2J7PD

Gmppnp-stabilized ng domain complex of the srp gtpases ffh and ftsy
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
282
structure length
265
Chain Sequence
b'IPWGGNLEEVLEELEMALLAADVGLSATEEILQEVRASGRKDLKEAVKEKLVGMLEPKPVEPKGRVVLVVGVNGVGKTTTIAKLGRYYQNLGKKVMFCAGDTFRAAGGTQLSEWGKRLSIPVIQGPEGTDPAALAYDAVQAMKARGYDLLFVDTAGRLHTKHNLMEELKKVKRAIAKADPEEPKEVWLVLDAVTGQNGLEQAKKFHEAVGLTGVIVTKLDGTAKGGVLIPIVRTLKVPIKFVGVGEGPDDLQPFDPEAFVEALLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SIGNAL RECOGNITION PARTICLE PROTEIN
publication title Structure of the Gmppnp-Stabilized Ng Domain Complex of the Srp Gtpases Ffh and Ftsy.
pubmed doi rcsb
source organism Thermus aquaticus
molecule tags Signal recognition
total genus 98
structure length 265
sequence length 282
chains with identical sequence E
ec nomenclature
pdb deposition date 2006-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00448 SRP54 SRP54-type protein, GTPase domain
D PF02881 SRP54_N SRP54-type protein, helical bundle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.140 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2j7pD01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2j7pD02
1CR4A 4P32A 4RFVA 3VR3A 2GJ8A 2J7KA 2ZJ5A 1OHHA 1YR7A 4Q21A 4EDHA 1NLZA 4OHYA 3WRXC 2DCUA 4ZIRB 4TYYA 2GZAA 1R0WA 4LUCA 4LZZA 1G18A 2VHUA 2FGKA 4DLWA 5D3MB 2JLSA 4P33A 1E9AA 2W0MA 3CPEA 2WWFA 3EXAA 3GJ3A 3BH6A 4LBYA 5J40A 3RANA 4FMBB 4UNRA 2FFBA 3I1FA 3CKLA 2ZI5A 3QY0A 1X86B 1YQTA 2ODEA 4JL6A 4TMTA 1ZYUA 1FX0B 5KU1A 1J90A 5G3ZA 1XBTA 4TL9A 4QHTA 1QHXA 4BRUA 2IT1A 2QM8A 3AM1A 3G0HA 4H1VA 2XTZA 1NKTA 5FUVA 1NJFA 4QBIA 4PXAA 5TXGA 3R8CA 1G7SA 4DT1A 4JZKA 2RHMA 1XX6A 2OCPA 3CM0A 1FQKA 1J99A 4MGKR 1C4OA 1UEIA 2GZHA 5J4LA 4OK6A 3RS3A 3UG6A 2KB0A 2AWOA 1CRPA 1XXHA 1E99A 4PQYA 2CNWD 1G4UR 2PCJA 1GTVA 1RZ3A 4MGZR 5AK0A 4F4JA 5KOYA 1R0XA 3EPJA 2CCKA 4PAMA 1R5BA 5BW8A 2REBA 1RRGA 4DDTA 4S2EA 4BQSA 3CIOA 1XTRA 3VFDA 2PX3A 3NXSA 2A5YB 4XSHA 4QNRA 2QMOA 4M4SA 3AUXA 3CWZA 3VTKA 3LBNA 2JLQA 4Q00A 5FPYA 2ZJ8A 4BFZA 2VTKA 3RABA 3Q5DA 5HKKA 2A5JA 2C96A 3P4XA 4M9ZA 2C98A 1Z22A 1ZW6A 2BOVA 3C16C 4PR0A 5HE8A 2OUKA 3U3RA 1G6HA 1SVSA 4OQFA 3GLIA 4KFTA 4TQ9A 2VHCA 3GLFB 2EWVA 1KI3A 2DYKA 3AVWA 2QP9X 4MRRA 1TF2A 4NYMQ 3FFAA 3MCAA 2CHQA 1I4DD 1M2OB 1XZQA 1MO5A 2OFXA 3NC1C 4A8JA 2CCGA 1Z6TA 2QQEA 2WICA 1JEDA 4KODA 3JVVA 1U8YA 1GOTA 1KAOA 3SI7A 4C0SA 4J0QA 1D2MA 4RZXA 3H86A 2ZM5A 1SKYB 3FHCB 1U99A 1P9NA 4P4SA 1AGPA 4TZ0A 1DAKA 1LNZA 2QGZA 4A1FA 4GFDA 4ILEA 2ZSEA 4D82A 1YRAA 2OCAA 1M7HA 3DMDA 3UMFA 5KYKA 4CT4B 4TMVA 1T3SA 3KQKA 2IS6A 4K81B 2D7CA 4MITA 1HE8B 3P27A 3ZS8A 4XSGA 1TMKA 4GT1A 4DLVA 2IYQA 3OEHA 1SVKA 3X1ZA 1DO0A 1P73A 2NPFA 1JXMA 3W90A 1II9A 1HT2E 3K09A 3IIMA 1LFDB 3A4MA 4EJSA 1DAFA 4Q1AA 1JNYA 3Q9LA 3FOZA 1DPFA 1FW6A 4M1OA 5EJEA 1AQUA 5JMTA 4D25A 4ZKDA 2MMCA 2Z43A 3IO3A 3CUEF 2YWFA 1CTQA 3QF4B 4DIDA 2VHQA 2V3CC 3NDBB 4MH0R 5AJWA 3L0OA 4LHWA 3RS2A 4LOAA 3RYTC 1JXOA 5J4KA 4MDFA 4OQMA 4YC7A 2IF0A 2DFTA 4TLEA 5BN3A 2O8EB 2IW3A 4G5SA 3H84A 2D62A 1Z07A 3PV0A 3SQWA 1E0KA 3WP1B 2RGGA 1P61B 4Q1EA 3PUZA 2VIIA 3GMTA 2IUTA 2JCSA 5E3HA 3LNCA 1AN0A 3VR5A 721PA 4CVNA 5LDDC 2JJ1D 3AF4A 2LCFA 4C0HA 1FUKA 3ADKA 2PEYA 1X8KA 5FBLB 5UKDA 4EPTA 3KXKA 3NH6A 3IHLA 2JLZA 2GWHA 4PPNA 4IOMA 5EP3A 2O8CA 3FMFA 1LY1A 4V0NA 2DB3A 4HDQB 4S35A 5KNDA 1FMLA 1E3MA 2N46A 4JJZA 1H8ED 2FN4A 5CK5A 3U60B 3MWYW 3AVYA 3LLUA 4RD2A 1P7CA 2A5GA 3LH5A 2YOFA 4ARZA 5KDDA 4PZZA 3ZJYA 2H8KA 4B2IA 1UBEA 4HZUA 2GAAA 5FBVB 2X77A 3W34A 5BWMA 5L3SB 5HCIA 4PHTA 4K8OA 2HDNB 1E4VA 3D6TB 2F9LA 1MKYA 1LF5A 1KJYA 4JLKA 4URXR 3G5UA 5CDFE 4MKFA 4PO1A 3ETLA 2ODWA 4RFSA 4GZLA 2ZJZA 2WVJA 1KK2A 4WOPA 5JSZA 3AVXA 3QXXA 4RD3A 3W8NA 3PVSA 221PA 2VBCA 2Z5FA 1RIFA 1YJ5A 3OIVA 3DZ8A 3ZVRA 1SXJE 1P9WA 4NONA 1XPOA 3GFPA 2ANBA 4FCTA 2B8TA 3GEHA 4WW0A 5C4MA 1Z0FA 2C9OA 2RGNA 4F4IA 3AKYA 4BEJA 3WNCA 4G5GA 2JEOA 1F5NA 4UKDA 4OI0A 5K8UA 4MRVA 4NH0A 1LF0A 4DEXA 5K8IA 2WSMA 4C0JA 3BD9A 1Z83A 4DLRA 3K0CC 3ND9A 4TMZA 3TQCA 1SKQA 4GRAA 4C30A 2OXCA 3EIQA 1W0KA 1JEEA 2IEZA 2PZFA 1R5OA 4BLSA 5G40A 4MKIA 1Y3AA 1KMHB 3JVUA 3L8YA 4CT5A 2PEZA 1X6VA 3AVQA 2H57A 1FTSA 5DHAA 1PJRA 2RKOA 2WJJA 1OXXK 2OCYC 3WBKA 4B71A 4RCZA 5H1YA 1AJEA 1T9HA 2YNMA 3SNHA 4EAQA 1YRBA 2P6NA 4L15A 1K8RA 1Q44A 1Z29A 1FFHA 4KO8A 2RGXA 1TPZA 2JA1A 3B85A 2NO1A 4QGAA 5FOVA 5GVRA 2I1VB 5JCPA 1KJZA 5L8VA 4P3YA 4QOSA 5E4FA 5HR5A 2P2LA 4GOKA 1XTKA 4TL7A 5FTKA 3UMSA 4PC7A 2QEQA 2JJ2D 3HR8A 1PV4A 4XIGS 2WWWA 3CRVA 1AK2A 4FMDB 3ZZ0A 4DDWA 4LJAA 4TTRA 3TGPA 4HLUA 3DM5A 2FMXA 4YXWA 1Z08A 1JR3D 3NEYA 1A5TA 2V4ZA 5AR1A 1R10A 3KFXA 3Q7QA 4LHXA 4AK9A 2KSQA 4XWKA 2FV8A 1QG2A 1UM8A 1IJEA 1Z0DA 2REOA 4Q4AA 1XD8A 1OT3A 4I99A 1P62B 1N6OA 5L3QA 1ZM9A 3I73A 1NMXA 4BZQA 4HLQB 5IF9A 4LHZA 2CL7X 2D4HA 2IYZA 4LX0A 3EAQA 2IYXA 1BS1A 4R7ZA 1ZIOA 5B57C 2F1JA 4TT3A 1RYFA 2CJWA 2NZ8A 2NIPA 3W6OA 4NYJR 4LJ7A 3TUZC 1ZU5A 1S4QA 2JGNA 1S96A 2JASA 2EWWA 3QKRA 3OE7A 2XB2A 2GF9A 1OIXA 1VCOA 2A30A 3NKVA 4UNQA 4X8MA 4L5BA 1KDTA 2ONJA 2O8DB 3THYB 5EE1A 3TR0A 1Q1QA 2ZIAA 4IW3B 3SFZA 1M34E 3TW4A 5CITA 4KHZA 4PO9A 2FSIA 1P2UA 4CEIB 