2J7PD

Gmppnp-stabilized ng domain complex of the srp gtpases ffh and ftsy
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
282
structure length
265
Chain Sequence
IPWGGNLEEVLEELEMALLAADVGLSATEEILQEVRASGRKDLKEAVKEKLVGMLEPKPVEPKGRVVLVVGVNGVGKTTTIAKLGRYYQNLGKKVMFCAGDTFRAAGGTQLSEWGKRLSIPVIQGPEGTDPAALAYDAVQAMKARGYDLLFVDTAGRLHTKHNLMEELKKVKRAIAKADPEEPKEVWLVLDAVTGQNGLEQAKKFHEAVGLTGVIVTKLDGTAKGGVLIPIVRTLKVPIKFVGVGEGPDDLQPFDPEAFVEALLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Gmppnp-Stabilized Ng Domain Complex of the Srp Gtpases Ffh and Ftsy.
pubmed doi rcsb
source organism Thermus aquaticus
molecule tags Signal recognition
molecule keywords SIGNAL RECOGNITION PARTICLE PROTEIN
total genus 98
structure length 265
sequence length 282
chains with identical sequence E
ec nomenclature
pdb deposition date 2006-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00448 SRP54 SRP54-type protein, GTPase domain
D PF02881 SRP54_N SRP54-type protein, helical bundle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.140 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2j7pD01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2j7pD02
1UJ2A 1VG1A 4Y0VA 1V5WA 2N42A 1YQTA 4PR0A 1II9A 5CM8B 1UM8A 2KE5A 2HUPA 5G41A 1I4TD 1HURA 3RHFA 2PJZA 5KNCA 1Z06A 2FFHA 3FTQA 4CT4B 2LKDA 4Q1FA 4B48A 3RS3A 4ARZA 3K0EA 1X8KA 4WW0A 3GJXC 4MYCA 1FX0A 4LYFA 4LSGA 2FX3A 3SYKA 2A5FA 2HV8A 4S2EA 1X8LA 3RLFA 1C4OA 1VCMA 4HUTA 2ASEA 1W0KD 4EPXA 2CCJA 2JIZD 2Z83A 3W3AA 4YMSA 3U4QA 1D2NA 1Z6TA 3LX8A 3IO5A 1OHHD 4N0DA 2MMCA 3E1SA 3EZFA 4OBEA 3X2SA 1GITA 3AGPA 3QPVA 4OQMA 4CYMA 3HJNA 3C41J 1KDRA 2ZI4A 5EE9A 1NF3A 2OCAA 3CONA 3SJCA 4MDFA 2NO0A 2AKYA 2QPTA 3CIOA 3LDAA 1GG2A 1M74A 5KSZA 1BOFA 3QKTA 4TL9A 4DEXA 4EFMA 5C1BA 4YXWA 2O8FA 2G1KA 2JDIA 3B9QA 2A5GA 5KDOA 2PT7A 1Z6GA 4Q7MB 4URYR 5HR5A 2B21A 4PSKA 1FMJA 2VSOA 3T1QA 1EWQA 4BFVA 3B13B 4HAWA 1NJFA 1SQ5A 4I1VA 1VHTA 2DCUA 3KXKA 3K9LA 1FTNA 1OHHA 1ZBDA 3C15C 3CPJB 3D31A 2Q3FA 2F1IA 3VKHA 4TWZA 1R6BX 1TU4A 3IHWA 3QI2A 1GIAA 3TUJC 4A2WA 3R9XA 5DN6A 2WKPA 4WA7A 1S9HA 1CJUC 4QG7A 4BFZA 1G8YA 1MOZA 3R7WA 3NBZC 3NBFA 1IN5A 1JAIA 3IKJA 4URZR 1E4VA 4B73A 1XPRA 2J7PA 2XX3A 2F1RA 2ZRJA 2ZJ8A 2IUUA 3EPJA 1P61B 4BUJA 3OZXA 1XD8A 4LRWA 4GT1A 3MWJA 2Z6VA 3RWMB 3EA5A 2ZS8A 4OI0A 2ZTSA 3UKDA 421PA 4JIMA 1B23P 5JMTA 2ZI9A 1DS6A 3P4XA 1OH8A 5F9FA 2OBMA 5FUVA 2CJWA 4PSVA 4DIEA 3A58B 1PLKA 1SVMA 4RZ2A 4IOLA 4PPGA 2A5YB 1Q1BA 2OV2A 1NSFA 4P31A 5KNBA 5ELXA 1PLJA 1ZM2A 4HEJA 5G40A 1I4DD 2A2ZA 2QAGB 3W9YA 4H1VA 1NKTA 1TQ6A 4PHFA 3SJZA 4A92A 2LKCA 3BE4A 2YJTD 3OF5A 3WY9A 1E2DA 3DEFA 3KQLA 3GJ4A 5DO9A 3WHLA 3U5ZB 2XOKA 3QXXA 2H8KA 1IN4A 2GXSA 5F3WB 1XJQA 1DVRA 1AS0A 1G64A 3NHBA 3O8RA 4GMDA 4CEJB 1KKMA 1W4AA 4B3CA 4KBGA 1N0VC 4C0BA 2ECKA 2VHTA 4C0KA 3I92A 3MAAC 4F93B 3W5IA 3BH0A 3FKSD 4M1SA 4DLZA 1XNJA 1ZD1A 4DSTA 5GJCA 2KWIA 4QBIA 3ZJYA 5E7JA 4BLPA 2QM7A 3L0OA 5B64A 2IYQA 2P5SA 1CR1A 3H86A 3CZQA 5C2JB 4WAUA 1F6BA 2R8RA 3E70C 5FBRB 2ODWA 2WSSA 3CLVA 4P33A 2ZU6A 4AC9A 3JVUA 3AF3A 3EPLA 3IGFA 4RZXA 1HQYE 2RGGA 3B1ZA 2PL3A 3FVQA 4WZ6A 4B75A 1KDOA 3QBVA 4EQ6A 5JLJA 4DSUA 5KO2A 1NN1A 5M04A 1ZW6A 2J41A 3X1ZA 1N6LA 4GSYA 2XB2A 1F60A 4IOJA 4NH0A 3QF7A 3LAWA 5H1YA 4Q4HB 4QGFA 1JPNA 4FMCB 1ZU4A 1H65A 1VG8A 3FHTA 3QKSA 3S1AB 5LDDC 2QA5A 4AKIA 2OSBA 3FE2A 1OXSC 3DZ8A 1KMHB 4OQFA 5BWMA 4Z8YA 2XSZA 5DSZA 4DEYA 4IJMA 1QRAA 2ZRAA 1NP6A 2PMDA 4AG6A 4GBMA 1NJGA 4A0FA 2IF2A 2IC5A 2GWHA 1DAKA 3AKYA 3WYAA 1ZU5A 2B92A 5G3ZA 1SVWA 3OAAD 2XB4A 4FN5A 2HT6A 2B6HA 3BJIC 1KSJA 3TBKA 1G6OA 1N0UA 2RGNC 3QENA 3T12A 1MR3F 2IHBA 3HPRA 2AHOA 1SZPA 1KKLA 4OKSA 3QPUA 1CLUA 1TQ4A 2J0SA 3A1TA 1GZSA 1IXRC 2BKEA 1Z0DA 3C8UA 4BFTA 1E9RA 3DPUA 4Q4HA 1PUIA 1GTVA 1R0YA 1S0UA 2P67A 2ZVPX 3HYRA 1X8JA 3RRZA 5KSPA 1Z63A 3KKNA 2ZPTX 3VNVA 4FXPA 2IHYA 2ODNA 1N6OA 1XJ0A 1JAHA 1VMAA 1XP8A 3L8ZA 4MKHA 1E2EA 3PUYA 4P4UA 2VP6A 1OFHA 2VP0A 2RGNA 2ZRBA 4L8GA 3MCAA 1CJKC 2QTFA 4B43A 3BXZA 3UWKA 4DXAA 3SJAA 1KY3A 4JYCA 2CEAA 4QBHA 3GLFA 1ZNZA 4ZDWA 3ASZA 4UNPA 1MO6A 4Q19A 4KJZA 2W6IA 3K0FB 5HZKA 2J0VA 2WWIA 4Q5IA 4ARZB 3B78A 4GOXA 1ETUA 2N1BA 4DLRA 1FMLA 2CL6X 1G4UR 2GEDA 3NHAA 4OHWA 3SU8A 4B3BA 1EX6A 4Q4AA 3ZVMA 4KFRA 3O8DA 1M2OB 4ASUA 2BEKA 2O8DA 4QJ4A 4M9SA 1WBBA 4LJYA 1S1MA 3QXHA 4DCTA 1XD2B 4XJXA 4E07A 3K1JA 1BS1A 3LY5A 3K0SA 2X2FA 5CIWA 2Q6TA 3HPQA 3VQTA 4BFXA 2DFNA 5L3VA 3ETLA 3AVOA 3QQ5A 3D6TB 2G6BA 4IFEA 2I1QA 4LYJA 2HF9A 1XEWX 2WMNB 2BDTA 1JI0A 5DI3B 2D06A 2V1XA 3QKRB 3QBTA 2WZQA 3K70B 2C8VA 4TTRA 2C77A 2V3CC 3A8TA 1ODFA 5L8VA 3LA6A 3GJ7A 3HR7A 3VR3A 4RVCA 1Z3IX 2FNAA 2Q9BA 1IN8A 2VF7A 4TN1A 4QKQA 1X6VA 4Q4AB 3AUYA 4P4TA 1KO8A 2HDNB 4M0LA 2Z5FA 1T3LA 2YWGA 3K9GA 3ZS8A 4BZXA 3KDSE 1OH7A 2W2TA 4IVQA 1FZQA 1GL6A 3MD0A 5AUQA 4JL6A 4MH0R 1Z08A 1COWD 1TQDA 1U8ZA 4LHWA 4RFSB 4UXIA 3R7WB 2WWHA 1DELA 1S8FA 4UJ5A 5TXGA 2NO1A 3K0AB 3UPUA 2VP5A 1R4AA 3KKPA 1BYIA 1SVKA 1JR3D 3T35A 4BLSA 1ZINA 4G5SA 4ZCIA 3P20A 4D25A 3K9HA 1F3OA 2EFHB 2IK8A 2ZREA 1WP9A 3T5GA 4L15A 3RS5A 1FUKA 1XBTA 3I8SA 1G8FA 1JPJA 1BMFD 2EWVA 1OIVA 1P73A 5FTJA 4XVQA 1FNNA 5L3SB 2JASA 2F7SA 2PZEA 2SHKA 