2J83A

Ulilysin metalloprotease in complex with batimastat.
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
259
structure length
258
Chain Sequence
EIVKIPVVVHVVWNEEEENISDAQIQSQIDILNKDFRKLNSDVSQVPSVWSNLIADLGIEFFLATKDPNGNQTTGITRTQTSVTFFTTSDEVKFASSGGEDAWPADRYLNIWVCHVLKSEIGQDILGYAQFPGGPAETDGVVIVDAAFGTTGTALPPFDKGRTATHEIGHWLNLYHIWGDELRFEDPCSRSDEVDDTPNQADPNFGAPSYPHVSCSNGPNGDMFMNYMDYVDDKMVMFTQGQATRVNACLDGPRSSFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ULILYSIN
publication title Substrate Specificity of a Metalloprotease of the Pappalysin Family Revealed by an Inhibitor and a Product Complex.
pubmed doi rcsb
source organism Methanosarcina acetivorans
molecule tags Hydrolase
total genus 84
structure length 258
sequence length 259
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05572 Peptidase_M43 Pregnancy-associated plasma protein-A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 2j83A00
3O2XA 1BQQM 1PWWA 1QUAA 1G12A 4H76A 2MLSA 3AYKA 1PWQA 2X3CA 2USNA 3LEAA 3B2ZA 3VTGA 4H1QA 3RTTA 4XBHA 1MMBA 5H8XA 2OVXA 3I7IA 1J7NA 3MA2A 4J4MA 2MZEA 4JA1A 1ZS0A 2O36A 1UTTA 3L0TA 1RM8A 4XM7A 5B5OA 4AIGA 4GWNA 5BOTA 1ASTA 4WK7A 2V4BA 2CLTA 2W0DA 3P24A 1HFSA 3P1VA 5D2BA 4AUOA 4I03A 1K7QA 3KEKA 3Q2GA 1I76A 2RJPA 2OI0A 3LE9A 1ATLA 2AYKA 2XS4A 2J83A 1XFWA 1SLMA 1D8FA 1EAKA 1KUFA 2DW2A 1YCMA 2ERQA 2QPJA 2MZHA 3HBVP 1SU3A 3ELMA 3ZVSA 1JAOA 4DV8A 3BA0A 3LJZA 3LMCA 1H71P 966CA 1BIWA 3F16A 4PKQA 1PWPA 2JNPA 1JJ9A 4XCTA 1S4BP 3TVCA 1WNIA 1MMRA 4DD8A 2TCLA 5CUHA 2OW9A 1BQOA 1C8TA 1KBCA 1XFUA 1BZSA 4QKZA 1IAAA 1A85A 2OXZA 3O64A 4IN9A 4GQLA 1YP1A 1IABA 3E8RA 1QIAA 1ZXCA 1K7GA 1MNCA 1JIWP 4JP4A 3DSLA 3HY7A 3DPEA 1I1IP 1GE5A 3B92A 4HMAA 5I3MA 1R1JA 2X7MA 3K7LA 5I2ZA 2YB9A 2DW0A 1Q3AA 2FV9A 4FXYP 3HDAP 2MLRA 4GWMA 1GO8P 2SRTA 4FVLA 4H84A 3TS4A 1JAPA 1XFYA 4H2EA 1SRPA 1Y93A 2W12A 4PKUA 1XFVA 4JQGA 1R55A 3LUMA 1KUHA 3LQ0A 3OHOA 3LUNA 1ZP5A 4DPEA 1QICA 2RJQA 1XURA 3OHLA 5L7FA 4L6TA 4Q1LA 3DNGA 2WO9A 5D1TA 3B8ZA 1IAGA 1OM6A 1Y0VA 2ERPA 5I43A 5D3CA 1Z3JA 1SATA 2JSDA 3EDZA 2W15A 2O3EA 3WV1A 1QIBA 3LQBA 4PKTA 3HYGA 1XUCA 1GE6A 3KMEA 3G42A 4PKRA 3ZXHA 1JAQA 2A8HA 2X3AA 4G0DA 3DPFA 4GF1A 830CA 1EUBA 2L0RA 1FBLA 1JK3A 1YQYA 1R1IA 4H30A 1CXVA 4CTHA 1OS9A 1HFCA 5BOYA 3EWJA 5CXAA 1B8YA 1BUVM 3EDGA 2JT5A 1AYKA 3AIGA 2MZIA 3EHYA 1C7KA 1JANA 4G9LA 3F17A 3K7NA 2J0TA 2OW2A 5D7WA 2FV5A 3I7GA 1DTHA 3DWBA 4PKVA 1D5JA 5CZMA 1BUDA 1CGFA 2Z2DA 1D8MA 3LIKA 1UEAA 5D1SA 1KUKA 3F18A 1OS2A 1CGLA 2WO8A 2K9CA 1JH1A 1DMTA 3Q2HA 3KHIA 1ROSA 1CGEA 1HTDA 4A3WA 3USNA 3HBUP 4L19A 3N2UA 1BSWA 4A7BA 3UVCA 4I35A 3SHIA 3LJTA 4GR8A 3ZUKA 1R54A 2DDFA 1R1HA 2YIGA 2PJTA 3CKIA 3LJGA 4WZVA 1O0TA 1A86A 1KAPP 1CIZA 3KECA 2KRJA 4FXQA 1B3DA 4WF6A 1JIZA 2OW0A 3N2VA 3AYUA 1G9KA 3U1RA 2OY4A 3GBOA 1Y8JA 2Y6CA 5L79A 2POJA 456CA 