F 4BB0A 3V7OA 3L6CA 5IZCC 2GJSA 3NI2A 5LYJB 1CQWA 4K03A 5E1OA 3U37A 2WWRA 1V37A 4YCAA 1I80A 1VLSA 1ATZA 5KYVA 5T7BA 4XWOA 1P77A 4NICA 3HGMA 2IZ0A 1XHEA 3MWDB 3DUWA 2EEZA 3NC0C 4FGJA 4F06A 4XDZA 1JZQA 1UDCA 2VYQA 2PM8A 5EWLA 2VK4A 2F17A 5A02A 3GQVA 4MQLA 2JLAA 1Y5RA 2W98A 4JJIA 4PONA 3AKDA 4CLEA 2GSWA 4MIOA 4AJEA 3K2QA 4ME6A 1JPNA 2QY9A 2XUZA 3T0IA 1UBUS 1OLUB 3QBEA 2VH2A 4CDNA 4JI8B 4NCIA 3GEMA 3F5FA 3LUPA 1JEQA 1AF7A 2OV4A 3AQ4A 2HCBA 5BQIA 5CFPA 2MSCB 3BJRA 5K5EA 4BXOA 4E70A 4DR1B 3CFYA 1UBNA 4YXFA 1UDBA 1GCAA 2WSIA 3RC8A 2PL5A 2ZBDA 3L4KA 5EHNA 4ZOAA 5JYEA 4GI5A 5EIOA 1OUMA 1T1EA 1CS4C 1NR1A 3G02A 3WZMA 3HYRA 1U99A 4P36A 3NRHA 1M54A 4H6WA 1Z0KA 4JHXA 1F38A 4CM9D 1OXVA 3GLSA 2BGKA 1X77A 3LP5A 3VPCA 3V32A 3AEKB 3UJDA 3B6IA 3RYTC 5LOVF 3ZLJA 4E14A 1FUIA 3SVTA 1YKSA 4PQYA 4C22A 2BWJA 4EEXA 2WTXA 2P9GA 5JAHA 2CEAA 2O6LA 1FUKA 1E85A 4IWNA 2B1GA 3NETA 5EHZA 5JT4A 4B6EA 3OEEA 2E4XA 4HB0A 1NHGA 1E86A 5LQJA 1XA4A 5BN5B 1E0SA 4QT4A 5ARBA 1TO1E 5CFRA 3GYGA 3P9PA 1JMKC 1JWBB 4NFLA 5EIAA 2XAAA 2HYDA 5JPDA 5B3KA 4R68A 4I50F 1KS2A 2NYUA 2G3KA 2L0XA 4ND8A 2YV2A 4QDLA 3ROTA 4WNIA 4H3VA 3EXEB 4IH9A 3E3LA 5GPGB 4NJMB 1KFKB 4DJEC 4LDPA 3RI3A 2FRVA 1Q0MA 1O08A 2F8SA 3ICOA 2L18A 2BJWA 3M9WA 3PWKA 1T3GA 1PYOA 1L5SA 1I13A 2W2MA 1NGSA 5DBGA 3GCZA 2XWPA 2X8JA 5LC1A 2K2WA 3AW9A 1AGRA 1TLTA 4XIFA 1OZAA 3JASB 1GZ5A 2BI4A 2ZW9A 2CJWB 4G86A 2M6LA 2ZB3A 1O95C 1QJCA 4MVJI 1NZFA 5A03A 4LBZA 4X90A 4R6WA 5EAIA 1IJFA 1A4RA 1E1YA 1ID1A 3C8GA 5JCZA 4TTTS 3HCWA 2IHJA 3T7CA 2G63A 3KVOA 4PAGA 2Y3DA 5EJAA 1P9OA 1Y63A 3UK1A 3LRPA 3JQQA 4LNHA 5K51A 3EFEA 4L22A 4R8SA 1ZX1A 4KVGA 5EKXA 2CSUA 5A7FA 1DNPA 3Q8WA 3QKIA 4EZBA 2EEPA 4JC7A 3MMSA 1JJVA 4N18A 1UT5A 5ALRA 3DWIA 2ODPA 1VKRA 4BJHB 4G63A 3TL3A 3WMGA 