2J88L

Hyaluronidase in complex with a monoclonal igg fab fragment
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
204
structure length
174
Chain Sequence
b'DIQMTQSPASLSASVGETVTITCRASENIYSYLTWYQQKQGKSPQLLVYNAKTLAEGVPSRFSGSGSGTQFSLKISSLQPEDFGNYYCQHHYGTRTFGGGTRLEIKRADAAPTVSIFVVCFLNNFYPKDINVKWKVLNSWTDQDDSTYSMSSTLTLTKDEYTCEATHKTSTSPI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYALURONONGLUCOSAMINIDASE
publication title Identification of a B-Cell Epitope of Hyaluronidase, a Major Bee Venom Allergen, from its Crystal Structure in Complex with a Specific Fab.
pubmed doi rcsb
source organism Apis mellifera
molecule tags Hydrolase
total genus 34
structure length 174
sequence length 204
ec nomenclature
pdb deposition date 2006-10-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2j88L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2j88L01
5FO8B 1ZAGA 3UC0L 3ZE0F 1KCSH 1S7XA 1QBML 4HC1A 1R3IL 1MRDL 2RFXA 4ONOA 4DKEH 3G6JB 5F7HA 4R0LC 1T0NB 1SJVA 2XTJE 4GW5A 1I8KB 2FEDD 4CMMB 1S7VA 4DVBB 5ESAB 2KQMA 3T8XB 1Q1JH 1IFHL 4G6JL 1WVZA 2FJGB 4M43H 1F2XK 3MLTA 4FFYL 4BUHA 2FECI 4M00A 1OARH 3F7YA 2EDKA 2A9NH 4YX2H 4P2CG 5BS0D 3WCYA 1K8IB 5E9DE 5IESH 3RJDA 4CADB 1TMCB 4UU9A 1A1OA 4ELMF 4XP4H 2HFEB 3BKCL 5FO7A 4PRIE 2EKSA 2VC2L 4NC1E 3WFHA 2ENYA 1REIA 1JZ4A 1S7SB 1A7BA 4XH2B 1MFCL 3O2DH 5K9OB 2Y06H 3T0EA 5J9PA 5I16A 3QIWD 5D1ZA 5ICYB 4KK6D 1BBJA 1IQDA 4OKVA 3CX5K 4KUCF 3CZFB 5TDNB 4JGJA 1KNOB 4I3RL 3UTTA 4Y19D 2C7UA 2CRMA 3Q3GB 2WBJD 5LQBL 1U93B 3N9GH 2C1OA 4H0HB 5F9OH 2E7HA 5H37G 4L4TE 1KJVA 5I76B 3H9YA 4XWOD 3Q5TA 3UTZB 3CDFA 1RU9L 4YDKH 4X6FA 1KN4L 2Q87A 2FD6H 3QT2A 3RY6A 3A6CH 2X4PA 3UTOA 1FNSL 1RK0A 4LBEB 4R90L 4OQTA 3P4OA 5JW4N 3MRBA 4EQ3A 3GJEA 1WT5A 5BS0A 4G6FB 4OCRL 1DP0A 1MCNA 2BVOA 3LDBC 2GJ6A 4NNXB 4MLSA 2NY1D 3HB3C 1WBYB 3H7LA 4LLWB 2EDBA 5F93C 2VZSA 3VRJA 3D39A 3LQZB 4LCCB 