4M8NE 2RGEA 3A4NA 2REOA 3TH5A 2IUTA 4TTQA 1VYUA 3GD7A 5EP1A 1T3SA 1Q3TA 4DC9A 2IYVA 1II8B 2FSFA 5CJ2A 2KBEA 1AS3A 2YZ2A 1OH5A 3B60A 1G1MA 4M9QA 1ZUNB 4EPYA 3F5FA 3QNUA 4CRWB 3CZPA 3I72A 2DHRA 2Z43A 3FHCB 3ZD6A 4Q03A 2FGJA 4TQUS 3WMGA 2BOVA 5KUTA 4C0QC 1LS1A 1W49A 1G17A 3A1VA 5A4JA 3RYTC 1KI9A 1VHLA 2H7VA 4LUCA 4PFSA 1ZM7A 3QXJA 1L7VC 2XNSA 2NO7A 2DY1A 4L5BA 3OE7A 4TLBA 1YU9A 3CX8A 3KXIA 4NCNA 2BJVA 4ITRC 3FYHA 3U6KA 4Y0AA 2ORWA 1F2TB 1N5LA 3CF0A 4GP7A 4IDHA 3CNNA 2OCYC 3GJ6A 2NMVA 5J4LA 3SN6A 1ZC3A 3NBXX 5H68A 5P21A 1ZCAA 4DLWA 5JHGB 4HATA 2ATVA 2I1VB 4Q1AA 5AJWA 1ZCBA 3QXCA 4YDHB 2OFWA 4ZCMA 1Z6AA 2PLRA 1KI2A 4MYTA 2YOFA 1MH1A 4P4SB 1K6MA 3SHWA 3OIUA 1E9DA 2QUZA 1Z2CA 2J0UA 2UKDA 3L2OB 4HLUA 2GEUA 3N2IA 1KDPA 5J4VA 1R8QA 2WJHA 3O47A 2ZAMA 2IS1A 1CBUA 4MKGA 2FFAA 3QJYA 4MGZR 5DLQC 1KMQA 2OAQ1 3TAUA 4D2IA 1GNQA 5IHPA 3WHKA 3ZDQA 5FOWA 5C18A 3G0HA 3DO6A 3E5HA 1JECA 1HTWA 1AM4D 4DLTA 4LYHA 2BMJA 2REXB 4CGZA 4QJ5A 2QG6A 4MITA 2OILA 1E2NA 2JLVA 1G7RA 4AG5A 5JJKA 2YWHA 3QG5A 1Z8FA 2D2FA 4HLCA 4MRSA 3I62A 2WPDA 1E1QA 2NQ2C 2YKGA 2PJRA 3SJBA 3K0CA 2WWXA 3B2EA 3TW4A 2ZROA 2IYTA 3EIQA 4FCVA 3JZAA 1Z29A 2OE2A 4A8JB 5C46F 1ZM3A 2QU8A 2R65A 4TMTA 3QF4A 3WXMA 2OESA 4GP6A 1Q1EA 2XSZD 5FFMA 5A0FA 3SHFA 2MSCB 1N0WA 3MMPA 2EW1A 1E0KA 1ZYUA 3B8HA 2ZRKA 4JLMA 3V4RA 2RCNA 2GTPA 5HZHA 4AI6A 1GRNA 3GLHB 1KO7A 3MWLA 2ZSDA 4URUR 2QTHA 5JSZA 1GVNB 3BGWA 3GLGB 5EXSA 1KAOA 1WDTA 3PR1A 4OK6A 1U9IC 4QC2A 2EYQA 3TUIC 5AUNB 2OBLA 3IQWA 3QKUA 3SC3A 1JJ7A 4JVMA 3GP8A 4I4LA 1W36C 3EZ6A 3KTAA 1U99A 1Q3HA 3THXA 4TL6A 1RPZA 1T8TA 2WMOB 3CF2A 4NCIA 2GETA 2C5LA 1R7RA 1UEIA 1WA5A 2XXAA 3B5JA 3BFVA 1XD9A 4FD2A 4JLAA 4L9SA 4FCWA 2QY9A 2JLQA 1E2KA 4ACAA 3EX7C 2HLDD 4LHVA 1NG1A 4PHHA 2CL7X 1D2MA 4UXHA 2BJWA 621PA 1LS6A 2YWEA 1UKZA 1KDTA 2BWJA 3AH8A 3KUCA 5JSZB 1CR0A 1JALA 4F92B 4TQ9A 3OEEA 4HLDA 5AR1A 1BYUA 5FOSA 3PXGA 1E2GA 1Y3AA 3NTUA 1IJFA 4G01B 1FFHA 4IHQA 1OE0A 1P6XA 2GJ9A 4HAVA 1JXOA 1S4QA 5EXPA 1G3IA 1P4SA 1W2HA 1TL7C 2WWFA 4D0GA 4W5HA 4IRUB 4KFSA 4QHTA 4V0NA 4A8JA 4BFUA 2R9VA 5FOVA 4Q1CA 1UAAA 1YR7A 5DH9A 2FFBA 3PEWA 3VU9B 5JRJA 2Y8EA 5FR2A 2ZRHA 4QM6A 4EJSA 1CRPA 4ZKDA 5CIQA 5GJWC 4KLNA 1NIJA 1D9ZA 3QEOA 1J2JA 4WZBE 5FTNA 2CVFA 3WBKA 3C4JA 1MO4A 1NN5A 1OB5A 3HR8A 4M22A 4PPNA 1W36B 3DOFA 1EG7A 3VR2A 5A5GA 3TVTA 4GOJA 1N6PA 1RFLA 1TEXA 4HLUC 1UBGA 3VR1A 1A1VA 3ZZ0A 2C03A 1N6HA 2GCOB 4MKFA 2A78A 3LBIA 5EZ5A 5FPKA 4IVRA 1G4AE 4Q9JA 1KIMA 2CDNA 1GDDA 1CTQA 4U00A 3ND9A 1HT2E 1Q12A 4FWTA 4PQRA 3U3JA 1OFUX 3ONWA 1GL9B 1DTSA 2DBYA 3ZQ6A 4XWAA 5FPHA 121PA 1P5ZB 1RW4A 2FFQA 1ONBA 1FNMA 2JJ1D 1F5NA 3P26A 1IN6A 4PPQA 1SKYB 4TL8A 4K81B 4MRVA 2YC2C 1T4GA 3AVUA 3IPXA 2B7BA 4US0R 1U8YA 2EFDB 1XDBA 4QRHA 2AWOA 1EXMA 1FUUA 3FWYA 4TLCA 3IIKA 2WSSD 4EFLA 2UZIR 2AL7A 3LWNA 4ZKEA 1CEEA 1E98A 1E2LA 1UF9A 2P5TB 2XITA 4M1MA 2BMFA 2H5EA 1R0XA 2XNDD 4MYHA 2WIBA 4HB4A 4AURA 3R9WA 2BIFA 4Z1MA 4CZ2A 2P65A 1KJZA 1Z0JA 3TSWA 4E5UA 1G7CA 4B3DA 3U44A 2RHDA 2G83A 3BH7A 5FPTA 3T5DA 1OXUA 2E87A 3O8BA 4DT1A 2ZJ5A 4F38A 1KI3A 2GVDC 3EA0A 2IWRA 5J47A 4GPTA 5GADl 1VKJA 4R71A 4CEIB 5L3QB 3QKSB 3Q8XB 4PO8A 2J46A 4Q9LA 3AQ4A 2J7KA 4CEIA 2PH1A 1IY0A 1N5KA 3UATA 1P60A 3EARA 1SVLA 1XTSA 2GVZC 2GXAA 3CF6R 1X86B 4LPSA 3EW9A 3GJ8A 4RY2A 5SZKB 1UBFA 3OAAA 1E2JA 2FJUA 2RGCA 1O87A 5FL3A 2EQBA 2QP3A 2WV9A 2FGKA 1TEVA 1US8B 2W83A 3H84A 4FWIB 1HYQA 3DKVA 5E7IA 4A6XA 4G5RA 3RWOA 4B33A 5F9HA 2FSIA 1DG3A 2WJIA 3A4LA 2WKQA 1UDWA 2KI5A 4QM7A 2IS2A 4ZV4A 2HEIA 1E69A 1R0ZA 2QBYB 5FBQB 2XXAB 1NVVR 4F7WA 4FINA 3DKPA 4KFTA 3IEUA 3I3SR 1E2HA 1TNDA 5LB4A 4F4IA 3A36A 1VECA 2IBMA 1IAQA 4X8MA 2AK3A 4LY6A 3O8CA 2B8WA 2Z0MA 3NEJA 4IDPA 3QPWA 5DISB 5TY0A 1G19A 2GAAA 3CR7A 4RFSA 5BN3A 2AD5A 1E2FA 4V02A 3D3QA 2VLIA 1QDEA 4DB4A 2DYKA 5G3YA 5CDFA 1LB1B 3B1YA 4LPKA 4DWJA 4EJSC 2OCBA 1UBCA 2I3BA 4RD3A 1YRAA 3CH5A 3RDPA 1E9FA 2GZHA 1R5NA 4BRWA 3B9PA 2GF0A 5F2EA 2VTKA 1DE0A 3EAQA 2AFHE 4URXR 2O5VA 1GILA 1QHIA 4LHZA 1L4UA 1LF5A 3RS0A 3VX3A 2LWIA 2L0XA 3BK7A 2YVUA 2ODBA 5K8UA 3BH6A 4DRZA 2LCFA 3PUZA 3FMPB 4HZUA 1CIPA 4IXMA 1YR8A 4H1UA 2VP4A 2JLXA 1ZUIA 3VAAA 1HE8B 3TMKA 3BOSA 1CULC 1LW7A 2C96A 2FN4A 2OLKA 3HU3A 1DARA 4AK9A 4JT2A 4BLOA 2IWHA 3T1VA 3K9NA 2GK6A 5CITA 1KGDA 1W48A 5DYIA 5CM9C 1QHGA 1D8TA 4AYXA 4BQSA 3PVSA 3KKMA 4RJLA 4EAQA 4ZDJA 1VG9B 4IDQA 1GNRA 2ZRFA 1V43A 2RB4A 1WF3A 2WHXA 1CJTC 4KV9A 4AD8A 4DB2A 4GZMA 1M7BA 2K5UA 2RGBA 4UNSA 2JGNA 3GQBA 1N6RA 1CR2A 3ZIAA 2VBCA 3KB2A 1DG1G 4YDSA 2OFOA 1P62B 1TF2A 3B85A 1QZXA 3UIEA 1Z5ZA 1S96A 4HAZA 2CJWB 2XTNA 3I73A 3JVVA 3KJEA 1KJYA 1SXJD 4XD7D 1VCNA 5B2ZA 1NBMA 5FR1A 3EC1A 2IYWA 4JLPA 3THWB 2CMKA 4LJ6A 3K09C 2NPIA 2D4HA 2D7DA 1DAFA 1GM5A 4I1SA 2IYYA 5KU1A 3ADCA 3AM1A 4PO9A 4KYIB 2ZRCA 4D4MA 5FUXA 2IXGA 1MO3A 1XU4A 4BGDA 3L0IB 1UFQA 1OH6A 2XGJA 1W0JD 1M1YE 4HSEA 1RYHA 2FDCA 1GKIA 5L3RA 3U7HB 2OLJA 1CF4A 5SZIA 1DAIA 1J99A 2FSHA 4Z51A 2UZ3A 4O25A 2ZU0C 1G18A 4W9MC 3DM5A 3HP1A 1T9HA 2ZS9A 4IXNA 3GJ0A 4UQOA 4TZ0A 4URVR 1SXJA 2OEPA 1T5IA 2IYUA 1P2SA 2V54A 1IY1A 4KSCA 4RFVA 4RZUA 5BN5A 3GLGA 3H4MA 1XTQA 1U90A 4DBLC 4AKHA 2IL1A 2FE4A 4D6PA 4Z54A 5KSOA 1LF0A 1SVIA 2VYFA 3FFBA 