2EZ4A 4XRGA 5AMXA 4ZYUA 1G21E 3ZUGA 3OZBA 1DIAA 3R9XB 1N8TA 3DFZA 2XMZA 1E3EA 2G5CA 3UG7A 3CIOA 4UCXA 1IZYA 5JXHA 5FWYB 3REOA 3L77A 3JYQA 5EE3A 4KIWA 3EWAA 2WG2A 1JTVA 1BIFA 3MWEB 1W76A 1J56A 4DLZA 2DCUA 3FTEA 4FKZA 4D1YA 2NZYA 1Q12A 2AK3A 5ALJA 1N7HA 4I99A 1U8ZA 2WF7A 5EE0A 4U2GA 4R4JA 4B4OA 1SKYB 1J09A 5JYBA 1P1FA 1TU0A 3KQMA 3U9MA 3BXZA 1W88B 1R0LA 4A82A 4GGPA 4M9CA 1L5MA 3SJAA 4RGYA 2R7SA 4JMLA 4J9UE 3URMA 2NACA 4JYBA 2QM3A 1PWZA 5FHQA 4BB9A 4PC1A 1TE2A 3HTKC 4MLZA 4Z2YA 2VAXA 2HADA 3X2EA 1QSGA 2R6FA 1H2WA 1AK9A 3G0OA 4JKOA 4PAWA 3QY9A 1LX6A 2QJRA 2HK6A 3HJRA 4J3FA 3RGWS 3AUJB 4IJWA 1K68A 5H02A 2PCJA 5DHSA 3CCFA 2EJCA 4DV1B 4MX8A 3U49A 1O03A 3RS7A 3R8CA 1G8SA 4C4RA 4J6FA 2EFEB 5CCDA 4CCYB 1GL6A 4YVFA 3KL2A 5FI3A 3H8VA 5ADHA 1U8AA 2VSXA 3NMJA 4L57A 2GN1A 4AIRA 2GBGA 2OFFA 1G5ZA 2P6PA 5DMHA 2GLTA 1IWOA 2AF3C 2DFPA 1VTKA 3JQAB 4MPTA 3LKZA 2AFHE 3E03A 2O2JA 1SAYA 4CRWB 4JN6B 4NK4A 4QQ8A 1PFGA 3UFXB 1SZPA 2CXTA 1NBAA 3N75A 4WJLA 1A7EA 3T3HA 5NULA 2PWPA 4E07A 2C0QA 2HH9A 1BMTA 2F00A 5H7XA 4PYJA 4OGKA 3DVQX 4G24A 4RA6A 1PSZA 3N8IA 4QEDA 3HYCA 2AN3A 1RHMA 3FI9A 2AR7A 2OO3A 4EWLA 3ND6A 1D0ZA 4JB3A 2OCYC 4JCCA 4HWKA 4YRKA 1TTPB 1L5KA 4EHKA 2RKWA 1II8B 3AIOA 4HGRA 4ZJUA 5D3MB 4REMA 3TLEA 3CSDA 4U2DA 2FSSA 1QGZA 2X6TA 5LFAA 4B0OA 3UB3A 2YHAA 2ZRFA 4WCFC 4EFNA 1ZISA 2R7UA 1QVAA 2C2GA 3RAJA 4BIMA 3H17A 2B37A 3F6CA 2CXUA 4U3JB 2IXEA 1OQCA 1NBOA 4M8KA 3NT5A 3NYJA 1QONA 4O79A 1THMA 3ZE7A 3KKPA 3HZZA 5HGJA 2Y3HA 1X1QA 4YAUA 2DQYA 4FYMA 1LLUA 1V5GA 2QTWB 1Y82A 1P7WA 3S1LA 2A3NA 4MPJA 3ELBA 3KCNA 4AKTA 3D8NA 3P9QA 1B1AA 3KKBA 1E3LA 3MCAA 3NMUF 4LVNA 3S81A 4XTRA 5CH8A 2VP4A 3H1TA 2MU1A 4Q9DA 3LJBA 3K6BA 5SICE 2H1VA 2D4AA 3DBOB 1NQVA 1CJUC 3OA0A 3PPVA 3KYIB 1W4CA 3ZWAA 2HHAA 