4ACAA 4LRWA 5JRZA 4DB2A 2JIZD 2V6JA 4KVGA 2GXUA 5G41A 1OFHA 2R6CA 4PZLA 1UJ2A 3WBJA 4MRPA 1XEXB 1JJ7A 1Q20A 2ZSAA 2JLYA 1ZVQA 2W00A 2ZJOA 4TTPA 4RSGA 1SGWA 4B44A 1ETUA 3A58B 3KXIA 2HJVA 3U2QA 5FPKA 3N2EA 1EWQA 2IC5A 2JLRA 3MRSA 3PIRA 2B21A 2REXB 4FMCB 4RZ2A 3LD9A 2R44A 3IBGA 2FSFA 2G88A 2WIAA 5KDOA 1U8AA 2FDCA 2RAPA 1MRNA 1TL7C 2GEUA 3H0KA 3A36A 1KDRA 2VL7A 2OV2A 4JS0A 4L9WA 4YXWD 3OFNA 2ZYWX 4TMKA 2OBNA 4AG6A 1GM5A 4OK3A 3V4FA 3I5XA 2F1HA 5FOSA 1N6PA 3DKPA 4BGDA 2X19A 3LX8A 2IYYA 4IOLA 3PCRB 3OESA 2A3RA 3I5YA 3U7FB 1GKUB 2YWHA 2GBLC 5FTNA 4K46A 2A5DA 3QPVA 2ZYTX 3L0PA 1PUJA 3GLFE 3WYFA 3LLMA 4DWJA 1RRCA 1NVVQ 5FL7D 4HUQB 4O0MA 4DCSA 1ESNA 3QXJA 1KY2A 1TQ6A 2V7QD 3DOFA 3KB2A 5K8LA 4TWZA 3HU3A 5ANRB 2BV3A 3A4LA 1WMSA 1DTSA 4YLGA 5B64A 5SZIA 1E96A 3SJZA 5CK4A 3V9PA 3OIUA 3QUSA 4AI6A 4YMUA 3BGWA 3UPUA 3W6PA 2JLWA 3QPWA 4BLRA 5KSOA 1XPRA 4MUBA 3WXMA 3CRRA 2OSBA 1SKYE 5CJ2A 1GSIA 2EU8A 2GDJA 2OLJA 3A1TA 3TIFA 2J0UB 1US8B 3LVRE 4RD6A 1QDEA 1E1RD 2ZUDA 5CYOA 5P21A 1DO2A 4B6EA 4YDSA 5KUTA 4G5QA 3KL4A 2XOKA 5DI3A 2QPAA 2C04A 5HZHA 3HPRA 1W5SA 4KFUA 3QI2A 2ZE6A 2WWHA 4FCWA 2OEPA 2IYVA 1VYVA 2WOOA 2BJVA 3LXRA 4U5XA 4R2IA 3FYHA 1XU4A 2BEJA 4V0KA 4Q4HB 2WTUA 1QHSA 1ZUHA 2IUUA 3U44B 1NY5A 3CZQA 1Z0JA 4IFBA 1KOFA 3IUYA 3KXLA 5CYPA 3RLFA 3TVDA 2QQ0A 4MGYR 3RS7A 3SS8A 5IHPA 4KSCA 2ZS9A 1OKKA 3B1VA 4LV6A 1GDDA 1P3JA 3CH5A 4TLDA 2NO6A 3IIKA 5FTLA 1NSFA 2ZROA 2DWQA 5J4YA 4L4UA 2PZEA 3QEJA 3NBFA 1R5NA 5TB5A 1E1QD 4M1MA 2N42A 4IKEA 4AWXA 4D4LA 5H8WA 2QPOA 2J7PD 3K9HA 3B1WA 3PJRA 3S1AA 4I1SA 1VCMA 3W9YA 3BFXA 5BYKA 3SDZA 1KI7A 4FMDF 2J0SA 5BXQC 2QGNA 2BMJA 1M1YE 2H5EA 3IQXA 4KFRA 4QHYA 1XCGB 5DISB 4B34A 2OE2A 2OT3B 4CEJB 5EZ6B 2PLFA 4PC1A 4JYBA 1L2TA 2ODBA 3U7HB 2EFHB 5JWHA 4ASUA 4KBFA 1WP9A 3IIJA 2JATA 4TYWA 1J8YF 3GP8A 3FDIA 1Z63A 2GZDA 5LB4A 1K6MA 4LBWA 1DBSA 2FG5A 5JFGA 3ZD7A 1AKEA 2QMEA 3BBPA 4LSGA 3VR2A 4A8JC 4A82A 2QE7D 4DDVA 1EG7A 2PT5A 2JLUA 2QL6A 3LA6A 3OIWA 2J1LA 2N1BA 2E9SA 1XB2A 5KNCA 1N0UA 1UEJA 2VSXA 1Z0KA 2AWNA 3O8BA 3A4NA 5EXXA 3G82C 3ADDA 2QBYA 2VP4A 3EA0A 4Q7MB 1HH4A 2BEKA 1ZM2A 2XNDA 3KQLA 3NEJA 4A2PA 1YR8A 2GK7A 1V5WA 3LWNA 3NBZC 4RKEA 2WWXA 4BFXA 2AK3A 4JVSB 4E09A 1BOFA 2ZRIA 5KSZA 2AHOA 2KJQA 1E9FA 1G17A 2QPTA 3PUVA 1U81A 4NCKA 2FJUA 5FUWA 3RDPA 4W5WA 4A4DA 2CMKA 4NMMA 4V0OA 4CRWB 4Y0VA 1I4LD 1G8HA 4I1VA 2XSZA 3CPJB 1R2QA 3ZQJA 4F38A 2G0NA 2HV8A 2EW1A 3ASZA 2IUSA 2XXAB 3OAAD 4EJSC 1QVAA 1UKZA 3SE0A 3BERA 3BRWD 2EYUA 4G1UC 3CRQA 3C5CA 1AKYA 2ASEA 2RMKA 4GP6A 4KITB 4R9UC 2QAGB 4QGGA 3I61A 2BCGY 1KSHA 1RFLA 1SXJB 1LW7A 1ZD1A 1E2MA 2ZRGA 4FI3C 3THWB 2C8VA 3B7GA 2BBSA 4FMCF 2NO9A 2FGJA 2VHJA 1OH6A 4AKIA 1T4GA 2QRZA 3P26A 1DAMA 3MWJA 5IK2A 2XEXA 3T5DA 1G16A 3R9IA 3BK7A 4HAWA 3A37A 4AG5A 3CR8A 3I32A 1Z2AA 4MRSA 4ZIRA 2D2FA 1XTJA 1ZP6A 3PXGA 1IN7A 3GCGA 1J7KA 5F98A 2QA5A 1W4CA 5G53C 3UANA 1JAHA 3I4LA 4JT2A 3EZ2A 1N5JA 1OFUX 3K9LA 4R98A 4D0LB 2AKYA 1OH8A 3D7MA 2FA9A 4OK5A 5DE3A 2F1RA 3W6NA 1E9CA 3FMIA 4H9GA 2P5SA 2QMHA 2Q3MA 2KWIA 4UNNA 4XJXA 2H92A 2ZVQX 2Q9AA 2CBZA 1QG4A 3FHTA 4C0BA 4RVCA 1G9XA 2QT1A 1MABB 4B76A 1BYUA 1IN8A 1RVDA 3B6EA 1IY1A 3EPHA 1JR3E 3BS4A 3IEVA 1RC8A 1P9RA 2W2TA 3GLGB 2ZXUA 3T61A 2EQBA 2BKUA 1F3OA 2OM2A 1W44A 2VYFA 4H1UA 4B3DA 5KHOC 1ZNYA 2O8BB 1NN0A 1Z2CA 3O8CA 3VX3A 1WXQA 1BYIA 2GNOA 1CXZA 1YKSA 4JJKA 2QT0A 4GOXA 4NCNA 1JI0A 2BJWA 3GJ8A 4A0RA 1KTVA 3OHMA 4XH9B 4P0TA 1IJFA 2ZE5A 3Q8XB 4IJMA 4Q18A 1WRBA 1NRJB 1W46A 2QSZA 2H18A 2FFQA 3CLVA 1G291 4LV8B 5LD2B 3I72A 2C77A 1KO5A 4ON9A 5FUYA 2ZRHA 2IHYA 4Z8XA 1RE0A 4F91B 3QKSB 3U6BA 1A82A 1GNPA 4Q7KA 5CJPA 1HT1E 5JS8A 3BFKA 2RGNC 4PPGA 4WAUA 1UAAA 4CZ2A 4DJTA 4A36A 4ZPXA 1COWA 4Q9IA 1E9BA 5HTKA 1P4SA 3QQ5A 4FCVA 1H8HD 3LVQE 4UNPA 1LTQA 2JDIA 3KQNA 4JL8A 1TADA 2HUPA 3BE4A 2IXFA 4G5OA 3GLHA 4JBYA 2C5LA 1YU9A 4OHVA 5IK2D 3T5GA 1J70A 4CEHA 4XVQA 5CB6A 2HF9A 3AV0B 2ZJYA 4CW7A 5ELXA 4BE7B 2IXGA 1NN5A 5C46F 4CGZA 4JVMA 3A1VA 3QXHA 2VEDA 4UJ5A 1G19A 1XJQA 2R9VA 4UJ3A 5DGXA 4OI2A 3WY9A 3ASYA 2DY1A 3Q85A 1VHTA 1K5DA 3ZGXA 1UBFA 3DO6A 1EFUA 3CX6A 4M2LA 4NYIQ 3SEAA 4JIMA 2GXAA 4LJ6A 2WHXA 3WNBA 4AIIA 1O87A 3JZAA 4RJLA 1G64A 2CLDX 2GKSA 3CF6R 5AJXA 4Q7JB 4HYYA 3PUYA 1NIJA 3HU2A 4HLUC 2BWJA 1P2SA 1N5IA 3QKUA 3J81k 4MYHA 1EX6A 1T0HB 4X8HA 1KGDA 2BC9A 4QKQA 3LDAA 3TQFA 4TSFA 1T6NA 3EW9A 1E0JA 5DNYB 1KKLA 4PFSA 2Q3FA 1L4UA 1IY0A 2CK3A 2WWGA 2YOGA 5EQTA 2VRWA 4IDOA 1G8YA 4OHZA 4IVRA 1WQ1R 2BHRA 4JKYA 1E9SA 2GVZC 2UZ3A 3A1SA 4TL6A 5DYGA 4IEIA 3RC8A 1OHHD 1QRAA 1RW4A 1ZNWA 2F43B 4KXFB 5FUXA 1G5RA 1X1RA 2GRJA 4HAYA 1K5GA 5JI3E 5IRCD 3K8YA 2YHSA 4EUNA 4EPVA 1VCNA 1COWD 2FWRA 3T15A 3FFBA 5H68A 2X2FA 2JAQA 4A0HA 3GFOA 1MO6A 1YZNA 2NO7A 2BDTA 3P32A 3P20A 1KZGB 3FE2A 4D4JA 3UK6A 4B3FX 2GEVA 2ZRFA 4CYMA 2ZR7A 3VMFA 3U4QB 4AY2A 4ESVA 3U3KA 3B2EA 3RNLA 4AD8A 4WZAE 1MH1A 2CVFA 3B1ZA 1AQYA 3R9WA 1OXVA 4Q9JA 1GL7A 4LJ5A 1II0A 1CJTC 5BYJA 1C9KA 1UPTA 1VG8A 1CJVC 2P6RA 2XTMA 4OBEA 3LQRA 4B2LA 4AYWA 2GK6A 2HXYA 2WKQA 3T1OA 4M1KA 4DT1B 3HDTA 4MYTA 3K0AB 4C2UA 1YZGA 4Q1DA 4ZDWA 5KNBA 8OHMA 4KLNA 1NJGA 2FE4A 2CDNA 3GFTA 3KKMA 4D6PA 3AF0A 4OYHA 4Q9LA 4R2HA 4AYTA 1XXHB 3DPUA 1FNMA 