5E2VL 12E8H 4EBQL 1JK8A 3K4DA 4K71C 4OUUA 4TNVK 5JIKA 4B50A 4JFYA 1IKNA 3ARUA 1OF2B 5D7LA 3TO2B 3RZCD 5GGUA 4P3DB 2VDRL 1T03H 3QIWA 4XGZA 3P11H 5FFLA 5HHQB 4FNLH 3RX8A 1N64H 1EO5A 2R0LH 4PRHE 3BRDA 3BEWB 5BRZB 3KPSE 5BW7C 2CDFB 2ZNXA 4Y19A 3MA9H 2E5EA 2WBJA 2VLKE 4QRRD 2R4RH 1U8IB 3L5WB 3V5DB 2YD1A 4DGIH 3M17B 1GHFL 3G5YB 2FIKA 5JDSA 4GKSB 4RFNC 1F4YL 1ZA6A 3O8XD 2QADC 5GISL 4OLYH 2PTTA 4HGKC 1BMGA 2BERA 1KCRL 5DS8A 3GSQB 2Q8BH 3H2WA 4XNZB 4NZRH 3QCUH 2XXMB 2V5RA 1UJ3A 4OZ4B 2OJEB 2Q3AA 1NAMA 1MSPA 4LLVB 4PY8I 3ARSA 5DQJB 1GC1L 1JPTL 4ODTH 5FF6A 3PJSA 4KK8D 5E1AA 3OKNA 5GS2H 3D0LA 4F9LC 3P0YH 4IHOA 2DWEA 3FN3A 5DJCA 4KK9D 1ORQB 1XAUA 1L4IA 3B9DA 3S4SB 5C0EA 5A3ID 3MSPA 3GHEH 4JY5H 3S3SA 3L3GA 5ACLA 2Q8AL 1MQKH 4EI6A 2OL3A 3NVQA 3BDYL 3EO0A 4F37F 1QFOA 2BSED 1YYLL 1FVCB 3IFPB 1AD9A 2R2EA 1FNFA 3L5XH 3CFCH 1XT5A 3HI6L 1QFPA 3TVMD 5AAMA 1IGML 5DJ0B 3O3EA 4HJ0C 4QRRA 4KJYA 4RGOL 2R0WL 3QAZC 1G6RL 1GGBL 5BMFL 4LF3A 1L0YA 1MWAH 5FYLH 3VXUA 3O8XA 1T66D 3P4NA 2AJ3A 3PHSA 4WNQB 5A16A 1IC7H 3PWNB 3RKDC 4LCYA 3BGFB 4HD9A 4ZSOE 1RZIA 3TYGH 3U4BH 1BIHA 4OCXH 3H7BB 4ODXA 3MACL 3QBTB 2ICEA 3O4OC 3LHPH 4OGZA 1MI5E 5FCSH 3F7VA 1CICD 3S96A 2OQJB 3QNZA 3HE7C 3W11C 1KG0B 4XCCH 2IFGA 4LGPB 3BKJL 4Q9BA 4FABH 1PDKA 3KJ6H 5C08B 1IILE 4OB5H 1K3ZA 2DQDH 5EIQA 1LMKA 1R3HA 1DDHA 2NNAA 4NBZB 2GSGB 1BJ1H 1PGRB 3RP1A 3TVMA 2Z31C 4NHCL 4MCZA 4X6DF 5GRZA 3RVVD 3G08A 2UZXB 4S1DD 3MLSL 5C07B 3B9KC 3WDIA 3HRZA 4KXZH 3N1QC 4YFLF 3L3DB 3DXAE 4N1EA 1JP5A 2J5LB 5F9WC 3LSOB 3CLFH 3ZLQC 4XBPA 2FJHB 4QGTA 5I15L 1DBBL 2DQJL 2X42A 1UM6H 4BYHA 5E2UL 1NMCC 3MRLA 5FYKL 5KSBB 4LARH 2NW3A 3CVHL 2IFFL 4F58H 1CZ8L 1RV6X 1QRND 2WANA 3FT3B 5FM5M 4HH9B 1GCFA 2WUBL 1WCBA 2H1PL 5J7CC 1AXSB 4HV8A 2HT2D 1CICA 3I9GH 4GAJH 5I1HH 1OAXL 1T2JA 4LVHB 1JPFB 1EAJA 4KKAD 3ZE1F 1G6VK 1UEYA 2YUXA 3TN0C 1S8DA 1U3HC 4PJFB 1SVZA 4YHNB 4JN2B 5JW3H 3BQUB 3LPFA 