5CBPA 3G7SA 2O8DA 3R3UA 2A5GA 5FBWB 3CUTA 4QATA 3V6MA 4Y2YA 3QPDA 2PZJA 4M7WA 1NR5A 5YASA 4N6NA 4Q3LA 4PSAA 5KUTA 4RPJA 1L3CA 4EFLA 4YTEA 4FMCB 5JNUA 1QX4A 4YRTA 1A9RA 2AYXA 4XVUA 1ESNA 2HIGA 2G06A 3KSAC 5C46F 1OC4A 5AHWA 2VDOB 1JEYA 2PQ6A 2HMQA 2W2OA 3QFTA 3G1UA 1PUJA 4F4UA 4AYXA 3G0DA 2X3UA 4DJDC 2CCYA 4EBFA 4Q39A 3G68A 1NVVR 5CK4A 1NW6A 4XSVA 3TE7A 3WS7A 2PR2A 4ZT6A 3KQSA 1NFFA 3K30A 4E09A 2FQ1A 3F8WA 3JYYA 3E9DA 2VJCA 3WP0A 4R9RA 3QKWA 3OY7A 1ZD1A 1N9GA 3OKCA 1YQUA 5A62A 5JSUA 2PEZA 5HZMA 1T4CA 3PFGA 3UHFA 4X1IB 2I76A 3O3OB 3FD8A 3EC2A 2FXIA 1DHRA 2YJ3A 4GSYA 2ZVPX 4LMRA 1TX4B 2FP3A 3A1UA 5K3FA 3R5SA 1GQAA 1EBUA 1CHNA 3AG5A 1X8KA 3GWZA 2NAFA 1STOA 3G1WA 2Y0CA 5G3YA 2AMJA 4CIDA 2FGYA 1HR0B 2VUIB 4BMDA 2CNBA 3AOGA 1H0SA 3JT1A 4YFVA 4IWYA 4PLYA 4B74A 1Z73A 2ZIFA 2NSHA 2H0RA 3CRVA 4MAFA 4P6IC 3DD1A 4GOLD 3AHGA 2P0YA 3IJ5A 2AQKA 3WYCA 3VYSB 4CL3A 2AGVA 3HPQA 3M5CA 3RC7A 3O8DA 4E5VA 6ABPA 1K89A 3A36A 3K53A 2V65A 4OI4A 4WAUA 5L4SA 4B7CA 4NCKA 1P2TA 1UMCB 4G36A 2AXPA 3OICA 3HB0A 3DOFA 4JD5A 3FUVA 1ZHZA 2MINA 3LCMA 1TIBA 1S8OA 4CETA 3F7NA 1XSEA 3SR3A 3IEMA 4MRRA 2DLDA 3FWPA 4X9XA 1JLRA 2IV2X 1M6YA 1N2EA 1QBGA 2CV1A 4DJTA 4CCSA 3L6RA 5CJ2A 1XP5A 3JVIA 4K0RA 3F78A 3OEED 4QXAA 2G71A 3QVOA 1QNLA 2YUIA 3PGXA 1KAQA 1MA3A 1OV6A 1Z0DA 4J30B 5EGSA 2WHPA 1V6SA 3G4ZA 2JFOA 4MO9A 1IEXA 5FPHA 3OC6A 2C7BA 3VR0A 2AYZA 2YL0A 5BMVB 4MHTA 3C41J 5ALLA 3CB2A 1JG1A 1WPRA 4Q9IA 4IXNA 4L2IA 4ESHA 3MTIA 3EPKA 1PFWA 5JISA 4WLEA 2PGDA 4LMPA 2HIHA 1HLPA 4BS9A 2PJDA 1OROA 5ICFA 3IV9A 2KQ9A 3WLLA 4MGIR 3TM5A 2DXIA 2PQMA 1H2ZA 5CVJA 4JJ7A 3ZWWA 2D74A 4QUBA 721PA 3DP7A 4QUIA 1CRQA 1TM3E 4TS9A 2A88A 4QXMA 1J00A 1JYSA 3JD0A 1SULA 5IU6A 3FMFA 5EXEA 4BMOB 1V41E 2B4TO 3L2OB 3H2JA 3C8GD 4QTXA 3TYXA 2D7JA 