2J7PD

Gmppnp-stabilized ng domain complex of the srp gtpases ffh and ftsy
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
282
structure length
265
Chain Sequence
IPWGGNLEEVLEELEMALLAADVGLSATEEILQEVRASGRKDLKEAVKEKLVGMLEPKPVEPKGRVVLVVGVNGVGKTTTIAKLGRYYQNLGKKVMFCAGDTFRAAGGTQLSEWGKRLSIPVIQGPEGTDPAALAYDAVQAMKARGYDLLFVDTAGRLHTKHNLMEELKKVKRAIAKADPEEPKEVWLVLDAVTGQNGLEQAKKFHEAVGLTGVIVTKLDGTAKGGVLIPIVRTLKVPIKFVGVGEGPDDLQPFDPEAFVEALLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SIGNAL RECOGNITION PARTICLE PROTEIN
publication title Structure of the Gmppnp-Stabilized Ng Domain Complex of the Srp Gtpases Ffh and Ftsy.
pubmed doi rcsb
source organism Thermus aquaticus
molecule tags Signal recognition
total genus 98
structure length 265
sequence length 282
chains with identical sequence E
ec nomenclature
pdb deposition date 2006-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00448 SRP54 SRP54-type protein, GTPase domain
D PF02881 SRP54_N SRP54-type protein, helical bundle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.140 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2j7pD01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2j7pD02
2F55A 1XCGB 1EGAA 3DMNA 2Z83A 3ASYA 1Z07A 4A8JA 2J7PD 1G4UR 4B44A 5J47A 1IN4A 2EFEB 4Z54A 1HQCA 3GPLA 3UG6A 3ZZ0A 1X8LA 3KKOA 5EP2A 3AGPA 1VDZA 3L43A 1G64A 2GAAA 2JGNA 4KI0A 3AEZA 3K0CA 3X1ZA 3I4LA 2WWGA 4GNKA 1U8ZA 3IHWA 2H57A 3VHLB 3L0SA 4QGFA 2F3TA 4LC0A 4N0DA 2OE2A 4HDQB 5CYOA 1ESNA 2OFOA 2ZAMA 1J7KA 1YZGA 1G7SA 1SVSA 1Q0UA 1ZBDA 4MYCA 2CCJA 3ECCA 2X2EA 4EPYA 4PPGA 4BFWA 4P0TA 4LV5B 3QOFA 4RCYA 4Y0VA 4DLVA 5CDFE 1CRQA 4LYJA 1QHYA 2GETA 1ETUA 4ZCIA 3C16C 5B58C 1U9IC 3EZ7A 1HY3A 2JJ2A 2O8FA 1RKBA 4RD2A 1F48A 1TUIA 3DHWC 1YZQA 3QUSA 3CRQA 2OCYC 2XX3A 3HDTA 4BASA 2FEMA 2JLXA 3I62A 5JSZB 1KNQA 4FINA 3GMTA 3NBYC 5HCNA 4TLEA 2GXAA 4C0BA 1H8ED 4IVPA 1G3QA 5JRJA 5JEDA 2QU8A 3CF2A 2CHGA 1KDTA 3OAAA 1A2BA 1DO0A 3NXSA 4JT4A 3WYFA 4O3MA 3ADKA 1Q1QA 2HUPA 1T0HB 1N6LA 3QF7A 3NBXX 5KYKA 2ZRPA 1R8QA 1GUAA 4QHSA 5EZ6B 4RZ2A 1GDDA 2FFQA 1TX4B 2ZI4A 4YXWD 4HSEA 1R7RA 1AZSC 3I8XA 1U0LA 2BCGY 3A1TA 1KMQA 1ZNWA 3FMPB 3PQCA 3I5YA 2BCJQ 2GK6A 3ND9A 3GJ7A 4A8JC 1W46A 1H8HD 2Q3HA 4Z8YA 5A4JA 3RSLA 2OAP1 1FP6A 3E2IA 1EESA 2BC9A 4V0KA 2DB3A 3GLHE 3WBKA 4IDHA 4A0HA 1G291 1VHTA 4AIIA 1EFTA 3D7MA 1OKKD 4Q4HA 2F9MA 2JLRA 1TEVA 5P21A 2CMKA 1QDEA 3K0CC 3VR4A 4B2LA 1OYWA 3THYA 3FFAA 2BMDA 3W8RA 4LHWA 1T3SA 5AWFC 1O3YA 3N70A 2QY9A 4OYHA 3U3KA 4EQ6B 3VHXA 3LQRA 2Z4SA 2CVHA 2FN4A 2KE5A 1AGRA 3FKQA 4I1SA 3UMRA 1Z28A 3GJ6A 5GJBA 1Z22A 5EXSA 4DDUA 1KKMA 2W0SA 4O2RA 3VU9B 2A9KA 2C77A 1P3JA 3WYGA 3X1DA 3T61A 4XVUA 2Z43A 4NU0A 3U3RA 1S1CA 1LW7A 1Z0AA 2NO1A 3HJNA 2CL6X 1SXJA 1XWIA 1EWRA 4KBFA 2J5XA 1T5IA 1II8B 3DO6A 3K0AB 2CNWA 3REFA 3LNCA 3UK6A 4RD1A 3W9YA 5KTYA 4DRZA 3E70C 4PC3A 4B76A 1ZW6A 2VA8A 4AY2A 1W0KD 2ZRKA 1CRPA 3PEWA 3SN6A 5EP1A 1ZCBA 2ZS9A 1NF3A 5AK0A 2BDTA 4PHHA 1RYHA 1XD9A 2ZI6A 4PXAA 3SZRA 4JJZA 3WHKA 3GJXC 821PA 2HT1A 1KK1A 1E1RD 2FPMA 1Z0IA 2P2LA 3EIHA 1NKSA 3OEHA 4FMCB 2FFHA 4DSOA 2H18A 4FWTA 5FTNA 4IVQA 4EFMA 1CTQA 3AVUA 4KFTA 3NBZC 2BM1A 2WPDA 4D4KA 3AVQA 3TQCA 1YHNA 1D2EA 4Z1MA 3ZIAD 4LRWA 5IDVA 4XVRA 1EFHA 1KO7A 1KGDA 1OFHA 4CVNA 1XPOA 1N5IA 3CX7A 4CEIA 3ZGXA 2BMEA 4B33A 4MUBA 1JR3D 5BYJA 1N0VC 1ZM3A 1R6BX 2PH1A 4JBYA 1G41A 1GFIA 3Q8XB 2YWFA 4PAMA 4FMDB 3KUDA 4GOJA 3T1QA 2QPTA 3FHCB 5JS8A 2GZHA 3JVUA 4KSCA 1IJFA 2JIZD 1GIAA 2AHOA 3OIYA 2EFGA 2QAGC 5E7IA 4YMWA 1XBTA 3GLHB 5DSZA 1WBDA 1Q3TA 2YKGA 4DLTA 1WXQA 2E9SA 2OZEA 2KBEA 3B60A 3G82C 1YQTA 2XTNA 2F1HA 3WRXC 1ZM9A 3EWSA 3R7WA 3FB4A 4A2PA 2Z6VA 1KI6B 3PV0A 1F2UA 2ZS8A 5JI3E 1NJGA 4K46A 3UWKA 4JLJA 1F5NA 2F1JA 3P27A 3B78A 2QMEA 1EG7A 2JLSA 4IFEA 5BWMA 1Q44A 4LWZA 4HYYA 1OLOA 3U61B 1OH8A 5H8WA 2DFLA 2VEDA 3DM5A 3MJHA 2WJJA 3I5XA 2HT6A 3REGA 4A92A 1UKVY 2F43A 2W6JD 3RWOA 3QI2A 5ANRB 3KQNA 1XXHB 3K70D 3GEHA 3KL4A 4TTQA 5KUTA 3DZ8A 5K8LA 3SHFA 1EFUA 4QBHA 2Z5FA 3MLEA 1COWD 3C7KA 4YC7A 3T1TA 3O8CA 4UXJA 1W36D 3PVSA 5CK5A 4POAA 1GNRA 4IFBA 2HXYA 2OBLA 2ORIA 4Z8XA 1KSJA 3BORA 4P33A 1GRNA 1W5SA 2IYRA 4TLCA 3U2QA 5BQ5A 3VTKA 2QAJA 2VP2A 1L7VC 3SU8A 3GJ0A 3SYNA 3QEJA 2O0HA 4P4SA 1S1MA 1SHKA 5C46F 3A4NA 2WWYA 1XU4A 3UMFA 4XWKA 2A78A 1LB1B 4XD7A 2JAQA 4FMCF 3ZD7A 2BWJA 3EZ2A 2JJ1D 2WV9A 4HLUA 2JLWA 4OQNA 2O0JA 1HE8B 1XJCA 2C98A 2OFXA 3BFXA 4V02A 1ODFA 2A5FA 2KSQA 1II0A 3LXRA 4S2EA 3MWYW 4PC7A 4MQBA 4QNMA 3OF5A 4JLOA 4BGDA 4MDFA 1OIVA 4OHVA 3GFOA 4N1AA 4P4TA 2CHVA 1GL6A 2QZ4A 3FHTA 2O8BA 4Q9JA 2BMJA 1E0JA 4NCJA 3U7EB 1ZP6A 2C04A 4EFLA 3CWZA 4OI0A 1E9BA 3NDBB 3K9NA 4ZDWA 2WZQA 1B0UA 1G3RA 2ZUDA 3IPYA 3ZVLA 4FMDF 3EPKA 3X1YA 3SHWA 2IC5A 2GCOA 4DCNA 2NO0A 4B75A 3PUVA 4P3YA 1FQKA 1TTTA 4DCTA 1Q22A 3RS4A 1ZM7A 3CX8A 1A4RA 4TL6A 2GXSA 4TQ9A 1NLYA 4DZZA 1TF7A 4QBFA 1HE1C 4DEXA 1Q57A 2OO7A 4XH9B 1E1QA 3TLXA 2WIBA 3NHAA 2BJWA 4A0GA 3GEEA 3IEVA 1D5CA 1VECA 3CKLA 3TBKA 4GBMA 4RFVA 4UNRA 2KBFA 1MT0A 5HKKA 4A1FA 3AM1A 1R10A 1T6NA 1US8B 2XZOA 4Q7JB 3TUZC 1AZTA 1DADA 3LBNA 1Z0KA 4HLDA 4UQOA 1RRGA 1K5DA 1Y3AA 3LLMA 2PEYA 3WNDA 3FFBA 2IUUA 4ZDKA 3KKQA 