3LBHA 5EJEA 3QOFA 4DLVA 3OIWA 1KHTA 3AF4A 4RCZA 4V0OA 2WJGA 2ZUBA 4NTZA 5AUOB 3CNOA 2ATXA 2AD1A 2G1JA 3MUFA 4DUGD 1UEJA 3UG6A 1AIPA 4TSFD 5FTMA 3P27A 5CK4A 1XTJA 2TMKA 4JLNA 4MYUA 3U3OA 1A2BA 1NKSA 3GLHA 1NN3A 1OFTA 2BBTA 2AR7A 3C16C 1N6NA 1FQKA 5KPDA 2VHUA 2QM8A 4KODA 3ZVRA 4JVLA 1TADA 2OXCA 4Q66C 3RSOA 5FH9A 1EFTA 3AVQA 3B7GA 2R6CA 4MA4A 3GLFE 2OXRA 1OKKD 1UDXA 1YR6A 1N5JA 2BM0A 2OUKA 5JJIA 1BKDR 2DB3A 4PX9A 1YZUA 3LW8A 5HE8A 4BE7B 1M7GA 4M9XA 2PZGA 1JR3A 1CKEA 2XZPA 3ZH9B 1E1RD 4FIDA 2WWYA 5IRCD 3IEVA 1DAEA 1MABA 4KXFB 4OI1A 3A6PC 5CDFE 1E32A 3NDPA 4CW7A 2MMGA 5JCPA 4LJ8A 2JLSA 1ZP6A 4RD2A 1Y63A 4KI0A 4TMZA 1P75A 2DFKB 1RZ3A 5DI9A 1BMFA 1PZNA 4OHVA 1II0A 1CR4A 1RIFA 2JJ2D 2KB0A 2O0HA 3W6PA 3L82B 3T34A 1XMJA 2PMKA 4CF7A 5JECA 1Q57A 1D9XA 4V0KA 4XH9B 1XEFA 2IYXA 1P3JA 4YXWD 4RZ3A 2A3RA 3C5CA 2JDID 2ZJBA 5FOXA 3Q3JB 3G5UA 3LXXA 5EE5B 1DAHA 2WPDD 4JLJA 4QNRA 5ANRB 2JAQA 2OO7A 3BB4A 1TX4B 4XVUA 1OT3A 5E7MA 3TJZA 4DLUA 3TGPA 4NCKA 1T0JB 5CB8A 4O0MA 3NG1A 4BLRA 2W00A 4A2QA 1G8GA 2CLDX 2FV8A 2VP2A 1XX6A 4GOKA 1XCPA 4PC1A 1M8PA 3DMDA 3M1IA 3T61A 2W2VA 4JLOA 3CWZA 3EIHA 4IDNA 1QVAA 3ZZTA 2AXPA 2VHQA 1XWIA 2BBSA 3D7MA 2P6UA 2R6GA 2V9PA 1G7TA 1TPZA 3SS8A 2V4ZA 1AK2A 2CXXA 3GEHA 5IK2A 4YMTA 1U2RA 3BFXA 1TMKA 4HDOB 1OYWA 2CHGA 3SZRA 5FL7D 3BD9A 4F4JA 4GNKA 2D62A 2QT0A 3A1SA 1U9IA 3VMFA 4P32A 3K09A 2F3TA 4M53A 4JMPA 4C0JA 4CEHA 3MFYA 3KKOA 3CPHA 1E9AA 1IY2A 1YJ5A 3MRSA 3TQFA 2C95A 3CPEA 4JBWA 3U6BA 3DL0A 3PJRA 4TYYA 2P6NA 4JKYA 1KK0A 3REGA 4LX0A 1AGRA 3THXB 1XXHB 3THYA 4KLZA 2QPOA 5SZHB 4TYQA 4DJTA 1ZNWA 2FPLA 1LVGA 2H17A 4C0AC 1WMSA 1NMXA 4NONA 1E0SA 5AK0A 2CL0X 5CK5A 2XOKD 3NKVA 5IK2D 3CRQA 1DAMA 3NDBB 2R44A 4AYWA 4LV6A 3WYGA 4C0HA 5FPSA 3GLGE 4EQ6B 4B2PA 1E2MA 2CLCX 2ZRPA 1ZM9A 5CLLA 3L43A 2ZETA 1TUIA 1Z6XA 4II7A 4A36A 4WZAE 2PCLA 2ZR7A 1KMHA 5AJYA 3BBPA 2FZ4A 3RC3A 1NI3A 5KOYA 1N6KA 3IPYA 4NKRA 1T91A 5JZVA 1Q1QA 1W44A 3LD9A 3GPLA 1W4CA 4DT1B 3PV0A 3V9PA 1EFHA 3W8RA 2QI9C 4NHOA 5EE3A 3CH4B 3HU1A 4D82A 4EPRA 4DDVA 4C2TA 1X1SA 1LFDB 2JA1A 4JSYA 1FP6A 3X1DA 1JJVA 2ONKA 2ZVQX 2F3RA 1G20E 4QBFA 1QHNA 5KDLA 1IONA 3TK1A 4P4SA 4O2LA 4BFWA 2HXSA 1G7SA 3L8YA 4DLSA 4D0LB 1DO0A 3PUWA 3F3YA 4XTRA 2GILA 2QORA 4QNMA 1W5TA 2OAP1 1ESMA 2XTZA 1QHHB 4PQFA 4Q9IA 3W34A 4A0RA 3VHXA 2IYZA 2GBLC 1EFRA 1DBSA 2YYZA 1RRFA 2BEJA 1R5OA 1AA9A 3CO5A 1SULA 1Q1ZA 2WAYA 3TUZC 2EYUA 3ZZUA 1T8UA 3WP1B 1KK2A 3KXLA 1NN0A 1W36D 2C9CA 4NCHA 4PHGA 2G88A 1MABB 4YQFA 2VPPA 4KO8A 1W1WA 4DCNA 1XEXA 2QMHA 1XCMA 2W6JD 3LVQE 3FKQA 1EFUA 2JATA 1YZTA 4TT3A 3FHOA 5J4YA 3KUDA 2QAJA 3UK6A 1AGPA 3QY0A 2O8DB 1HV8A 1P72A 3V4FA 821PA 3AP1A 1FL9A 2A9KA 4DKXA 5JCZA 3V00A 3ZGXA 4HB0A 4XSHA 1EK0A 3PITA 2WJJA 1SXJC 4A9AA 3Q5DA 4MRPA 2P6RA 4TTPA 5FL7A 4V0MA 2P2LA 2W0SA 2BV3A 2C9YA 2O8FB 2AX4A 2YC4C 1AKYA 5DIFA 4ABYA 1GL7A 3VR5A 1VTKA 1T5LA 3TLXA 1IM2A 4D26A 1XXHA 3BORA 4L4UA 2EFCB 3SEAA 2RMKA 2WJYA 3SBDA 4H9GA 5JRZA 5B58C 5GVRA 1CJMA 2OT3B 1E2IA 1VCOA 4JBXA 2ZSEA 1VYTA 5BW8A 4FMCF 5FTLA 1E9SA 1HH4A 1FQJA 3LO5A 4MGKR 4JT4A 4LC0A 1R2QA 2C2HA 4JL5A 4YMUA 3HYTA 1G3MA 2CCKA 3MLEA 4WIAA 3X1WA 5C4MA 2I4IA 3K70D 2J87A 3GLIA 1IXSB 2G0NA 3EASA 2IXEA 1ZAKA 1Q20A 3OFND 4EFNA 3C7KA 3K0AA 2CHQA 2VQSA 1JEEA 3RS4A 1KOFA 2IS4A 3I61A 5HCIA 4E22A 3KKQA 1P9RA 2FEMA 1A2KC 4R98A 3U7GA 3AVTA 1JBKA 1P9WA 2QPAA 5TMPA 1S3SA 4LDJA 3G82C 2JJ2A 3PQCA 4N3NA 4JVSB 4BPBA 3AVWA 1XPUA 1I2DA 1FX0B 1IBRA 5JWHA 1WB9A 2BCJQ 3U61B 1E2QA 4UNNA 1EGAA 4Z1MD 2F1JA 3BB1A 2W2XA 4A2PA 5GVSA 5J5CA 3DM9B 1B0UA 1AZTA 2ZANA 2PZFA 3TNFA 4HYYA 3FGNA 3UANA 1XEWY 2ONJA 1NG9A 1HEIA 1LTQA 1ZD9A 2GKSA 3LXRA 1XZPA 1GNPA 1VYVA 2CE7A 2QMEA 3FDIA 3MWKA 2P0EA 4DZZA 2NG1A 1W5SA 2GEVA 1NLFA 3NC1C 1ANKA 1HUQA 1M6NA 4JSTA 2O8CB 2BM1A 3SQXA 2QNRA 4QBGB 1MRNA 4MRRA 1E3MA 2GCOA 4TLDA 3T15A 1JR3E 1D2EA 4BZQA 3CNLA 2ZYWX 5E95A 3PENA 5DI3A 4GDFA 3L0PA 3GLFB 1EFRD 1ZMXA 4B32A 4ZDIA 1YZNA 1H8HA 1XMVA 2QEQA 3PG5A 2G9NA 2E1RA 2BBOA 4G0NA 3CRRA 1G3QA 4Q00A 4B6EA 3BB3A 4F4CA 1GRRA 1OIWA 2J59A 4LHXA 2WTUA 4TZ6A 1R0WA 4B71A 1GAJA 3DDCA 3AVXA 3PFIA 5C4GB 3AF0A 1U81A 2W0MA 1NVXQ 5FI0B 4EJSB 3TR0A 4A4DA 6Q21A 3UWOA 2QN6A 4M1TA 1Z0AA 2VH5R 4KYUA 3KQKA 5GJBA 1KAGA 4X8OA 3VR6A 4QOSA 1G41A 1OV4A 5IT5A 2ZR0A 3W3ZB 4TT3D 5B30A 3DHWC 1P2UA 4C0SA 4PAMA 5D3MB 4N1AA 4CVNA 3GFOA 2DWQA 1NVVQ 1NL3A 2ANBA 5H70A 3W90A 3GLHE 2YV5A 2NIPA 4O2RA 1SHZA 2Z4SA 2BMDA 3H1TA 4NL4H 4A1FA 2VO1A 1GSIA 4M4SA 1NMYA 2RGXA 2CLSA 1XPOA 1PV4A 4OJKA 1N25A 2WOOA 1XRJA 1L4YA 5JS8A 2GA8A 3FMFA 1KNXA 1G291 2OG2A 4CIDA 2JLRA 4PSAA 3K0FA 4GI7A 2R6FA 2D7CA 3EC2A 4PO1A 5EE0A 3U3KA 2G0TA 1UKEA 4DDTA 3U7EB 4PC2A 2V1UA 3B6EA 4NYIQ 1YZGA 3UG7A 5CYPA 1SKYE 2ZJYA 1OJLA 4Q9HA 4QJ3A 3UMSA 4PTLA 4QL3A 3U4QB 5JS7A 1U0HC 1E94E 4B44A 2EU8A 3NVAA 4TMXA 4AKEA 4IW3B 3S1AA 4FCTA 1W2GA 5EUQB 1HT1E 2ZRGA 4B2IA 1YE8A 1YR9A 4IVPA 1KI1A 2QRNA 1E9BA 3OIYA 4CDGA 2F9MA 4HAXA 5GJVC 3CX6A 4AWXA 3AKEA 1RJ9A 2VHJA 2PEYA 3B1WA 4LBWA 2ODEA 1CXZA 2R62A 4L16A 3B1VA 3QIAA 4A8JC 3LLMA 1J8YF 3WRXC 2FMXA 4M1YA 3FKSA 2RAPA 5FUYA 4TYNA 2JIZA 4G5OA 2CE2X 3WP0A 3KQHA 2C99A 4RKFA 2RGAA 2A30A 3LQQA 2QQEA 2WWGA 2IT1A 3NBYC 1MV5A 4ESHA 