3U7RA 3M6UA 5EI5A 1IZ0A 2FG7C 1C3EA 2VF5X 4KFCA 3UM9A 4TVOA 3WFJA 3UGJA 3A3OA 2OZLB 1HKHA 4BNZA 4EHFA 1SELA 3RVMA 3ESAA 5HPYB 5FEMA 3CZAA 4WN9A 3R2JA 1NMQA 4KGVA 1YDWA 3BIFA 2XMBA 5C5EA 4PHTA 4DY6A 4Q4HA 3FETA 5IC4A 3HEBA 3RAEC 2QAGB 3ZC3A 1CR1A 2HPVA 3IQ6A 1XNJA 5AW3A 1WUHS 2ZIXB 3O6XA 3L6EA 3CX3A 1BD3A 1R66A 2P1RA 1NJ8A 3HBAA 1L5HB 1F8XA 2WVAA 3PR2B 3ZNOA 1RQLA 3R5FA 5K6TA 2X4GA 3JZAA 5FWDA 5AVQA 2FK7A 3UMYA 2W5UA 3A58B 4K9DA 3QZUA 3BRCA 5MGNA 3VR4D 3WK9A 4EB0A 1L4FA 3ZH9B 1MPTA 2J6BA 5KPDA 1D8AA 4EG8A 5BRAA 1JG4A 1AGPA 4BO7A 1A95A 1LZLA 4CDMA 2FU5C 4J03A 2ZPUA 4B71A 3QU4A 3ZWYA 2G8NA 2VOJA 3GV0A 4E6EA 1KZGB 2ECKA 1G16A 2MYNA 4EI7A 3GFQA 3BIWA 3KTFA 4A2WA 4ND3A 3S2ZA 1UIRA 2EDAA 1RM5A 1CC1S 1YJBA 2VQ6A 4BWGA 3C0KA 4Y7CA 4OV6B 1DKLA 2H1HA 2NXEA 4BVEA 4R0VA 1Z35A 3H9GA 3IPAA 4UZEA 1T1RA 2PH1A 3GPIA 1F8GA 4RD9A 2JI9A 3Q9UA 2HF9A 3EC1A 1U04A 2G7MC 4GPTA 2FLWA 1V5EA 3T5PA 2J7KA 3ZXUB 5CHYA 2G9VA 3OE7A 1LPPA 8LDHA 3WBFA 3TTTA 3WL4A 4ABTA 1BEZA 2BMEA 5IAGA 1K06A 4OLBA 2IL1A 3H11B 1K66A 3LMKA 4EIWA 1VE1A 1N6HA 4LYGA 1QIJA 2ZATA 4F4BA 3JTEA 4CCWA 5IP5A 1DV1A 5IBQA 3AZQA 1VPWA 5J1SB 3UH0A 2VVTA 4A8JA 4WLFA 3AKZA 3PPXA 3PCVA 1R12A 5I8PA 4QECA 3JQEA 3SSOA 2ZSBA 4QFDA 3DNFA 3HFRA 2I4LA 3T9DA 421PA 5IAKA 1COWD 3HNJA 4NYJQ 3OLQA 3WXMA 3ZTWA 4AN1A 4DPKA 3ROKA 3HCRA 2EP8A 3TLMA 2VSQA 3KG2A 5FEUA 3JD4A 1UWCA 4BE4A 2PAFA 2AVNA 1SNYA 2VA8A 3G0CA 3WMEA 1BDJA 3FZGA 2RK6A 3PG5A 3CEPB 1HV8A 2P9FA 1VYHA 3HSKA 2MHCA 3ECSA 4KX3A 5ALDA 3TKYA 2BBWA 3HDHA 2FW9A 3RHSA 3ZGNA 1QVWA 4C4AA 1MAWA 2EU8A 3IDOA 3Q6IA 4B3JA 3MT7A 5LP6F 1QG0A 2NGRA 3H3JA 4CM5A 7MHTA 5CUQA 2HMVA 3G5TA 5HP4A 3L7LA 4NNOA 3HWX1 4FEEA 1V9SA 4NEGA 5D84A 3VH1A 2DQSA 1D2RA 3NOOA 4ZVVA 3WNQA 5JZSA 2XOKD 1PFVA 1KDZA 1E1LA 