1KAOA 2GJ9A 1ZC4A 3PFIA 4FW9A 3FVQA 2CBZA 2RGDA 2GNOA 3V4RA 3IDQA 2RGNC 1FZQA 1P75A 2FSHA 4TQAA 4F38A 2R6FA 2VLIA 2JASA 3QXJA 2QMUA 1IY0A 1W2GA 2ZR9A 3KXKA 4IDNA 3FDIA 1BMFD 2BBOA 2J0UB 3TSWA 1Q1EA 3V9PA 5LB2A 2V54A 6Q21A 4IEIA 4MGKR 5KSYA 1UKYA 3PUWA 2CK3A 4BLPA 2GEVA 4B34A 4GZLA 2OLJA 5A5GA 5CM9C 2WTUA 4MRPA 4OQXA 1XFAA 4AD8A 4TYYA 4FD2A 4QM7A 1WA5A 3OFND 3HR7A 5C4GB 1X8JA 3RSOA 1KSFX 2QT0A 5IF9A 3KXIA 3RS0A 1SVLA 3M1IA 3CLVA 1CJMA 4ZV4A 4LHXA 2HYDA 4O2LA 2GBLA 5JWOA 1EFRD 4QBIA 4NYIQ 4PSAA 2ZETA 1CS4C 3C5HA 4TL7A 4W5JA 4GOKA 3WXMA 4BLOA 2QBYB 3QBVA 2FZLA 3B2EA 5FTKA 5SZHB 1AIPA 3SC3A 2XZLA 2D7CA 5DHFA 4URVR 3EC1A 2ZR0A 1LV7A 4DCUA 1NMXA 4B43A 2W2TA 1KKLA 4C7OB 1KI4A 1XMIA 4DLZA 1DELA 2OBMA 3SFZA 5IK2A 4B3DA 1WGWA 3QXCA 4IOMA 2D2EA 2V6JA 4NE2A 2QPAA 1PLJA 1IJEA 2MSCB 3KQLA 3OIVA 5EXXA 1W4BA 1NVXQ 3IHLA 1HYQA 2ZS7A 4HUTA 2WMOB 4DLRA 2V6IA 5LD2B 1OB2A 2ZAOA 3B1VA 2HF8A 3IKJA 5FOSA 3VNVA 1AS3A 2HLDA 2MMGA 3BK7A 2EW1A 2ZJ5A 2I4IA 3KTAB 1RRCA 4OQFA 4ZDJA 4M1TA 2ZXUA 1LS6A 3IBYA 5JBQA 1Z63A 1R2QA 1BIFA 3VNUA 1W7AA 1KK0A 2FZ4A 2IS4A 3TK1A 1SVIA 2ZU6A 2VHTA 4UNPA 4EJSC 4M8NE 1XCPA 4LPSA 421PA 1ZCAA 4C4PA 5L3QB 2ZYWX 4JVLA 5FOWA 5FR1A 1G3UA 2B92A 1GILA 1GWNA 2GVDC 4B3CA 3UG7A 1G5RA 4QG7A 4MKIA 5FBVB 5JSZA 5DO9A 4TLDA 5UKDA 2FF7A 4IDQA 3LQQA 3RS5A 3TGPA 5FOTA 2P6RA 4DIDA 2I1QA 2BKEA 1OFUX 5SZKB 1YZKA 2H5EA 3U60B 3ICQB 5EE1A 4M1OA 4C0SA 4GMXA 2QORA 3GLFA 5KSPA 3BC1A 3P4XA 2PZGA 2GBLC 1LY1A 1RW4A 2YC4C 1NVWQ 1CLUA 3L2OB 4LYHA 4ZCMA 1SVOA 3V4FA 1OF1A 2ZRFA 4D4JA 1IXSB 4RKEA 4KFRA 2XITA 5LPNA 1G1MA 1X1RA 2OBNA 1NL3A 2OXRA 2ZRDA 5DLQC 3CBQA 1N6NA 3T15A 2ZTSA 3D3QA 4BLSA 2OEPA 1QHGA 4BFZA 1E4YA 2KJQA 1JI0A 4BPBA 2GCNA 1WCV1 1G8PA 3NC1C 2ZRJA 4TYNA 2VO1A 4I1OA 1RYFA 2FPLA 1R0ZA 2VTKA 3A1SA 4HZUB 4BZPA 1ZD9A 4QBGB 3BXZA 4XSHA 3MMPA 4CT4B 2GF0A 4EQ6A 5J4KA 3BGWA 2W6ID 2DFTA 2GILA 4UJ3A 3I72A 1E2LA 4HUQB 3BH0A 2MMCA 5TB5A 2EQBA 4QXAA 4IRUB 1YKSA 3K53A 3AKCA 4D25A 2RCNA 1YRAA 2X1VA 4MA4A 4C0KA 2IYQA 4ZDIA 1G8GA 1XPUA 2WAYA 1E9CA 4QHTA 4NDZA 5B2ZA 1I4DD 2H17A 1DAGA 3B1XA 1P9RA 1W5TA 3LW8A 1KMHB 1RVDA 1GRQA 3U3OA 2WJGA 4KODA 3UANA 1II8A 1VYVA 4BFXA 1ZRHA 4DIEA 2GA8A 5E95A 4JVSB 4L4UA 4D0NA 3IO3A 4KCGA 2V7QD 2QPOA 5DIFA 5D3MB 4NYJQ 3AGQA 1GAJA 5FBWB 3SYLA 1G5TA 1KDOA 4A0FA 1FP7A 2WM9B 4NCIA 5EE5B 5CDFA 4J0QA 2AFIE 3AVOA 1TF2A 1J90A 3DM9B 2CCGA 4OQMA 4NTZA 4AK9A 2CHQA 4TMXA 3NDPA 2YWEA 3HPQA 3TW4A 4FCTA 4GZMA 2GJ8A 3OE7A 1OV4A 2EVWX 1JQJC 2QP4A 3B5JA 4PO8A 4WW0A 4XSGA 2AD1A 4EIWA 1E3MA 1CR2A 4TMKA 1NG1A 2A5DA 3AF2A 3D31A 3D6TB 3AKDA 3ZYCA 4YMTA 2IYVA 2XZPA 1QG4A 3RC8A 5DH9A 1GKIA 4Q47A 4DHEA 1J99A 4Q7LA 4ZCLA 4DBLC 4G5RA 5GADl 1UPTA 2OM2A 3SJCA 4BZXA 4RSGA 4EFNA 1IXRC 5ELXA 2CXXA 1KTVA 3OESA 3MWKA 4Q02A 2XEXA 3ZVRA 3BE4A 2B8TA 2DY1A 2JEOA 1PUIA 3MUFA 4X8OA 1U8AA 4DLYA 1E2IA 2ZREA 1WP9A 3QQ5A 4HDCA 4Q01A 5JWHA 5LBIA 4MYUA 2EU8A 1Q20A 3I32A 1NN3A 4YQFA 2R6CA 2VP5A 1NN5A 5HE9A 1YR7A 2B8WA 4B3BA 1GRRA 4L5BA 2P0EA 2FG5A 2O8CB 3GLHA 5L8VA 4LJ5A 5JMTA 4PSKA 1KNXA 1GOTA 4JMPA 4QHYA 1XZQA 4WZAE 1R8SA 3K09A 2BM0A 2MSDB 1GG2A 1XD8A 4LCBA 4R9UC 2WBLC 2QENA 2FWRA 1KI6A 3QPWA 5J4LA 4G0NA 2GEUA 1TQ6A 1CJTC 5C2JB 3IBGA 3ICEA 2YOFA 4GMDA 4EKDA 2BV3A 1MO5A 4LHYA 1T0JB 3VR1A 2AFHE 1KO4A 1OXSC 2DYKA 2ZYTX 3PG5A 4A36A 3VKGA 2HEIA 3V00A 2AK2A 3GFPA 4TQUS 2A7QA 3K8YA 2J0QA 3L8ZA 3JZMA 3LBIA 3ZVMA 3TE6A 1XXHA 2X77A 1E99A 3EG5A 1VYTA 1ZU5A 3IO5A 4QOSA 5EUQB 1E2JA 2MSEB 3TH5A 2IXFA 5CJPA 5H70A 5EE9A 2KI5A 3K0EA 5JJIA 1IHUA 2G0TA 1PV4A 4X8LA 2ZUBA 2WWXA 3IIMA 2GCPA 3K9HA 1W1WA 4F92B 3ZZUA 5F98A 2GEDA 2FSFA 1E2KA 3QF4B 4URUR 1N6IA 2QEQA 4M22A 1OFTA 4M2LA 3SQWA 4GP6A 4BE7B 4KBGA 3EZFA 2O8EB 5FL7D 1SKQA 4JVNA 5TY0A 4P32A 2EWWA 1DARA 1LS1A 1U98A 4L9SA 3B9QA 2XTZA 3A1WA 1IM2A 1Q1ZA 5KDLA 3TR5A 2BVNA 2OESA 2UKDA 2ZRNA 2UZ3A 3CRVA 1XMSA 1FL9A 3RC3A 4TT3D 5JI2E 4CZ2A 3LLUA 4GL2A 2G9NA 3U44A 1I2MA 1OW3B 3AUYA 3KJGA 1QRAA 1XEWX 4BFTA 4OQLA 2QUZA 1W0JA 2YYZA 4BUJA 2CLSA 4HAXA 4ASUA 3U4QA 1Z08A 1XEWY 2IT1A 1E9AA 2A5GA 2ZRHA 4IOKA 1U94A 3IQXA 2ZROA 3BAFA 3LO5A 4GSYA 4PPNA 3K70B 5EP4A 3X2SA 1UDXA 4OHZA 2W58A 4KHZA 3B6EA 1NBMD 1UKZA 4KJZA 1Q21A 4M1SA 3LH5A 3EZ9A 3RYTC 4BEBA 1RPZA 1HT1E 1W36B 2ZI5A 2V55B 4E22A 1W2HA 1A2KC 1E0KA 2YOGA 4Q1BA 3K0FB 3ZS9A 4ARZB 2G6BA 2REXB 4QKQA 2QQEA 4QJ4A 5JLJA 2IXEA 1DBSA 1S4QA 1W49A 3QXHA 3AF3A 3WY9A 1E4VA 5IT5A 5JHHB 2IEZA 4Q4LA 4RD0A 2Y8EA 2AWNA 2N1BA 4V0OA 1KZ7B 4JJKA 3RLFA 3LX8A 3M0EA 4TSFA 4WXPA 2BIFA 2AN9A 3SJAA 4HDOB 5G3YA 2YHSA 4BFYA 1F6BA 3Q5EA 1XJQA 4DSNA 1MR3F 2BKUA 2PJZA 4TTRA 1OXUA 1KSHA 3K9LA 2F1IA 4LZZA 1TL7C 1ZC3A 4PANA 2G77B 2FE4A 2ZE8A 2ORVA 4XIGS 1FUUA 2QT1A 2ANCA 3CRW1 2WSSA 3SJBA 3IGFA 4PZZA 2GTPA 1XP8A 4ZI3A 5BN4A 3ZVNA 2ZRMA 4L15A 4Q7MB 3N2EA 1XTRA 3PUZA 3JZAA 1US8A 2C9YA 3RRYA 1NSTA 2VIIA 4KITB 1QZXA 1I2DA 3NBFA 5KU1A 5FPHA 5J40A 3PXGA 4JT2A 2ONJA 3UPUA 1R5OA 5TARA 1JQLB 3T12A 3GLIE 3VQTA 4IKEA 4KVAA 4KVGA 1SZPA 1KK3A 2IUTA 2FH5B 2FGKA 2ZSEA 4IW3B 2LWIA 3EX7C 3MAAC 1T3HA 3W6OA 3Q9LA 5B30A 5LB4A 2AKAB 1YZNA 2VF8A 4RFSB 1GP2A 1JAIA 3EIQA 2IYWA 2J0UA 3AB3A 3R9XA 4PFSA 3DKVA 5EQTA 3K1JA 1WE2A 1VCOA 4RZXA 1P6XA 