1G4KA 2N8RA 1I73A 3F19A 3WV2A 4AXQA 4JIJA 4GR3A 2K2GA 1XFXA 3KRYA 4L63A 5LABA 1K7IA 2Y6DA 1IAEA 4IUWA 1CAQA 1JKYA 1HV5A 1GO7P 1GE7A 2W14A 2W13A 2E3XA 1OO9A 1D7XA 1KUIA 4PKWA 3RTSA 2WOAA 2OVZA 5JMYA 3TSKA 4H82A 4ON1A 3G5CA 1G05A 1UMTA 2I47A 1OM7A 5D1UA 1L6JA 1MMQA 5B5PA 1FM1A 3NX7A 4GR0A 4PKSA 4WKIA 4WKEA 1PWVA 1BKCI 1SMPA 1BKCE 1GKDA 4HX3A 1CQRA 4EFSA 1GXDA 3KWVC 3LK8A 1OMJA 4XM8A 5BPAA 3LIRA 2OW1A 1OM8A 4IJOA 1RMZA 3V96B 1EB6A 4FU4A 2OZRA 3HB2P 2OXUA 4H49A 2DDYA 3LKAA 3F15A 3EDHA 2D1NA 4H3XA 4AYKA 2X3BA 2JIHA 3HDBA 2AIGP 2XS3A 1IACA 3F1AA 2JT6A 1ZTQA 1KUGA 1PWUA 3EDIA 1C3IA 1AKLA 3LGPA 3KMCA 1QJJA 1QJIA 1CK7A 4JPAA 2DW1A 3WV3A 4DF9A 1UMSA 5I4OA 3HY9A 1AF0A 5I0LA 2OY2A 4ILWD 1SLNA 1USNA 4R3VA 2HU6A 1HOVA 1MMPA 1BM6A 1ND1A 3DL1A 3LILA 5I12A 2CKIA 3L0VA 1YOUA 3VI1A 1XUDA 4XM6A 1IADA 2E2DA 1UTZA 2EROA 1ZXVA 2D1OA 1FLSA 1GKCA 4ZR5A 1O0QA 1HY7A 3TT4A 3KEJA 1XFZA 1ZVXA 1G49A 1BKCA 3EHXA 4GUYA 2OXWA
chains in the Genus database with same CATH superfamily
3O2XA 1BQQM 1PWWA 1QUAA 1G12A 4H76A 2MLSA 3AYKA 1PWQA 2X3CA 2USNA 3LEAA 3B2ZA 3VTGA 4H1QA 3RTTA 4XBHA 1MMBA 5H8XA 2OVXA 3I7IA 1J7NA 3MA2A 4J4MA 2MZEA 4JA1A 1ZS0A 2O36A 1UTTA 3L0TA 1RM8A 4XM7A 5B5OA 4AIGA 4GWNA 5BOTA 1ASTA 4WK7A 2V4BA 2CLTA 2W0DA 3P24A 1HFSA 2YUFA 3P1VA 5D2BA 4AUOA 4I03A 1XM5A 1K7QA 3KEKA 3Q2GA 1I76A 2RJPA 2OI0A 3LE9A 1ATLA 2AYKA 2XS4A 2J83A 1XFWA 1SLMA 1D8FA 1EAKA 1KUFA 3DTKA 2DW2A 1YCMA 2ERQA 1XAXA 2QPJA 2MZHA 3HBVP 1SU3A 3ELMA 3ZVSA 1JAOA 4DV8A 3BA0A 3DTEA 3LJZA 3LMCA 1H71P 966CA 1BIWA 3F16A 4PKQA 1PWPA 2JNPA 1JJ9A 4XCTA 1S4BP 3TVCA 1WNIA 1MMRA 4DD8A 2TCLA 5CUHA 2OW9A 1BQOA 1C8TA 1KBCA 1XFUA 1BZSA 4QKZA 1IAAA 1A85A 2OXZA 3O64A 4IN9A 4GQLA 1YP1A 1IABA 3E8RA 1QIAA 1ZXCA 1K7GA 1MNCA 1JIWP 4JP4A 3DSLA 3HY7A 3DPEA 1I1IP 1GE5A 3B92A 4HMAA 5I3MA 1R1JA 2X7MA 3K7LA 5I2ZA 2YB9A 2DW0A 1Q3AA 2FV9A 4FXYP 3HDAP 2MLRA 4GWMA 1GO8P 2SRTA 4FVLA 4H84A 3TS4A 1JAPA 1XFYA 4H2EA 1SRPA 1Y93A 2W12A 4PKUA 1XFVA 4JQGA 1R55A 3LUMA 1KUHA 3LQ0A 3OHOA 3LUNA 1ZP5A 4DPEA 1QICA 2RJQA 1XURA 3OHLA 5L7FA 4L6TA 4Q1LA 3DNGA 2WO9A 5D1TA 3B8ZA 1IAGA 1OM6A 1Y0VA 2ERPA 5I43A 5D3CA 1Z3JA 1SATA 2JSDA 3EDZA 2W15A 2O3EA 3WV1A 1QIBA 3LQBA 4PKTA 3HYGA 1XUCA 1GE6A 3KMEA 3G42A 4PKRA 3ZXHA 1JAQA 2A8HA 2X3AA 4G0DA 3DPFA 4GF1A 830CA 1EUBA 2L0RA 1FBLA 1JK3A 1YQYA 1R1IA 4H30A 1CXVA 4CTHA 1OS9A 1HFCA 5BOYA 3EWJA 5CXAA 3EDGA 1B8YA 1BUVM 3DTIA 2JT5A 1AYKA 3AIGA 2MZIA 3EHYA 1C7KA 1JANA 4G9LA 3F17A 3K7NA 2J0TA 2OW2A 5D7WA 2FV5A 3I7GA 1DTHA 3DWBA 4PKVA 1TVIA 1D5JA 5CZMA 1BUDA 1CGFA 2Z2DA 1D8MA 3LIKA 1UEAA 5D1SA 1KUKA 3F18A 1OS2A 1CGLA 2WO8A 2K9CA 1JH1A 1DMTA 3Q2HA 3KHIA 1ROSA 1CGEA 1HTDA 4A3WA 3USNA 3HBUP 4L19A 3N2UA 1BSWA 4A7BA 3UVCA 4I35A 3SHIA 3LJTA 4GR8A 3ZUKA 1R54A 2DDFA 1R1HA 2YIGA 2PJTA 3CKIA 3LJGA 4WZVA 1O0TA 1A86A 1KAPP 1CIZA 3KECA 2KRJA 4FXQA 1B3DA 