1K5GA 1WCV1 3OIVA 1P2TA 4POAA 5TB5A 721PA 5L3QA 3K53A 3EPKA 1G5RA 2HJGA 4M9ZA 2ZYUX 5KPJA 2Q3MA 5EXTA 1A5TA 1OKKA 4NPHA 4Q48A 4MGIR 1A82A 1N3BA 5DYGA 3KJHA 5BQ5A 4DSOA 2YOHA 1EESA 4NYMR 1S2MA 1KI4A 3ADBA 4I1OA 4XOIA 1OW3B 1IJEA 2GJSA 3OESA 5DHFA 3SFVA 2YHSA 1H8ED 4PANA 4LZZA 3AVPA 1KO4A 4PAOA 1E9EA 4ACBA 3M0EA 1JR6A 1J90A 1KJWA 2H18A 2ZYVX 2GCNA 4NBSA 1W0JA 4QXAA 5FBLB 4I81A 5FPYA 1NLYA 1XJCA 4US2R 4KVGA 3PUXA 3RS7A 4MKIA 3OE7D 1AJEA 2CHVA 3PEUA 1DO2A 3NH6A 3LW7A 4BEBA 3TQCA 2JEOA 2JLWA 3AGQA 2ERYA 4MGYR 3WNBA 5DN6D 5EUMA 4RD1A 3N70A 2GNOA 4Q4LA 2BMEA 4ZI2A 2V6JA 5TVKA 2VP9A 3ZVNA 1C1YA 2P3SA 2J0UB 3RNLA 2EVWX 2O8EA 2QAGC 5AWFC 5TV2A 1JEDA 1OXVA 5JFGA 1GRQA 1ZIPA 5LD2B 3K0CC 4TLAA 3N5CA 4HB2A 4HLQB 1JQLB 4HDQB 2QMUA 5AJVB 1KO1A 1QBKC 1UPTA 4C7OA 3WMFA 4G3XA 4TMVA 4EPTA 1F2TA 3Q85A 1AQUA 4ILEA 5HKKD 2N46A 1IQPA 4BASA 4LYAA 2OBNA 2F55A 2JLYA 2VIIA 1KSFX 2E9SA 4BFSA 3GFTA 1Q0UA 2WKRA 3LQRA 3SR0A 4TMWA 2RH5A 2GBLA 1TAGA 4Q4JB 2QAGA 1P7CA 3NEYA 1Q44A 1TF7A 4V0LA 2JLUA 3HDTA 4JJKA 1E2PA 1DOAA 2W6ID 2AN9A 1HY3A 4EKDA 1RC8A 3KB1A 2PX3A 2IUSA 3EWSA 4Q47A 1E79D 3GCGA 2ZUDA 4Q7JB 1I4LD 5EP2A 5K8LA 1SKQA 3KX2A 2OZEA 1MT0A 3SYNA 2VA8A 5HCNA 1AKEA 4IDOA 4Q21A 3A4MA 3VKWA 5HKKA 1CU1A 5KHOC 2ZRMA 1YZLA 4A6PA 4XVRA 1FPMA 2BCGY 4IOKA 4B35A 3C5HA 1UKYA 4FW9A 4EUNA 2F6RA 2ERXA 5DHAA 2PX0A 4NCJA 3A1WA 2ZRNA 1DPFA 4JLDA 3T1TA 1KI6B 1ZUHA 3Q5EA 2V7QA 3I4LA 5G53C 1VPLA 1RJ9B 4PZYA 2J0QA 1XTKA 3I1FA 3WYFA 5KYKA 3VNUA 4NDZA 3LH5A 2Q9CA 1F2UB 1RYFA 2J5XA 2WIAA 3BS4A 4DDUA 2QRZA 3Q7QA 2ZE7A 2F1HA 4LV8B 4BEJA 1W46A 3MJRA 1CRQA 1UKVY 2VEDA 3WBJA 1JNYA 5JWOA 1NIPA 2ZI7A 3HWSA 2AKAB 2WJVA 2PEZA 3H0KA 1QVRA 3K70C 4LV5B 4NMMA 3W5JA 4R2HA 4YC7A 4RSGA 3U2QA 1M34E 2DR3A 2J45A 1HE1C 4PPFA 1AZSC 2ZYTX 4JYBA 4B2LA 4JKIA 2REBA 3TVDA 1ZD8A 4E09A 2ZIAA 1ZNXA 1NNEA 4LK2A 2FPKA 1N6IA 1PJRA 2ZI6A 4BWYA 1PVOA 1J70A 1G8HA 5DE3A 1QG2A 3NIBA 2WICA 1KNQA 3BWDD 1S1CA 2FZLA 3L0SA 4LOAA 2GXQA 4CEHB 2ZSFA 5IDVA 2FSGA 4K46A 4BLQA 3RABA 3SI7A 3DOEA 3TRFA 4US1R 1H8EA 2QL6A 1O3YA 2ZM5A 3P1JA 4U02A 5E3HA 3NC0C 1QHYA 2BHRA 2DWOA 4R7ZA 2IF0A 3RVBA 4Q1DA 3I5YA 5CLQA 1Z83A 1KY2A 4HUQA 2GAOA 4Q4JA 5EP3A 2J1LA 1NBME 1JQJC 5AUPB 3EG5A 2QROA 1AN0A 4RD4A 1G3RA 1WXQA 3QF4B 4LJ9A 1SXJE 1KZ7B 3NH9A 2XZLA 3I5XA 1QHXA 2ORVA 1XMIA 3KJGA 4UNRA 3P32A 2GJ8A 5DGXA 2HCJB 2FA9A 4LBVA 3ICQB 4MUBA 3OEHA 1GOTA 4XD7A 1KO5A 2XJ9A 4PC7A 3DZDA 5JEDA 4NZYA 4D81A 1MRSA 1R8SA 3RANA 2QMOA 4OI4A 4A0GA 3WNDA 4QGAA 4S35A 3T1OA 2CK3D 4LC1A 2ZSAA 5KTYA 1F48A 2O8BB 1XB2A 2AK2A 5DNYB 2WVJA 1OF1A 2OM2A 5LB2A 3CBQA 4URWR 3IBYA 1E96A 4HUQB 3CX7A 2GF9A 2HYDA 4R9UC 1YZQA 4HAUA 4HDCA 4D0NA 1Z0KA 2XZOA 3BFKA 2RKOA 5LD2C 4A15A 4Q7KA 3FMIA 2IX3A 1TTTA 5JI3E 3QXSA 2VRWA 3ZS9A 1XZQA 4P3YA 3KJIA 4A0HA 3QSYA 2O52A 2ZAOA 2ZQ5A 1KK1A 5FOTA 2NZJA 2Q21A 3LV8A 4K8OA 2EWWA 4B3GA 1NVUQ 4C9BA 4ERNA 1IN7A 4IOMA 4Q1BA 4WVFA 3VHLB 4V0ME 4C4PA 4FMBB 2NO6A 4DCVA 4JVNA 3N2EA 1ESNA 2DWPA 2QSYA 2GDJA 1W0KA 2QGNA 3AF2A 3ZQJA 1UBEA 4I1UA 1OXTA 5CB6A 2ZUCA 1SGWA 2ZE6A 4KITB 4IEEA 1HQCA 1U98A 4OYHA 1LV7A 2X19A 5FUWA 2IEZA 4R2IA 3FPAA 3QVUA 3CRW1 3QG1A 1QHSA 2PCJA 2VHCA 3RRYA 5LBIA 3LLUA 5JJLA 2ANCA 3LBNA 4NYIR 3M4YA 4DCSA 2MSDB 2HF8A 1NRJB 1SVOA 5FBVB 1BO6A 5CYOA 4XWOA 1A7JA 2ZI5A 2ZJ2A 4HI0E 3Q72A 1P9NA 4B76A 2PLFA 4B3XA 1WE2A 1COWA 4DSNA 2R6DA 3ZYCA 2VSFA 5KNDA 1ZJ6A 4C2UA 2HXYA 3OHMA 4DLXA 1YKSA 2JCSA 2QE7A 1E1QD 2AXNA 2GCPA 3OFNA 5EE1A 4M1KA 1E1RA 3THWA 1YZKA 1KTVA 2G3YA 1OXXK 3BERA 4X8LA 1NSTA 2IYSA 2ZSBA 2DFLA 2VF8A 1XFAA 2G77B 3ND8A 3KQNA 3TSOA 3A37A 2X8AA 3MGCA 3EWAA 3REFA 2W6JA 4PC6A 3VKGA 1SXJB 3T06B 1BIFA 1SVSA 1XMSA 2FU5C 1W4BA 2GK7A 1RKBA 2ZRLA 2R6AA 2YOGA 4Q02A 4WXRA 4OHXA 3EZ2A 2GESA 3M6AA 4JL8A 4PAQA 4JBYA 1Z2AA 3QE0A 3RAPR 3SDZA 1NBMD 2Q0HA 1QF9A 3SE0A 4ZDKA 5EXXA 4C3ZA 3IQXA 4TQAA 1WGWA 3ASYA 2QGZA 5BYJA 2B8TA 4G5GA 3AB3A 3IO3A 4Q01A 1OFIA 5KSYA 2FF7A 3PUVA 2UVQA 4OHYA 3D8BA 221PA 1CJVC 3ICEA 4Q1EA 2EFGA 4TYPA 5JWRA 4FI3C 1KYIA 5HTKA 4AY2A 4LHYA 1NY5A 4B3FX 5KDDA 3MSXA 1WRBA 3FB4A 4M21A 3A1UA 5AJXA 5JI2E 4LJAA 4YMWA 4ZCLA 4G1UC 4KAXA 3X1YA 3QUSA 1M7HA 4QGHA 4Z8XA 1GP2A 1XD2A 3OEHD 3ZD7A 1N2CE 2D2EA 4LBYA 4YLGA 1A4RA 2XNDA 1S9DA 4IFBA 1WQ1R 2IXFA 4YMVA 3RRNA 1G3UA 2XEXA 1H8HD 5J40A 3MWYW 2HLDA 4LGMA 3SNHA 2CCGA 2QP9X 2O8BA 3EIEA 3W6OA 3TIFA 5J4KA 1G8PA 1K5DA 2CK3A 3OEED 2H92A 3IIJA 1FW6A 3I8XA 2ZRIA 4OL0A 3W6NA 3SQWA 5EQTA 4GRAA 1R10A 1NLZA 4BLTA 2HYIC 2C9OA 4TL7A 1FP7A 2NO9A 3CW2A 2QTVB 4KHZA 3ADDA 2HT1A 2WM9B 3BC1A 4LJ4A 5FBWB 2QSZA 3F0TA 2QT1A 3EPHA 4ZIRA 3THOA 3SBEA 3FOZA 2Z4RA 3CRMA 4LI0A 4OQXA 5BXQC 2QBYA 2BBWA 3GFPA 4WBSA 4KVAA 1XTIA 4NYMQ 1TUEA 4NP6A 4LWZA 4ZO4A 3CKLA 4DDWA 4DVGA 4ON9A 3KZ1E 1U0JA 1NY6A 1MO5A 4LCBA 1EWRA 1GWNA 2ZEJA 2ZS7A 5IF9A 2OHFA 1E4YA 1G6HA 3GEIA 3R8CA 3KL4A 1US8A 1E6CA 2YNMA 2GZDA 2XTMA 3Q7PA 2KJQA 3TW8B 5J4HA 1F2UA 1ZC4A 3LVRE 1G21E 1VIAA 3GJ5A 2V55B 1LNZA 2J9RA 4E03A 4X8HA 1NVWQ 2Q9AA 2V8OA 3IILA 1WBDA 8OHMA 3C14C 1Z0IA 2V6IA 4RD6A 1KK3A 3RC8A 4IEIA 1PUJA 1II8A 3FFAA 3AKDA 1JB1A 2QZ4A 3AEZA 3MJHA 4DLYA 3GEEA 4GL2A 2NOAA 1Q22A 2ZE5A 3TAHA 3ZIAD 3AVVA 1L8QA 4OJQA 4W5WA 4OK5A 3DVLA 