1TF5A 2B7CA 2QRZA 1DG3A 4HAZA 1PLKA 3IEUA 3Q7PA 4Q1FA 1X1SA 4XTRA 3EPLA 1TU4A 2WJVA 2ZI7A 4PAQA 5FTJA 1E2DA 1L2TA 1SGWA 1NMYA 1ZIPA 2X2FA 3HU3A 1OXVA 1C4OA 1CU1A 3RWMB 4NONA 4DC9A 1TADA 1KY3A 3ZD6A 4HB2A 5FI1B 3GFTA 3LRPA 4NBSA 4A6PA 3CH5A 1XTSA 3OEED 3QKRB 1Z47A 5DI9A 5BN5A 4M0LA 4LJ7A 2RKOA 2VSOA 4XJXA 1ZVQA 1VIYA 5EXPA 4HLQB 1MRSA 2O52A 4C30A 1QHIA 1NVVQ 3A37A 4I1VA 1IQPA 1FPMA 1G3MA 3EC2A 3NKVA 3ZS8A 2ZIAA 4H1UA 1G8YA 5K8TA 4EDHA 4FXPA 1RC8A 3SBDA 2QBYA 2AWOA 4NYMQ 3ZQ6A 3BB3A 4R98A 1CP2A 3SFVA 1KI9A 2QMHA 1KO8A 4JLVA 4PPQA 2PL3A 3ND8A 2JLQA 5L3RA 4Q4AB 1RE0A 4C7OA 2OILA 2ZANA 3L8YA 1Z06A 3LWNA 1GVNB 1UADA 3BIFA 5AJVB 1SXJC 3P20A 1CKEA 1TPZA 4AYWA 1N5KA 2XOKD 2ZRGA 2KB0A 2R62A 1KI8A 3A1VA 3GLGA 2NPFA 3A6PC 4OHWA 1SKYE 3RANA 4ZIRA 3ONWA 2OSBA 2IA5A 3CX6A 2VHUA 1DPFA 2WWWA 1ONBA 2D3WA 1Z0JA 1TAGA 2VBCA 5TXGA 3QBTA 3TSZA 4LHZA 4CW7A 1AM4D 4D4MA 3GLIB 4QJ3A 2ZUCA 4B3XA 4DCVA 1YR9A 2X19A 2ZEJA 3FKSD 3OIUA 2IL1A 3SS8A 1QHHB 4G5GA 3AKEA 4UNQA 4DDTA 1OSNA 4Q7KA 4M4SA 2WKQA 2XB4A 2WKPA 4M9QA 3B8HA 1YR8A 5L3QA 3WNCA 1E2FA 3F8TA 1S0UA 3U7FB 2YV5A 5IHPA 2XXAB 1NKTA 4TTPA 4AKEA 2Q6TA 2OCPA 2RHDA 1QVRA 4Y0AA 2QNRA 1KO1A 4MGZR 2J45A 2UZIR 4JS0A 2J7PA 2RGBA 3R9IA 3NEYA 4JLDA 5JEEA 3CZQA 1RIFA 3FGNA 4WOPA 2XNSA 3CZPA 1JB1A 1DG1G 5M04A 1XMVA 5JCZA 4ZKEA 1UBGA 5DI3A 4GPTA 1I4TD 3TSOA 2QE7D 3RDPA 3K9GA 2VHQA 4C0JA 2IYUA 221PA 1MABB 2FSGA 1Z29A 4NMMA 4OHYA 4S35A 3TVDA 4V0NA 2IYYA 2JLUA 1D8TA 4AYXA 2XTMA 1UF9A 4Q03A 3SR0A 2VQSA 2YZ2A 4EPRA 4MYHA 2HYIC 3DEFA 5E7MA 1OE0A 4DDWA 3F0TA 3SQXA 3U7GA 1W44A 4F91B 5DGXA 2FDCA 4IDOA 1SHZA 1KJZA 3LD9A 4JBXA 3S1AB 1G20E 3AF0A 2XSZD 4BLTA 1ZUNB 1TQ4A 5GVSA 2ZJ8A 2IHBA 2EYUA 2ZJZA 4TYWA 3GP8A 3NC0C 4FCVA 4N0EA 2QA5A 1E79D 1ZM4A 1YRBA 4HZUA 4BQSA 2H7VA 1JALA 2HDNB 3PEVA 4BEJA 5LD2C 2H1LA 3MG9A 4TMVA 1JAHA 4C2TA 1H8EA 4BFSA 1T91A 1U90A 1NVVR 3OZXA 5HZKA 2G0NA 2L0XA 4KU4A 4HUQA 4EAQA 1LFDB 2K5UA 1ZD1A 3QY0A 1OFIA 4BRUA 2NIPA 2QRNA 2N42A 5CIWA 1HQYE 4DLUA 3CNNA 5HTKA 4YXWA 1Z2AA 4JLNA 5G40A 1SKYB 2JDID 1IN6A 4NP6A 3W5JA 1KSGA 1VG8A 1W4CA 2IHYA 3AV0B 1MOZA 1OHHD 5D3MA 5DYGA 4BLQA 2GDJA 1H8HA 1GNQA 2V8OA 5KOYA 2ZRAA 1SULA 5H68A 2IWHA 3RRMA 4B6FA 3TW8B 4L8GA 1CEEA 1Z83A 1W4RA 5GJCA 1E96A 3CR8A 3Q3JB 1OKKA 2JLZA 2DFNA 2IUSA 5AJZA 3TQFA 4RD3A 1N25A 3QVVA 3GD7A 3PEUA 4CYMA 4JL6A 2I1VB 5AR1A 4DLWA 1Z6XA 4LDJA 4CDGA 4MRNA 3I92A 2AK3A 3LDAA 1W4AA 1KI7A 1EK0A 4HLUC 4Q48A 1TQ2A 2PT5A 4HLCA 4PPFA 1G17A 4XWAA 5JS7A 1FW6A 5BN3A 4KFUA 2C99A 1OIXA 2BMFA 3BFKA 2CL0X 4LJ9A 5FUXA 3QNUA 2VP6A 2QAGB 4V0LA 1G21E 3C41J 3P1JA 1RJ9B 5TV2A 3I61A 2AX4A 5TDHA 2DWQA 4LI0A 5AJXA 5FOUA 4TYQA 4NHOA 3CPHA 4R7ZA 4D0LB 2AD5A 4HI0E 4NZYA 4G1UC 4KLZA 2GESA 2IYTA 3DDCA 4U00A 3THXB 1KJWA 4QRHA 1X6VA 3CF0A 1N6PA 4M1KA 1CJUC 4KYUA 4M1MA 4W5WA 1LNZA 1X86B 1W0KA 2P5SA 4YMVA 4NPHA 2OCAA 2P6NA 2FJUA 3TNFA 2FV8A 3P4YA 4ZKDA 1IONA 2O8CA 2OG2A 4B35A 1QHSA 3DOFA 2GZDA 1R0YA 1T8TA 4H1VA 4UXIA 2QTHA 3WP1B 2DHRA 1E1RA 2HV8A 4D2IA 3WMFA 5FBRB 3ASZA 3BD9A 3EXAA 4FN5A 1ANKA 1XTKA 1PVOA 3H1TA 4Q1AA 5DN6D 3NHBA 2FFBA 2ORWA 1G8HA 2J87A 2ZI9A 3O8RA 1P9WA 1VHLA 4LBVA 2AXNA 4CEHB 4V0ME 3ZIAA 1E2GA 5HCIA 2RGGA 4LUCA 4TMWA 1UEIA 2IS2A 1NLFA 4JYCA 2QM8A 5E7JA 2ZSAA 2GWHA 1Q12A 1NNEA 3KQKA 4BECA 3ADBA 1FNMA 3AP3A 1JR3A 5DNYB 4IXMA 2C5LA 4TLAA 1N6RA 1V5WA 1GL9B 1G8FA 2BHRA 2ERYA 1ZMXA 1BOFA 1ZYUA 3H2YA 3P32A 1NBME 3H86A 4II7A 4ABYA 4B71A 3THWB 2JIZA 2DWPA 1KZGB 2PZFA 4TN1A 3PJRA 5F2EA 2F6RA 4URWR 3AVYA 2QN6A 4UNSA 4M9ZA 1TMKA 4HB3A 2Q9AA 3QF4A 4A2WA 2BJVA 3X1WA 4W5HA 4XOIA 3EZ6A 4JBWA 3OIWA 2PLRA 3MRSA 3A4MA 3QVUA 4U02A 5J4YA 4CGZA 2O8EA 1XCMA 1E0AA 2PMKA 2ODBA 2QTVB 1S2MA 2Q21A 1S9HA 1YZUA 3HP1A 4URXR 1IOZA 4KSBA 4WZ6A 1IN8A 2OXCA 4M53A 2ODNA 3U7HB 5KDDA 3TIFA 2JJ2D 3CNLA 2FX3A 4LV8B 2ANBA 4LJ6A 3RABA 2PCLA 2FOLA 3BH6A 2HCBA 3AF1A 2FPKA 2C2HA 3RHFA 4DLSA 4FWIB 1JEDA 2J1LA 2W6JA 3KQHA 2O8DB 5L3SB 4JZKA 4LJ8A 4UXHA 1J8MF 4B6EA 4RD6A 3KKNA 3VR6A 4CEJB 3OAAD 3GJ3A 3PITA 4TYPA 4DKXA 4PR0A 1COWA 1G6HA 1IY2A 1XD2B 2BBWA 2ZSFA 2NMVA 3LAWA 2ZI3A 4DXAA 3A58B 1MRNA 1G19A 3B7GA 4Q1DA 2J59A 1KDRA 3K0FA 5FOVA 4ARZA 4B3GA 2PMDA 1NLZA 2YVUA 2ECKA 3H84A 1PJRA 2W2VA 5FI0B 5DHAA 5KNBA 5FBLB 2VH5R 1FUKA 2AKYA 4LJYA 4L16A 3T35A 4W9MC 4KXFB 1JEEA 4US2R 4B73A 3GJ4A 2W00A 1JJ7A 1NP6A 1VTKA 2GXQA 4LY6A 4O25A 1G7CA 3HWSA 2CCKA 1ZUHA 2P67A 3QKSB 2JJ1A 1DE0A 4Q19A 5AUNB 4PHFA 2ZM5A 4A15A 1AQYA 1TQDA 4TZ6A 3SNHA 1XTIA 1GL7A 2ZJOA 3KB2A 2ZITA 4JL8A 1DOAA 1MH1A 2RB4A 2CJWB 4DCSA 1AK2A 3JVVA 1OH5A 1GITA 1NVUQ 1TUEA 2VRWA 2ZE6A 5FTMA 3T5GA 1E94E 1LVGA 3NEJA 3FOZA 3U5ZB 2G83A 2W0MA 4NYIR 3CB4A 2VYFA 4PQYA 3T1VA 3VU9A 4ZI2A 3B9PA 3AUXA 3KFXA 3LFUA 1E98A 4C9BA 3FYHA 2JATA 1ESMA 1HUQA 3QENA 2ZRBA 3B85A 2J46A 3UKDA 1NIJA 1TU3A 2IS6A 3K0AA 4B3FX 3G0HA 1SXJD 2NO9A 1JJVA 3LVQE 4MRSA 2WOJA 2HJGA 4ACBA 4WZBE 2DBYA 4JLAA 4A2QA 2RAPA 2CNWD 4OHXA 1N6KA 2ODWA 4LGMA 3EW9A 5DYIA 2QMOA 2IW3A 2R9VA 2VHCA 2WMNB 5FBQB 1PUJA 2JCSA 2UVQA 4RFSA 3K70C 4H9GA 4LJAA 4F4IA 1HEIA 2P65A 1G9XA 1LTQA 1NN1A 2ZSDA 3KKMA 3W6NA 4PHGA 4OI2A 4O0MA 4NH0A 1F2TB 4JKIA 2H92A 1K5GA 5BXQC 1R4AA 2YNMA 3GEIA 3OEHD 4N3NA 4EUNA 4C0LA 