4WF6A 1JIZA 2OW0A 3N2VA 3AYUA 1G9KA 3U1RA 2OY4A 3GBOA 1Y8JA 2Y6CA 5L79A 2POJA 456CA 1G4KA 2N8RA 1I73A 3F19A 3WV2A 4AXQA 4JIJA 4GR3A 2K2GA 1XFXA 3KRYA 4L63A 5LABA 1K7IA 2Y6DA 1IAEA 4IUWA 1CAQA 1JKYA 1HV5A 1GO7P 1GE7A 2W14A 2W13A 2E3XA 1OO9A 1D7XA 1KUIA 4PKWA 3RTSA 2WOAA 2OVZA 5JMYA 3TSKA 4H82A 4ON1A 3G5CA 1G05A 1UMTA 2I47A 1OM7A 5D1UA 1L6JA 1MMQA 5B5PA 1FM1A 3NX7A 4GR0A 4PKSA 4WKIA 4WKEA 1PWVA 1BKCI 1SMPA 1BKCE 1GKDA 4HX3A 1CQRA 4EFSA 1GXDA 3KWVC 3LK8A 1OMJA 4XM8A 5BPAA 3LIRA 2OW1A 1OM8A 4IJOA 1RMZA 3V96B 1EB6A 4FU4A 2OZRA 3HB2P 2OXUA 4H49A 2DDYA 3LKAA 3F15A 3EDHA 2D1NA 4H3XA 4AYKA 2X3BA 2JIHA 3HDBA 2AIGP 2XS3A 1IACA 3F1AA 2JT6A 1ZTQA 1KUGA 1PWUA 3EDIA 1C3IA 1AKLA 3LGPA 3KMCA 1QJJA 1QJIA 1CK7A 4JPAA 2DW1A 4L7AA 3WV3A 4DF9A 1UMSA 5I4OA 1OZ9A 3HY9A 1AF0A 5I0LA 2OY2A 4ILWD 1SLNA 1USNA 4R3VA 2HU6A 1HOVA 1MMPA 1BM6A 1ND1A 3DL1A 3LILA 5I12A 2CKIA 3L0VA 1YOUA 3VI1A 1XUDA 4XM6A 1IADA 2E2DA 1UTZA 2EROA 1ZXVA 2D1OA 1FLSA 1GKCA 4ZR5A 1O0QA 1HY7A 3TT4A 3KEJA 1XFZA 1ZVXA 1G49A 1BKCA 3EHXA 4GUYA 2OXWA
chains in the Genus database with same CATH topology
3O2XA 1BQQM 1PWWA 1QUAA 1G12A 4H76A 2MLSA 3AYKA 1PWQA 2X3CA 2USNA 3LEAA 3B2ZA 3VTGA 4H1QA 3RTTA 4XBHA 1MMBA 5H8XA 2OVXA 3I7IA 1J7NA 3MA2A 4J4MA 2MZEA 4JA1A 1ZS0A 2O36A 1UTTA 3L0TA 1RM8A 4XM7A 5B5OA 4AIGA 4GWNA 5BOTA 1ASTA 4WK7A 2V4BA 2CLTA 2W0DA 3P24A 1HFSA 2YUFA 3P1VA 5D2BA 4AUOA 4I03A 1K7QA 3KEKA 3Q2GA 1I76A 2RJPA 2OI0A 3LE9A 1ATLA 2AYKA 2XS4A 2J83A 1XFWA 1SLMA 1D8FA 1EAKA 1KUFA 3DTKA 2DW2A 1YCMA 2ERQA 2QPJA 2MZHA 3HBVP 1SU3A 3ELMA 3ZVSA 1JAOA 4DV8A 3BA0A 3DTEA 3LJZA 3LMCA 1H71P 966CA 1BIWA 3F16A 4PKQA 1PWPA 2JNPA 1JJ9A 4XCTA 1S4BP 3TVCA 1WNIA 1MMRA 4DD8A 2TCLA 5CUHA 2OW9A 1BQOA 1C8TA 1KBCA 1XFUA 1BZSA 4QKZA 1IAAA 1A85A 2OXZA 3O64A 4IN9A 4GQLA 1YP1A 1IABA 3E8RA 1QIAA 1ZXCA 1K7GA 1MNCA 1JIWP 4JP4A 3DSLA 3HY7A 3DPEA 1I1IP 1GE5A 3B92A 4HMAA 5I3MA 1R1JA 2X7MA 3K7LA 5I2ZA 2YB9A 2DW0A 1Q3AA 2FV9A 4FXYP 3HDAP 2MLRA 4GWMA 1GO8P 2SRTA 4FVLA 4H84A 3TS4A 1JAPA 1XFYA 4H2EA 1SRPA 1Y93A 2W12A 4PKUA 1XFVA 4JQGA 1R55A 3LUMA 1KUHA 3LQ0A 3OHOA 3LUNA 1ZP5A 4DPEA 1QICA 2RJQA 1XURA 3OHLA 5L7FA 4L6TA 4Q1LA 3DNGA 2WO9A 5D1TA 3B8ZA 1IAGA 1OM6A 1Y0VA 2ERPA 5I43A 5D3CA 1Z3JA 1SATA 2JSDA 3EDZA 2W15A 2O3EA 3WV1A 1QIBA 3LQBA 4PKTA 3HYGA 1XUCA 1GE6A 3KMEA 3G42A 4PKRA 3ZXHA 1JAQA 2A8HA 2X3AA 4G0DA 3DPFA 4GF1A 830CA 1EUBA 2L0RA 1FBLA 1JK3A 1YQYA 1R1IA 4H30A 1CXVA 4CTHA 1OS9A 1HFCA 5BOYA 3EWJA 5CXAA 3EDGA 1B8YA 1BUVM 3DTIA 2JT5A 1AYKA 3AIGA 2MZIA 3EHYA 1C7KA 1JANA 4G9LA 3F17A 3K7NA 2J0TA 2OW2A 5D7WA 2FV5A 3I7GA 1DTHA 3DWBA 4PKVA 1D5JA 5CZMA 1BUDA 1CGFA 2Z2DA 1D8MA 3LIKA 1UEAA 5D1SA 1KUKA 3F18A 1OS2A 1CGLA 2WO8A 2K9CA 1JH1A 1DMTA 3Q2HA 3KHIA 1ROSA 1CGEA 1HTDA 4A3WA 3USNA 3HBUP 4L19A 3N2UA 1BSWA 4A7BA 3UVCA 4I35A 3SHIA 3LJTA 4GR8A 3ZUKA 1R54A 2DDFA 1R1HA 