3K9CA 3OOEA 3ZIUA 1E9FA 3NALA 1SCAA 3H5AA 2ZJ0A 1V8PA 1Q7CA 1I3MA 5IAAA 1RYMA 4P3XA 3PQ6A 1J49A 1G2QA 1KHTA 1B6TA 1XVUA 4BBZA 4OLJA 4LHYA 2OCKA 4C6RA 1DC6A 1Y3FE 2G67A 1HRDA 1Y80A 4ZEVA 2P35A 5LM3A 1IY8A 3D6UA 4YRJA 3W6OA 5EIXA 5AKYA 1MENA 3HVRA 3ZQYA 1ULHA 4KQHA 4W1QA 4CS7A 4Y9RA 1QNFA 4MKZA 5JUAA 3RKOF 5E7IA 5CLFA 3TTWA 2FPRA 4BX3A 1T0JB 1XX6A 3MJDA 2GEUA 1FVXA 3KPVA 4KR3A 4JSTA 3DXZA 4R1UA 3Q3EA 3G3EA 1U5CA 1KOLA 4RSRA 1S7ZA 3D5TA 1WSAA 4PIVA 4MO2A 1LEHA 2HFIA 3IB3A 4XCXA 4V3CA 1GDHA 3GBSA 2PKWA 4JUAA 3ZEAA 2WKQA 1VCIA 4FX2A 5I7FA 1DWUA 5FNVF 1KDRA 4NC9A 4TWZA 1LV8A 4MRNA 2G5PA 2WYHA 3JQ6A 1ZYUA 4TTSA 4LPSA 5JJ5A 4PQGA 1TC1A 1ZCJA 3RQSA 2UKDA 3EQ6A 2X2PA 1DKOA 4A5SA 3QMKA 3RJ9A 3MEQA 4CR7A 3RYFA 3X3HA 1SVLA 3R7AA 3SBOA 3AJ9A 2FHPA 5KNBA 2Z4RA 3UAWA 5F7XA 3NIGB 5KDOA 1X1RA 1UIMA 5KX5A 1RE0A 3DC7A 4IS2A 4S1PA 2ZZMA 2IA5A 4TRRA 3LBNA 2XDQA 2FOIA 2GBLA 3UUGA 3JRNA 2XL8A 5AVUA 1U7WA 1NVTA 1Z2AA 1DC7A 4TZTA 3PNVA 5D8DA 5CDUA 1R6VA 3MGBA 5I7SA 2R5WA 4FDVA 2ZRQA 1HEYA 5H5JA 4BJ5A 3KZNA 4FBGA 1XTPA 3QHQA 1Y3AA 4M6WA 5ESDA 1TU4A 2E18A 2HQOA 4K6FA 1DRWA 2O5EA 1WA5A 4LF6B 4F6RB 5EHQA 4RV5A 4HZUA 1GRVA 5CJPA 1J0XO 2FSPA 2O7RA 3V1TC 5KTSA 4G1UC 5FA6A 5LU8A 5IDXA 1A4UA 3I6MA 4H9GA 1WTCA 1R0ZA 1NAHA 1U7OA 2XBMA 4LQLA 3L7OA 3AEQB 1H2EA 2NVOA 3Q7TA 5ICMA 3PFHA 1RLIA 2GTIA 2EDCA 3LYHA 4GOMD 5L0IA 3GRFA 4WZAB 4DDTA 1MMDA 2IU0A 5FOTA 3DHEA 4C0SA 1IL0A 3QKSA 4NENB 4KRYA 2QQ5A 1SK9A 1AY0A 5CLJA 2XTMA 3QWHA 1FX0B 4Y6GB 2QG4A 4K3VA 1JAYA 2QWXA 2JA2A 4YCDA 1SUIA 2ZUTA 2X9LA 3DBRA 2BMWA 2VSOA 5A4KA 4MB2A 4KWIA 4NTZA 1EXWA 1QAMA 2VDQB 3SXPA 4LKOA 4RK1A 2CHFA 1HC7A 2W6NA 1FNTc 5D3KA 5A6KA 1U0JA 1JQJC 1A5TA 1LFAA 5C32A 2ZM5A 5BN3A 1G5RA 2BRUC 5FL7A 2AW5A 2OO5C 3I8XA 1ONNA 2GN4A 5L3RA 