1DE0A 2AN9A 4IHQA 2IYSA 2HF8A 2QM7A 1XDBA 2ZPTX 4US2R 1FOEB 5L3SA 3CWQA 2VLIA 2YJTD 2WJYA 3Q72A 4RD4A 2BMDA 1G3IA 5GVSA 1CIPA 2MSDB 1NBME 2BVNA 4Q7LA 1KK1A 3ZDQA 1GFIA 2EVWX 3V00A 1AM4D 1P2TA 5G3YA 4DCTA 1YR9A 3CBQA 4TSFD 2ZETA 1VDZA 4XTRA 4Q4JA 3K53A 4UXHA 2ZITA 3LW7A 2NMVA 3PEVA 5JHHB 4JBWA 1BIFA 3A1UA 5HKKD 1N0VC 2CLSA 4MYCA 3K9NA 3B1YA 5AUQA 4C0LA 2ZSBA 2IYRA 4ITRC 1WF3A 2J59A 2J9RA 2ZQ5A 2EFGA 3M4YA 2QNRA 3ZIAA 3EX7C 2ANCA 2QSYA 3FHOA 3L8ZA 2HEIA 4B75A 3GLIB 1XCMA 5JLJA 3VX4A 2XZOA 3VAAA 3K9GA 1U0HC 2WKRA 1M8PA 1YZTA 3LO5A 1GRRA 1UDXA 2FPLA 2YC4C 4OKSA 4YQFA 4PPQA 5C18A 1E2LA 2CVHA 5F9HA 2QMUA 2Q0HA 4D80A 2PMDA 3MGCA 4C3ZA 2MMGA 3FKQA 1W4RA 5DO9A 4LV5B 4A8JB 2IS4A 2V6IA 3SN6A 4JLNA 1KMHA 2F6RA 4TMWA 5M04A 1G4AE 4N0DA 1DAHA 1OLOA 4IDHA 4DUGA 2DFLA 4B3CA 5BN5A 1Q3TA 3C41J 2ZRKA 1OJLA 2R8RA 2YYZA 1KK0A 2PLRA 4YONB 4A15A 3GJ6A 2GF0A 2O0JA 3BB3A 2FEOA 2EYQA 4DSTA 4HB3A 4Q48A 3VHLB 5KSPA 3X2SA 1KO7A 2KBEA 3K0FA 1N5KA 1GL6A 1N5LA 2J46A 3EWSA 5KDLA 3OEHD 1YZUA 1CRQA 2H17A 4JLJA 4MQBA 1Q0UA 2RGEA 3AP2A 3TUIC 2FX3A 4IDNA 1MV5A 4GOJA 3NH9A 3RVBA 4XWOA 3AP1A 1Q12A 3F0TA 1NLFA 1PUIA 3AVOA 4PSKA 5DN6A 3ZS9A 4FIDA 1N2CE 4QGFA 121PA 3I8SA 1OIWA 2CXXA 3AF1A 3LRPA 2C9YA 5E7JA 2EFEB 1KHTA 2XTNA 3MD0A 2V1UA 3AH8A 1E2JA 1E2PA 1SQ5A 1AZTA 4ZKEA 1LB1B 1HQYE 1I2DA 3JZMA 1UF9A 4XTCS 4RY2A 4D2IA 4HAUA 4D0NA 2J0QA 5JBQA 4PC2A 4PPFA 3OIYA 1DAIA 3BC1A 3QEOA 1GP2A 1W2HA 4TYPA 5FR2A 4DCNA 1NY6A 4PC6A 3U7GA 3RRNA 2IXEA 2V9PA 2AX4A 1FMJA 2WJIA 3AP3A 4KV9A 3ZIAD 4GMXA 1E9RA 3THXB 1U0JA 4IVPA 4HUTA 3R8FA 3SR0A 5CLLA 2B6HA 2J41A 1DVRA 4DXAA 4URWR 4N0EA 3T12A 2KI5A 3VU9A 1EFCA 5F2EA 2ZS7A 1FP7A 5SZHB 4BLPA 4GP7A 3HYTA 3GLGE 4CEIA 4OQLA 3FWYA 2P65A 2C9CA 4DUGD 4EIWA 3IKJA 3LX5A 4ZI3A 2ZREA 3IEUA 1YZQA 3BXZA 5AJZA 3B82A 2OESA 4HZUB 2A5FA 1VYUA 2BKEA 5C2JB 3K70C 4JSTA 2Q6TA 4M9SA 1NLYA 3CW2A 1IY2A 4BASA 2WZQA 3AUYA 4P31A 5EP2A 3KKNA 1M7GA 4NDZA 4A92A 4BLOA 2F1IA 1W47A 5JSZB 1ZC3A 4ZV4A 1G5PA 5F3WB 1RJ9A 1JQJC 3EZ6A 4NU0A 2WJGA 3NWJA 1XTSA 3EASA 3X1XA 3CF2A 1XWIA 1W7AA 1XEWX 5J4HA 1QHHA 3GJ7A 2W6JA 2WIBA 1T8TA 1WGWA 1SVOA 4MA4A 4P4UA 2E1RA 2J45A 3GJ5A 3THOA 2IS2A 2ZAMA 1YZLA 2C99A 1E94E 1B23P 5FOWA 3DM9B 3ZYCA 4B2PA 3A8TA 4L16A 621PA 4DLUA 1TAGA 4V0ME 1W0KD 2ZYUX 3VHXA 4BFTA 3SQXA 4A0FA 4QGHA 5FPTA 1EWRA 1OFTA 3RAPR 4D4MA 1SVIA 2QTFA 3U7EB 1HTWA 1S9HA 2LKDA 1LVGA 1N6LA 4KU4A 3FMOB 5A5GA 4FN5A 4Q9KA 2WJVA 5CM9C 1WDTA 3TJZA 1GUAA 3KKOA 3W5JA 1MO3A 2D06A 1VKJA 2IF2A 4Q03A 2XB4A 2CHGA 2VQSA 5BN4A 1WA5A 3AVUA 1F2UA 2NOAA 3K1JA 2ONKA 1G5TA 4C0QC 4DSOA 1E2DA 4ZCLA 1P6XA 1E2EA 2AR7A 3EARA 4W7SA 1OW3B 2QI9C 1KI6B 4BPBA 1VTKA 1UFQA 2EFDB 4M1SA 4AKEA 1WBBA 3EZ9A 3QF7A 1TQDA 4Q4HA 4MKHA 5FBRB 4Q01A 2O8FA 4LJ9A 521PA 4AKHA 1RKBA 4HEJA 1GG2A 4LYFA 1YE8A 1OH7A 1EFTA 3CNNA 3T1TA 3CH4B 4Q4AB 4GDFA 3KUDA 2PX0A 1LS1A 4JBXA 2C95A 2F55A 1EFRA 1QF9A 5L3QB 4NYMR 3U6KA 1NF3A 1D9XA 2BMFA 1G41A 1AS0A 2PBRA 2ZE7A 4B33A 3KB1A 4MYUA 4PAQA 1OYWA 3SU8A 2HCBA 1CJKC 4TT3D 1Z0AA 4HB2A 2R65A 1KI1A 3N2IA 4DHEA 5A4JA 2CJWB 3Q5EA 3OE7D 1NBMA 3QKRB 1NP6A 3LAWA 1R4AA 4XD7A 2ZRPA 4JT4A 1UBCA 1KSGA 1IHUA 2FH5B 4URYR 4JLAA 4BZXA 1IXSB 5TMPA 1IBRA 4W9MC 1XMSA 2ORWA 4JLPA 1MRSA 3HPQA 4IFEA 2CE2X 2YINC 4M21A 2F7SA 1E4YA 3HJNA 1CU1A 2LKCA 3MJRA 1E2IA 1E69A 2ZRAA 4N1AA 3TSOA 3RRZA 1NMZA 5IT5A 2AFHE 1KI8A 4DLTA 5CIWA 1T3HA 1QHGA 4OQXA 4Q47A 3SHFA 4A6PA 5JRJA 3CONA 2PH1A 4XOIA 1BH2A 1ZD8A 3IPYA 3ONWA 1G3RA 4ABYA 1EX7A 1NSTA 1XXHE 4EQ6A 2QU8A 2Q3HA 4Z54A 2Z4SA 2XZLA 2HLDA 4C4PA 1ZCBA 3LW8A 4WVFA 2Z0MA 2D7DA 3M1IA 4LC1A 4WZ6A 4LGMA 4E5UA 3AF2A 2RHDA 3AKCA 3TRFA 2GILA 2CCJA 4KSBA 1L4YA 1OIVA 3OFND 4RD0A 1N0WA 4ZI2A 1G20E 3CRMA 3WMFA 1UKEA 1NI3A 2CL0X 1DADA 3BH0A 3MJHA 2ERXA 2D3WA 2WSSA 4FW9A 4QFMA 1Q3HA 3WMGA 4B43A 1WE2A 3AGPA 4IXMA 2J87A 3C5HA 2VO1A 2H16A 1KKMA 4LBVA 1NVWQ 2IYUA 2RGCA 2YOHA 4TLCA 1J2JA 4KI0A 3UXMA 3SBEA 5CDFA 2YWEA 1QZXA 4V03A 4JVNA 3SYKA 1XEFA 2ORVA 3NBXX 3GLIE 1JJVA 5EP1A 4EPRA 4QJ3A 1LV7A 3N70A 3AB3A 2QAGA 1Z0IA 4LPKA 2G1JA 3ZD6A 1SXJA 4O2LA 3NDPA 3WYGA 2D74A 5SZKB 4BECA 1VECA 4HATA 2H1LA 1BMFA 3THWA 4AKGA 4DDUA 1D2NA 1P2VA 2GVDC 2NQ2C 3WRYC 2P6UA 3VNUA 2VHTA 4TYQA 4BFUA 3CF0A 2IS1A 1CJMA 2D2EA 1AZSC 3QNUA 4D26A 2P0EA 5JWOA 3EWAA 3MLEA 1ESMA 3T1QA 2XOKD 4TTQA 1E2GA 3SBDA 4U7DA 1I2MA 2KE5A 2VP2A 2QRNA 5CB8A 2XJ4A 1HEIA 4F93B 1SZPA 2DFKB 3D31A 4C7OA 1KAGA 1ZC4A 2GCPA 3MSXA 4PHHA 2G9NA 2DWOA 2ZE8A 5TV2A 3CZPA 1SULA 2BMEA 4WXRA 4PTLA 1A1VA 3RHFA 3ZZTA 1MABA 4IXNA 1DS6A 2R6DA 3PENA 3R7WA 3UWOA 4TN1A 3WHLA 1WB9A 2RGAA 2WPDA 4Z1MA 3B8HA 4DCVA 1XRJA 3O47A 3TE6A 1E9EA 1OKKD 1HURA 3H1TA 4B3GA 1ZUIA 4TMXA 1II8B 1CF4A 2OBLA 3AKEA 4G01B 3MWLA 3DOEA 5F9FA 1SHZA 1XMJA 4QXAA 3AQ4A 1TF5A 2V55B 3SJCA 1HV8A 1F2TA 1G3UA 4LY6A 2VP6A 5AUOB 3DDCA 2Z83A 2V8OA 3KTAB 1CR2A 4PX9A 1DG3A 4PSVA 4DZZA 4TL8A 3R20A 3S1AB 1W49A 3VQTA 1TQ4A 2NTYC 3HU1A 4NL4H 3GPLA 4ERNA 1AS3A 3ZZUA 2JLVA 2YKGA 4LPSA 3N5CA 1GWNA 2G6BA 2AD5A 3R9XA 2CE7A 3D8BA 4ASUD 4PQRA 4QJ4A 1S0UA 3QBTA 3B5JA 3E1SA 5D3MA 5JJIA 2NG1A 5FBWB 1VG0B 3U61B 1BKDR 2AKAB 3MAAC 1OH5A 3UWKA 1Q1BA 5TARA 3PEWA 1GNRA 4QG7A 3PUWA 2X8AA 4JKIA 1ANKA 