2YIGA 2PJTA 3CKIA 3LJGA 4WZVA 1O0TA 1A86A 1KAPP 1CIZA 3KECA 2KRJA 4FXQA 1B3DA 4WF6A 1JIZA 2OW0A 3N2VA 3AYUA 1G9KA 3U1RA 2OY4A 3GBOA 1Y8JA 2Y6CA 5L79A 2POJA 456CA 1G4KA 2N8RA 1I73A 3F19A 3WV2A 4AXQA 4JIJA 4GR3A 2K2GA 1XFXA 3KRYA 4L63A 5LABA 1K7IA 2Y6DA 1IAEA 4IUWA 1CAQA 1JKYA 1HV5A 1GO7P 1GE7A 2W14A 2W13A 2E3XA 1OO9A 1D7XA 1KUIA 4PKWA 3RTSA 2WOAA 2OVZA 5JMYA 3TSKA 4H82A 4ON1A 3G5CA 1G05A 1UMTA 2I47A 1OM7A 5D1UA 1L6JA 1MMQA 5B5PA 1FM1A 3NX7A 4GR0A 4PKSA 4WKIA 4WKEA 1PWVA 1BKCI 1SMPA 1BKCE 1GKDA 4HX3A 1CQRA 4EFSA 1GXDA 3KWVC 3LK8A 1OMJA 4XM8A 5BPAA 3LIRA 2OW1A 1OM8A 4IJOA 1RMZA 3V96B 1EB6A 4FU4A 2OZRA 3HB2P 2OXUA 4H49A 2DDYA 3LKAA 3F15A 3EDHA 2D1NA 4H3XA 4AYKA 2X3BA 2JIHA 3HDBA 2AIGP 2XS3A 1IACA 3F1AA 2JT6A 1ZTQA 1KUGA 1PWUA 3EDIA 1C3IA 1AKLA 3LGPA 3KMCA 1QJJA 1QJIA 1CK7A 4JPAA 2DW1A 4L7AA 3WV3A 4DF9A 1UMSA 5I4OA 3HY9A 1AF0A 5I0LA 2OY2A 4ILWD 1SLNA 1USNA 4R3VA 2HU6A 1HOVA 1MMPA 1BM6A 1ND1A 3DL1A 3LILA 5I12A 2CKIA 3L0VA 1YOUA 3VI1A 1XUDA 4XM6A 1IADA 2E2DA 1UTZA 2EROA 1ZXVA 2D1OA 1FLSA 1GKCA 4ZR5A 1O0QA 1HY7A 3TT4A 3KEJA 1XFZA 1ZVXA 1G49A 1BKCA 3EHXA 4GUYA 2OXWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O2X A;  1BQQ M;  1PWW A;  1QUA A;  1G12 A;  4H76 A;  2MLS A;  3AYK A;  1PWQ A;  2X3C A;  2USN A;  3LEA A;  3B2Z A;  3VTG A;  4H1Q A;  3RTT A;  4XBH A;  1MMB A;  5H8X A;  2OVX A;  3I7I A;  1J7N A;  3MA2 A;  4J4M A;  2MZE A;  4JA1 A;  1ZS0 A;  2O36 A;  1UTT A;  3L0T A;  1RM8 A;  4XM7 A;  5B5O A;  4AIG A;  4GWN A;  5BOT A;  1AST A;  4WK7 A;  2V4B A;  2CLT A;  2W0D A;  3P24 A;  1HFS A;  3P1V A;  5D2B A;  4AUO A;  4I03 A;  1K7Q A;  3KEK A;  3Q2G A;  1I76 A;  2RJP A;  2OI0 A;  3LE9 A;  1ATL A;  2AYK A;  2XS4 A;  2J83 A;  1XFW A;  1SLM A;  1D8F A;  1EAK A;  1KUF A;  2DW2 A;  1YCM A;  2ERQ A;  2QPJ A;  2MZH A;  3HBV P;  1SU3 A;  3ELM A;  3ZVS A;  1JAO A;  4DV8 A;  3BA0 A;  3LJZ A;  3LMC A;  1H71 P;  966C A;  1BIW A;  3F16 A;  4PKQ A;  1PWP A;  2JNP A;  1JJ9 A;  4XCT A;  1S4B P;  3TVC A;  1WNI A;  1MMR A;  4DD8 A;  2TCL A;  5CUH A;  2OW9 A;  1BQO A;  1C8T A;  1KBC A;  1XFU A;  1BZS A;  4QKZ A;  1IAA A;  1A85 A;  2OXZ A;  3O64 A;  4IN9 A;  4GQL A;  1YP1 A;  1IAB A;  3E8R A;  1QIA A;  1ZXC A;  1K7G A;  1MNC A;  1JIW P;  4JP4 A;  3DSL A;  3HY7 A;  3DPE A;  1I1I P;  1GE5 A;  3B92 A;  4HMA A;  5I3M A;  1R1J A;  2X7M A;  3K7L A;  5I2Z A;  2YB9 A;  2DW0 A;  1Q3A A;  2FV9 A;  4FXY P;  3HDA P;  2MLR A;  4GWM A;  1GO8 P;  2SRT A;  4FVL A;  4H84 A;  3TS4 A;  1JAP A;  1XFY A;  4H2E A;  1SRP A;  1Y93 A;  2W12 A;  4PKU A;  1XFV A;  4JQG A;  1R55 A;  3LUM A;  1KUH A;  3LQ0 A;  3OHO A;  3LUN A;  1ZP5 A;  4DPE A;  1QIC A;  2RJQ A;  1XUR A;  3OHL A;  5L7F A;  4L6T A;  4Q1L A;  3DNG A;  2WO9 A;  5D1T A;  3B8Z A;  1IAG A;  1OM6 A;  1Y0V A;  2ERP A;  5I43 A;  5D3C A;  1Z3J A;  1SAT A;  