3L0PA 1V43A 3QPVA 4IOJA 5JJLA 4YONB 2V9PA 1KDPA 2QL6A 2WPDD 1E6CA 2CE7A 1R5BA 2G1JA 2EYQA 2Q9BA 1ZD8A 4BFUA 1P62B 1QHNA 2RGXA 4Z1MD 3Q85A 2C03A 4MRVA 1P2SA 3IPXA 3T06B 1WBBA 4D6PA 2NQ2C 1KHTA 4K81B 1G4AE 2WSMA 3ZZTA 4DUGA 1XEXB 2WIAA 1OJLA 1WF3A 4NCHA 4CRWB 5CB6A 4B48A 2IS1A 1G7RA 4TMZA 1GZSA 2VP4A 3WHLA 3X1XA 4RKFA 3CH4B 4ESVA 4W7SA 5CLQA 4ESHA 4NCKA 1A82A 1BS1A 2DFKB 1BMFA 2IK8A 2P3SA 4G01B 1QBKC 4Q4AA 5JFGA 4X8MA 4R71A 1MO4A 2D7DA 2R65A 5FUVA 4JL5A 4Q4JB 4A0RA 1YJ5A 4ZPXA 1R0WA 1XTJA 2P5TB 3TAHA 3K0SA 5CIQA 5FPKA 2NO7A 4JIMA 4MRRA 4EJSB 4MDEA 1CR0A 4QM6A 1D2MA 3A36A 2VP0A 4MKGA 4K8OA 3I3SR 2R2AA 4BZQA 1OIWA 4OK3A 3GLFE 3UWOA 2X8AA 3OFNA 2PBRA 5BYKA 4ON9A 2OAQ1 3ADDA 3NG1A 1M8PA 5JHGB 1B23P 1IAQA 3GLIA 5C1BA 3QE0A 1E9SA 4IDPA 4C0HA 3HU1A 2A30A 4HAUA 4AYTA 4QJ5A 2A2ZA 1YR6A 1QHHA 3RS7A 3N2IA 1MO3A 1EFRA 4AKGA 1M34E 2QQ0A 1N2CE 3CO5A 4M21A 4AI6A 1A7JA 2J3EA 2OUKA 4PSVA 4F4JA 1P60A 2ZYVX 5KO2A 1E9FA 2IYZA 4XWOA 3L0IB 3ZDQA 5KDOA 4PTLA 3HYRA 4JVMA 2GXUA 2NPIA 3KZ1E 2OHFA 4NYJR 3FMFA 4M1YA 2IX3A 2WAXA 4Q18A 1ELOA 5JCPA 4DEYA 1G7TA 2QG6A 4HATA 1E2NA 1MABA 1N0WA 1CJKC 2XB2A 1OXXK 5G53C 3ZQJA 4IXNA 4JKYA 4LC1A 1A1VA 1QHXA 3RAPR 3B1WA 4LJ4A 2IWRA 3RS2A 3IIJA 2WKRA 1E0SA 2IF0A 1P9NA 2A3RA 4HAWA 4XD7D 4U5XA 1GM5A 4D81A 4DT1B 3VR5A 3CPEA 5JWRA 3O47A 2CLDX 3CNOA 3WMGA 4QGAA 4G5QA 1M7GA 4Q9KA 2ZRIA 2R8RA 2XJ9A 1UEJA 2ZRLA 3NH6A 3FWYA 2LCFA 3K09C 4LBZA 4UNNA 4G5SA 1RFLA 3BS4A 3S1AA 5KNCA 3IIKA 5AUOB 3KQUA 3DZDA 1RZ3A 3LW7A 3MCAA 4RZ3A 4Q9HA 3VFDA 4C0QC 2KWIA 4JLBA 3VX4A 3M4YA 1DEKA 4R2HA 1AQUA 3PUXA 1ZIOA 2BBSA 1A5TA 1G5PA 2PJRA 2ZPTX 3W90A 4XVQA 5DE3A 2J7KA 3SE0A 1AKEA 2IYXA 3UXMA 121PA 1EXMA 2CVFA 3BH7A 3ETLA 3GLFB 2ZVQX 1K6MA 2HJVA 1BYIA 2XGJA 3DMDA 4D80A 4IVRA 4LYAA 1E1QD 1S8FA 4AG6A 3VKHA 4M1WA 2Q3FA 5CJ2A 4RD4A 1D9XA 4XTCS 1FX0B 4WXRA 1AN0A 4DLXA 3HPRA 2LKDA 3NVAA 4LHVA 3EPHA 5HKKD 2C8VA 2J41A 4MH0R 4C3ZA 1XNJA 1ZJ6A 1E2HA 4F4CA 2NTYC 4E5UA 2GVZC 3L0OA 2NOAA 3NTUA 4JSTA 5IRCD 3QG5A 1JECA 3G5UA 1E9DA 2OLKA 2C95A 1E2QA 2DPXA 1X8KA 2W6IA 3GCGA 5J4HA 2QM7A 1Z6AA 1U2RA 2GZAA 2NZ8A 3Q7QA 4FCWA 3SDZA 4ACAA 1XMJA 2CDNA 4I99A 2QAGA 3AKYA 3MSXA 3QXXA 3J81k 1Z6YA 1RJ9A 2VF7A 3AVXA 1G16A 4MKHA 2PX0A 5GJWC 4A9AA 4D82A 1DAFA 4X8HA 2ZJAA 3NWJA 4IEEA 1DAKA 1H65A 1TEXA 3THXA 2ZE5A 2GJAA 2V7QA 2ATVA 5CK4A 1P2UA 3C15C 1XXHE 1EWQA 3PCRB 2W83A 2D62A 1BKDR 3TUIC 1N6HA 4QGHA 1JR6A 4MGYR 1Z6GA 4HB0A 1YE8A 2NO6A 2CK3D 3UMSA 2VL7A 3W6PA 1D9ZA 4ITRC 4U7DA 4GRAA 1GSIA 1SVMA 1T4GA 4JLPA 3DKPA 1II9A 3EASA 4AC9A 5H1YA 2VSFA 3W8NA 4B2IA 3UIEA 1FQJA 2IXGA 4G3XA 3QG1A 4YMSA 1YZLA 5FFMA 1P2TA 4QFMA 1CIPA 1KK2A 4OJKA 1RRFA 5JRZA 3QJYA 1TNDA 5K8IA 4EPWA 4CEHA 1IY1A 3WRYC 1VCMA 3THOA 2QGZA 3KB1A 5EE3A 1J8YF 4MKFA 4TZ0A 3GJ5A 3LBHA 3MGCA 1KI1A 2HXSA 1AGPA 2G1KA 4QC2A 3CUEF 5FOXA 2Q0HA 3PENA 4YLGA 1QF9A 1HTWA 1P4SA 1Y63A 5IK2D 3THWA 3W3ZB 1T8UA 1U0HC 2SHKA 1WMSA 2B7BA 1YZTA 4IHQA 4BRWA 2XNDA 1DAIA 3U6BA 3DVLA 2WWIA 3MJRA 5GVRA 3B82A 4DJTA 5HR5A 3KTAA 2N46A 4A6XA 4C2UA 5EUMA 2JLYA 2HLDD 2AL7A 3FMIA 1OH7A 2C78A 3GQBA 4FIDA 1UDWA 1FOEB 2DWOA 5G41A 1CR1A 2E1RA 2G88A 4RZUA 4E07A 2ZRCA 1WRBA 3EPJA 1EX6A 1BH2A 1GKYA 1OT3A 1KOFA 1S3GA 2EFDB 4GP7A 2C9OA 2ZU0C 1W48A 1G3IA 1KAGA 2O8DA 5KNDA 1T9HA 4A8JB 5L3SA 5BW8A 1MO6A 4Q1EA 1UM8A 1DAHA 1OYYA 2YINC 3IUYA 3PUYA 5HE8A 1XRJA 1HV8A 1M1YE 5J4VA 4CEJA 2RMKA 4LK2A 4LV6A 1XD2A 1DAEA 1ZNZA 1GNPA 4BWYA 2F7SA 3CPJB 1NJFA 1FMLA 3KJEA 4KAXA 2V1UA 1SXJE 2Z0MA 1VG9B 4PQFA 3WP0A 4MUAA 1VIAA 1JBKA 4PAOA 2G3YA 3VKWA 1F60A 1NY5A 2YJTD 5FL7A 3T34A 1KI3A 5SZIA 3CONA 2NG1A 1P61B 4JSYA 4PO9A 3D8BA 2JLVA 3P26A 1AS2A 4PZYA 4DSUA 2REBA 1HT2E 2WJIA 3O8BA 4Q9IA 1C9KA 3QKSA 4EPXA 3EA5A 4V0MA 4TT3A 2WWFA 3LY5A 1N5JA 1N3BA 1P73A 4GOXA 5F9FA 2O8FB 3KX2A 4BLRA 1PLLA 1JXOA 2EFCB 3RVBA 2QP9X 5TMPA 2F3RA 3CWQA 3O8DA 8OHMA 2FMXA 3BBPA 3PIRA 3U44B 2CJWA 2ERXA 2IYLD 2RGNA 4OKSA 5A0FA 4R2IA 5FPSA 1GTVA 1OXTA 3U4QB 4OJQA 1L4YA 2ASEA 1N5LA 2BEJA 4NKRA 5EJEA 4NYMR 4URZR 1NBMA 3RRNA 1WB9A 4TWZA 1AA9A 4KYIB 4I1UA 4FMBB 2BEKA 3TRFA 1ZAKA 1KMHA 4V03A 2ZJ2A 3W5IA 1NN0A 2P6UA 2PX3A 3VX3A 4F93B 3MFYA 4LBYA 1Z0DA 1Z2CA 1J70A 1KO5A 1T5LA 2OFWA 3T5DA 1MKYA 2R6DA 5FUWA 1E2EA 2FSIA 3AP2A 2B6HA 4KV9A 4DB2A 2V4ZA 3WYAA 2GHIA 4US1R 4HAVA 1Q3HA 2ZVPX 3PEYA 4OK5A 1M74A 2RGCA 1CXZA 3QIAA 3E5HA 4JYBA 2CE2X 4Q4HB 2F1RA 1U81A 1RRPA 2H16A 4D26A 4CT5A 1F2TA 2Z4RA 1XX6A 1D2NA 5AJWA 1U99A 3OE7D 4TL9A 5KSOA 3THYB 4Z51A 3R8CA 1R5NA 1LF0A 3TUJC 1G18A 1ZNXA 2D06A 2D74A 4Q00A 3IILA 3L82B 1S3SA 3U6KA 3GLGE 1UBEA 4TLBA 1AKYA 2GJKA 5CM8B 1C1YA 3AQ4A 1VMAA 4YDSA 5FUYA 1VG1A 2QTFA 4RJLA 5FPTA 1NRJB 3W3AA 5EZ5A 3DL0A 3MWJA 3QXSA 2FA9A 1IN7A 2HF9A 2ZJYA 4HAYA 1XF9A 3I1FA 5FPYA 3KXLA 1SXJB 2NGRA 3R20A 3QKTA 1E2PA 1XEXA 4P4UA 3TJZA 2VSXA 3TVTA 1OH6A 1S9DA 3KKPA 2H8KA 1KY2A 1N6OA 3GJ8A 4DUGD 4QGGA 4DVGA 5JZVA 3AVPA 1XEFA 1K8RA 1F3OA 2YWHA 4GT1A 1VCNA 4QL3A 5C18A 3LVRE 2FNAA 1VPLA 4I4LA 1IBRA 3BERA 4LPKA 1FTNA 1ZUIA 1XPRA 4AWXA 4MGIR 3FHOA 1CJVC 4FI3C 4KLNA 4Q4JA 1PZNA 3TKLA 2LKCA 5CITA 3WMEA 3RS3A 2FGJA 2CLCX 2QP3A 3LXXA 3MWLA 2QI9C 2EFHB 1SVWA 5AJYA 4EJSA 4GFDA 2BBTA 2DCUA 3E1SA 2ATXA 