1FX0A 2IX3A 4PO8A 4OHXA 2PL3A 4I1OA 4PZYA 2RB4A 4KYUA 2I1QA 3QBVA 3W3ZB 2NGRA 4RD1A 1A4RA 2XNDD 2ZRJA 2QBYB 2VSOA 5LBIA 4DVGA 1OE0A 2OILA 3FB4A 3K70D 4NCIA 1VG9B 4RCYA 2IEYA 5DH9A 3BB4A 5GADl 1QHYA 4YMWA 4QHSA 3EPLA 2DWPA 2BCJQ 3IQWA 3FMPB 4G0NA 5EP4A 4A6XA 4FXPA 1TU4A 1X1SA 5JECA 1U98A 2A2ZA 2HXSA 2GAOA 3SZRA 4Q5IA 2QG6A 2XSZD 3T35A 2ECKA 4MRNA 1D5CA 4L8GA 1RPZA 1JBKA 4U00A 2CNWA 2XNSA 3EA5A 2W2VA 1WBDA 1TEXA 3QSYA 5LB2A 2BM0A 4A9AA 5SZJA 2IWRA 2OFWA 2R6FA 1O3YA 1B0UA 1CJUC 1QVRA 4A2WA 2IA5A 1W1WA 1EGAA 5J47A 3BH7A 1TU3A 4M53A 4NKRA 5E7MA 3TKLA 3BAFA 3FKSA 2AL7A 2ZI9A 1OXTA 421PA 4GSYA 4IEEA 1DAEA 2WWIA 2FFAA 4LJYA 1T91A 1R8QA 4RZ3A 5TY0A 3QENA 4BEBA 3C15C 2F43A 2GCOB 1E0SA 2AFIE 1G8GA 3QJYA 1G6OA 1U94A 4Q66C 1YR6A 3GLFA 3NG1A 1PLJA 3EC1A 3W3AA 1XTQA 4MKGA 2ZS8A 4WBSA 4EKDA 1U9IA 3F5FA 2ZUBA 4QBHA 3U3MA 1RYHA 4U02A 3EIEA 3RC3A 3I3SR 2ZEJA 1OXUA 2E87A 2W0SA 3HYRA 4NYJQ 5JHGB 1OSNA 3U4QA 4HSEA 4Q19A 3UG7A 3GJ0A 4DSNA 2G3YA 2X1VA 5FR1A 1XZPA 1HY3A 4UNSA 1E2QA 3C8UA 3HP1A 2YWGA 2TMKA 3GJ4A 4FD2A 4UXJA 3L0IB 4CDGA 5A0FA 1VPLA 2BIFA 3ADCA 1CULC 3TVTA 3TBKA 3K0AA 3NC0C 3NBYC 2ZR0A 2IL1A 5FBQB 1NVVR 2GHIA 4OI4A 4GZMA 3CX7A 1SVMA 1R0YA 1ZM7A 1EXMA 1KK3A 1U2RA 4JLDA 1M6NA 2RGDA 1ZNXA 5JEEA 1JR6A 1XD2B 5CLQA 1W36C 5BQ5A 3B9QA 2OHFA 4D0GA 2GEDA 2WBLC 4V02A 4URVR 3ADBA 3MFYA 2VP5A 2ZI4A 3OEEA 2G83A 4FWTA 3BFVA 3OZXA 2O0HA 3NHBA 3E2IA 5FTMA 1FL9A 2OO7A 3QF4A 3LBHA 2FOLA 1OYYA 3V4RA 4CF7A 4DLSA 3AEZA 4BUJA 2JDID 3T1VA 3FKSD 1IQPA 1VCIA 2ZSDA 3KJEA 3B9PA 4QJ5A 4W5JA 1W0JA 2O8EA 2ZJAA 4US0R 3VR1A 1TUEA 4JYCA 3GLHB 4M9QA 2B92A 4HDCA 1QBKC 1GL9B 4I1UA 1H65A 1ZNZA 3QPUA 1Z6GA 4CEHB 1C1YA 4NP6A 3ZQ6A 4BLQA 1N6NA 1KDPA 2GTPA 1VMAA 4M0LA 2Z4RA 2QUZA 1GKIA 1M74A 3O8RA 1ZD9A 2G77B 3GJXC 2JJ1A 4NE2A 3VR4A 3I8XA 4F4CA 2FPKA 2OZEA 3EZ7A 1N3BA 5DIFA 5DI9A 1XMVA 1XTIA 2FPMA 3UIEA 1HE1C 4UXIA 2K5UA 3DL0A 4Q4LA 4Z8YA 3TH5A 1W48A 4QC2A 4HDOB 1CEEA 1OPXA 5GJWC 2XITA 3QVVA 1H8EA 4JMPA 1Z5ZA 3DMNA 3BORA 4EFLA 3M6AA 1DOAA 2MSCB 3ZVMA 3TMKA 4A0GA 3D3QA 1IN4A 4WZBE 2VP9A 2VF7A 3EIHA 5C4GB 1N6KA 2DFNA 4E03A 2ZSFA 2RGBA 3GQBA 2WV9A 4GL2A 3L43A 3ZVNA 1ODFA 3B1XA 1CLUA 4ESHA 3I92A 5C1BA 3BWDD 4EPWA 3DZDA 3QE0A 2IBMA 1EK0A 3ICEA 3MG9A 4M9XA 2YV5A 1RRFA 4R71A 4US1R 5DHFA 1IN5A 2FSGA 4TLBA 4PSAA 2CK3D 2ZYVX 2R6GA 1KDOA 1GKYA 1BO6A 2R6AA 3TNFA 3C14C 3FTQA 3PITA 5JI2E 2DHRA 3OEED 3IO5A 2F3RA 1G3QA 4IDPA 2WOJA 4XWAA 1NN3A 2PT7A 4HB4A 2G0TA 3NVAA 2ZJBA 3PG5A 2ZRLA 2WWYA 1JPNA 1OXSC 1U90A 3MMPA 3T06B 1ELOA 3IBYA 4BLTA 3CR7A 2A78A 3P1JA 1G8FA 1XP8A 4PHGA 2YZ2A 1GRQA 2IYTA 3WMEA 1W0JD 2YC2C 3MUFA 3EPKA 1F48A 2DPXA 1NNEA 1KIMA 1KMQA 1AGRA 4TLAA 4HI0E 1HQCA 1TTTA 3H2YA 3THXA 1KNXA 1SHKA 2C2HA 1XNJA 4X8OA 3AKDA 2Q21A 2H7VA 5EXPA 1T5LA 4P4SB 1MR3F 1ZU4A 5JEDA 4NCJA 5FOXA 1VIYA 3TAUA 1S2MA 2CEAA 2O5VA 2HT1A 3RWMB 4IOJA 3X1YA 4C9BA 3LY5A 1XMIA 2QTHA 2SHKA 4Q1BA 4DCUA 1Z6YA 2MSEB 5E95A 4Y0AA 4HAZA 3SJAA 1VG1A 5AJVB 1F60A 3QIAA 3PQCA 2DR3A 1NG1A 1FZQA 2OBMA 4AURA 1NG9A 2I3BA 2JJ2A 4Q1FA 3QXSA 4QRHA 2GJ9A 1LS6A 2RH5A 5JJKA 4KVAA 4YMSA 4C2TA 1I4TD 1KSJA 2ZI7A 3TK1A 3CRW1 1T5IA 4EJSB 2P67A 1OB2A 3MWKA 1EESA 4KBGA 3EC2A 1JR3A 1KZ7B 5L3RA 1Z3IX 5J4VA 1XEWY 1GAJA 2WJHA 4D81A 5B30A 1JQLB 4B74A 4QL3A 1XFAA 2ZAOA 4DLYA 1JALA 2OCBA 1ZINA 2ORIA 3LV8A 4XVUA 3TW8B 4IDQA 3RRMA 3DVLA 1OFIA 3P4YA 3QXCA 1X3SA 4W5HA 3X1DA 4Q4JB 4NBSA 2P3SA 5FH9A 1W5TA 1WCV1 4WA7A 1N25A 2NO0A 4B48A 5HZKA 1F6BA 1FP6A 1NIPA 1UKYA 4DSUA 5FL3A 3CX8A 5KO2A 2OAQ1 3L82B 1D8TA 1XF9A 3WNDA 1ZRHA 3RS4A 2F9MA 3L2OB 4HLDA 5KTYA 1KYIA 2QAGC 3KJGA 3EG5A 4HAXA 1SXJC 3ECCA 1Z6XA 4O2RA 1G1MA 1S1CA 3LXXA 2YVUA 2O8DA 3THYA 2HJGA 3KJHA 2R62A 3NHAA 2O8CB 1FNNA 3LQQA 2B8WA 4DBLC 4A2QA 4E22A 3VNVA 1CR1A 2O0KA 1Z8FA 1D9ZA 1JAIA 1DARA 2HT6A 2JIZA 4M8NE 1G21E 1OF1A 3AGQA 2XAUA 2ZU6A 1XEXA 3IPXA 1D2EA 4ARZB 3K0SA 4B47A 2UVQA 4GBMA 1IXRC 1DG1G 4MUAA 4FINA 4JLMA 3AVTA 2GXSA 4C0AC 3K0FB 3UMRA 2IYWA 1W4AA 2ZJ2A 2VP0A 1ZAKA 5TVKA 4EPYA 3B13B 4E07A 1X8JA 2IK8A 4RZUA 4BFWA 4BFYA 1E6CA 4RFSB 2ZVPX 1ZMXA 1YHNA 2ZRMA 1G7RA 1KI6A 3W5IA 4B3XA 1N6RA 1NKSA 1NL3A 1S3SA 3IDQA 1R6BX 5DN6D 4O3MA 4DC9A 4B3BA 5EUQB 3O8DA 3WP0A 4NPHA 1CBUA 4GPTA 2A7QA 4Q9HA 4MDEA 4D4KA 4ZDJA 5HCNA 1CP2A 2FFHA 4LK2A 3PR1A 2VPPA 5JZVA 3AF3A 1OB5A 1VIAA 4JSYA 2BBTA 4DKXA 4N3NA 1DAGA 3TR5A 5LD2C 2F3TA 4HAVA 2WAXA 4M1TA 3QOFA 4HUQA 5FL7A 2PJRA 1PVOA 1XD9A 2W6IA 2FEMA 4PC3A 3DHWC 4DLXA 1E2HA 2V7QA 2Z6VA 2Q9CA 2ZANA 1GNQA 2WM9B 1U8ZA 4UQOA 2CL6X 4JLBA 3RWOA 2Y8EA 4NYIR 1IM2A 5AUNB 4EFMA 3PEYA 2ZTSA 3LBIA 3PEUA 2ZRBA 4NTZA 3SHWA 3KQUA 1AS2A 1UADA 3QVUA 4Q02A 3TUJC 1ZUNB 3VU9B 4WIAA 3KZ1E 1E79A 2VSFA 2NZJA 2J0UA 1US8A 1G7CA 4NHOA 1G7TA 4B32A 4LBZA 5HE9A 1E98A 1GILA 5B58C 4DEYA 1E1RA 2V54A 3FVQA 2GA8A 1CS4C 2OLKA 5B2ZA 5J5CA 1Z28A 3H4MA 1XJ0A 4EPXA 1CR0A 1JPJA 1IN6A 2C03A 1W2GA 3REFA 2L0XA 3WHKA 1YVDA 3Q3JB 4CIDA 1PLLA 4POAA 4L9SA 3U44A 4DB4A 5EXSA 3BIFA 3ND8A 6Q21A 1KNQA 1SVWA 4OL0A 5EE3A 3B78A 1E2NA 4XVRA 5D3QA 3KKQA 4IOKA 2BBWA 3RRYA 1W36D 2GJAA 1FUUA 2I4IA 3KUCA 3LFUA 1W36B 1KY3A 2BBOA 1RJ9B 1KSFX 4PAOA 2JJ8A 5AWFC 2ZRNA 3TAHA 3BOSA 2ZU0C 3BJIC 1NMYA 2W6JD 5FI0B 