2JSD A;  3EDZ A;  2W15 A;  2O3E A;  3WV1 A;  1QIB A;  3LQB A;  4PKT A;  3HYG A;  1XUC A;  1GE6 A;  3KME A;  3G42 A;  4PKR A;  3ZXH A;  1JAQ A;  2A8H A;  2X3A A;  4G0D A;  3DPF A;  4GF1 A;  830C A;  1EUB A;  2L0R A;  1FBL A;  1JK3 A;  1YQY A;  1R1I A;  4H30 A;  1CXV A;  4CTH A;  1OS9 A;  1HFC A;  5BOY A;  3EWJ A;  5CXA A;  1B8Y A;  1BUV M;  3EDG A;  2JT5 A;  1AYK A;  3AIG A;  2MZI A;  3EHY A;  1C7K A;  1JAN A;  4G9L A;  3F17 A;  3K7N A;  2J0T A;  2OW2 A;  5D7W A;  2FV5 A;  3I7G A;  1DTH A;  3DWB A;  4PKV A;  1D5J A;  5CZM A;  1BUD A;  1CGF A;  2Z2D A;  1D8M A;  3LIK A;  1UEA A;  5D1S A;  1KUK A;  3F18 A;  1OS2 A;  1CGL A;  2WO8 A;  2K9C A;  1JH1 A;  1DMT A;  3Q2H A;  3KHI A;  1ROS A;  1CGE A;  1HTD A;  4A3W A;  3USN A;  3HBU P;  4L19 A;  3N2U A;  1BSW A;  4A7B A;  3UVC A;  4I35 A;  3SHI A;  3LJT A;  4GR8 A;  3ZUK A;  1R54 A;  2DDF A;  1R1H A;  2YIG A;  2PJT A;  3CKI A;  3LJG A;  4WZV A;  1O0T A;  1A86 A;  1KAP P;  1CIZ A;  3KEC A;  2KRJ A;  4FXQ A;  1B3D A;  4WF6 A;  1JIZ A;  2OW0 A;  3N2V A;  3AYU A;  1G9K A;  3U1R A;  2OY4 A;  3GBO A;  1Y8J A;  2Y6C A;  5L79 A;  2POJ A;  456C A;  1G4K A;  2N8R A;  1I73 A;  3F19 A;  3WV2 A;  4AXQ A;  4JIJ A;  4GR3 A;  2K2G A;  1XFX A;  3KRY A;  4L63 A;  5LAB A;  1K7I A;  2Y6D A;  1IAE A;  4IUW A;  1CAQ A;  1JKY A;  1HV5 A;  1GO7 P;  1GE7 A;  2W14 A;  2W13 A;  2E3X A;  1OO9 A;  1D7X A;  1KUI A;  4PKW A;  3RTS A;  2WOA A;  2OVZ A;  5JMY A;  3TSK A;  4H82 A;  4ON1 A;  3G5C A;  1G05 A;  1UMT A;  2I47 A;  1OM7 A;  5D1U A;  1L6J A;  1MMQ A;  5B5P A;  1FM1 A;  3NX7 A;  4GR0 A;  4PKS A;  4WKI A;  4WKE A;  1PWV A;  1BKC I;  1SMP A;  1BKC E;  1GKD A;  4HX3 A;  1CQR A;  4EFS A;  1GXD A;  3KWV C;  3LK8 A;  1OMJ A;  4XM8 A;  5BPA A;  3LIR A;  2OW1 A;  1OM8 A;  4IJO A;  1RMZ A;  3V96 B;  1EB6 A;  4FU4 A;  2OZR A;  3HB2 P;  2OXU A;  4H49 A;  2DDY A;  3LKA A;  3F15 A;  3EDH A;  2D1N A;  4H3X A;  4AYK A;  2X3B A;  2JIH A;  3HDB A;  2AIG P;  2XS3 A;  1IAC A;  3F1A A;  2JT6 A;  1ZTQ A;  1KUG A;  1PWU A;  3EDI A;  1C3I A;  1AKL A;  3LGP A;  3KMC A;  1QJJ A;  1QJI A;  1CK7 A;  4JPA A;  2DW1 A;  3WV3 A;  4DF9 A;  1UMS A;  5I4O A;  3HY9 A;  1AF0 A;  5I0L A;  2OY2 A;  4ILW D;  1SLN A;  1USN A;  4R3V A;  2HU6 A;  1HOV A;  1MMP A;  1BM6 A;  1ND1 A;  3DL1 A;  3LIL A;  5I12 A;  2CKI A;  3L0V A;  1YOU A;  3VI1 A;  1XUD A;  4XM6 A;  1IAD A;  2E2D A;  1UTZ A;  2ERO A;  1ZXV A;  2D1O A;  1FLS A;  1GKC A;  4ZR5 A;  1O0Q A;  1HY7 A;  3TT4 A;  3KEJ A;  1XFZ A;  1ZVX A;  1G49 A;  1BKC A;  3EHX A;  4GUY A;  2OXW A; 
#chains in the Genus database with same CATH topology