2HCJB 2ONKA 3C14C 4ILEA 4LYFA 2YC2C 1E69A 3CW2A 3ADCA 4TL8A 4RCZA 5KHOC 4WAUA 1Z6TA 1XDBA 3OEEA 1Z8FA 2PLFA 3OHMA 5LDDC 3TR0A 2C9CA 5AUQA 4CEIB 2EWVA 4OK6A 5JECA 2RGAA 3Q72A 5D3QA 1JPNA 4G5OA 4A82A 4E03A 2ZE7A 3QSYA 2QSZA 2RH5A 4KFSA 1AJEA 3CRRA 2C96A 4OBEA 4PQRA 1QG2A 4MITA 1FNNA 2BOVA 521PA 1XZPA 5C4MA 3FPAA 1L8QA 4HB4A 3HR8A 4WA7A 2PEZA 3CM0A 1Z3IX 2TMKA 1FFHA 4PC2A 3SYKA 1NG9A 2R6GA 4LBWA 1VYUA 4YDHB 2XOKA 3VAAA 3TAUA 4AKHA 4Q9LA 1Q1BA 3B13B 2WVJA 4IJMA 1Z5ZA 3R7WB 1LF5A 3EIEA 1DTSA 1F2UB 1MV5A 1ZNYA 2ZJBA 3C5CA 5L3VA 1KYIA 1P5ZB 3AH8A 3GLGB 4LX0A 4ERNA 1SQ5A 4BFVA 1I4LD 3CF6R 2ZSBA 1J2JA 5CYPA 5GJVC 4DT1A 3I8SA 4ZIRB 4CF7A 4JLKA 4EPVA 1CULC 1D6JA 1KJYA 1O87A 3EA0A 1HURA 2GAOA 3FKSA 1NMZA 3U3MA 4WVFA 1GKUB 2JJ8A 1W0JD 3FTQA 4ASUD 3EAQA 2J0SA 2F43B 3KFVA 5FH9A 3QEOA 4DWJA 1OB5A 3KUCA 1X3SA 5F9HA 2J9RA 1UAAA 2DR3A 1IN5A 2O5VA 1VG0B 1E9EA 2FFAA 3Q5DA 3A8TA 2ZQ5A 2GJSA 2QGNA 2QE7A 2VPPA 1OPXA 1Z0FA 2XJ4A 1IXZA 3H4MA 5DI3B 1JPJA 4RVCA 2AXPA 4NL4H 1AS0A 4P4SB 4WIAA 4JLMA 4PHTA 4Q66C 5FL3A 4TSFD 2AR7A 2GF9A 4CIDA 5E3HA 4GI7A 4UJ5A 3AVWA 3SJZA 4LOAA 5DISB 5HPYB 2FEOA 4L9WA 3SOPA 3BOSA 4LSGA 2A5YB 2QSYA 2I3BA 4F7WA 3BB1A 4OL0A 1FX0A 2O0KA 1W47A 1BYUA 3B1YA 1WDTA 1R0XA 2WWHA 2WSSD 3N5CA 1YU9A 2PT7A 3AP1A 3ZH9B 1QVAA 2WJYA 3VMFA 1E9RA 1JXMA 2IEYA 4OI4A 4DSTA 4PC6A 2XSZA 3R9WA 2O8BB 4TMTA 1ZU4A 2FU5C 2W2XA 3ZLJA 1E2MA 1P2VA 3ZJYA 1E79A 3M6AA 1G6OA 2WHXA 2OV2A 1CBUA 2VP9A 3EWAA 3IQWA 3VR2A 4A4DA 5CB8A 4D0GA 4B2PA 2REOA 3BB4A 3SI7A 2CL7X 4PZLA 2YWGA 3F3YA 3AF4A 1NY6A 1M7BA 2GCOB 3CIOA 1U0JA 3RRZA 1P72A 3C4JA 4DB4A 2IBMA 5J5CA 3VR3A 2V3CC 2NZJA 4GDFA 2IF2A 3RNLA 1XJ0A 1M7HA 3FE2A 2B21A 3T1OA 1SVKA 2JDIA 3BWDD 2OCBA 1HA3A 3A4LA 1DVRA 1U8YA 3FMOB 4ZO4A 4YMUA 4AKIA 1HH4A 1JR3E 1L4UA 1W36C 1OHHA 1ZINA 2D4HA 2WICA 3UATA 3R8FA 4M9XA 5TVKA 2Q9CA 2A5JA 3DPUA 4AG5A 2RGEA 721PA 1XTQA 5B57C 2E87A 3BRWD 3B1ZA 5F3WB 2GRJA 1T3LA 4RY2A 3TMKA 4B32A 2Q3MA 3H0KA 3LV8A 1YVDA 1N0UA 5FTLA 1BO6A 2XAUA 4MYTA 3PR1A 4PX9A 3HYTA 4QNRA 1M2OB 5FR2A 4AURA 3QKRA 1S96A 4EPTA 3QPUA 2F9LA 1E32A 4PC1A 3LX5A 5B64A 3NH9A 2ZYUX 4HEJA 1VCIA 4P31A 3KJHA 3HU2A 1WQ1R 5SZJA 1CF4A 5KPJA 4KO8A 5JJKA 4US0R 2OT3B 5E4FA 2GK7A 2PZEA 4I81A 3AVVA 1CR4A 3KDSE 5KPDA 4Q21A 2R44A 3QKUA 1KI2A 1DS6A 2ODEA 2GKSA 3AVTA 4URYR 4UKDA 1ZM2A 3CRMA 3EARA 1UJ2A 5HZHA 1NIPA 2RHMA 3F5FA 3WBJA 1XB2A 3MD0A 2VHJA 3DOEA 2ZR7A 1M6NA 3LA6A 2PCJA 4NCNA 621PA 1KIMA 4B74A 2JA1A 5K8UA 2R6AA 4D4LA 3C8UA 4OI1A 4DDVA 4M9SA 5EE0A 1U9IA 4HZIA 2IYSA 3BJIC 4IOLA 1EX7A 2WOOA 3W34A 2CEAA 2QROA 2J0VA 4E09A 4Q1CA 5CLLA 5EXTA 1NSFA 1UKEA 3KJIA 5EP3A 2XNDD 2WJHA 3NIBA 1P7CA 4PO1A 3U3JA 1DAMA 1EFCA 2V1XA 1JNYA 5DN6A 3A1UA 3BFVA 4B47A 1UBCA 1UFQA 4C0AC 2D2FA 1FMJA 1UBFA 3CR7A 1VKJA 3WNBA 5G3ZA 1DO2A 5AUPB 5KSZA 3SEAA 1NI3A 3I73A 1FTSA 2YOHA 2XXAA 4WBSA 4Q5IA 3SBEA
chains in the Genus database with same CATH superfamily
1EGAA 5JC1A 1T1EA 3ASYA 4IQ4A 5EY5B 3TZBA 2NV6A 2D2IA 2WNSA 1OQCA 3V1UA 1QR6A 1RTKA 2QXTA 2O4CA 3EPRA 4GNKA 3AINA 4INAA 3TLEA 1B43A 4Y6PA 4ZJZA 4E2WA 5BV8A 1R5JA 1M56C 1UDRA 1K6EA 3B12A 3OT5A 1ENOA 2YWXA 3GZNA 3TLKA 3QUSA 1CUBA 3TB6A 1B0PA 4F3YA 3DQZA 9LDBA 1R6AA 5CPFA 1A2BA 2C4HA 2IZ5A 3I9MA 1O9GA 2I7CA 3NBXX 4IHJB 1LWOA 2P3QA 4OH1A 4QEDA 4Z8YA 4JHXA 1EESA 1Q7RA 1PQWA 2JLRA 3UB4A 2Y2UA 1Z37A 1OYWA 1R74A 1PGPA 3VHXA 3LQRA 3F6YA 3ZU3A 2H4ZA 5KNLA 1JHUA 5GJBA 4O2RA 3TZLA 1EIWA 3REOA 2R7LA 1XWIA 1G5IA 4DRZA 4FYMA 4W63A 5E6UB 4CQJA 1QLJA 5FNVB 4GPIB 4MS3A 2ZVDA 1G20A 3SXUB 3VDNB 3R3YA 1N78A 3G79A 5CX1A 3GOQA 2VZ8A 4G8CA 3ZGOA 4JQOA 5FYQA 3AVQA 2ETSA 1VP9A 4G8DA 4LRWA 4W7HA 4CMGA 3OTIA 2H48A 1TQ8A 3ZTWA 2BMEA 1X7YA 1JR3D 4LTMA 1N0VC 1E58A 3AZOA 3LKVA 4RZQA 1PX0A 4FYKA 4MDHA 3JRMO 2C9MA 7MDHA 4YMWA 3QNWA 4N9WA 2KBEA 4YJFB 3T5AA 4MHOA 1B7GO 3EDYA 5AKLA 4R41A 1EUCB 3RF3A 4ER3A 3B78A 4HYYA 3U61B 1VLJA 3H1PA 1NR7A 1JHDA 1H1TA 1NJSA 4Y1RB 1A7VA 3PTAA 3AOEC 4ETMA 3TQHA 3RI3A 4TKLA 3GF4A 3QPCA 4H0FA 4UM5A 3C43A 3C3JA 3EPPA 1XU4A 4XWKA 1LB1B 3KVYA 2JAQA 1A7UA 1M2EA 2JJ1D 4HLUA 3RFFA 4GP9A 4Z2AA 2OFXA 2KSQA 3KJXA 3PNLA 1CRWG 4MRAA 5CM2Z 4EY3A 3H6GA 3NAGA 4I3HA 2VK2A 5HKLA 3A06A 1XN1A 1APBA 1TK3A 3U26A 4P3XA 3ROKA 4LRXA 3L6EA 4ROSA 3PUVA 3ZWXA 1H05A 2PUCA 4DZZA 2B6NA 3BF7A 5I7EA 3MBGA 4R0NA 3TLXA 2BJWA 3ZI4A 3CLTC 3GLUA 1TM3E 3F74A 5JUAA 2H7XA 1KYZA 2WEKA 2NUBA 3SCZA 1FU8A 1K5DA 3LLMA 4S1PA 4Z7OB 3T9OA 2VF2A 3RQIA 2EKLA 2HA3A 2HM7A 5EHQA 3RHTA 3HGMA 1EE1A 4JOSA 1ZQ1A 2GBCA 2P4QA 2VJMB 1NW6A 2H6EA 1U8XX 4HRAA 1T6BY 4WABA 2YV1A 2HN9A 2B4KA 4LF4B 3EDRA 3MJTA 4EO9A 1NMQA 5F5XA 3HCPA 4TUYF 4G0MA 4AD8A 1QUFA 3OFND 4E7ZA 1SVNA 5DASA 1VA4A 1KTMA 3B3QA 3X1MA 1KFKB 4NQRA 3CLVA 3JQGA 4MVXA 1P1IA 4QELA 1V9SA 1AIPA 3PFGA 2IPNA 2PS0A 4DCUA 1NMXA 1J9GA 1KI4A 1J0AA 5HMLA 2E21A 3GFQA 1Z4LA 5EXEA 5HM6A 1XJ5A 4GVPA 2BKVA 2MMGA 3CLUC 1OTYA 4BGEA 3HSKA 1LS6A 2OK7A 3GBPA 1YCHA 5GM2A 1VZ2A 2DKFA 4C4PA 2ZYWX 2WB7A 5MN4A 3TGLA 2WB4A 4MKIA 1ZGHA 2BTEA 1L4EA 2QD5A 4H7HA 3RS5A 4JKVA 1OWMA 4NNOA 4B1FA 1VIMA 4MV4A 3V6MA 4IHJA 1ITZA 3PQ8A 1U4SA 1RW4A 3CN7A 2P35A 3N2ZB 4ENWA 4AX8A 2JGMA 4BLSA 2KJQA 1T6QA 1S8AA 2PX2A 1W29A 2Z2IA 3EGXB 1MB4A 1N1CA 3N07A 2GF0A 3O2QB 4CI9A 3DAOA 4ULVA 3HNPA 4ABTA 4QXAA 4RQAA 2B61A 4NEGA 4HNUA 1QCDA 4RHTA 4NX2A 4DIEA 4L4UA 5DIFA 2KYHA 4A0FA 5JS2A 2O8NA 1VBNA 1CFZA 5FNVA 4OQMA 4NTZA 3SXUA 1ORIA 2I71A 2BN4A 4B6JA 2WZCA 3FPFA 4TMKA 3UC9A 2QJWA 3NTRA 5DKFA 2WUEA 1M10A 5CVTA 4DHEA 4KXUA 3M4NA 3GM3A 3GG2A 2OXEA 1GAXA 4M98A 1FNSA 3BJZA 4EFNA 1SXQA 5C7YA 3G4ZA 1P7WA 3P45A 3F90A 3OWTA 2YRFA 3L04A 4KN5A 1EINA 4DYVA 1GQRA 5BUSA 4AT1A 5JMTA 1E18A 4OP2A 4YJFA 2C5HA 3KZVA 1I3OA 2KHZA 2C88A 2OY0A 2FWRA 1JDBC 1G9TA 4N5DA 1KZ1A 2MDTA 5A03A 4X93A 4D4GA 4LS3A 1U5BB 3PGA1 5F4ZA 1RJEA 3LE8A 4Y1RA 3L46A 1HEUA 2Z58A 2G1AA 4N65A 3DOOA 4JURI 1F14A 3D8HA 4I50F 3QFHA 5HA5A 2OO3A 2I91A 4FSHA 1LS1A 2H4XA 1QZTA 3UPDA 1ZGAA 1H3EA 2IBFA 2PRJA 4CZ2A 3HBLA 1I2MA 1HPLA 1QP0A 1C3XA 2ACWA 1OX4B 2F17A 1RU3A 3ZIDA 4O0LA 2OEVA 2A68F 2P79A 4RMJA 5JSYA 4CHGA 4F5WA 1E0KA 3AI7A 2C4WA 2HQOA 4HWPA 4ITUA 3NCTA 3WY9A 4RD0A 4RBNA 4W8PA 2FRDA 4ONEA 5DGDA 5AKGA 5CT4A 3L8MA 4XIGS 2QT1A 4CUKA 5HX7A 5IAAA 4RWEA 3PVZA 4YUYA 4KQKA 3GHHA 3ZVNA 2V6BA 1TLFA 3PUZA 3WKAA 5KVSA 4RTNA 5J40A 4JT2A 1DMRA 2W9YA 5TARA 2BI8A 4JJAA 2JAHA 2FH5B 2EZ9A 2FGKA 3VYTB 3IULA 4LTDA 1T3HA 3UUFA 1FFGA 1ISJA 1ZR2A 4WINA 3BD8A 4Y2GA 3EIQA 3C7AA 3FHDA 1T4CB 3CLUD 2Z8ZA 1EGMB 2PSSA 1DOWA 3IEUA 2LIGA 3HKDB 7ABPA 2GEJA 3EVCA 3LUGA 3K0KA 4A6PA 1PNOA 2FF5A 4QUDA 4U2FA 1MRSA 4KMOA 1FPMA 3OQJA 1L5RA 1C29B 1WN0A 4LKRA 1J6UA 4WXHA 3W2WA 1H2RS 1L4BA 2G8LA 3LKDA 2C7BA 1GQQA 3GPCA 3KPYA 1FPQA 3AR9A 1V3VA 1C3OA 2OORA 3PHBE 2R0QC 1CVIA 2FG7C 3FKSD 1MFPA 4I5DA 4KUGA 1LK7A 1UXKA 2P9HA 3OM8A 4I1IA 1IBMB 4JS0A 4JLDA 3FGNA 3C3BA 5EI5A 3VZDA 4ZKEA 1UBGA 3TECE 4D9BA 3UHPA 4ZLDA 5ARCA 2QV7A 2BW0A 5AXAA 4F1KA 4X00A 4JB0A 4GGPA 4DZRA 3B0UX 3NFRA 1CDOA 1EM8B 1ZGJA 2GZMA 3D5TA 4F91B 3WZ2A 3FYUB 4IDGA 4ZA2A 1Z2PX 1WUHS 2ZJZA 1CZNA 3GLQA 2HDNB 2VWPA 1XLTC 5ALFA 1LFDB 1GTSA 1PWYE 3RGWS 2CMGA 1Z4IA 2VDPB 3VR3D 3R0VA 4DLUA 4RTKA 4JLNA 4KN8A 2Q1XA 1Z2EA 1SXHA 2V8OA 3SWWA 4TN5A 3MTEA 2IZZA 3A9SA 1PU2A 3GMIA 1KBQA 3QVVA 3PEUA 4DLWA 1Z6XA 4GPAA 3D7SA 4LF9B 1KI7A 1QWSA 5ALIA 2CXHA 5AQ1A 3ZY6A 2CXPA 4LISA 2PS9A 2QDXA 3W2HA 4R7ZA 4HI0E 1C2TA 1XRRA 1XMOB 1EZ4A 3FIUA 3LFTA 2FJUA 4ZKDA 1H0SA 1IONA 2HMAA 3WP1B 5KEIA 1B26A 4OXKA 5BY2A 4QDZA 1X7WB 1NBOA 3O8RA 2D5BA 2I6UA 2FEKA 4V0ME 1KJ8A 2BFNA 5KI6A 1LK0A 5HUQA 1QYCA 5JE8A 4XM1A 1U5BA 5EQDA 3ZJ4A 3JYYA 1XN4A 4PXYA 4D9GA 4OXNA 2WG1A 3AJ9A 5EMLA 1FA9A 5F2EA 1PNRA 3HO1A 4W5HA 1Z9BA 3O82A 1USIA 2AA3A 4MWGA 4BJ3A 2YLDA 1YYJA 4FS3A 5BUCA 4BJTA 1TZMA 2QGFA 3KXDA 3KAPA 3FHLA 5DFAA 3BH6A 4EP1A 5CUQA 2IDMA 1ADYA 3HB9A 2DLCX 4Q3DA 2R5NA 4DKXA 1COWA 4HNTA 1LLDA 1ZJZA 3ONDA 1G19A 4L75A 5FOVA 2GK4A 4Q1DA 2PFSA 1K7SN 3R7FA 3NLLA 1PKEA 1FUKA 2OWDA 2WTMA 2P61A 4QXRA 4NC3A 1DE0A 5A6BD 4KWIA 4A15A 2ZJOA 1BE8A 5JPCA 4CL8A 5JZOA 2YL7A 1VYIA 1ENYA 1E94E 4R8VA 4C4OA 3NYWA 5JDIA 1T2FA 2WMYA 4MI6A 3SX0A 1TKAA 1N2ZA 4YIHA 4XGKA 3KUUA 1C02A 2B8EA 1HEIA 2ID7A 1T4CA 4CM8B 3EXG1 1ZVKA 4C6HA 1K9VF 3BGDA 1WTAA 3HKDA 4EYOA 3GEIA 1K6JA 2Z2YA 2ZWOA 2DBRA 5A6AA 5SYNA 2WPDD 2Y76A 1U28A 2EYQA 4YRSA 2RGXA 2H1RA 1WETA 1NUQA 1P2SA 3DFKA 1UKBA 1G4AE 2JARA 2VRNA 3L4SO 1FVFA 4M8LA 3GYBA 1HZJA 3WLTA 1BXZA 4H7EA 1TJ4A 2P3SA 5EJ9A 1MO4A 1ZSVA 2NO7A 3U56A 4UHDA 2A59A 4MKGA 2X8AA 2QM0A 3V5XA 3ADDA 3SG0A 3BWEA 4G97A 1PW7A 1NQOA 1EWVA 2O4UX 1NOIA 1ZSYA 2XUQA 2AFIB 4F4JA 3PS9A 4PTLA 4ETIA 2NPIA 1W5AA 1G7TA 2BUCA 2W11A 2WQ6A 1N0WA 1H4TA 3D1VA 1GL3A 4JKYA 1U8UA 2JK0A 4HAWA 1P9NA 1L4GA 1EM8A 3WMGA 4CX9A 5EQJB 5JFOA 1P6UA 3K66A 4XYLA 1NAIA 5DHSA 4ZCQA 2ZUTA 4RZ3A 2G62A 1IUKA 1H85A 5JNUA 2V0NA 1B4DA 1XIVA 3DMRA 2D0OB 2Q3FA 3L6BA 1UMBB 4WY2A 3WDLA 1H1LB 4E5UA 2K7ZA 5KVQA 1DQRA 4RPJA 4X1KB 5IVDA 1JZQA 1PEDA 4PYOA 2PGLA 1CQIB 1XAJA 5DRYA 3UGTA 3BCUA 4ZQFA 2GTHA 1OI4A 3ER8A 3ESBA 1N5DA 2W83A 1U0EA 1VA5A 4WADA 1JR6A 4UMEA 1T6XA 2VC2B 3VKFA 5BP7A 4ZJPA 1WB5A 1OXBB 3W8NA 1X7WA 4Q5SF 5H16A 1Q14A 4ZYUA 4I5IA 4F2GA 2ODQA 4QYMA 3AONB 4EUKB 4G78A 3LUCA 1OWOA 3W3ZB 1T8UA 5AI6A 5CA0F 3WO0A 3DR5A 2WWIA 3NM5A 1DAOA 4N39A 1U4NA 3AUAA 1TT7A 1M75A 4CKXA 1FOEB 3HO8A 4G09A 1B41A 4GZ5A 3EJNA 3HYLA 1EX6A 4G1BA 4BU1A 3KPUA 3OPNA 1OYYA 5J4VA 1IZZA 2IP2A 4X7RA 1UQTA 4Z3DA 5BT9A 3KJEA 3PFFA 3FB1A 1T8WA 1WNTA 5P8WA 1TXGA 3N0RA 1GJRA 1CIVA 4RGBA 2IODA 4E5NA 5EUCA 3M33A 1Z6QA 3IT0A 1O0CA 3EA5A 3HNIA 4K9NA 4MV1A 4A8HA 2OKCA 1ZVMA 2O2JA 5IYZB 4FYWA 2AMYA 1RBMA 1FVXA 3PDWA 1QYRA 2BEKA 3TRFA 4C7KA 1VJ5A 4I46A 5CD9A 3MFYA 5HRCA 4LVNA 3T5DA 4P54A 1A72A 2XKKA 2V4ZA 1Y9AA 2GHIA 2QRLA 1UDAA 3PEYA 4OK5A 1RAFA 1A4XA 4CM8A 4Q4HB 4O3FA 4D26A 4CT5A 4F4DA 1AXRA 1KZ9A 3U13A 2AQIA 3EXG2 3ED5A 4AJIA 2C2GA 2YL2A 3H3XA 5ERGB 1XV5A 1SOAA 3W3AA 4PYNA 4KXVA 1I6LA 4J2HA 4ZCPA 4PQGA 1P8JA 4M37A 1LE2A 4F1JA 2QYOA 4G6ZA 2DAPA 3JD1A 1F3OA 5HIMA 4BPMA 1PTJC 2YN4A 1N9KA 5G4LA 4K9LA 5CITA 4OU5A 4U7FA 1NWCA 3O39A 3QPAA 5AJYA 3ZU6A 3GRRA 2OGTA 1UBSB 2EIJC 3NI2A 3SKXA 4KMMA 4HMOA 2YC2C 4UCQA 3TR6A 5CNIA 2WM3A 1ZH8A 1N8NA 4DR7B 3FUVA 2R6HA 4XTKA 2AFIA 3F46A 1QC5B 4I1RA 3VXKA 2XAAA 5I9LA 3VAAA 4KQFA 3T7AA 3T0IA 3SDSA 2MU1A 1SVUA 1ZNYA 4DDMA 1GG5A 4XB2A 1SQ5A 1R3DA 1I4LD 1G21B 2ZSBA 1IUOA 4DR6B 