3P4YA 5TDHA 5L3SA 2C78A 2A5JA 2WOJA 2W58A 3CUEF 5EZ6B 3QEJA 3VR4A 3UMFA 3W8NA 4JZKA 1W7AA 3JZMA 4C30A 3DMNA 5UKDA 4EIWA 2QQ0A 5TARA 2OFXA 4BFYA 2VL7A 3UXMA 4EPWA 1RRPA 4CT5A 4KFUA 3CM0A 1J8MF 2GHIA 1ZIOA 3GLIB 5D3QA 1IHUA 3SYLA 2EFEB 5JHHB 5BYKA 2ZJOA 1OPXA 5D3MA 1YVDA 1ZVQA 3KQUA 4P0TA 2WBLC 3GMTA 2BVNA 2ORIA 3AUXA 4PZZA 2ZITA 4KCGA 4PHTA 4BRUA 3EZ7A 5HE9A 3SFZA 4C0LA 1GUAA 2BC9A 3AP3A 4Q9KA 4WOPA 3TKLA 1NMZA 3THYB 3VFDA 4EPVA 3KTAB 3QVVA 1X1RA 3LFUA 4YONB 4RKEA 4MRNA 1KZGB 4BZPA 4WXPA 4LJ5A 1MKYA 3LRPA 2XJ4A 4KSBA 2BKUA 1OSNA 1E0JA 5F98A 2NTYC 4OQNA 1G9XA 1KSGA 3I32A 4V03A 2O8EB 1E0AA 3VTKA 3PEVA 3LNCA 2X1VA 1IOZA 2IA5A 1D6JA 3TR5A 4LJ7A 2Q3HA 4O3MA 4DCUA 2CBZA 2F9LA 4JLBA 1OB2A 4CEJA 1RRCA 3BAFA 1ELOA 3AVYA 2NGRA 4Q18A 1ZM4A 3AKCA 1T0HB 2B7CA 1RVDA 2WAXA 3HU2A 4QHYA 4ASUD 4D4KA 2F43B 4B47A 1Z28A 2ZJAA 4FMDF 3U3MA 3QKRA 1AS2A 5K8IA 3BRWD 1XXHE 5E4FA 4ZI3A 3CB4A 3R9IA 3Q9LA 4OQLA 4N0EA 1CS4C 1YRBA 2YINC 3J81k 2PBRA 4I99A 1W47A 4OHZA 1BH2A 4MUAA 1E9CA 4D4JA 4RCYA 3VU9A 1TU3A 1TF5A 1T6NA 2A7QA 3NXSA 3IBGA 4MQBA 4UKDA 3AV0B 4HZUB 4C7OB 2AWNA 4UXJA 2R2AA 2DPXA 3GLIE 1FTSA 2ZJZA 4M1OA 3MG9A 4D80A 4GZLA 4M2LA 5CJPA 1K8RA 5FOUA 3TE6A 3RS2A 4ESVA 1L2TA 2GJKA 3R8FA 3H2YA 3WRYC 5JBQA 4BECA 1GKUB 2F43A 2IYRA 2CVHA 3R20A 2CNWD 1QHHA 4XWKA 1YHNA 1W4RA 1I2MA 1GKYA 1KSHA 1OYYA 1U0LA 4OK3A 2FOLA 4B34A 1DADA 4U7DA 2O0KA 2VSXA 1TQ2A 3KFVA 3ZLJA 1VG0B 1E99A 1E79A 2H1LA 1GFIA 1SHKA 1U94A 4PQYA 2H57A 4W5JA 2QE7D 2GZAA 3IDQA 1UADA 4UJ3A 4DUGA 3B1XA 3AP2A 2JJ1A 4U5XA 1G16A 2XAUA 4TSFA 4XSGA 4EDHA 1G5PA 2QP4A 4LBZA 2ZE8A 1QG4A 2GRJA 1D5CA 4IKEA 2YWFA 3IUYA 1Z22A 4JLKA 2AFIE 2C04A 2CNWA 2V7QD 5K8TA 2J3EA 1VIYA 4M1WA 4XIGS 1KI6A 4HZIA 4Q7LA 4NU0A 4RD0A 1KI8A 2RHMA 3CWQA 3ECCA 4NYJQ 4QHSA 2ZRDA 4HAYA 2HJVA 4AIIA 1OLOA 1R5BA 1XF9A 4JJZA 3EZ9A 3LX5A 3B82A 1N5IA 4AYTA 2FEOA 2WWWA 4QGGA 2A5DA 4AKGA 1JXMA 2RGDA 3PCRB 4GMXA 4DIDA 2GXUA 2FH5B 3PIRA 1KI7A 2X77A 3IIMA 3RSLA 2GJAA 4UNQA 4W7SA 3WNCA 1Q21A 1AQYA 1Z6YA 521PA 3U44B 3PEYA 4PC3A 1VDZA 4NYJR 4PZLA 1FOEB 2PT5A 4G5QA 4JLVA 1ZRHA 2JLZA 4F91B 1G5TA 1XCGB 2ZR9A 4XTCS 3NWJA 3UMRA 4ZPXA 1XEXB 2JJ8A 1T3HA 4TYWA 5FTKA 3CR8A 3RRMA 2J7PD 3IHLA 4HB3A 5EP4A 2H16A 2C98A 1RE0A 4FMDB 4A82A 1EX7A 3AF1A 3BIFA 3TSZA 3X1XA 2KBFA 3ZVLA 2HCBA 2NZ8A 4B6FA 1CP2A 2D3WA 3WMEA 3FMOB 2IS6A 4J0QA 1PLLA 2O8CA 2FPMA 1RRGA 5HPYB 5JEEA 1Z0FA 3K8YA 2QENA 3KFXA 4DHEA 3SOPA 1Z47A 2IYLD 4NE2A 1XTRA 4MDEA 1IXZA 2D74A 1OIXA 3U7FB 2NPFA 3GJ3A 5SZJA 4ZIRB 4JS0A 2WSMA 1Z07A 1DAGA 5AJZA 1VCIA 3U3RA 3F8TA 2MSEB 2DFTA 1J7KA 1P2VA 4GFDA 2IW3A 4B74A 4KBFA 5LPNA 2OCPA 1DEKA 4TLEA 4L9WA 4TMKA 2IEYA 4D4LA 3U60B 2FWRA 3EXAA 5FI1B 4QFMA 3VX4A 1X3SA 3ADKA 5H8WA 1LY1A 2FG5A 2X2EA 1EFCA 4PXAA 5BN4A 3CRVA 4OI2A 2ZXUA 3E2IA 5B57C 4KU4A 1ZNYA 1C9KA 2KSQA 2ZI3A 2O0JA 1HA3A 1U8AA 1S3GA
chains in the Genus database with same CATH superfamily
2IE0A 1VG1A 2WE8A 4Y0VA 4FGLA 1Y5LA 1E2UA 1V5WA 2N42A 3EZNA 4HN2A 5A05A 1YQTA 1H1DA 2VR1A 2X6TA 1UM8A 4GM1A 4H4DA 1XCLA 1T5OA 1X0XA 1YD7A 1O6BA 3N2KA 3ULKA 3E9ZA 1Q0LA 3FTQA 2LKDA 3A27A 4C1NA 2V74B 3A1CA 4U3JA 3FPJA 3CF4A 2Q8NA 4RF4A 3H17A 1X8KA 4JENA 2QDXA 2WU1A 1G2PA 3D0OA 4XFDA 5KZMB 1O6ZA 3HB5X 1KWKA 2BKAA 3LBAA 2WVOA 3MILA 4J0JA 4PZ0A 3T3EA 3EQ8A 4BNDA 4F8EA 2HV8A 4QPCA 3QFTA 2CXOA 3C74A 3RLFA 1LPPA 1XLUA 2WV7A 4B7AA 5I7WA 2F1KA 5IDWA 4FCCA 3G50A 3ICVA 4YMSA 4NZPA 4EF6A 2V5UA 3NV7A 3IO5A 1OHHD 4HNSA 4E51A 3PC8C 3E1SA 3EGWA 2F3QA 3LGSA 3RRFA 4HC4A 1GITA 4CLRB 1D7OA 3OCJA 1JDSA 2ZI4A 1NF3A 2OCAA 3CONA 4MDFA 3MFNA 2UUAB 4GE0A 3R0ZA 4O4JA 1MZPA 1DKRA 3QHAA 4BJHB 1GG2A 3AR6A 1XTUA 1ZI6A 4R9SA 1DQYA 3QKTA 4DEXA 4EFMA 5C1BA 5LKAA 3WLIA 5CX4A 5HIIA 3KYBA 2YIVX 1LI7A 3W4YA 4RTKA 3SE7A 3AM1A 4MS4B 4GX2A 2J3QA 1XAHA 4Q7MB 4PSKA 1FMJA 1N0IA 4URYR 3U3JA 5GIOE 4OXRA 2B8NA 4DE5A 4BFVA 4Y2YA 3SD7A 3BN3A 1JHYA 3LCCA 4HAWA 4O8CA 2VHZA 4BO5A 1SQ5A 1VHTA 1ORVA 3BIWA 2DR0A 3PEFA 4JEHA 4BMCA 4EB6B 5EMNA 1FFSA 4J43A 2F1IA 2G1AA 1R6BX 1PZEA 4O4LB 4YTEA 3GBSA 3ASVA 2JIMA 1RZVA 5LYYA 1Q74A 3M1CB 2E4XA 1W87A 2PMCA 1CJUC 2WKPA 5CURA 3ZZMA 1G8YA 1A9YA 1JKIA 1YKGA 4FE3A 4JH0A 3R7WA 4F06A 4URZR 3LOQA 4TUYF 2PGOA 5BUSA 3MGKA 2B99A 2J7PA 1QF7A 1JIJA 1TXGA 1R5ID 1Q6YA 1SU4A 2Y1GA 2ZRJA 2ZJ8A 3LP8A 3ORYA 4L2IA 4N0PA 4RMHA 4DDMA 3WIDA 3IYLW 3PXBA 3VHXB 4EG1A 4YYZA 5K99A 5C7OO 3NHUA 5LQSA 3V80A 4D02A 2CV0A 4DA6A 2HKVA 1YDHA 1LSUA 1Y6RA 4JX8A 4R0MA 1DXQA 2YHAA 1J97A 3M6IA 2EFJA 2V7WA 1UIRA 1PX0A 1VM6A 3ASNC 3EPRA 4GPZA 2HRBA 5T64A 1SU7A 3JQGA 4K9LA 1MORA 2P6PA 2RH9B 4MPJA 4YK7A 1DKNA 3QNMA 1E86A 421PA 4AO8A 2I2WA 5CB4B 2ZI9A 1RXVA 2ONYA 3UB4A 4BQOA 2QN9A 3WAJA 3IT2A 4D8TA 1HW1A 2HU8A 4FFBB 4RXMA 4ID3A 1RQNA 1R4TA 1Z7YA 4EEZA 1M1YB 4ZI7F 5EJFA 3TFOA 3Q8LA 4IOLA 3WIEA 4PPGA 2OV2A 3I6BA 4CX9A 3HB7A 4HEJA 3WL8A 4IRMA 5AI0A 2A2ZA 3HADA 3HU5A 4X65B 4H1VA 1NKTA 1PJZA 3DBLA 4A92A 5J23A 2LKCA 3BE4A 3GUHA 4R51A 4GYTA 4RV4A 1N4AA 3OF5A 4MB0A 3T1NA 3WY9A 3SHQA 3Q15C 1UXGA 5DO9A 1OI3A 3KK0A 5DQZA 3WHLA 4PLPA 1E8DA 2Q4EA 3U3XA 5F3WB 1XJQA 2AX3A 1O4VA 2BONA 1W4AA 3T4RA 4B3CA 3JTEA 3MWEA 4MP3A 2Y93A 4D96A 3BJZA 1D1SA 2YYYA 3D6VA 3G8AA 5LYJA 