 3O2X A;  1BQQ M;  1PWW A;  1QUA A;  1G12 A;  4H76 A;  2MLS A;  3AYK A;  1PWQ A;  2X3C A;  2USN A;  3LEA A;  3B2Z A;  3VTG A;  4H1Q A;  3RTT A;  4XBH A;  1MMB A;  5H8X A;  2OVX A;  3I7I A;  1J7N A;  3MA2 A;  4J4M A;  2MZE A;  4JA1 A;  1ZS0 A;  2O36 A;  1UTT A;  3L0T A;  1RM8 A;  4XM7 A;  5B5O A;  4AIG A;  4GWN A;  5BOT A;  1AST A;  4WK7 A;  2V4B A;  2CLT A;  2W0D A;  3P24 A;  1HFS A;  2YUF A;  3P1V A;  5D2B A;  4AUO A;  4I03 A;  1XM5 A;  1K7Q A;  3KEK A;  3Q2G A;  1I76 A;  2RJP A;  2OI0 A;  3LE9 A;  1ATL A;  2AYK A;  2XS4 A;  2J83 A;  1XFW A;  1SLM A;  1D8F A;  1EAK A;  1KUF A;  3DTK A;  2DW2 A;  1YCM A;  2ERQ A;  1XAX A;  2QPJ A;  2MZH A;  3HBV P;  1SU3 A;  3ELM A;  3ZVS A;  1JAO A;  4DV8 A;  3BA0 A;  3DTE A;  3LJZ A;  3LMC A;  1H71 P;  966C A;  1BIW A;  3F16 A;  4PKQ A;  1PWP A;  2JNP A;  1JJ9 A;  4XCT A;  1S4B P;  3TVC A;  1WNI A;  1MMR A;  4DD8 A;  2TCL A;  5CUH A;  2OW9 A;  1BQO A;  1C8T A;  1KBC A;  1XFU A;  1BZS A;  4QKZ A;  1IAA A;  1A85 A;  2OXZ A;  3O64 A;  4IN9 A;  4GQL A;  1YP1 A;  1IAB A;  3E8R A;  1QIA A;  1ZXC A;  1K7G A;  1MNC A;  1JIW P;  4JP4 A;  3DSL A;  3HY7 A;  3DPE A;  1I1I P;  1GE5 A;  3B92 A;  4HMA A;  5I3M A;  1R1J A;  2X7M A;  3K7L A;  5I2Z A;  2YB9 A;  2DW0 A;  1Q3A A;  2FV9 A;  4FXY P;  3HDA P;  2MLR A;  4GWM A;  1GO8 P;  2SRT A;  4FVL A;  4H84 A;  3TS4 A;  1JAP A;  1XFY A;  4H2E A;  1SRP A;  1Y93 A;  2W12 A;  4PKU A;  1XFV A;  4JQG A;  1R55 A;  3LUM A;  1KUH A;  3LQ0 A;  3OHO A;  3LUN A;  1ZP5 A;  4DPE A;  1QIC A;  2RJQ A;  1XUR A;  3OHL A;  5L7F A;  4L6T A;  4Q1L A;  3DNG A;  2WO9 A;  5D1T A;  3B8Z A;  1IAG A;  1OM6 A;  1Y0V A;  2ERP A;  5I43 A;  5D3C A;  1Z3J A;  1SAT A;  2JSD A;  3EDZ A;  2W15 A;  2O3E A;  3WV1 A;  1QIB A;  3LQB A;  4PKT A;  3HYG A;  1XUC A;  1GE6 A;  3KME A;  3G42 A;  4PKR A;  3ZXH A;  1JAQ A;  2A8H A;  2X3A A;  4G0D A;  3DPF A;  4GF1 A;  830C A;  1EUB A;  2L0R A;  1FBL A;  1JK3 A;  1YQY A;  1R1I A;  4H30 A;  1CXV A;  4CTH A;  1OS9 A;  1HFC A;  5BOY A;  3EWJ A;  5CXA A;  3EDG A;  1B8Y A;  1BUV M;  3DTI A;  2JT5 A;  1AYK A;  3AIG A;  2MZI A;  3EHY A;  1C7K A;  1JAN A;  4G9L A;  3F17 A;  3K7N A;  2J0T A;  2OW2 A;  5D7W A;  2FV5 A;  3I7G A;  1DTH A;  3DWB A;  4PKV A;  1TVI A;  1D5J A;  5CZM A;  1BUD A;  1CGF A;  2Z2D A;  1D8M A;  3LIK A;  1UEA A;  5D1S A;  1KUK A;  3F18 A;  1OS2 A;  1CGL A;  2WO8 A;  2K9C A;  1JH1 A;  1DMT A;  3Q2H A;  3KHI A;  1ROS A;  1CGE A;  1HTD A;  4A3W A;  3USN A;  3HBU P;  4L19 A;  3N2U A;  1BSW A;  4A7B A;  3UVC A;  4I35 A;  3SHI A;  3LJT A;  4GR8 A;  3ZUK A;  1R54 A;  2DDF A;  1R1H A;  2YIG A;  2PJT A;  3CKI A;  3LJG A;  4WZV A;  1O0T A;  1A86 A;  1KAP P;  1CIZ A;  3KEC A;  2KRJ A;  4FXQ A;  1B3D A;  4WF6 A;  1JIZ A;  2OW0 A;  3N2V A;  3AYU A;  1G9K A;  3U1R A;  2OY4 A;  3GBO A;  1Y8J A;  2Y6C A;  5L79 A;  2POJ A;  456C A;  1G4K A;  2N8R A;  1I73 A;  3F19 A;  3WV2 A;  4AXQ A;  4JIJ A;  4GR3 A;  2K2G A;  1XFX A;  3KRY A;  4L63 A;  5LAB A;  1K7I A;  2Y6D A;  1IAE A;  4IUW A;  1CAQ A;  1JKY A;  1HV5 A;  1GO7 P;  1GE7 A;  2W14 A;  2W13 A;  2E3X A;  1OO9 A;  1D7X A;  1KUI A;  4PKW A;  3RTS A;  2WOA A;  2OVZ A;  5JMY A;  3TSK A;  4H82 A;  4ON1 A;  3G5C A;  1G05 A;  1UMT A;  2I47 A;  1OM7 A;  5D1U A;  1L6J A;  1MMQ A;  5B5P A;  1FM1 A;  3NX7 A;  4GR0 A;  4PKS A;  4WKI A;  4WKE A;  1PWV A;  1BKC I;  1SMP A;  1BKC E;  1GKD A;  4HX3 A;  1CQR A;  4EFS A;  1GXD A;  3KWV C;  3LK8 A;  1OMJ A;  4XM8 A;  5BPA A;  3LIR A;  2OW1 A;  1OM8 A;  4IJO A;  1RMZ A;  3V96 B;  1EB6 A;  4FU4 A;  2OZR A;  3HB2 P;  2OXU A;  4H49 A;  2DDY A;  3LKA A;  3F15 A;  3EDH A;  2D1N A;  4H3X A;  4AYK A;  2X3B A;  2JIH A;  3HDB A;  2AIG P;  2XS3 A;  1IAC A;  3F1A A;  2JT6 A;  1ZTQ A;  1KUG A;  1PWU A;  3EDI A;  1C3I A;  1AKL A;  3LGP A;  3KMC A;  1QJJ A;  1QJI A;  1CK7 A;  4JPA A;  2DW1 A;  4L7A A;  3WV3 A;  4DF9 A;  1UMS A;  5I4O A;  1OZ9 A;  3HY9 A;  1AF0 A;  5I0L A;  2OY2 A;  4ILW D;  1SLN A;  1USN A;  4R3V A;  2HU6 A;  1HOV A;  1MMP A;  1BM6 A;  1ND1 A;  3DL1 A;  3LIL A;  5I12 A;  2CKI A;  3L0V A;  1YOU A;  3VI1 A;  1XUD A;  4XM6 A;  1IAD A;  2E2D A;  1UTZ A;  2ERO A;  1ZXV A;  2D1O A;  1FLS A;  1GKC A;  4ZR5 A;  1O0Q A;  1HY7 A;  3TT4 A;  3KEJ A;  1XFZ A;  1ZVX A;  1G49 A;  1BKC A;  3EHX A;  4GUY A;  2OXW A; 
#chains in the Genus database with same CATH homology
 3O2X A;  1BQQ M;  1PWW A;  1QUA A;  1G12 A;  4H76 A;  2MLS A;  3AYK A;  1PWQ A;  2X3C A;  2USN A;  3LEA A;  3B2Z A;  3VTG A;  4H1Q A;  3RTT A;  4XBH A;  1MMB A;  5H8X A;  2OVX A;  3I7I A;  1J7N A;  3MA2 A;  4J4M A;  2MZE A;  4JA1 A;  1ZS0 A;  2O36 A;  1UTT A;  3L0T A;  1RM8 A;  4XM7 A;  5B5O A;  4AIG A;  4GWN A;  5BOT A;  1AST A;  4WK7 A;  2V4B A;  2CLT A;  2W0D A;  3P24 A;  1HFS A;  2YUF A;  3P1V A;  5D2B A;  4AUO A;  4I03 A;  1K7Q A;  3KEK A;  3Q2G A;  1I76 A;  2RJP A;  2OI0 A;  3LE9 A;  1ATL A;  2AYK A;  2XS4 A;  2J83 A;  1XFW A;  1SLM A;  1D8F A;  1EAK A;  1KUF A;  3DTK A;  2DW2 A;  1YCM A;  2ERQ A;  2QPJ A;  2MZH A;  3HBV P;  1SU3 A;  3ELM A;  3ZVS A;  1JAO A;  4DV8 A;  3BA0 A;  3DTE A;  3LJZ A;  3LMC A;  1H71 P;  966C A;  1BIW A;  3F16 A;  4PKQ A;  1PWP A;  2JNP A;  1JJ9 A;  4XCT A;  1S4B P;  3TVC A;  1WNI A;  1MMR A;  4DD8 A;  2TCL A;  5CUH A;  2OW9 A;  1BQO A;  1C8T A;  1KBC A;  1XFU A;  1BZS A;  4QKZ A;  1IAA A;  1A85 A;  2OXZ A;  3O64 A;  4IN9 A;  4GQL A;  1YP1 A;  1IAB A;  3E8R A;  1QIA A;  1ZXC A;  1K7G A;  1MNC A;  1JIW P;  4JP4 A;  3DSL A;  3HY7 A;  3DPE A;  1I1I P;  1GE5 A;  3B92 A;  4HMA A;  5I3M A;  1R1J A;  2X7M A;  3K7L A;  5I2Z A;  2YB9 A;  2DW0 A;  1Q3A A;  2FV9 A;  4FXY P;  3HDA P;  2MLR A;  4GWM A;  1GO8 P;  2SRT A;  4FVL A;  4H84 A;  3TS4 A;  1JAP A;  1XFY A;  4H2E A;  1SRP A;  1Y93 A;  2W12 A;  4PKU A;  1XFV A;  4JQG A;  1R55 A;  3LUM A;  1KUH A;  3LQ0 A;  3OHO A;  3LUN A;  1ZP5 A;  