1E2FA 2BM1A 2DBYA 1QHHB 2GETA 4LYHA 4URUR 5CM8B 4KCGA 3PUXA 4QM6A 3RSOA 1Q1ZA 3GLHE 4BRWA 4KFSA 1E1QA 4DLZA 1Q1EA 4LHYA 1ONBA 1S9DA 1X8LA 3VR6A 5FI1B 1IOZA 1FQJA 4PQFA 2J7PA 1P60A 4BFVA 4JLVA 5DSZA 1HA3A 3CO5A 4G3XA 1UBGA 3SFVA 1AA9A 2IWHA 3VKGA 4LC0A 1MO4A 4CEJA 2OXRA 2W6ID 1GITA 1XCPA 3A6PC 2Q9BA 3TSWA 2QAJA 2ATXA 2HYDA 1TNDA 2VH5R 1A7JA 2ZI6A 1KO1A 4YMVA 2WMOB 4LHVA 4TYNA 1M7BA 1U9IC 4OI1A 2FSHA 2O52A 1KO4A 3SYLA 1OV4A 2NPIA 2QP3A 3SC3A 4GNKA 1E79D 3C7KA 2ERYA 5JJLA 2QE7A 2UZIR 5GJVC 1YZKA 1ZM4A 1F2UB 4LYJA 1R7RA 2ZRDA 3RS0A 4TQUS 4NCHA 4B6FA 1Q57A 4LCBA 4YDHB 3T34A 4RKFA 1AIPA 5EUMA 2XJ9A 2J3EA 4MGIR 1HYQA 4KJZA 1DEKA 3E5HA 3F8TA 2PMKA 4I81A 3AVVA 2W2XA 2IHBA 3VKWA 1KJWA 5AJYA 1QHIA 2AXPA 1KO8A 4ZDIA 2ZRCA 1RRPA 5KSYA 3IHWA 4QNMA 3M0EA 2O8FB 3SJBA 2QROA 4PANA 1GRNA 4HLCA 4KYIB 4I4LA 1SVLA 1Y63A 2LWIA 5L3VA 4KAXA 3CPHA 3U5ZB 1EFRD 1V43A 4P4TA 2XXAA 1II8A 3QG5A 2QENA 1KI4A 1GIAA 1T3LA 4M1YA 4ZCMA 3OAAA 1FTNA 2OAP1 2XX3A 3BB1A 5DLQC 4M22A 5JS7A 1Z06A 2KBFA 2WAYA 4NZYA 1UDWA 3KDSE 4HB0A 5EZ5A 1R0ZA 1UKVY 3FPAA 2HYIC 2XGJA 1NBMD 4JVLA 5H70A 2GJKA 1GZSA 4XD7D 3F3YA 3KTAA 2ZUCA 1FPMA 3K0CA 4O25A 1L7VC 5LPNA 1CKEA 2P5TB 1XPUA 1S8FA 4BFSA 1E9DA 1JB1A 4ZO4A 1ZCAA 2VA8A 3KJIA 2GXQA 5KPJA 3DKVA 4IVQA 5K8TA 4LI0A 5CIQA 2QN6A 1NVUQ 5EE5B 4JL5A 3GD7A 4OQNA 1A2BA 4JLOA 1ZBDA 2EFCB 3U3OA 4AYXA 1XJCA 3IGFA 5DI3B 4TZ6A 2OG2A 3SOPA 3IILA 2AXNA 3ZLJA 2PJZA 5HPYB 4QBFA 2RCNA 1TEVA 4OJKA 3RS5A 1R8SA 4FWIB 1IAQA 5E7IA 2HLDD 4C0KA 4Q1CA 3EZFA 1NN1A 4EQ6B 1DELA 3UKDA 1P5ZB 2UKDA 1Q21A 2J5XA 3TSZA 1KI2A 3CNOA 3GLGA 4KLZA 2VF8A 2QZ4A 3Q7PA 3KKPA 2B7BA 1Q22A 3X1WA 4ZCIA 3A1WA 2O8BA 1P72A 1JECA 3OF5A 4LWZA 2JLXA 5TDHA 2WSSD 3AVPA 1KI9A 1U0LA 2GESA 3CNLA 1NVXQ 1TQ2A 3C4JA 2G1KA 1VYTA 2PZGA 3QG1A 4IRUB 5FOTA 2IYLD 5IDVA 3HR7A 2XZPA 2ODNA 3KFVA 4TQAA 4ACBA 3QKTA 1S3GA 3K09C 2J0VA 5GJBA 3ZVLA 3QKSA 5DYIA 1G3MA 1Z6AA 1Z47A 1L8QA 1EFHA 2W58A 1GVNB 4GI7A 5GJCA 4AC9A 1IXZA 1SXJD 4HZIA 4Z51A 3GEIA 2QTVB 2WMNB 2R2AA 4LDJA 1N6IA 3CB4A 1BMFD 4DRZA 1ZIPA 3I62A 1H8HA 4II7A 4BWYA 1W4BA 1MOZA 4V0LA 3SYNA 1G8PA 2GCNA 3HWSA 3ICQB 2C78A 2CHVA 1E2KA 2X2EA 3REGA 2GCOA 1N6HA 4M1WA 5FPSA 4V0MA 5FOUA 2B7CA 2GJSA 4DIEA 1QHNA 3B60A 2PCLA 1E0AA 2FU5C 2WKPA 4BZPA 3K0EA 2FNAA 3KX2A 3KQHA 2ATVA 1S1MA 3E70C 1ZM3A 1HUQA 4GMDA 1T0JB 5EE0A 1J8MF 2FF7A 4X8LA 1TF7A 821PA 4OJQA 3K70B 3ZH9B 4C7OB 4PHFA 5FTJA 2QP4A 5KPDA 4F92B 1TX4B 1ZJ6A 1T8UA 1PZNA 2AD1A 4OHWA 3UATA 2WPDD 4F7WA 5FPHA 4Z1MD 3R7WB 4QM7A 3WYAA 2QORA 1A2KC 1MT0A 4QBGB 3GEEA 1PLKA 4ZDKA 2QY9A 3VKHA 2W83A 1P75A 3RSLA 2FZ4A 4G5RA 3DEFA 4LJ4A 2AK2A 2FZLA 2CLCX 2ZI3A 4LYAA 4URZR 5AUPB 5FFMA 3L0SA 5JWRA 4EFNA 1D6JA 3U3JA 1IONA 3NIBA 2OFOA 2ZR9A 3NTUA 1F2TB 5JCZA 3W8RA 4LJ8A 2GBLA 5EE9A 5EXTA 3TLXA 2V1XA 4WXPA 4B73A 1XD2A 4B35A 3PFIA 1TUIA 2A9KA 3FGNA 1E32A 1VHLA 2HCJB 4YMTA
chains in the Genus database with same CATH superfamily
1JZQA 1ODKA 4IAOA 4ZIRB 3OTWA 4E7OA 2VHUA 3OICA 3U4CA 5U4QA 5D3MB 1E9AA 2W0MA 1A5BB 2F17A 2TMGA 3PL1A 3K31A 2GH1A 5ALHA 1XTZA 4BNVA 3B1JA 4PTYA 2XTZA 1NJFA 3NAGA 4WKPA 4JVOA 4RW0A 4CF3A 1GTVA 2I78A 4U6SA 1Y81A 4AXBA 4R5MA 5BW8A 5F5NA 4W5NA 3UV7A 2O2DA 1C0KA 2JIMA 1Z16A 3VTKA 2CLKB 2Z04A 3LFHA 2A5JA 1JIIA 1Z22A 3G6WA 3U3RA 2WFAA 4PN3A 3DFUA 3TLYA 5B6IA 3SXPA 2DYKA 2EFJA 1I4DD 3OURA 3NC1C 2RCYA 4PW0A 1SC6A 3QXGA 4PNHA 1H2BA 3DTNA 1D2MA 3FHCB 4XUEA 5K0IA 4JCZA 3QVKA 1FS5A 1LVKA 4JCCA 3N76A 1XAHA 1YA9A 4K9PA 1Z82A 1G63A 3EEOA 1OJ7A 3T4RA 2Y4OA 1M1ZA 4RD9A 1RFGE 3EZIA 5AP9A 2FPRA 2VHQA 4GEHA 2PS1A 1X1TA 1RI4A 4CR8A 4N0PA 2O8EB 3ZHYA 3DONA 3K66A 3DL4A 5IWAB 4OREX 1YB7A 1MEEA 1G38A 3GMTA 4N12A 2IPNA 2JJ1D 2LCFA 2QX6A 5I9NA 4MV3A 3KXKA 3NH6A 4PRYA 5HQ3A 5EP3A 4DOZA 4IOMA 4PPNA 5JCJD 2O14A 1LPBB 5JS1A 5ED4A 4N5HX 2DJIA 3FPHA 3LH5A 1KDVA 1MFZA 5KHLB 3OPYI 4JAVC 1YCFA 4G0OA 3QTBA 3ETLA 4ZYUA 3UAGA 5JSZA 3W8NA 2ODPA 3W5VA 2M32A 3IUPA 3FMVA 1P9WA 3TPFA 1YKGA 1F5NA 4KYVA 3FY4A 4Y2QA 3SIWA 3KZOA 2PZFA 1R5OA 3DYBA 1KVSA 1JX6A 2VNAA 5DHAA 2C4VA 4RCZA 1DEAA 1FFHA 2ZWIA 4KO8A 2GSDA 3PQDA 3TZEA 5KNDD 4JUFA 3UMSA 4ESEA 4R2WA 1PR0A 1AK2A 4BTVA 3EY9A 5JZ9A 1Y9AA 3KYCA 1C7JA 1EFPB 3Q7QA 4Q4DA 1NFQA 2PU7A 1DG9A 3CN7A 2CL7X 1CEXA 3SR4A 3C6BA 1ODLA 4EX7A 3S6JA 1ZIOA 1JDJA 4KG7A 3HXTA 5U9CA 1JHXA 3B12A 3THYB 1Q1QA 3IP6A 3HDVA 3H8WA 1W52X 2Q0SA 2XA2A 1X7YA 3TLEA 3GM2A 2ZJOA 4TTPA 4B44A 4R51A 3DQZA 1KERA 1NQXA 3PC2A 4WMLA 1U8AA 1VFNA 1JU9A 4G4SP 3UUFA 4XW2A 3U09A 5GGXA 1CY0A 1OAAA 3DKRA 3ER6A 2XMQA 2X19A 1LRJA 1UC8A 2Y0DA 4INJA 2YWHA 1LWOA 2YUIA 1GUDA 1YI0A 5HA5A 4J03A 1WY5A 4TRNA 2ZBPA 5ANRB 2FP3A 1N2XA 4HWPA 4N3GA 3QUSA 3BMOA 4YMUA 2JLWA 1XPRA 3WXMA 4MQ9F 3CRRA 4YFVA 2OSBA 3Q11A 5DDIP 5CYOA 1I2CA 4RENA 1PSDA 1AUOA 2NZXA 4J4BA 3TJ6A 1T2NA 1AKQA 1ISJA 1GPLA 4G84A 4NK5A 3CZQA 2II6A 1QRDA 4AWAA 4LGYA 4I1PA 2NU8A 2FUKA 1FJHA 1BX3A 5AW9A 1P1KA 1RJEA 1TUGA 10MHA 3QEJA 3OLWA 3MCVA 1NXXA 3A28A 1BMQA 4IKEA 1O6GA 2BFDB 2Y6UA 2NSJA 3INGA 4I1SA 3WB0A 3JQPA 4X5OA 3ZSUA 4B34A 1MQSA 2OJQA 4PC1A 3W1VA 1L2TA 1ZLYA 3HTKC 1Z35A 5KNCA 4AL1A 3KQLA 2CFOA 5INTA 1YD7A 2ZOSA 2AK3A 5E3CA 2AHOA 4MUHA 2HMSA 1GLNA 3PUVA 4NCKA 2W2LA 3L7BA 