1Y1LA 2ECKA 3QVYA 3NGXA 5FFNA 3UK0A 3OCXA 1SEVA 3EMBA 4ZI7A 5EVJA 4ZGBA 2VDOB 4M1SA 1LBTA 4CSAC 1ZD1A 4XEFA 3DP9A 3HBFA 1EHCA 2KWIA 3T3GA 3ZJYA 5BNIA 5JAHA 1QG0A 5TMBA 3TOZA 4BDSA 1Y81A 5CFPA 3NTXA 2P5SA 4BJTA 1CR1A 2Q5HA 4HQKA 3CZQA 1JE0A 3OIGA 4DNQA 1T2FA 2CUTA 2P1ZA 2R8RA 1AK9A 5EZQA 4UASA 1BXZA 3CLVA 1QKJA 4DR5B 2ZU6A 5IVHA 1SUSA 3ZXXA 2WHRA 4CLOA 1WB4A 1B3BA 1NYLA 1AK1A 1HQYE 4RTOA 3FVQA 5JZOA 4WGZA 4B75A 4B6GA 2W4IA 3N0WA 1EVJA 4KEAA 1UOQA 1KYWA 2OXEA 2XB9A 4DSUA 1ZW6A 2GN0A 1XRNA 3E9MA 2IOHA 4XX0B 1KDVA 3X1ZA 5I4BA 3TS1A 3QFCA 1QO9A 4IOJA 2JIQA 3LP5A 3CBGA 4KN8A 2CZGA 5DNDA 4EATA 5L4LA 1F06A 1JPNA 4FMCB 2B2XA 5DP2A 2C20A 2QQ5A 3DMRA 4Z0HO 3ZE7A 4AROA 5K8CA 2HMAA 2YS7A 4H7PA 4ECEA 4EY8A 2R60A 4TVBA 1BFKA 4YJ2B 3ZSUA 3DZ8A 4EJFA 1UBJS 4EX6A 1Y6FA 2HL6A 4Z8YA 4WXHA 3HBJA 5DSZA 3V1NA 4DEYA 1QRAA 3AERA 3TPZA 1NP6A 3ZJVA 2LNDA 4AX4A 4XYGA 3JYYA 1QMPA 1D0SA 2HK6A 3KVVA 1Z38A 2V7GA 3DMGA 4V2UA 3AKYA 1DAKA 4FS3A 3RNOA 4UTVA 3P9NA 2B92A 3R5XA 5G3ZA 3KOXA 2I62A 3GD5A 3V8MA 2BZGA 4W82A 4C6TA 4FN5A 4JP8A 1SOWA 3TBKA 1G6OA 1QFYA 4OM8A 3H4VA 3HR4A 2AG5A 2AHOA 4MV7A 1UBUS 3C3DA 5G1OA 4D0RA 4OKSA 2CNNA 3QPUA 1CLUA 2C3PA 1FQWA 3DW3X 4JCCA 5L4NA 4MR8A 4QFDA 4IDAA 4MQLA 4X91A 4BFTA 5DXAA 3T1YB 3DPUA 1S0UA 2FQ1A 1Z63A 1P2BA 1VLHA 3ZG1A 3IQIX 2ZPTX 3KKNA 4IHKA 4PACA 2EPNA 2QX4A 1BDMA 2WFAA 2I3DA 3D8HA 3EJWA 1VMAA 1WB5A 4CLRA 3SLKA 4RM2A 1J0XO 1E2EA 3RQFA 4MVUA 4OGLA 2VP0A 2WSBA 5DK6A 1MCZA 2PUJA 4N5NA 1MP0A 1SO8A 1LKZA 3MCAA 5THKA 1CJKC 2J3HA 4G4SO 4HE8D 1WD7A 3FPEA 5F7JA 4DXAA 4M36A 1QOZA 5DTRA 1O94C 3BGSA 3ZV3A 3BTSA 5I7UA 1CZKA 1B8VA 1HXHA 1X1CA 2L69A 3K4HA 3WB1A 3GLFA 1I14A 4D74A 2PGJA 4UNPA 3SXJA 3KAKA 4KJZA 3ABRB 4IH4A 2W6IA 3TW8A 2J0VA 1ESEA 4FOTA 4ND2A 2XDYA 4PVDA 2O7QA 3SC2A 3MEQA 3B78A 3I1YA 1FMLA 2CL6X 3URMA 4OUDB 2JK0A 3E0QA 5EQFA 1I0ZA 2AVKA 4FYJA 4A7PA 5A5VA 1XTZA 3TJ6A 2GEDA 4JIGA 1ORIA 4ALIA 4DA9A 3HHEA 1K6XA 3SU8A 2YL7A 1VMKA 3B3FA 2PL9A 3F67A 1JIXA 3PDCA 4MMYB 4RZIA 3K20A 4K9KA 5TPZD 2BEKA 4XPIA 1T2VA 2O8DA 1QQ3A 4H4EA 4MS3B 3OQJA 4N03A 1WBBA 4BWGA 3O73A 1HEYA 1SUDA 2R11A 4JGIA 2Y71A 3E48A 3ESCA 3LC2O 5HFJA 4WNYA 5F1OA 1CY4A 2WL8A 1BS1A 3LF2A 2KW5A 5CIWA 2Q6TA 1TWAA 1HDCA 1AUEA 2RG1A 4HNAA 1USGA 1RU3A 1DCMA 2OM6A 3ONVA 3D6TB 3LVBA 1T3TA 2FJ0A 3Q3GE 1D4AA 4RH3A 1KYZA 1C14A 3V5XA 3LIIA 3BIXA 1A88A 1DQRA 3A1DA 3H75A 3TOCA 4KRGA 2WZQA 4D4GA 4TV8B 3CNEA 4FNAA 3R7SA 1WV1A 4BCBA 4GXRA 2C7OA 2UDPA 3FCSB 4G89A 4IIXA 1SHTX 2MINB 1A76A 2VOJA 1IAVA 4W8PA 3VTAA 2YCLA 3PZBA 1SBTA 1IVNA 4RVCA 1Z3IX 2LIVA 4M7PA 1ECCA 1RYEA 3LA8A 3C97A 5AKGA 3AUYA 1KO8A 4ZQEA 3HEBA 2NVBA 3JW8A 3K9GA 4IF4A 4NOLA 3TX2A 3ZS8A 4A0SA 4BZXA 1E6LA 1XZLA 4C3BA 3B51X 3LHIA 1FZQA 1NBBA 3D8SA 1VE3A 4U7GA 2XXBA 3CAXA 3S81A 2WIJA 1K7EB 2E4WA 3R7WB 2PSSA 3R7BA 1DELA 4HDSA 1S8FA 5BORA 3MT8A 1T0BA 3DEJA 3H99A 2PR7A 3KHTA 1PTJA 1HETA 4R1PA 3T3IA 2VP5A 1R4AA 4EHKA 4W99A 2UU9B 4NBWA 5A04A 2C1ZA 2O5CA 1JR3D 3T41A 3T35A 1N34B 1ZINA 4ZCIA 3S2FA 1ZMTA 1C81A 1SKAA 1N9GA 2EFHB 2IK8A 1U8CB 3KQPA 3LOPA 2Y0BA 4JOCA 4QSHA 3GFRA 5A71A 2GA9A 4I4TB 1BMFD 3NU1A 3GAZA 4EMBA 1SPBS 1P73A 3A3PA 4OPMA 5ICSA 2PJUA 1FNNA 2HADA 4WLNA 4AW9A 2ACVA 4UPEA 3HJCA 5E2QA 2RGEA 4I1YA 3VTFA 5EYPA 2JFZA 3HA2A 4JVSA 1M34B 2CFSA 1Q3TA 3K6KA 4J9VA 2IYVA 2OOKA 1II8B 2P61A 4XGNA 4HNQA 3SK0A 5CJ2A 1NGSA 2ATCA 1EDDA 3HNJA 2KBEA 3KEOA 1RBZA 2C4HA 3B60A 5AVYA 1ZUNB 4D42A 2EXXA 3QJGA 1VKNA 2RHLA 3IR5A 4MNDA 1ISMA 1RCUA 4OHMA 2DHRA 2Z43A 2PUHA 1WABA 3NCTA 4U1RA 3ZY3A 4Q03A 4C03A 1OXMA 2GUGA 4JJ7A 3ZD6A 2RBKA 2BOVA 1E4EB 2Q27A 3LGXA 4NCQA 1N57A 4MVJI 4BEVA 4E14A 3A1VA 5A4JA 4TKZA 2WD8A 2YASA 1OT5A 1ZM7A 2ATEA 3DC2A 3KOWA 2DY1A 4INOA 4UU1A 1Z0UA 3E8MA 5KQRA 1TQ8A 4ZU6X 1R88A 1H0KA 3OWXA 3FYHA 5G1PA 5TF0A 2ORWA 5IBPA 5AVQA 1N5LA 3LJKA 4HQNA 3EQ9A 1MQAA 1HR0B 3CNNA 4UDOA 4Z0TA 1N7HA 2BD0A 3RIXA 4ZEVA 3OD5A 5HDBB 4BC1A 2FPGA 2I2BA 4XUDA 3WJ7A 3SZUA 2WYHA 1IW7F 2YW9A 3BA1A 5EVCA 1ISRA 3NBXX 3BRSA 4UEKA 1DKQA 3FN4A 1VTMP 1KMNA 3DDSA 3ONNA 4ZA2A 5P21A 1UBSB 4HATA 4X3CA 2I1VB 1QR6A 4ZCMA 2YBEA 5AJWA 1Z6AA 2PLRA 2EL7A 1FAPB 5FP0A 2YOFA 1MH1A 2RD9A 2I4TA 1I9GA 1JUDA 5SV2A 1BCSA 2AR9A 3SHWA 1O0CA 3T4XA 2O2GA 2N0SA 4UHEA 1NNLA 2W8BB 3MJFA 2VVTA 2ID7A 2KQUA 1Z2CA 1YQ9A 3A6EA 1W2WA 2HBRA 3JAKA 1KF0A 3L2OB 4ZT3A 2GZRA 1DBPA 5GZ1A 3RJ5A 3DDHA 3FF1A 1N2EA 1TYCA 2OAQ1 3I09A 4OQEA 1EFAA 3COYA 2CYDA 4Z99A 3U31A 3RAEC 5IHPA 3WHKA 4P9FA 4QKQA 3D6NB 1HC7A 3E5HA 3LUFA 2P1RA 4CF5A 4I5FA 4MGHA 4NQFA 1JB9A 4LYHA 3H2UA 4DRJB 4OJNA 3IE0A 5HOQA 4ZJYA 1DKOA 4F9TA 3DTVA 3LUTB 1EVQA 2JS7A 3ZE8A 1YTUA 1E2NA 3TBHA 1MC1A 4PFJA 2JLVA 3I45A 3QW0A 1WU8A 5GZ3A 1ORRA 2E37A 1GU1A 4QE3A 3VI4B 1YZHA 2HLPA 3C8HA 2XIJA 2EFYA 4ONEA 3SJBA 3K3PA 2WWXA 4EWLA 3FHLA 3WLAA 4KP7A 1D0XA 2CCYA 2BZSA 2GBGA 1Z29A 2FAPB 3WYEA 1ZGAA 2QJRA 4F45A 5C46F 1ZM3A 3AFIA 3X3HA 3BXFA 4YAIA 2BGNA 2WJAA 1X0VA 3QEBZ 2OESA 4FYKA 1EYZA 2ZBRA 3NYJA 6CHYA 1RMQA 3HN7A 5BQPA 1YDIA 2BFOA 2MSCB 1N0WA 4HEA1 1E0KA 5LZ2A 2V45A 3P9YA 3V4RA 4D92A 4QQKA 1E3IA 4ESOA 3H2VA 1TKAA 4JC8A 4Q9AA 5D01A 5HZHA 2ZIXA 1N78A 1CC1S 2HQOA 2O57A 1TC2A 3MWLA 3WG7C 4P08A 1QU2A 3GUCA 4UPDA 1E5TA 