4DPE A;  1QIC A;  2RJQ A;  1XUR A;  3OHL A;  5L7F A;  4L6T A;  4Q1L A;  3DNG A;  2WO9 A;  5D1T A;  3B8Z A;  1IAG A;  1OM6 A;  1Y0V A;  2ERP A;  5I43 A;  5D3C A;  1Z3J A;  1SAT A;  2JSD A;  3EDZ A;  2W15 A;  2O3E A;  3WV1 A;  1QIB A;  3LQB A;  4PKT A;  3HYG A;  1XUC A;  1GE6 A;  3KME A;  3G42 A;  4PKR A;  3ZXH A;  1JAQ A;  2A8H A;  2X3A A;  4G0D A;  3DPF A;  4GF1 A;  830C A;  1EUB A;  2L0R A;  1FBL A;  1JK3 A;  1YQY A;  1R1I A;  4H30 A;  1CXV A;  4CTH A;  1OS9 A;  1HFC A;  5BOY A;  3EWJ A;  5CXA A;  3EDG A;  1B8Y A;  1BUV M;  3DTI A;  2JT5 A;  1AYK A;  3AIG A;  2MZI A;  3EHY A;  1C7K A;  1JAN A;  4G9L A;  3F17 A;  3K7N A;  2J0T A;  2OW2 A;  5D7W A;  2FV5 A;  3I7G A;  1DTH A;  3DWB A;  4PKV A;  1D5J A;  5CZM A;  1BUD A;  1CGF A;  2Z2D A;  1D8M A;  3LIK A;  1UEA A;  5D1S A;  1KUK A;  3F18 A;  1OS2 A;  1CGL A;  2WO8 A;  2K9C A;  1JH1 A;  1DMT A;  3Q2H A;  3KHI A;  1ROS A;  1CGE A;  1HTD A;  4A3W A;  3USN A;  3HBU P;  4L19 A;  3N2U A;  1BSW A;  4A7B A;  3UVC A;  4I35 A;  3SHI A;  3LJT A;  4GR8 A;  3ZUK A;  1R54 A;  2DDF A;  1R1H A;  2YIG A;  2PJT A;  3CKI A;  3LJG A;  4WZV A;  1O0T A;  1A86 A;  1KAP P;  1CIZ A;  3KEC A;  2KRJ A;  4FXQ A;  1B3D A;  4WF6 A;  1JIZ A;  2OW0 A;  3N2V A;  3AYU A;  1G9K A;  3U1R A;  2OY4 A;  3GBO A;  1Y8J A;  2Y6C A;  5L79 A;  2POJ A;  456C A;  1G4K A;  2N8R A;  1I73 A;  3F19 A;  3WV2 A;  4AXQ A;  4JIJ A;  4GR3 A;  2K2G A;  1XFX A;  3KRY A;  4L63 A;  5LAB A;  1K7I A;  2Y6D A;  1IAE A;  4IUW A;  1CAQ A;  1JKY A;  1HV5 A;  1GO7 P;  1GE7 A;  2W14 A;  2W13 A;  2E3X A;  1OO9 A;  1D7X A;  1KUI A;  4PKW A;  3RTS A;  2WOA A;  2OVZ A;  5JMY A;  3TSK A;  4H82 A;  4ON1 A;  3G5C A;  1G05 A;  1UMT A;  2I47 A;  1OM7 A;  5D1U A;  1L6J A;  1MMQ A;  5B5P A;  1FM1 A;  3NX7 A;  4GR0 A;  4PKS A;  4WKI A;  4WKE A;  1PWV A;  1BKC I;  1SMP A;  1BKC E;  1GKD A;  4HX3 A;  1CQR A;  4EFS A;  1GXD A;  3KWV C;  3LK8 A;  1OMJ A;  4XM8 A;  5BPA A;  3LIR A;  2OW1 A;  1OM8 A;  4IJO A;  1RMZ A;  3V96 B;  1EB6 A;  4FU4 A;  2OZR A;  3HB2 P;  2OXU A;  4H49 A;  2DDY A;  3LKA A;  3F15 A;  3EDH A;  2D1N A;  4H3X A;  4AYK A;  2X3B A;  2JIH A;  3HDB A;  2AIG P;  2XS3 A;  1IAC A;  3F1A A;  2JT6 A;  1ZTQ A;  1KUG A;  1PWU A;  3EDI A;  1C3I A;  1AKL A;  3LGP A;  3KMC A;  1QJJ A;  1QJI A;  1CK7 A;  4JPA A;  2DW1 A;  4L7A A;  3WV3 A;  4DF9 A;  1UMS A;  5I4O A;  3HY9 A;  1AF0 A;  5I0L A;  2OY2 A;  4ILW D;  1SLN A;  1USN A;  4R3V A;  2HU6 A;  1HOV A;  1MMP A;  1BM6 A;  1ND1 A;  3DL1 A;  3LIL A;  5I12 A;  2CKI A;  3L0V A;  1YOU A;  3VI1 A;  1XUD A;  4XM6 A;  1IAD A;  2E2D A;  1UTZ A;  2ERO A;  1ZXV A;  2D1O A;  1FLS A;  1GKC A;  4ZR5 A;  1O0Q A;  1HY7 A;  3TT4 A;  3KEJ A;  1XFZ A;  1ZVX A;  1G49 A;  1BKC A;  3EHX A;  4GUY A;  2OXW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...