2J8WA 3ED5A 1EKXA 4Y2SA 1N4AA 2GZ2A 4F38A 1UKZA 2H54A 5IT9A 2P9JA 1CZNA 2C07A 1D8AA 1DAPA 3RFTA 4JIGA 3MWJA 3HHPA 3BK7A 2C0QA 4FGLA 1EUQA 5IM4F 4D6XA 1J7KA 3UGTA 5G53C 2IKQA 2Q07A 4QXMA 3IEEA 4JB3A 4GHWA 3D3WA 5DE3A 4XJXA 1C3EA 4DLLA 4C0BA 1RPAA 1QK3A 1TJ4A 4MUYA 4X3PA 1JR3E 2ZUEA 4Y9DA 1MMNA 2HJMA 4HEQA 3LOQA 5DLYA 3L7MA 2JZOA 1QJ4A 1WPXA 1KTVA 5FUBA 4DFDA 3KEFA 4CG0A 1BAPA 3T5PA 2XUJA 1MD9A 1P31A 2AZXA 1GNPA 3VNQA 2RGNC 2ZB2A 1ZOOA 2PXAA 4UFNA 1RLOA 4Q6WA 1PBNA 4JL8A 4XVCA 3BE4A 4OIRF 2LE0A 4FOPA 1BH6A 2CC2A 3BM5A 4EYSA 4DIBA 4QUHA 1PR3A 1ZHYA 3PXDA 4NBTA 1F20A 2R7VA 4UHCA 1OZFA 3O8OA 4NK4A 3AR9A 2MSKA 4N18A 4IV5A 2B25A 4ZI5A 1HG0A 4JHXA 4AZ3B 2YFHA 4AIIA 3T94A 2JEZA 1SCUB 2HA0A 2EBUA 5IX8A 3SICE 3TQFA 1XVTA 2X2PA 4P3NA 4LY3A 4PLFA 2ET6A 5CVTA 4PFSA 4PU0A 2WWGA 3ANSA 2Q5FA 3ZQVA 3RVJA 4G37A 1FP1D 4EUNA 4UHBA 4IIJB 3S8EA 2DM6A 4A0HA 4J0EA 3H9BA 2R68A 3IXQA 4AP9A 1IZMA 5LVAA 2YXEA 2G9QA 3R9WA 1XZMA 3N8HA 2XKAA 5LC1A 5CXXA 1PEYA 4NENA 1MLDA 2CWWA 3PKIA 1NJGA 3I2IA 4EKEA 4PWYA 3M9XA 5L3SA 4C0WA 2XMPA 4Q7LA 1LPAB 1GFIA 4RMHA 5G3YA 2CXRA 2L82A 4TSFD 3WGGA 3P0IA 3SKYA 4DNOA 3KD2A 3DNFA 2Q6KA 2C7BA 2EJWA 5C3UA 2VNJA 3UNXA 2PHZA 5HF6A 3KQQA 4HS4A 4NR0A 3DMYA 2BHNA 2XZDA 3AEQA 4HRVA 3T5MA 2WF9A 3MEQA 4C7MA 2UUOA 3AW8A 3SN6A 1T4DA 4JLNA 1G4AE 3RC9A 1FW8A 4ZO7A 2VTVA 4MKRA 2GF0A 2I3DA 4GC9A 1TA9A 1U7TA 3NHRA 4Q48A 2BUCA 4FYIA 2LK4A 2J46A 4ZCSA 3I9MA 2QLTA 4FS3A 1K6XA 2JLCA 3T1HB 4KQHA 2CZCA 2XHEA 4GSKA 1N2CE 3LRPA 1L3CA 2RHRA 1POXA 1AZTA 4ZKEA 1S5PA 2VH1A 3UTCA 3AI3A 4YAWA 1NX9A 4DLKA 1DINA 5JBQA 2ODAA 2WG0A 3U0BA 3D6NB 2CW5A 1G5HA 3K8ZA 3L40A 3PRYA 4BC1A 5I4KA 5FUQA 1WB4A 4URWR 1EKYA 4BLPA 2FWMX 4OIMA 5JZOA 3NUQA 4QVKA 3IKJA 1LBTA 3BXZA 1N77A 5F78A 2Q6VA 2A5FA 5JDIC 1G8AA 2BKEA 4W6QA 5E8RA 5F3WB 4QQ8A 2JAPA 3GJ7A 4KR3A 3AUTA 1KMNA 1LPEA 2E1RA 1M1XB 2C99A 4ZVOA 5KZMB 4LF5B 1SC9A 1NTOA 3JQGB 4EI7A 1VMDA 1X80A 3KZNA 3RAPR 1SUFA 4PX2A 3NOXA 2FR8C 2O48X 2NTEA 5A5GA 4WI1A 4EUEA 1JPUA 1EDDA 2Q2VA 4JFAA 2I65A 2XYQA 2C3OA 4N0QA 2IVFA 3Q9NA 3FKJA 2EFDB 4ENVA 5CURA 1PZXA 3TQHA 2RGWA 4M55A 4YCCA 1YE8A 2YY5A 5EIWA 4JBXA 2X8JA 1CJKC 2V7XA 4E21A 4OQZA 5BPFA 1H05A 3HEBA 4GM1A 3ML1A 3OFJA 3WJ7A 1YQWA 4CS7A 4LEIA 1K1EA 1XRLA 1BEEA 3WYCA 4JLPA 1JSLA 4N5LA 3O93A 3BD6A 1JLRA 2ZYHA 4MTOA 3PGA1 2AFHE 5B3LA 3ITEA 1QHGA 1ADJA 3DOJA 2WQ7A 4BJ5A 2AKEA 2SBTA 4NWIA 4KSBA 4P6IC 2IY9A 1BEUB 4ZI2A 1H6BA 2X9NA 3WMFA 3OO0A 3V48A 1AKVA 2BEUB 3ZKAA 4ZVUA 1CUXA 2NTVA 4F2HA 4LPKA 4RJJA 4A91A 4Q7CA 1VBNA 1H2AS 2GO1A 4DDUA 5KU7A 5L6LB 1A8SA 3QE4A 3DULA 4IJJA 3H0EA 2PKQO 2IS1A 1BOOA 1ESMA 2DKOA 3IR5A 4F2GA 1MZPA 3HKEA 3IMFA 2OZLB 2R6ZA 4IF6A 3HEAA 4UVDA 4PBRA 5ITWA 1M5UA 1QM5A 1VE7A 1HDGO 2R6DA 1FEZA 2WPDA 2EJVA 2Z9CA 2CHEA 4TKUB 4TMXA 3BGVA 5AK5A 3SXYA 3DOEA 3KEMA 3QLUA 2Z83A 2BGLA 1EFVB 3C6ZA 2F1OA 2H2GA 1W49A 3AHFA 4ERNA 5TGDA 4ASUD 5ALOA 3X43A 4DS3A 3EZYA 1NVEA 2NUBA 5EN4A 2YS7A 4QG7A 4LE0A 1P39A 4N5IX 3WGHA 2NGRA 3LBFA 2OGZA 2XNDD 4F4FA 4NCIA 3SHOA 1BMDA 5GADl 3L4JA 1Z26A 4FJ0A 4FXPA 4OOFA 1U3WA 3U80A 4Q5IA 4C03A 4XI9A 2XCLA 1WLYA 4U00A 3PT9A 3AL2A 3EA5A 5HUHA 3KZCA 2CYCA 2B0CA 1SZJG 1B0UA 3BH7A 4M8LA 4GQHA 3A2NA 3BAFA 5KKCA 3KQYA 1EUCA 5DS4A 1E85A 1F06A 2NAFA 3FNEA 5FT9A 4AQ7A 3SZMA 3HYRA 3S2YA 2OC9A 2ZTHA 4IH9A 3T4XA 2Q6IA 2FW1A 2YWGA 4E6PA 1XA3A 1YK1A 1JGTA 4UTRA 3NBYC 4ZZ1A 2CHUA 4OI4A 2XCUA 3JPWA 2DERA 1SUAA 5KWJA 3I0ZA 3G9TA 3Q12A 1W36C 3ABLC 2P9YA 4OBWA 5BV7A 3OZXA 3C3BA 3F8SA 3QVGB 3T1VA 3KJEA 4QJ5A 3ZXUB 1Z34A 4DCOA 1ZOIA 3T9AA 2TSYB 3G59A 4RZIA 3R6WA 1NQOA 1SELA 3BMNA 3ORHA 5DNCA 3LGAA 4ZQIA 3E9QA 3QYAA 4INAA 3H11B 1J0BA 3NV7A 4UXIA 1RWXA 3THSA 4HDOB 2XITA 1X15A 3L18A 3GLVA 4RIHA 3VKFA 3FBGA 5C1BA 3B1XA 1CLUA 3DOCA 1VBKA 3ICEA 3MG9A 2YV5A 1LPOA 2JF0A 2RHOA 4R1SA 1Q0MA 2R6AA 4LRSB 2PKCA 4LQCA 4O08A 4HB4A 5TS3A 5LNK1 1GRQA 2IYTA 3OLVA 4XB6B 2DPXA 1JQAA 5I9LA 3THXA 1GHTA 4L2IB 2KQUA 3S99A 5A5VA 4TOIA 3HK2A 2IPAB 1JH8A 1JHAA 4Y0AA 2XKJE 2XE6A 3EN0A 3RS9A 4B4OA 3LC0A 1LS6A 4C2TA 2Z5VA 3EC2A 4NATA 1FRNA 2HFIA 2O1WA 3V4ZA 1TM5E 4ZTUB 4NBSA 1R4TA 4YRTA 16PKA 1C3XA 5IKXA 4IQFA 5EVJA 5HQTA 3H2HA 4HDAA 1PYDA 5CA1F 1J6UA 4UW9A 3PPYA 4JQZA 3PC4A 1MVNA 3KJHA 1PAUA 3LQQA 3I9V1 1VB5A 4A2QA 1U2GC 4UPEA 3E3LA 5K6AC 3KELA 1OZGA 2POQX 1G21E 4MB6A 5LYJF 1W88A 4P3KA 4D3DA 2JVIA 3AKZA 4MUAA 1SKAA 3JCUQ 4BFYA 3TCNA 4GI2A 3ZGYA 4QREA 1NI4B 4UUMA 4MDEA 3QYJA 2Q2QA 1HYEA 2X0NA 3LKZA 4N3NA 3N24A 3QU9A 4DMCA 3PR3A 4HAVA 4HUQA 3M6FA 2PQ2A 3T3GA 1OTHA 2ZANA 3PEYA 2J08A 4URHA 2HI0A 1XNGA 1E79A 2V5UA 3EXEA 2FZVA 1E98A 1OI3A 3K32A 3JARB 4QO7A 2OLKA 2B94A 1DOWA 5EJIA 3W2HA 2HSEA 2D5IA 1TCUA 1OGIA 3W78A 3HE3A 1WDMA 4MWCA 4CR6A 2VAPA 4B7AA 3IUJA 3TAHA 3ZWCA 1T9BA 4OB6A 5K09A 3R0XA 5IJZA 4WZBA 3B9RA 2GETA 4EO4A 1Q1ZA 3TOMA 2E2WA 4LZNA 1UBNA 3WLRA 1ECJA 1QAQA 2X58A 3VHXB 2Q9BA 1BD4A 2ZI6A 2K7ZA 3IOYA 4MCHA 4KQEA 3NFRA 4MULA 3SYLA 3N1UA 4J6EA 1OFGA 1V1MB 2ERYA 4WECA 1CUDA 3Q10A 1ZGJA 5DF1A 3S84A 5AVKA 2XJ9A 1YC2A 1N7JA 4KJZA 3OU7A 1RWVA 5AJYA 5JQWA 3RD5A 1QGOA 2E4UA 4HZGA 4I4LA 4UBMA 1V43A 2NPUA 1VL5A 4U7PB 3DFMA 4B3IA 1Z06A 1E20A 1ATZA 3KTAA 2W5UA 1SBIA 3BMOB 4YECA 1E9DA 