1YACA 2P78A 5F77A 1DG9A 2XRYA 2OWEA 2X1MA 1JHPA 4FM9A 3M49A 4I1VA 3U5TA 1HE2A 1Q0TA 3KUDA 5JZBA 2Q3TA 3I5UA 3WNZA 4ZIRB 3LXXA 3SJCA 4EK9A 3G0HA 4OO3A 5CA1B 2UZIR 2QUIA 2AZ4A 1O0BA 3OCVA 3F6SA 3LNMB 4CG0A 4QPDA 3STHA 1O1YA 4H4CA 2R03A 2GM4A 2GWWA 2IY7A 3TRFA 1J2EA 2YLDA 4A0QA 3HY3A 1WAMA 1DAKA 1GLNA 4BLOA 3P0FA 5FUQA 1H3FA 3OE1A 5TB5A 1FVOA 4IIBA 3M1AA 5CX4A 4B3BA 4IJVA 3GLQA 4FC6A 5DJ5A 4EUKA 1JFTA 5HOQA 1PUIA 2EX1A 2R44A 3ZE0B 3S28A 4K7JA 5BURA 2OHIA 3IKLA 1RIIA 2BW0A 4UU7A 1RKEB 4DLLA 3JZ0A 1GVNB 1WEKA 5KYWB 3BH7A 1GR0A 4DUGA 4NCAA 5KNCA 3DD7A 4HNQA 2XGJA 1YZTA 4N3NA 1LLQA 1ZP6A 4KE9A 2IOFK 2QTVB 4C2UA 2P4HX 5ALPA 5EIFA 3REFA 5AGFA 4L7QA 1W5AA 4A6EA 3P94A 2IELA 1UM9A 5HHTA 4DA6A 4XUDA 1F48A 2O2EA 4UHDA 2IV7A 1PEKE 3ILYA 1YNSA 4CEHB 3V5XA 4YYEA 3SR4A 4XPZA 3M4YA 3T3GA 3KV3O 1EHYA 1ZSVA 1N25A 3AOEC 2D2EA 2JJ1A 3EJWA 2C97A 2FSFA 3I9JA 4W7SA 4JCHA 4Z99A 1JE1A 2JGDB 2PD4A 3VNSA 3TX2A 4CQLB 5JJIA 1GO2A 4LIPD 1CK4A 2N47A 2ZRBA 2B94A 4PPGA 4IDEA 2KB0A 4UTXA 1F0NA 5B6IA 1C7QA 4OLAA 1HQDA 3BJIC 3US6A 4XRRA 1IM8A 1V7ZA 4IGGA 2OOSA 1KK3A 3DJUB 4RU1A 1IQ0A 2YQ5A 3THYA 1I1QB 3UMHA 1ETUA 4B6IA 1EXDA 5DWDA 1LFDB 4KYTA 2VXCA 4DR6B 1GCUA 2EPKX 5D1HA 3R3XA 4IQ4A 4QFMA 2F4VB 4Q5IA 1U7PA 1CNMA 3CZPA 1QB7A 2K7FA 3I9MA 5IBCA 1VC2A 1H3EA 1GN8A 1VE6A 4YMSA 2V55B 4Q9JA 1CCWA 3PIIA 1GPLA 1K08A 4MCIA 1QV6A 1V8OA 1QUFA 2OHFA 1V7PC 3ZN2A 5EEGA 3IDQA 1GZVA 3D8UA 1TF5A 3E9ZA 2QLTA 1XNQB 1U7UA 4BFCA 3DZBA 4C6TB 1Z74A 3C3MA 4BMSA 1ZVVA 4UNQA 2VPPA 4F9EA 1ZZPA 5CDTA 3C45A 4HFFB 3LX8A 1D8TA 3G23A 1P73A 3W6ZA 3A4LA 3I5MA 3OE7D 3NNNA 2JFGA 4W5RA 4N5IX 1KPHA 5EMKA 5J5CA 1QGDA 4OQNA 2QB5A 1WHSA 2PPVA 3CN7A 3WJ2A 3DOHA 2IBMA 2Q0SA 2BGNA 4F1KA 1KBZA 3JAKB 2WP0A 3KQKA 4M49A 1PZGA 1KY5A 4QO8A 1KEEA 521PA