2GPJA 4X85A 4HNVA 1C8LA 4CG2A 3W7VA 5H3LA 4FLMA 1Z8NA 5GPBA 4KE9A 4FQ5A 5JOQA 5A4FS 3OZDA 2O5VA 4HJXA 3Q5DA 2ZWIA 2YZMA 2Q2VA 4E46A 3FOAA 1NT4A 3K35A 4Q66C 5EHHA 5E3HA 3Q7IA 1H9BA 5J2TF 2IPOA 3SOPA 3BB1A 1W47A 1UMBA 3V34A 5I9BA 4EEZA 3VMFA 1DUVG 4DCOA 2NP7A 3R8XA 5IX8A 2VP9A 4X1KA 4BEMJ 3BB4A 1CQIA 2YWGA 4KNWA 5JS6A 3CUWA 3RRZA 3WNZA 3C4JA 3E1KA 1NASA 1T2NA 2CMDA 5IS2A 5IBCA 4JEUA 3KR2A 5AI9A 3K4PA 2WVNA 1W36C 1ZINA 4ALMA 5TVKA 4FOTA 4DZTA 1TO2E 2B2NA 3IB6A 2FEAA 1N0UA 3UT5B 1BO6A 4QNRA 1G66A 2P9GA 3QU7A 2PUWA 1OXBA 3WTCA 5FUQA 4KO8A 5JJKA 1P3Y1 3N2LA 2CVPA 3AVVA 3K1AB 4WLVA 4L5CA 4BAZA 2ODEA 3M5DA 3EXHC 2VPTA 3PWTA 4FNAA 3SMVA 2VDLB 2KX7A 1KIMA 2D5CA 5GZ3A 3UMYA 5AKHA 1NSFA 1W93A 3KJIA 4K87A 4J9VA 1YJBA 3PE3A 4AJ1A 1HDZA 4B47A 3AJDA 1UBFA 4PG4A 2CD7A 3WNBA 3CW9A 4FB4A 2H0QA 4KYVA 5FUBA 1W19A 3UNGC 3D3KA 3W8FA 5AMXA 2Q45A 3FRHA 4MQ9F 1IHDA 2B0HA 4GQHA 3KKOA 1VDZA 1BHO1 3A6GA 4KI0A 1C3EA 4GOND 3STXA 4AO8A 2YFYA 3FSRA 5LQJA 4HDQB 3GCZA 5ALRA 4MV7A 3D8TA 4LTNA 2FSPA 2Y1LA 1Y9DA 3EZ7A 1MC1A 4YASA 1H93A 1ZL0A 4F6RB 5IYZA 3KLBA 2HUPA 2I3ZA 5KYKA 5A3JA 1KPHA 1L7QA 4FBGA 4XZ3A 3DDUA 4DWVA 4Y2SA 4YXWD 5AHXA 2WU0A 2LP4A 4PBRA 2OHVA 5H81A 2OAP1 3SYTA 1V7CA 5F76A 3PQ3A 4JZYA 2O19A 4Q4HA 2IZ1A 2HHAA 2E37A 5K4AA 3PU6A 4L76A 2WI8A 1TVMA 2CW5A 1MO2A 3AT1A 5A5VA 1II8B 3K0AB 2CNWA 3L34A 1GNTA 1VRVA 2HMTA 1AGXA 4AY2A 3SSAA 3MF4A 2D6FA 2C1XA 1VHJA 1KDYA 821PA 3GJXC 1PHRA 5ADUS 5EKTA 3JT1A 4Y6SA 2DKOA 2AW5A 3RH3A 3PQ4A 1WW8A 2WYIA 2WG2A 3QTBA 4REOA 2FW0A 4XYBA 5B4VA 4LJRA 1R4TA 3QBJA 4PAMA 2BZSA 7YASA 1QC5A 1MAUA 2QAGC 4MJ3A 4OLFA 5TMEA 5HKOA 3ZD8A 2F1HA 3WRXC 1EZ1A 5JI3E 3OMLA 3UWKA 1IBLB 1G21A 3I2GA 4YRIA 2QMEA 5JXGA 1ONOA 1IWPB 2GA9A 1UBLS 5E9AA 4BWGA 3VR6D 3RG8A 3ZDFA 3OFKA 1W36D 2OBLA 2ZT8A 4GGMX 2BGMA 3ZDAA 4KPGA 2A88A 3G5AA 3R5TA 2ADFA 4NV1A 4UC0A 4JLOA 1NYRA 4G25A 4A2NB 4NCJA 4HADA 1OZGA 1ZKDA 4PG8A 1P4HA 1EIZA 4FMDF 3TNJA 4ZANA 4KR7A 1F8YA 1ZM7A 1U63A 1DWPA 1TF7A 1JP7A 3PI6A 4DEXA 3MFNA 1FRFS 3EMBA 1Y3IA 3FSEA 4PYRA 3UT5A 2XZOA 5T7BA 3TUZC 3LBNA 1RPJA 1IN1A 3ROMA 3TBFA 1D2RA 4N3BA 3GJQA 3L8JA 1GEEA 3K1AA 4K6GA 3V4RA 4UVEA 2RGNC 2VLIA 4W8KA 4PR9A 1XTPA 3Q9NA 1MQVA 1BMFD 2J0UB 1Q1EA 3V9PA 3JYHA 5HFAA 3L3BA 3Q8LA 4GPBA 2GEVA 4GZLA 4MW2A 2P9ZA 1GZVA 1UC8A 5CM9C 3T5BA 3HBFA 4HDRB 4MRPA 1QGYA 5BV0A 4RY8A 3HR7A 4KQJA 1OW7A 4HD8A 3ERCA 2B4YA 3K72B 2HR1A 1DV2A 3DGEC 4D46A 5E1MA 3ANNA 5JWOA 4PNPA 4B46A 4XJVA 3QGMA 2Q3EA 4E1VA 3T99A 2VTDA 1UDBA 3EBLA 3HL4A 5DHTA 3VZBA 2NO4A 2PAAA 1OB2A 3ZWAA 3VNVA 4F56A 1AS3A 3M6FA 3Q6NA 2AXEA 4ZDJA 3FX2A 4HV4A 3H5WA 2X8BA 4JUFA 3CO0S 1JBQA 4QG7A 4F6RA 4YNBA 3TEMA 3R7AA 2RGUA 4DIDA 4GMXA 2PZGA 2QE9A 1VMKA 1K86A 2YC4C 3V4FA 1OF1A 4FDTA 4MSUA 2J9VA 2TMDA 2P3LA 4JWTA 4M8KA 5DLQC 1LSOA 1O57A 1TYAE 3L1UA 2OEPA 4BPBA 1G8PA 3NC1C 2VO1A 4N8EA 2E2WA 4QBGB 3MMPA 3H1EA 4C43A 4KO2S 3BH0A 5TB5A 1UJNA 1CUHA 4NDZA 3T6BA 3FWZA 5FHQA 4RTOA 1II8A 1ZRHA 3RBVA 4JVSB 3SIPA 5HK9A 1J90A 4OFXA 4PCVA 3CT6A 4FCTA 2VJPA 1XCOA 2CL5A 5K01A 3EHMA 1U3VA 4BTLA 1I36A 2AJ8A 1FTGA 1BQ3A 3RVLA 3VHQA 1GKIA 1V8OA 2VCAA 1E6UA 4FLFA 4RSGA 4JI3B 1VP3A 4K88A 1U8AA 2NTVA 4YRLA 3AJEA 3LLKA 4Y9RA 4OJMX 1T9KA 4ZARA 2DX7A 2GEBA 1HDIA 2I6XA 1PJQA 1TT5B 3EG9A 5DM4A 3JTMA 1K4MA 1R6VA 5I9MA 2PT6A 2OBXA 3ET5A 4A36A 3A11A 3PPYA 2XUGA 4NOLA 4J75A 1WEHA 3T7IA 4RK7A 1LRLA 2V5UA 3J06A 2Q6VA 2QI9F 1E3LA 1POXA 3OF2A 4YI3A 1OFTA 4IILA 3KSZO 4NENB 1L5SA 4YN0B 4IGGA 1KQ3A 3JQFC 5KHLB 1ZUD1 2PH7A 4ARSA 4JU9A 3U3BA 4F5DA 3IC5A 4AJLA 2R66A 1B15A 1CQWA 2CJYA 4GM4A 3WQHA 4BEBA 1YAHA 2RAUA 3O3MB 3DVSX 5KMGB 4Z9AA 4KB5A 5K4GA 1C30B 5DM2A 2IQIA 4GECA 5HHTA 3PGJA 1ODJA 4QYTA 5DGIA 2BFWA 2HJRA 3UENA 1Q7CA 2ANCA 1AN9A 1IK6A 1R0RE 4OATA 3PA6A 3C3PA 2OHXA 2D59A 5KU1A 2XYPA 2NSFA 2LK4A 3T12A 3VPGA 4ZEVA 3IXMA 3JAWB 1T9GS 5C35A 3ZW7A 1DNPA 3Q9LA 2Q4EA 2W37A 2J0UA 4OYYA 3DYVA 2B7CA 4LQLA 1TU4A 1BJRE 1SFRA 1ZIPA 2X2FA 4ZAVA 3RWMB 4NONA 4QG3A 4GPD1 4AX2A 3T0GA 3NMIA 1PEAA 2Y67A 2AH5A 3BCRA 4XJSA 4BZZA 4H1UA 4HXYA 1SU8A 1PE0A 1Y6DA 4PPQA 2BRUC 2WKSA 3BXEA 2ZANA 3BIFA 3C1TA 4KAAA 2FW7A 4QFBA 4CU2A 3L7OA 1OC2A 4ZIRA 1F8GA 3FVYA 1AM4D 1ISSA 2CV2A 3GGSA 4DDTA 3SYRA 3KTOA 3WIOA 3WMWA 4Y0AA 1QVRA 2BFOA 5EMKA 5M04A 1VPVA 4J6FA 1DBVO 3ZHCA 4OHYA 3SHQA 4L0DA 4JITA 4S35A 2E49A 2GCGA 2HX1A 2W70A 1C4WA 4AJJA 4NOJA 2WYVA 1J8QA 2QRUA 3SQXA 4EG6A 4XPZA 3AK4A 3WLAA 5CLFA 2BGTA 2VPWA 2GGSA 5JT1A 3HO6A 1Y5MA 2HCRA 4DLBA 1JALA 2CNDA 2CLIB 3UJHA 3N86A 3IOYA 1Y3CE 1SHJA 2F9FA 3LF1A 2N42A 2R8BA 4WK0B 3CNNA 2WAMA 4JVSA 2FWAA 5FA6A 4L74A 2VBGA 3JVEA 1ZK2A 5K51A 4OBXA 2QTRA 1GLVA 2DXIA 5J1SB 2NNLD 3E4DA 2YZSA 1V2HE 1FW6A 4D3DA 3GEDA 4LSWA 4H7IA 2CL0X 4JBIA 4MB2A 3HADA 4M76B 4PFQA 3CPHA 1TMOA 2IYTA 4ND3A 2BF7A 4W5WA 4H1HA 4NPHA 1DWOA 4OGLA 2FCAA 3NZEA 3U0BA 1ZEMA 4B35A 1R0YA 2QTHA 2MJLA 4FN5A 1ANKA 5EINA 1G4WR 1IL0A 2P90A 4AMYA 1TT5A 1PJLA 2CVQA 4RABA 4CEHB 5EUBA 1UEIA 1KAHA 1OBHA 5BMOA 2KK1A 3K9WA 1K27A 2WNHA 1T2EA 4CG3A 1OJ7A 1EVEA 1U3WA 2H65A 2UYOA 2EZ8A 5DLPA 1QHFA 2HOQA 1GGJA 3KYIB 3H4VA 4LYDA 4NENA 1ADGA 3NVDA 4XQ1A 2Y77A 4H6PA 4KQ9A 3B48A 3FCSB 4Q4ZF 5HUHA 2YV3A 3OAAD 5FPQA 3CY6A 1AT1A 