1JB1A 3LF2A 4ZO4A 2EKBA 2GXQA 1WO8A 4JASB 3F5DA 1ZBDA 3SZGA 4C4SA 1NMSA 4DMUB 1M5RA 3VKVA 4Q1CA 1UZLA 2WSYB 4L95C 4TXJA 4Z99A 1M2VA 2BEWB 3W8FA 2O3QA 4TTTS 3D5QA 2HKVA 1DFGA 3OC6A 2AQHA 4LWZA 1RWOA 4AMVA 3OZTA 1KQFA 2JBWA 1LKZA 1PFYA 3E1KA 1S3GA 3K09C 3UUGA 4E7ZA 3A4VA 3H6KA 4H7IA 3W6ZA 1EINA 2I71A 3NIGB 4LDJA 4BVBA 3I4FA 1GNLA 4C4XA 1H23A 3OZBA 1W4BA 2E0IA 3R6GA 1TAHA 4DIEA 1H2YA 2VYVD 1SF8A 4Z3OA 4OQEA 4Z9BA 2R5WA 1Q1GA 3LO8A 4MR7A 4GRDA 1A2KC 3BXGA 3QOYA 4PJNA 4OP2A 4Z3KA 3T6JA 2PL1A 2FZ4A 5F2KA 2MINB 2ZR9A 4H2DA 3NBMA 1Z5UA 3BD8A 3UHAA 5IAKA 3GLRA 5CDTA 4RVDA 5AXBA 3JQ7B 3R9KA 1OHHA 1P4RA 1POWA 2D0OB 1T2VA 4TYYA 3H5AA 2FGKA 2IZ5A 2XBLA 3D3WB 3GODA 4P33A 4HNAB 3HCOA 3GGDA 5CDUA 3RBXA 3D3KA 1JDVA 1ZYUA 1E7YA 1K8XB 2G5GX 2EQ5A 1I3NA 4IIVA 3ZWOA 3IFSA 3QWFA 3CZCA 3CURA 2JVKA 3OBIA 1A4IA 2B5WA 3RS3A 1V8DA 1A98A 2V6GA 4RL4A 5AK0A 3F49S 1LVUA 1FS6A 4PAMA 4P2GA 1RRGA 3ZV3A 5EPUA 5I4IA 2RJOA 5BSKA 3R1IA 1Y7HA 1DIGA 4JI7B 4UCFA 1D1BA 1UXKA 2C98A 3C16C 4IDFA 2OUKA 3KJZA 4MICA 3SOZA 5BV2P 1JQKA 3LSTA 4A8JA 1HKUA 3OCJA 1JEDA 3JVVA 1GOTA 2HV6A 3U62A 1HYGA 5BOSB 2HZ7A 4XX0A 4PEVA 2G63A 1PV1A 2X86A 4A0QA 3RO7A 2OO5C 2FMFA 3KQKA 3TX2A 2JFBA 3E2MA 2NPFA 4U9IS 1RQRA 5GM1A 1RYMA 3L46A 4KVFA 1DAFA 2D1FA 1IIRA 4RA9B 4G4JA 5L0CA 2GM5A 3BJMA 3HCDA 4FGSA 3NDBB 4LHWA 3L8MA 4FXOA 1EU1A 1UAGA 4TLEA 3URMA 2I4RA 4XQ9A 2CN1A 1FSPA 5ITVA 4I55A 4B0OA 1IK4A 1YFLA 3O8LA 1M72A 2IGBA 4EPTA 3TB4A 1XI2A 1YDIA 3MWYW 5B1EA 2H9AA 3BE6A 2YOFA 3OTIA 3P5BA 5L3SB 5EKXA 1JEOA 1EA5A 2HDNB 4DM7A 4EFDA 2ZSKA 3J7TA 4RK7A 5BR1A 4MVJG 4AF8A 3FPLA 1KK2A 5F73A 4RD3A 3GY0A 2X9VA 5FLXA 4X6YA 2VBCA 1EWVA 1VHDA 3L8IA 4TV8A 2JFNA 4ZICA 4H35A 5C8XA 2YZ7A 4XWGA 4L5CA 2O2EA 4XQGA 4ZA2A 1RKCA 3P2OA 2X5NA 2L69A 5ED0A 3RROA 2P9FA 4CT5A 3GJYA 1LM3B 3KQWA 2CDQA 4JV5B 2ZQYA 1KDYA 1VTMP 4CKBA 5H1YA 4MYSA 2LGJA 4L15A 1K8RA 2M4EA 3HA3A 1VPWA 1G2OA 3ZEIA 1YS7A 1SJ9A 3QELA 1I6MA 3VGJA 1WL8A 4MVRA 1G8JA 1KQOA 5TF4A 1FR0A 5IU6A 4ZAXA 2PNOA 1PD1A 2QZSA 1QG2A 3SXUB 1FRQA 1EX9A 2B4QA 5FBHA 2ONZA 4QASA 1ZM9A 4EG0A 3H5RA 4CKYA 5DGCA 3MLBA 2I6GA 1B0PA 3GCXA 2NZ8A 2BC5A 3DBOB 2EWWA 5L7TA 3R5KA 4X8MA 3WQSB 2P90A 4KO2S 2A0BA 4UUBA 4ACAA 1MFPA 1C9EA 4ZHQA 5GIPE 1XEXB 3K2BA 3E6AA 4DA6A 1KPHA 5HF9A 2XRYA 5BV0A 5F2NA 2REXB 2ZXOA 2WIAA 4N6HA 1WV0A 1B41A 4ATNA 3W77A 4ZVNA 3NORA 3T7DA 4IVNA 1M1UA 2AMVA 2WYUA 3HN6A 4BX0A 5DTIA 3DP7A 1YOVB 3VYUB 5T1DB 5DLDA 1I4EB 4FFVA 3UT6A 1V74B 1QV6A 5K8LA 1X80B 2BV3A 5ALQA 2R7QA 3GDHA 2W2NA 1SKYE 4CTJA 3K9FC 3W5HA 5CLJA 5EJ9A 1US8B 2P30A 3SMVA 2B6NA 2C1XA 1M2EA 3BEHA 2CJPA 4MR9A 3PQFA 1NQUA 1ITZA 5F33A 1Z0JA 4LVUA 3AI7A 2GZRA 5IHPA 2YJ3A 1O6CA 1MNQA 4WK0B 3GUUA 2X8JB 1JEYB 5F35A 5FTLA 1SUSA 4LN1A 2A9RA 4QWMA 4OX9B 1LLQA 1FDRA 3B1WA 1UJ4A 2OD7A 1VLSA 3KJQA 2Q1YA 7ADHA 1E2XA 5H0IA 4CKWA 1HTTA 3T95A 4KBFA 7REQB 4TYWA 3HJUA 4LYYA 2ZIXB 3W3AH 3BEDA 2QMEA 4DMFA 3TFOA 4XJVA 1WV1A 2FJUA 4CQMD 2IHNA 1E5DA 5EHXA 1RSZA 2Z1DA 4G09A 4GP6A 1K6IA 3U5SA 3CQ9A 4KBYA 3NYIA 4F97A 1NYQA 4AKIA 5LP1A 1FY2A 3HKKA 1FE8A 4KH1A 4MRSA 2FUG1 8ADHA 5F98A 3ZHRA 3UANA 4JT2A 3AINA 3FN4A 3MBOA 1RBMA 3FHTA 3QEMA 3ZWYA 4XEHA 5F4BA 2VUSA 3CCFA 5KQLA 4ADSG 2O8BB 1BE0A 4WVLA 3CVJA 5A9SB 4L0MA 3EUEA 4HQOA 1IJFA 2YLDA 2QSZA 1W46A 5F5FA 2PGNA 3PWKA 4QOHA 3VOTA 1Y33E 1JKFA 3T0GA 4CSAC 3ERCA 4BNLA 1R6AA 5K0NA 1KBZA 3PIIA 3SS7X 1P4SA 4UNPA 4D45A 4YACA 5KQPA 3AJMA 1B43A 1PNQA 2X0EA 1WZ2A 4HDKB 1NX6A 5LJIA 4D0SA 2QXYA 1K04A 3I6YA 2PZKA 3OD5A 5C46F 3LMKA 4ECEA 1U3TA 4B3HA 4BNUA 3NWPA 1HR0B 4HYYA 3PUYA 3DUWA 1EX6A 4OMUA 5I47A 4CTOA 2LPMA 1LNSA 1KKLA 1ILEA 3MJDA 2Q3FA 4J75A 4Y2TA 4IDOA 2UZ3A 2F9FA 3HDQA 3VR3D 4GO1A 1QRAA 3Q3IA 2C97A 1YA7O 1RMQA 3F3SA 3FOCA 2XNKA 1YBHA 5JNUA 2Q4EA 4HGQA 2A9JA 2X5JO 1VIDA 3AQBA 4DKJA 2CVFA 2FPPA 1UPTA 5I9MA 1RIIA 2JL1A 3GYBA 4K9KA 2PTHA 1TJ3A 3SXJA 3TLMA 3C85A 2WLTA 3DPUA 4HK4A 2ZK7A 2VDWA 4Y98A 2WJYA 3PD0A 3ER8A 4JJGA 2ZFUA 4AROA 4DRXB 5D92A 5HKKD 2PWPA 1R15A 3DUFA 2RC6A 3VSBA 2IYRA 3BWYA 3F6EX 1I4WA 4OHRA 1RR6A 3BMNB 2WKRA 3LO5A 1MA3A 4CKZA 4KQJA 1MBZA 4URFA 1A7KA 4EJ6A 2G8NA 4BTEA 4OLAA 5LBTA 1F5SA 3X2SA 5ECYA 4ZT4A 2KBEA 4C5AA 4EECA 1CRQA 2FZGA 3CNHA 1MV5A 4G2NA 1Q12A 3RU9A 3OCWA 2RHJA 1OLXB 3ZU5A 1OIWA 1JQEA 4OXRA 5B1DA 3RAEC 2V45A 3O4IA 5J5AA 4PC2A 2C82A 4Y6RA 4J91A 3QEOA 1C0LA 1UH5A 3THXB 3K6RA 2OQRA 1JBQA 2PY6A 4BJTA 3R4CA 4PX5A 3NHKA 3K3PA 5LMCA 3A3PA 4QFDA 3JZFA 3HB1A 1XRPA 3HYTA 1XQWA 1AUEA 3LX5A 5EIFA 3IP1A 1L1RA 4MS3B 3VZDA 3MYRA 1UIMA 3K70C 2CCYA 1ULAA 3GRUA 3AUYA 5ADWA 2QDKA 4ZV4A 2EKDA 4MUXA 1XWIA 3MUNA 1T8TA 3NNDA 3D4LA 1E94E 3R5JA 4MJ3A 3NR2A 5HBRA 4KN9S 1VM6A 1M6VA 4M3NA 3ST7A 1MIOB 5FPTA 3A1NA 4JXZA 1TYAE 3IPRA 2QTFA 2BFFA 3A6HA 1T5HX 3DW3X 5CLGA 4BGEA 5DT9A 1O4WA 4LI3X 3OIDA 4ZK6A 1IH8A 3B3GA 1CPQA 3NYJA 1H1TA 3K1JA 3I0MA 1O03A 1Q0DA 4JXKA 3QTHA 4Y1FA 3S55A 1TQDA 1J8DA 2FEAA 1E1MA 2HU5A 4GDFA 5A6JA 2CJYA 1EFRA 1UMCA 3U6KA 5E3IA 5J23A 1D9XA 1AS0A 3I12A 5A4JA 4KR2A 1XKTA 2A86A 1TGYA 1U28A 1NBMA 3LAWA 4DUZB 1DQPA 2ZRPA 4OQ4A 2B83A 3F6YA 3OOJA 1E4YA 5COBA 3A6FA 4DLAA 4N1AA 4GKJB 3L7AA 3U9SA 1MB0A 3BBLA 3IPYA 1A9QA 1V54C 1UPAA 4JEAA 1EB9A 1NZDA 4Z54A 3ZPXA 