5E8JA 5KWEA 5B3KA 1RCFA 1FFDA 1JDNA 5EXSA 2G8LA 2L7AA 2QMYA 4TWRA 4Z2YA 3PR1A 1SR2A 4PR3A 4OK6A 1ZZPA 1U9IC 4H6PA 4KX5A 2WSIA 2PA3A 4QC2A 4R3UC 3X1JA 3TUIC 3IJEB 4YV7A 2OBLA 2YFYA 1FYVA 4EHFA 2H7BA 2O07A 4FZVA 3G0OA 4YN0B 3SC3A 3SMQA 4IG9A 3U4GA 4RU1A 2QUAA 4I4LA 4OBXA 4TTTS 1EM6A 3EZ6A 3NTQA 4GMGA 5JS5A 3C3JA 4PAGA 1PV3A 5KVCA 4TL6A 1IZZA 1T0PA 4OIQF 5DN9A 3ABLC 3CF2A 4X00A 1QP7A 1R7RA 1UZMA 1WA5A 3K32A 4JLAA 4JHXA 1FNTc 1XD9A 3F5SA 3IUSA 4XSVA 4FCWA 5HK8A 3TRKA 5I8WA 2JLQA 5E3IA 4EVIA 4ACAA 1O8BA 3IDSA 3ZV6A 5LP6B 5LP1A 3EX7C 4OXYA 4XZ3A 4LHVA 1KJNA 2ROQA 4PHHA 2WB2A 2XIQA 1YDGA 1AKUA 2Y0CA 1LDBA 2IY8A 2BJWA 5JE8A 1L4NA 4M0UA 2BTOA 2YWEA 1UKZA 4CIVA 4CMIB 4ZQIA 2JIRA 4IHJB 4F92B 3TZ6A 3OEEA 2CXPA 5AR1A 4HN9A 2GNPA 4KNWA 4FYXA 3DOIA 3OQ6A 1XG5A 2A9RA 2ZZMA 4K7BA 1JXAA 2XZDA 1FXSA 1NBAA 1U11A 2HTEA 1JMYA 1NE7A 1FFHA 2HSZA 1OE0A 1K2VN 4N4AA 4AICA 3CTPA 4HAVA 1JXOA 3HDGA 5K8VA 3PSHA 2ZTUA 3MTJA 1YK1A 1TL7C 4F2DA 1PFKA 2IKSA 5K05A 2W7TA 4QHTA 2VAMA 3D6JA 4K6OA 4V0NA 3BTUA 3VZDA 4M49A 1CRLA 3ZNOA 1S3IA 4Q1CA 4QDUA 3IQTA 3M9WA 6LDHA 5IKPA 5AYVA 5TJHA 3MMXA 1ZZGA 5JOQA 2WVGA 5BR1A 4LERA 5JRJA 3DHVA 5FR2A 3FOFC 1PR6A 2QLJA 2R7KA 5EKTA 2Q1TA 5HA5A 2N47A 3NMIA 2VJLA 4QM6A 1Y6GA 1I6LA 4HZGA 5CIQA 2AG1A 1O3UA 2N3ZA 2YJGA 4BYGA 1ECJA 3RK1A 1FFXB 3QEOA 3VVLA 2BFCA 4ER3A 3BDVA 4KQGA 4LCJA 4ETIA 3KT6A 2CVFA 4XM2A 4HDSB 4UTRA 3JSXA 2BSAA 3EIFA 1L5YA 3JZIA 2ODTX 3WLPA 2YZMA 3DCYA 3ENQA 5AW1A 5JVDA 3PX2A 1W36B 1T2AA 4AMGA 2R66A 3TVTA 2O19A 4OV6B 4KNVA 1N6PA 2R5WA 2YKZA 3BJMA 4MV6A 3VR1A 2JNWA 1W88B 2GCOB 3Q2IA 2BISA 1AV6A 1EE2A 3LBIA 3PTLA 4WXMA 2WT8A 1W85B 5EHHA 5JZSA 1RI3A 2OVFA 3OQBA 1TUBB 3HCCA 3NM6B 5FCLA 5IN4A 1ICIA 2UYHA 4JJ6A 4KHPB 4RBNA 4YECA 1I51A 2IJGX 2I99A 3ONWA 1B68A 2CNDA 1X1DA 2BMWA 5LBTA 5EWJA 1TEZA 3ZGZA 4DQXA 3LTEA 3NHZA 2VYCA 2Y3IA 2YIJA 3BDAA 4KE8A 4XWAA 5FPHA 1I5NA 1ONBA 1D6MA 2WFZA 1GLGA 1THGA 3P26A 1IN6A 1BEUB 3FB1A 2YC2C 3ZBQA 1RC1A 3GIDA 1X9GA 4BJ6A 2JCVA 2EFDB 1RM3A 3CN7A 2IIVA 3F9RA 2FAXA 1GTJ1 2WZCA 3WLMA 2O2XA 4X20B 4BC0A 1LRLA 4TLCA 4JKVA 1P7PA 2UZIR 3WKEA 3ISTA 3IAM1 1IUNA 2WA1A 3LWNA 1YQDA 1JGTA 3ZE9A 3BIJA 3OFJA 2P5TB 4Y1EA 4EI8A 1D0IA 7YASA 1YVRA 3WGMA 5CLHA 3NHPA 3VVBA 1ITZA 3DXJF 4B8ZA 3OOYA 2XNDD 3BD6A 2GHQA 4GLLA 1GQYA 2BIFA 3UHFA 4Z1MA 4CZ2A 3F9IA 3U16A 1T4DA 2VYNA 5L51A 3BE8A 1KFCB 1Z0JA 2FPGB 3FCAA 1L5ZA 4I8XA 3TSWA 2VTDA 1CNEA 1D6SA 3QI7A 1T26A 1L8OA 4FESA 2G83A 2Z2IA 3WADA 1WEHA 2E87A 1Y42X 4HS4A 3FYCA 2VJMA 2ZCUA 1DV2A 2NSYA 3O8BA 4CIAA 5IZCC 3JWHA 4GPTA 2LBPA 3UMBA 3L7CA 4RTNA 3R9XB 1GAWA 1VKJA 3ENWA 5KKCA 4AJIA 3SLRA 5FWYA 2YQZA 3CZ9A 4AZ0B 4PJMA 1YCFA 4IGFA 4G7HF 4KZKA 1HMPA 4D0SA 1IVYA 2J7KA 3E15A 1BOOA 2RAVA 3EDMA 1G5ZA 2M1XA 1FFEA 3H19A 3U4DA 3ZUGA 3UATA 1PZGA 3H5NA 3UHOA 3PHLA 3TXYA 2YWRA 2GVZC 1M3SA 3MELA 3ZWKA 3SNKA 3CF6R 3LUCA 3LPDA 4LPSA 4OL9A 3GHYA 3HCOA 1UDBA 3GJ8A 2VJPA 4HF7A 4RY2A 3LUKA 4W9RA 5SZKB 5IKXA 2AI1A 2VJDA 3C6MA 1N2XA 2IYAA 5JANA 4NDNE 3R8FA 2WV9A 3VVMA 2FGKA 3DOHA 1XHLA 1XQXA 2QIOA 3R0QA 4LYDA 1NE2A 1S8OA 3R7AA 1WR8A 3DKVA 4K05A 4A6XA 3C1OA 3LUPA 3EG9A 2PKCA 4G5RA 5IABA 3YASA 1QPBA 3DDWA 1VYIA 2SICE 3ND5A 6ADHA 1XELA 2EZUA 2XWSA 2KGOA 1ADJA 3FGPA 1P29A 2WJIA 3A4LA 1SURA 2WKQA 3PR3A 4QM7A 1HKUA 4K6CA 3QU5A 3RC1A 4DSOA 4ZV4A 3G2MA 1E69A 2G36A 2QYHA 3U4HA 4L3VA 3NFYA 4QDTA 2GJ4A 3N8DA 4RIFA 5FBQB 3V4OA 4BKQA 3RFUA 2R84A 1I2AA 3H2GA 4KVFA 4CHGA 2C5BA 4OGFA 2EERA 3MMZA 3ZWDA 4P1ZA 4TWIA 4FFLA 1O95A 1VECA 2CZQA 3LUJA 2AK3A 3ORFA 1ONNA 2NZVG 2A3NA 4L28A 3TZLA 2B8WA 1CYDA 3GZNA 3NEJA 3QPWA 4QUJA 3FUUA 5DISB 1Q0HA 3CUKA 1G19A 2FWBA 3CR7A 5ILGA 1QLEC 4QI0A 5ADUS 3ZK8A 5BN3A 3Q0TA 3OMLA 5B55A 3D3QA 4C07A 2VLIA 1CJBA 2DYKA 3INYA 3J7TA 2NXJA 5CDFA 5F12A 3H1AA 3AQBA 4LPKA 4IM7A 4LZWA 2QJWA 3UGTA 5I9LA 1NW5A 2W93A 4KQWA 4AMVA 2I3BA 1IDOA 4CMEA 3MWDB 3UW3A 3M2PA 3AWIA 4AP9A 1C2YA 1E60A 4AJ9A 4BTVA 1MA3A 4IX9A 4R8MA 3DKKA 5HM6A 1DEAA 3O1IC 2MHCA 1P8AA 4ANFA 4D3SA 1IQUA 1O89A 1LF5A 3QLUA 2JGFA 3VDMA 3LYAA 1X7GA 4GIBA 1MNAA 1P77A 1K27A 1WNFA 3UK7A 4N6OA 2QM0A 3BH6A 4O63O 1EIZA 4U8HA 4R8VA 4DRZA 1CIPA 1GT6A 2NU7A 3HBMA 3NAMA 1FSPA 4F4BA 3VAAA 4ITVA 3T7EA 1HE8B 3E58A 1UK7A 3HU3A 2OLKA 1SCUA 2CYBA 4WKCA 1ETHA 1TA9A 4X1IA 4BN5A 1CJSA 5KS2A 2HFJA 3ROGA 4PZ9A 4QDZA 4GKJB 3T1VA 1L4KA 5CITA 3RBXA 3CUYA 3TCKA 3U9LA 1JG2A 1KGDA 3N9IA 4KGZA 4U5DE 1QKRA 4OJMX 3UMGA 3WQQA 1T35A 4Y18A 4ETMA 6GPBA 2ZRFA 4ZQHA 4GC5A 1V43A 4HGRA 4Y6OA 9LDTA 1O58A 2OHOA 5IBCA 1OXKB 2EP8A 4Y2UA 4DB2A 1Y5RA 4W8HA 3WQHA 3ZKAA 2RGBA 4DC0A 3MGGA 2YV1A 2QXYA 2VBCA 3GH3A 2VUTA 3TD7A 4U5CE 1DTWB 2HU5A 2ZCVA 3HXPA 3LNTA 4I50A 4N7RA 4QTTB 3TFWA 1IRXA 3VA7A 3KPYA 5DM0A 1RRKA 1S96A 4QQNA 5AVJA 2XTNA 3HBLA 4X24A 3A4VA 4ZHQA 3KH2A 5C5CA 2P2DA 3SXUA 3ZX5A 4K28A 1SXJD 3VH1A 3SP1A 4BKRA 3QW2A 3OLQA 3GVIA 4W8GA 5B2ZA 3MYRA 4DYHA 3E61A 5LP6C 2WUVA 1ODCA 1C9YA 3PPVA 3K09C 2NPIA 4IG4A 5HKAA 3WHPA 5FLXA 2W37A 3WL6A 2D7DA 2UYYA 1GM5A 1P18A 2AGVA 1ZUNA 4BB6A 3ADCA 3GNLA 2BH2A 1P9LA 3L1UA 1VL5A 1IE3A 1WUYA 2BGIA 2YMMA 1PP4A 4BEWA 4ESVA 3T6BA 4IICA 1XU4A 3CKMA 3E35A 1UFQA 3L0IB 4BGDA 1OH6A 2XGJA 4U2GA 3AETB 1ZK1A 2BR3A 2O48X 