1DTEA 3S28A 4RKYA 5KMGA 1C30A 3RSSA 3AJAA 2QJRA 5T8KA 1UXHA 1HQDA 1JEEA 1U0GA 4LY6A 5DLDA 2Y3GA 3FSGA 1X7XB 1CDZA 3H9QA 1QRSA 3JVVA 2ZE6A 1LVGA 3VNAA 4QQRA 5LCXA 3EPVA 4BX9A 2Q9UA 5JMPA 1MXFA 1DCTA 2P75A 3JAWA 2E4ZA 2VYQA 1YFJA 2RAPA 3HZOA 3RTCA 3BIOA 3F3KA 2H2IA 1D1PA 1TRKA 1NN1A 2BAGA 3ONVA 3JQ6A 3WLRA 4M7WA 5GPGB 4UEQA 5BXQC 5TQ2B 1S2GA 1V43A 5DTRA 3QPVA 2FOIA 3IAM1 4L28A 4X84A 4YONB 3EEBA 1LGYA 3HJGA 4D6PA 1KQFA 1KHHA 3ZCVA 4MIOA 4ZMSA 4O4HF 1YJQA 2IK8A 5K3DA 1SOMA 5FUVA 5DHQA 2GX6A 4JI6B 2WC1A 4MDEA 4FZVA 1PJAA 1GGFA 2EKPA 1SEPA 1GPDG 4EX6A 1B23P 5FXMA 2ET6A 3E9CA 4UUNA 2VXOA 2L9JA 3T9DA 1QNLA 1P60A 3HCOA 3GGDA 1H0RA 4JVMA 2R9RB 3GR6A 4M1YA 1ACMA 1QG6A 2AV6A 3TZKA 4MQ5A 1QHXA 3RS2A 3PNVA 1C14A 3T1YB 1QIEA 2CLDX 5KX5F 3LC2O 4B79A 4UNNA 2XMDA 3RS8A 2A1TS 1SQ0A 5L0JA 1NBWB 4U7GA 1OGYA 3HY4A 1V8FA 4P22A 5D86A 3L7YA 4Q9DA 4WGFA 4DLAA 4FZ3A 3DMDA 2ZIEA 4LYAA 1S8FA 3Q0EA 4WD3A 5K09A 3AQIA 4WXMA 2O05A 2ZBGA 4O1MA 1L5OA 3KT0A 5H3CA 4YV0A 3U5SA 5KNCH 3HDQA 1H9GA 2DOKA 2VCBA 4BEVA 2DPXA 4GAEA 3K4QA 1WMFA 1EK2A 2ZJFA 1WMDA 1YAJA 3KEFA 4YAEA 2V9ZA 4A9AA 2E7ZA 2J4DA 3JYNA 3TQQA 2CNKA 5ICFA 2Z4TA 3C15C 3A6FA 2J6BA 5CB4F 2INGX 4I3FA 6ADHA 1E64A 1SVMA 1II9A 1BEUB 4YMSA 1KE1A 3A10A 2WZDA 1YQ9A 4JV5B 4CEHA 1HGXA 2PX6A 3WRYC 1J8YF 4DR4B 1C3VA 2ZYAA 5ILQA 1TM1E 2CYBA 4EKIA 2J8ZA 1K97A 1RI1A 1XZMA 1ND6A 3TW0A 1U0HC 2SHKA 4MR8B 4MKXA 3T4PA 5LMZA 2QZJA 3MJRA 4CLDA 4F4FA 3MC1A 5GVRA 3B82A 1UCFA 1NVGA 3KYIA 2JLYA 1JHZA 3H9JA 3ABKC 5JANA 1T9AA 3O6VA 1M2NA 3BL5A 1NP3A 4PSUA 3FR7A 2PYIA 4A2CA 3ZZMA 1KAGA 4AN1A 5BW8A 1MO6A 3AUTA 3UGOA 1FYDA 2FETA 1RBYA 4MVOA 4D42A 1FMLA 2MWQA 2PH3A 3LWDA 3IJ5A 5C8XA 4PAOA 3E9YA 3EHEA 4K6OA 5KZMB 3O8BA 1U11A 2BGGA 2WWFA 2DWUA 3KX2A 1X7XA 1FQOA 4IIGA 4U9EA 4R2IA 3H8JA 3IOMA 3OQIA 1E61A 3P0HA 5EJEA 4HQKA 1R64A 4I1UA 4TKVB 2XVXA 1TAQA 5CFRA 3K1TA 1MMAA 1E2EA 4U0JA 4KV9A 4DB2A 1ST3A 3A9WA 5DQTA 3B20A 1I7LA 2WUWE 3BE6A 3THYB 3T4EA 7AT1A 5TQ2A 2FPIB 4YDSA 2QTFA 3G8CA 2QZ9A 1FDSA 3DL0A 1Y8QB 2NYAA 2XUIA 2XMCA 1HTTA 5F28E 5FPYA 3R20A 3NVKI 4LY9A 4WCFA 2LNDA 4QGGA 3AVPA 1FTNA 5JAMA 5L4SA 3VOTA 3ZIUA 1YAUO 2EFHB 2BTQB 3TDKA 1QGDA 1MVOA 1JS1X 1RJDA 2G5GX 1CUAA 3QW0A 4NG4A 1FRQA 3RYHB 3M1YA 4EHLA 4CEIB 1ZHOA 3EGEA 4QRIA 2QSZA 2RH5A 4TSKA 4X1YB 2HQRA 1Z74A 4CCSA 3WLKX 4TZTA 1AKUA 3W5BA 5JJ5A 2I34A 1D7OA 4YDHB 5IARA 5M34A 4U9IS 2IE8A 2ZJBA 1DKPA 1P5ZB 4MW0A 2GK3A 2DR0A 1IRXA 3W1EA 2VHWA 5IUKC 1C3OB 1NMZA 1WHSB 2J0SA 3TTXA 2ZWAA 1A95A 3RARA 3RC2A 2TRSB 2IY8A 3OOJA 3EHDA 4IINA 1R0LA 1VG0B 3OU6A 4RVCA 5D51S 1AS0A 4WY8A 2PV7A 4P86A 5HIIA 3ZK7A 5FT9A 3DDSA 1E3EA 1JIJA 4QOEA 4QXOA 4P58A 5SYAA 2WJ3A 3TGWA 2WD7B 4E7SA 2RDMA 1RACA 2PUTA 2PXCA 1HYBA 4NCQA 1KFJB 3KHSA 1HE3A 3AF4A 3N2GB 4O1IA 2EJTA 4R9RA 4PQEA 1QXSA 1M7HA 3PCXA 4AKIA 4W7IA 4OA5A 4A91A 1OHHA 3WSTA 3ZWYA 1E86A 3DPUA 4Y2RA 3B1ZA 1VE7A 2XAUA 1GTL1 4F2DA 2O7SA 5FR2A 3QPUA 3SC6A 1JU3A 4PLYA 1QO9A 3ZQYA 4I81A 4MMYB 1CR4A 2CB0A 3HP4A 4LAFA 1QAOA 2FK7A 1YVUA 2I54A 3LA6A 3H18A 1QV9A 1E7MA 4FONA 2YN2A 1E92A 3MYYA 5BR7A 4MVYA 4MR8A 2GPSA 1UKEA 3NIBA 2LRHA 3TL2A 1VKJA 2QUAA 1T13A 5G3ZA 2MIIA 4WBSA 2YZNA 5IEJA 2Q4DA 1HDRA 1ORRA 2CT8A 3KJQA 5LQKA 3ZJVA 1G4UR 2J6CA 1RZRA 4CF3A 3ZZ0A 1X8LA 2B20A 1J21A 2WWGA 1RS0A 4WQMA 1FDVA 1S2LA 4MW5A 4QI2A 5EA2A 4LC0A 4MEBA 2LCHA 2XCQA 1G7SA 1TGYA 2AUTA 2RHJA 4OM8A 3FOFC 4IIFA 1ETUA 4NU5A 3LXMA 3CE6A 2ST1A 5E4JA 4UM8B 2PV0A 1H8ED 4P83A 1JLSA 3ADKA 2EBUA 4TKVA 2ZRPA 3VOSA 2PNJA 4L0CA 2VHEA 4M99A 2FFQA 3VSBA 2P6PA 1TX4B 3I8XA 2HK7A 2XHZA 1WEKA 3CZAA 1U9ZA 3RSLA 2DHDA 2DB3A 1M34B 5ALNA 1TEVA 4IPTA 1YDMA 3THYA 3KFLA 3FFAA 5DB4A 2FPIA 5AWFC 3BXOA 4WPGA 2Z4SA 2XLEA 1M6EX 1PT6A 2IOYA 1Z4QA 5A0VA 1Y8QA 3PQ7A 4YJKA 5DP1A 4XVUA 1I7PA 2PKWA 2Q3CA 4OMCA 5H4HA 2XL8A 2I7TA 1Z0AA 2JAOA 2NO1A 1P1RA 1FX1A 3LNCA 2I65A 3BUSA 1WDLA 3ZXIA 4AU1A 3ZHVA 5AVVA 3SN6A 1GPNA 2R7MA 3WLOA 3Q6MA 5SY9A 2P2LA 2E4YA 3CEXA 2BTQA 1Q2XA 5FTNA 4WN9A 5CFMA 4LRQA 5E0OA 4MW1A 3AOEA 2QG9A 3NBZC 1RHUA 1ZHTA 2PU5A 1NURA 1G38A 3RYHA 2DBQA 4CEIA 4B33A 3CLSD 5K4HA 4JBYA 2MT9A 4W6QA 4X1YA 1ZJYA 1GEGA 1E5LA 4BG0A 1N75A 1JA9A 5AH0A 4FNGA 4HS4A 2NXEA 2V98A 3DG9A 5BWMA 1SIUA 4MW3A 1OLOA 4BO7A 2W22A 2VFAA 1WHSA 2X7HA 2BSXA 4MS4A 1UKVY 2W6JD 4HFJA 3K70D 3E1GA 2WILA 5K8LA 2EEZA 3T1TA 4IFBA 4R1OA 5BNWA 1H4SA 1PYOA 3PX7A 3FGOA 3OOHA 3A4NA 2J5KA 4LYEA 1UZAA 5C5IA 1QP7A 1K3FA 1XTVA 4AN4A 3UJ7A 4AFNA 1QRRA 3ETNA 5A7GA 3DE8A 2R8YA 1NXWA 1BVHA 2WD7A 5HFJA 3S44A 2CHVA 2BMJA 4Z86A 2C04A 4DY4A 3K9NA 4D8TA 3UGJA 3QFRA 4QAQA 5CA1B 2PX4A 1E1NA 3SHWA 3ZK8A 3N2GA 4O4LB 3C63A 1URPA 1SBYA 1YC2A 1EWYA 2QVZX 2C5SA 1JKIA 3AOUA 5F7ZA 2Q8PA 4JEBA 3L8FA 5AW4A 2VDUE 1BDMA 4G86A 1CD5A 3O90A 1US8B 4M8IA 1DADA 5BW4A 5IM4A 2MYTA 3MCVA 1ECFA 4ZDKA 2OKUA 1KAOA 2RHLA 1X13A 3HNKA 4ZYWA 2X9LA 2FMKA 3BDIA 1ULAA 1G2OA 1VYKA 2O3QA 5ICCA 2PMCA 4X3CA 3M49A 3GEMA 2FX2A 2XDWA 1BWQA 4F4UA 2FMHA 3ZDEA 3RQSA 1Q0MA 1X8JA 3UK7A 3LBAA 3RVZA 2GZ2A 2W6CX 4I19A 4QBIA 4PSAA 3KT6A 2TMGA 5JXJA 4YWJA 3DL4A 2O1SA 4OG2A 3W2GA 3VO9A 1XELA 3LS2A 1XNQB 4Y2JA 1MC4A 4ITVA 3WFJA 1SF8A 2MSCB 3DCIA 1GUFA 3GW8A 2H51A 5ALKA 2ZAOA 4DL9A 3N6RA 3K1ZA