2Z0MA 2NT4A 4NY1A 2BGGA 2YBDA 1A71A 2HJSA 4Z0PA 4AECA 2O19A 1CDZA 4Q9DA 4WZBB 1X0VA 2FDXA 5AW2A 1J2JA 3T3HA 4N8DA 1V41E 2RK6A 2NUAB 3NTQA 2IYPA 5KJEA 2G1JA 1SXJA 1ZI8A 2H1RA 3RKOF 5SZKB 1F8GA 4D9JA 2PA3A 4AKGA 3GK3A 1M0TA 3VJKA 4G5XA 3VNUA 1CJMA 1X1BA 4D26A 3HQ4O 4G1FA 1CWUA 4IH1A 3B9BA 1ECFA 3QYPA 3DXJF 4NOMA 2DWOA 3UWOA 1WB9A 3EVFA 3I1JA 3IOMA 1M2GA 4D7AA 1CF4A 3AFIA 4HLNA 4RV5A 4JI5B 2FQ1A 4G7OF 1XYGA 4MP6A 4TN5A 2VOEA 3KTAB 1EAMA 3R20A 1TQ4A 3HU1A 4NL4H 4WE3A 4IIHA 1SZDA 3PNBA 2I76A 3N5CA 4R8KA 1L5ZA 5JJIA 2OCDA 1OH5A 5CNJA 4L57A 4FFWA 1E1YA 1GNRA 4W8GA 3EJWA 2IX3A 3IEMA 4PZYA 4KYUA 1G5QA 2QUKA 4RD1A 2CT8A 3V1MA 4DVGA 3HYCA 4QHSA 2PMCA 3GBVA 3VBEA 1AO3A 1TRHA 1HY5A 1VHWA 2ZR8A 1I3OA 4HD8A 2CV1A 1GPUA 4KWIA 4UU1A 1U6JA 3ZJUA 5EJ6A 5AXAA 2L2QA 3M5PA 4IEEA 1XYVA 3BIXA 2AFIE 1G8GA 3RE1A 5BNWA 1YR6A 4PG5A 3A11A 1VKHA 3W3AA 1ZSYA 3NJRA 1PTKA 3T7JA 2F3QA 4Z9AA 2E87A 1T1IA 5KVAA 4DCJA 1F8UA 2WB2A 4RDCA 1E2QA 4DILA 2UXBB 5IP5A 5CD9A 3L0IB 3BWXA 5A0FA 3OCVA 4PGAA 1P4AA 3V80A 4BE9A 1OU0A 2GEDA 2ZI4A 3BFVA 1WXIA 3HP7A 5FTMA 3DVRX 1OYYA 3Q7TA 4BUJA 4HMPA 1ZNZA 3ZQ6A 1MOSA 3NX4A 3HM9A 3I8XA 5DIFA 2ONYA 3MTQA 3E3NA 3PVCA 3UIEA 4Q9NA 1G2QA 1W48A 3I04M 2WUGA 2YVKA 1UAYA 4AJNA 5AI8A 2DRIA 5FNVB 4QUEA 4P83A 2Z6UA 2QM0A 4AJJA 3I92A 3WLQA 7ABPA 1EK0A 3D6JA 4B0PA 1IN5A 3RIPA 3AM5A 3P7MA 1BCSA 3LLKA 1D1QA 3EZHA 2JH8A 5HM6A 3PG5A 3MMPA 1HE3A 4OJTA 1G8FA 3JWGA 2Y27A 3B6ZA 1WXWA 3ZK8A 1K3TA 1F48A 3FUVA 4GOMD 1BS9A 3B1KA 1HDXA 2DBZA 4JH0A 5TS2A 3AKDA 4I2NA 1ZU4A 1N5OX 4L3OA 4MQEA 4DCUA 3SZLA 3P0RA 1PI3A 1NG1A 1FZQA 2XBUA 2QRGA 1MQ8B 5B3IA 3BZBA 1C9MA 3N05A 3SZ3A 4HSGA 5BSHA 1Z45A 2XUGA 3FOAA 4HFJA 2WJHA 1JQLB 3VSAA 1JALA 4UNIA 4IDQA 1MB3A 3CNBA 5B7NA 1W5TA 1Y1KE 2HPHA 3AB8A 4ZXFA 4H0CA 3PRHA 5GZ1A 5KO2A 3WOVA 1DKMA 3P0EA 4X00A 2FXIA 4O2RA 3QP9A 3UHJA 3AERA 3IV9A 2DBQA 4JSRA 2YY6A 5I8WA 4WCFC 1Z8FA 2RH9B 4M8NE 1DARA 5DX1A 4G0WA 2ZU6A 4X60A 1UBRS 1YQDA 4MS1A 3O9VA 3IKMB 2BE9A 3B1FA 4AJIA 1V4AA 3UMRA 4E07A 4E4YA 1NVKA 1KRWA 2F4NA 4MINA 4ZAZA 4L22A 3D5TA 3ESDA 3VJRA 1OQAA 1P9OA 3TVYA 2PVSA 4NC3A 4EARA 5D85A 3AF3A 1KAMA 1HFJA 1KEEA 1W1IA 3EVEA 5IBRA 5BSRA 2VQDA 3EWNA 1D7AA 1NBEA 4CKBB 3T54A 3SNKA 1HE1A 4Q02A 1D1CA 3JSAA 4JYZA 5ALNA 3RVSA 2I87A 4K87A 4YV0A 2NSYA 2OHVA 3ZV5A 1SVWA 3COZA 3CY6A 3R3VA 4TRMA 3MJEA 3HCFA 4LXHA 4AZ0A 2JJ8A 4S05A 4X97A 3JQRA 2H4XA 1QHHB 2XQIA 4ZO9A 3TZQA 4KCGA 2IUYA 4I7EA 1NYLA 3GLHE 4LTMA 4ZTZB 4GX5A 3WZ2A 4U9UA 4DQUA 1A9TA 5ALFA 4MKZA 1TWCA 1NQTA 3TSWA 5LP6C 2VH5R 2X6RA 1A5ZA 1T5TA 1M7BA 3FR7A 4C6RA 3O1IC 4JIOA 4X20B 3TLZA 3FRHA 3QMVA 4LYJA 2AQ8A 4KVZA 4QICA 4RKFA 2J3EA 3IP7A 2ESRA 4BO6A 3VKWA 1KJWA 1R3UA 3C1TA 1EGHA 1Y63A 5AKIA 5CDYA 2QRHA 3LS1A 4QAQA 1GZSA 4G1EB 3QEKA 3MWGA 3ZY2A 4DV0B 3A31A 4EY4A 1YR2A 1XZ8A 1D1TA 4AJ1A 4LTDA 4ZPJA 1PWZA 2NV0A 3HLZA 4H1WA 1NJ6A 3PWZA 5LDGA 5J2TB 4IIYA 4F4HA 3KD3A 4OJKA 4RNCA 3OQ6A 3TSZA 1Q95A 3FYSA 1E66A 1NM5C 5EWLA 3JRXA 4HRAA 3NU1A 4N65A 1KYYA 3RV3A 1V45E 4G0PA 2ODNA 3PGJA 3I9LA 4EUSA 2YWJA 3WGZA 3FFWA 4O4HF 4F9EA 1IXZA 4YJHA 1NPTO 1AKRA 3GEIA 4Q12A 3I62A 1M0WA 2AFVA 2GCNA 3ICQB 1ODSA 3UUEA 5K0FA 5FOUA 4JQYA 4LZLA 3ESZA 3KX2A 3KQHA 1OCEA 1SBNE 4S1VA 2H3HA 2W6QA 4CLDA 2F90A 4FT4A 2Y76A 2ZG6A 1ORSC 1M6WA 2WFLB 2WP8J 4LMAA 3WYAA 4EG4A 1FCJA 4RHEA 2YX1A 2QZJA 2GM9A 4KDRA 1W5BA 1XD2A 4MAFA 3JQEA 1VHLA 4TVSA 4P34A 4R8LA 4B84A 1ADGA 3R3WA 5CGZA 1TMOA 1SMYF 1H69A 2GZAA 2VDNB 4LUCA 4M89A 1OX4A 4IILA 1VA4A 2MSNA 4YQZA 5BSMA 3VU3A 3W79A 1YQTA 4TMTA 1J90A 5EKTA 2FPIA 2FZ5A 3SCZA 3ZY4A 2GI4A 1XBTA 2C2MA 256BA 3A4YA 2QM8A 1T10A 3EEBA 4YRNA 2JIOA 3N07A 4HDSA 5AYVA 3FSJX 2UYYA 1QLJA 5EC8A 2C92A 4PQYA 3KYBA 2QRQA 1MJ5A 3G0DA 2B3TA 2XT0A 4AE4A 3P2IA 1FFXB 1I10A 4XSHA 2O0LA 4J7UA 2ZJ8A 2AF3C 3VDNB 2BSXA 1P2FA 1R6XA 5EIOA 4RLFA 1M2OB 3K72B 2O7VA 4LYDA 5DVZA 1KAOA 1LSSA 1DMSA 3MCUA 4B2YA 4ANJA 2VK8A 4LDRA 1DAKA 2QGZA 4YCNA 3ZW7A 4K81B 2WJ3A 2AW3A 1T9GS 3I8OA 1VLQA 1QZUA 2IYQA 4U2CA 1M76A 3IT3A 2QYTA 3ZD8A 4HYEA 1PRYA 3TLGA 2RSEB 2C84A 5DRYA 3M15A 4NXNB 5JMTA 9GPBA 4DIDA 2IY7A 1ND6A 1GLGA 1OXKB 5EA2A 2OZVA 2IW3A 2W2KB 1R18A 3HHEA 1EWKA 5HEKA 2I6XA 5B1SA 1W2WB 5E3HA 3EB9A 3LNCA 3VR4D 4ARBA 4RZSA 5FP0A 1V6SA 3ORYA 2JLZA 3FMFA 4V0NA 4L4ZA 2WKSA 2WT9A 2ABWA 3G8CA 2J6CA 2OD2A 5KDDA 2X77A 2Y1OA 1NNUA 1VE5A 4XB1A 4AP5A 4DBQA 2BFCA 2Q2OA 3Q2OA 4GD3Q 3UWSA 3CA8A 4F3NA 3OIVA 4QUKA 1FMFA 1U8FO 3SLRA 4NONA 3KOUA 2XKKA 1L6IA 5C4MA 4BEJA 2HRBA 4P1ZA 1VZ3A 3WAQA 3WFJA 4DEXA 2F1KA 4JA0A 4GRAA 4C30A 2AXEA 3DDZX 3WE7A 3FMSA 4QWWA 3EJNA 4E14A 2RKOA 2NXEA 4X6LA 4OQPA 4ER0A 1TPZA 4G23A 4QGAA 1R0CA 4J2HA 1KJZA 1OR8A 3HWWA 3M5CA 2PMWB 3FRIA 4MARA 3IVXA 3SVLA 3GG9A 1DZ3A 2VJCA 1NASA 2OFFA 1A5TA 4AK9A 4H4DA 3O31A 4I99A 4S0ZA 4B8WA 5AKYA 2YUTA 3FTCA 1Y5LA 5B57C 2GN1A 2NIPA 5K3FB 1OUMA 5FI3A 5A5FA 4L5BA 1K2WA 3X2QC 1P2DA 3TW4A 5TF0A 5AVYA 4WCDA 4LRWA 1N8TA 2BFOA 4YCLA 4PZLA 1UJ2A 3OU6A 2JLYA 2I22A 3I58A 4FQ8A 4FKBA 5A4DA 2RI1A 1V8PA 3N2EA 4RMIA 2O07A 1M67A 3HWRA 1T9KA 2ZB4A 5FA8A 4U6NA 4GE0A 1QQ3A 4B09A 1PR4A 5A6SA 3IUSA 2FLKA 3GGPA 3THRA 5AVJA 2IBTA 4OJMX 2GBLC 4MA0A 3WYFA 4OKIA 1KY2A 4XQCA 5CK4A 2QX9A 2XTAA