2R1TA 2VKTA 2RIPA 3BWCA 3LK6A 3QBDA 4V0QA 2JB9A 3RVLA 2WUEA 3NJ8A 1GDTA 3UJAA 1CF4A 2OAGA 2V0NA 2DWCA 4DV6B 1LNSA 3KQYA 2FSHA 1A96A 1VFNA 4JCZA 3DPIA 4OAPA 5BNTA 1UP4A 3MXOA 4NMLA 4W9MC 1ST6A 4NC3A 3HP1A 4JIOA 1DZIA 1T9HA 2HLNA 2IRWA 2QLLA 4IXNA 4KSCA 4U0KA 3AC0A 5TS3A 4RZUA 3E9CA 2X1HA 3LBFA 4QTUB 4ZZ1A 4JXJA 1EFVB 4MCIA 1U90A 4R16A 4TMYA 4AKHA 3NHMA 1DBQA 1U1FA 4F2HA 1RQLA 2P40A 2R48A 2RHHA 3C6KA 3E3NA 5KSOA 2IXBA 5J63A 3HXTA 4ZXPA 3S0JA 4DLVA 4F9EA 1KHTA 4ARVA 4V0OA 4GW3A 1CZLA 4WABA 3DOOA 3Q5GA 3R3ZA 1XUOA 2CEKA 1GS9A 1INLA 4HKTA 3TTSA 3FTFA 2RK6A 3MUFA 1GPNA 2Q2VA 3N2YA 4D6XA 1OW7A 4ULVA 1DQSA 4MV0A 1B43A 1XTJA 1M1UA 3GC6A 5J5VA 2BP7A 3VH2A 2Q5CA 1S05A 2QJTA 2X9VA 3GLHA 1T5HX 3ZQVA 4BHTA 4EF5A 2WMDA 1NN3A 1OFTA 2PS9A 5IUJC 1N2BA 1NJ6A 2HHAA 4XFJA 3OT4A 1FQKA 3B48A 2VHUA 2QM8A 1UDRA 3AHEA 3A6FA 5DM1A 5DFAA 5KPDA 1TADA 3CGWA 3S8YA 4ZANA 5FH9A 2GN1A 1FFCA 3OF2A 3Q3HA 2X58A 4KI7A 4MA4A 4R31A 1PDOA 4Y67A 1OKKD 2BM0A 4ARIA 2OUKA 4RTQA 1C4KA 5FYDA 4AQYB 5B4TA 1ZVZA 3QEMA 2BGJA 4BE7B 1ZA1A 1V95A 3EB9A 1EG2A 3EXEA 2RGWA 5DNAA 1CKEA 1IHXA 2C4VA 1XU9A 2YHUA 4YJDA 2ILVA 3GYGA 3MTDA 4XLPF 1BKYA 3AFOA 5IRCD 1MABA 3K1AB 4ZLDA 1E77A 2VS1A 1A2QA 5C4IA 1ZSVA 2Q1XA 3A6JA 1Y7TA 2JW5A 3MUEA 1ZX1A 2A67A 4KI0A 4NSNA 3U4IA 4TMZA 2IEBA 1YNSA 2ID9A 4FSHA 4EWCA 1QG6A 2DFKB 2YW2A 5DI9A 1DDGA 1PZNA 2BFMA 1II0A 1TGYA 4KXYA 4OHVA 4B4VA 2JJ2D 1B6GA 3SSAA 2O9XA 2G0AA 1Z4NA 2FZWA 3PYMA 3W6PA 1YRYE 2PRJA 3H1EA 2PUDA 3OZSA 4FIZA 1N0HA 4ZVUA 4CF7A 2X41A 2O3RA 3ESDA 3GH1A 4LMPA 1OX6A 1D9XA 4XH9B 3JATB 1XEFA 3U7JA 4YXWD 2HN9A 2I55A 2A3RA 3N75A 1PVDA 2B4YA 4FJ2A 3G5UA 3VRHA 3PX7A 4YAGA 3R0VA 4ZCPA 3T94A 3I2IA 1B73A 2EKPA 3E8XA 4BE9A 5JC1A 1YJCA 2VQFB 2VH1A 2ZKIA 3RUIA 4FFPA 3LLVA 4CKXA 1QRRA 2FETA 2JAQA 4XVUA 1TX4B 3NV9A 5E7MA 3MRVA 3TJZA 1ISSA 1AUPA 2ZGVA 4TKMA 2R6JA 1WMBA 4ARCA 1W85A 4BLRA 2NW6A 4TXLA 3V7FA 4A2QA 5K4HA 1ZMBA 4OG2A 2FV8A 1UXJA 1RXYA 1XX6A 2BE9A 1AG9A 4GOKA 5CEFA 4PC1A 1AQIA 1NLXA 1WMDA 2I4OA 4NRDA 5F52A 4ERXA 1U7UA 2VUIB 3EUWA 5E1MA 1QXSA 5TPWA 3FDXA 4XEVA 3H2HA 4J3FA 4UZSA 3RT9A 2ZTLA 1PIWA 3EUFA 3ML1A 3ZZTA 3JQAD 3U2LA 1XWIA 2BBSA 4DQLA 2BL2A 4FGKA 1TPZA 3PF9A 4BB9A 4J75A 1Z88A 1JLLB 1VKOA 1AK2A 2JIDA 3UJCA 5KNDH 1PZMA 2CXXA 2Y05A 3L7DA 5D2CA 3GEHA 2P78A 5AP9A 5LMZA 3BFXA 4HDOB 2FRXA 1Q6ZA 3C8GB 2FWJA 4F4DA 1PT6A 1OYWA 2PMWB 2QVZX 5KOJB 4LF9B 5FL7D 3PHHA 1LVKA 2JCGA 2BE5F 4K6HA 5DYYA 4DCJA 5HJ2A 4TLLB 3HH8A 2CMGA 1X87A 2M98A 2FZGA 2Q5JA 2ZIVB 3K09A 4M53A 4CEHA 4C0JA 3MFYA 1E92A 4YA6A 3V4SA 5C32A 4DCPA 4BNUA 3MRSA 1G6KA 1PHPA 2C95A 2PH3A 2RHGB 4CM1A 1BX3A 5IAGA 2IHKA 2RHJA 5H9WA 2H0RA 4TS1A 4LGYA 4YRFA 2BPOA 3C4QA 3THXB 4RSHA 1XXHB 3ZQJA 2ETVA 1IUOA 1V1MA 1NW6A 2P9FA 2AR0A 4M89A 4QU8A 2B5OA 3ELYA 2WAOA 2AQKA 1WMSA 3FVWA 3UWOA 2XRZA 5GQSA 1WJGA 3ZE6A 1M10A 2CL0X 1BS9A 3WWOA 1DAMA 4FOSA 3CEJA 1ONSA 4Z9YA 3WYGA 1FRVA 2B1RA 3MCZA 4QT4A 3KD2A 3A2KA 4IZIA 2WJWA 1E2MA 4HXYA 1HYHA 3FH0A 4EG5A 4WXEA 3OCVA 4GUDA 3ABMC 4XX0A 1K9VF 3Q12A 5JXGA 3UXHA 4W5OA 1TUIA 4II7A 1AKNA 4U0JA 3LYUA 3QX7A 6AT1A 5CUQA 5KJ1A 3GAAA 4KE6A 5EWMB 5AVSA 1DQPA 1XLTA 5KOYA 2OP0A 3PGLA 1VP3A 4G0HA 4NKRA 3VR6H 1C1XB 4E5MA 3JD4A 3VPGA 4ZZIA 2Q6LA 3II6X 1Q1QA 5FX2A 2A9OA 3SS9X 3CEHA 1DTWA 3LD9A 1U0FA 3OT5A 4PLWA 3COJA 4Z9FA 1W4CA 2IPNA 2V98A 3L1HA 4MVZA 5CB0A 4CN8A 3L0CA 5DW3A 4FSDA 2VUHB 1G4US 3EVNA 3GT7A 4G4GA 4MUJA 3P9PA 2H1HA 3E05A 1M6WA 2CLLB 3N74A 5EE3A 3BZBA 3O8QA 4B6QA 5JSQA 5F23A 3UHAA 2BDUA 2Y0DA 3TQHA 1L7PA 4Q16A 2VFAA 3DMHA 1GL3A 3KZNA 1IN1A 1F6DA 1HG0A 2PWPA 2II6A 1H2EA 3ZPXA 1FP6A 1JJVA 2ZTMA 1EWVA 4BP3A 2P90A 5EJ5A 4X71A 3NX4A 3VC1A 4QBFA 5K8JB 1IONA 4UOZA 2RKWA 3KEQA 3O7MA 1GQRA 4M1QA 4FFSA 4OMDA 4UEJA 3WC4A 1QH8B 3L8JA 5FUQA 2QXTA 3KAPA 2GZSA 4U63A 1BJTA 5ICFA 2EKDA 5D91A 1KKUA 3PA8A 2HXSA 3L8YA 1AH2A 1Z25A 4EX7A 4XTRA 1JAYA 2QORA 2CFRA 1W5TA 1REQA 5E4YA 3O84A 4ZYVA 1ESMA 2XTZA 4NBLA 4XEUA 1FFGA 3EGIA 1H2FA 2ST1A 4CBVA 2IYZA 2WYVA 1R27A 3MX3A 4I1OB 5DHPA 1RRFA 1FLNA 2BEJA 4U7HA 1USWA 5KREA 4F9GA 1FCJA 1V2GA 2O2SA 2PUWA 4EOGA 4RHFA 4EL0A 1CWUA 3FTPA 1NT4A 1WU7A 2EZ4A 1BD4A 2I54A 5DOZA 3U9JA 5GOTA 5KMGB 4L8VA 1YIDA 2C9CA 5FORA 2L6HA 2A1TR 4U2KA 4PHGA 2L6GA 2JHAA 4D9KA 4CDAA 2XGOA 3EOAI 1WQ4A 5B12A 2W6ZA 4KO8A 4XPZA 5C51B 1XPJA 1XEXA 1N2JA 2QMHA 1XCMA 2NP6A 3T9CA 3CZ6A 5E8RA 3TRHA 3AQCA 2XB8A 1SCUB 5BP7A 1MIOB 3A9VA 1HL7A 1RHUA 2VCAA 4U9UA 4OHUA 1UZNA 3ZDBA 1A72A 3X1MA 3DBHB 1PFQA 4Z0PA 4ID9A 1N2CB 1AGPA 1UWKA 4XPIB 4C7XA 4G0VA 1HV8A 2O8DB 3JQ7B 5ITWA 1VE7A 3AP1A 1QP4A 2A9KA 1X80B 1X39A 2PVCA 2FN7A 1JYFA 3OLWA 1V4VA 1J0EA 4D56A 4RIGA 4DJ9A 1K3FA 1MVLA 2H59A 2GYWA 1VRWA 5BQXA 1E1CB 2OYRA 4CM3A 3F46A 2W0SA 3DDZX 1KFEB 1TAQA 3DT8A 2C9YA 1MB2A 4FFBA 2R68A 4HN4B 2O8FB 1GKKA 3Q2OA 4UTZA 5T7BA 1OYOA 2BEWB 1Y9JA 2FZEA 2VPXA 1J5PA 1NDUA 2C5HA 2JA2A 1RZRD 4Y2SA 1T2CA 3MFQA 3VR5A 6REQA 1VTKA 3GXOA 4FN4A 4RHYA 3TOLA 4OM7A 3T52A 5LOVF 1OBVA 3BGOS 2PX4A 3BORA 4WY5A 4GGPA 2WJYA 5LQAA 2DJ5A 2J9GA 3W5BA 5C1OA 2B37A 4FHEA 4J29A 4YAWA 4M0PA 1JEQA 3S2UA 4JBXA 4D3YA 2ZSEA 4HDNB 5FTLA 1H4VB 1E9SA 1HH4A 2HFIA 1MV8A 2RGUA 3BILA 4AS3A 1Y8QA 4J7YA 4JEAA 4JT4A 2Y6UA