2K7PA 2OTUA 4Q9RL 4OLUL 2ZCKH 4X9GA 2XI9A 3OAZK 3QIUC 1HCVA 1S5HA 3H6JA 4HKZB 3VE0B 3DUUB 1HHIA 5MEPB 1RI8A 3EKCA 3P4MB 3VFOB 3U6RB 2JB6A 2VISB 4H25B 4MNGB 1PG7W 4BH7A 4M3JA 4D94A 4Z0XB 4K7FA 1A6UL 3KYKH 5FCUH 3QHZL 2ESVB 5LGHL 3UC0H 1QP1A 1QBMH 5DUPH 1V5JA 4HUKB 4RAUB 1R3IH 1MRDH 4ONGL 1SJEB 3DUSA 4CU8A 4P5KA 2LU4A 3RPKA 1PYWA 1I7UB 5JW5A 5INCA 1NJ9A 1AGDA 2KZ1B 1IFHH 4G6JH 4H8WL 4KROC 5ECJE 4FFYH 1QFWI 2QHRL 1AGFA 5T3ZH 5C71A 2GITB 5J1AA 4L4VD 4ZUVB 1OT2A 5BV7L 3K8MA 1QRNA 3DX6B 5ICXA 5IB3B 4G42A 1R5WA 3M1BB 4RBPH 2CRYA 2VC2H 4J1UA 5DYOA 2ADGB 1YN6A 1MFCH 3N85L 1HK6A 1G9MC 2YBRA 4HUNB 1B0RB 2FHCA 1TLKA 2B4CH 1LHZA 4I1NB 4PJGB 4HIEB 1T21B 1OLLA 1NGPL 2R2HB 1JZ2A 3KYOB 4I3RH 3BEVB 4MZ2A 4KUCD 2NY0D 5LQBH 1UH2A 5EBMB 3CSGA 5CKGA 1ZA3A 4BZYA 3L5JA 1RU9H 2GQHA 3LH2H 4UTBL 3CFBA 4ZFOB 1E4JA 2NY3C 1YPZB 1KN4H 4QRPD 4PJEF 3QZWA 3OKDB 4APQC 5F7MC 4OF8A 3PWPE 4IMKC 4R90H 4P23D 2WWKT 3HS0A 1T5XB 1DQML 4ELKA 1SQ2N 3G6DL 4UIKH 2MQ0A 1S7XB 2AEPL 4ZO9A 1A2YB 2NY7L 3C5JA 5E2VH 1P2CA 4EBQH 4EQ2A 4JRWA 3RWJB 4ELMA 4S2SB 4FFVC 4OZGE 1EHNA 3C8KA 2PO6D 4GFTB 1H15A 4PLJC 1IEHA 3MLTB 3WEXB 2XWBA 3F7YB 4DZBA 2YPKA 4OLEA 1BP3B 4UI2A 3GJFH 1AO7E 4NN7C 1Z2KA 2LV4A 3BN3B 5JA8B 5EU3A 1FSKB 5HY9B 3BDXA 5FO7B 2H26B 1N3NA 4MLIA 2YR3A 2NY4B 4BKLB 1GHFH 4WFHD 1OSZA 1F4YH 4N1HB 5KVFH 5GISH 2COQA 2JTDA 3S5LG 3T0EB 4ACPA 3HPJA 4RSVA 4QRUA 5I16B 1KCRH 2XOTA 3QFDB 4MVBD 2EE2A 2WLYA 5FGBA 1AXIB 1BBJB 3GRWL 1KJ3L 5MI0C 4OKVB 5HGAB 3DMMD 3QA3A 2Q20A 3UTTB 2C7UB 4HGWA 1GC1H 4Z7VA 1JPTH 3W0WD 1CIUA 1S3KL 2C1OB 1FYHB 3RNQB 5I2IB 2H2PD 5JHLL 3MV11 1VPOL 2PO6A 1II4E 2YK1L 4Y4KB 1M05B 2X4PB 2XICA 5EBLB 4JPVL 2CKNA 1RK0B 1EO8L 5IB5A 4X5WA 3P4OB 3MRBB 4PY8J 2Q8AH 5BS0B 3BDYH 2BVOB 1YYLH 2F54E 4DN3L 2QQKL 3FHQA 3QO0A 1JPST 3HI6H 1ITCA 1AI1L 1A7NL 4OUUB 4WI7A 4YQXL 4J3VA 1XGYL 2R0WH 3LKSA 1GGBH 2EC9U 5BMFH 4ZUTA 3UDWA 5L9DL 3MA7A 3QHTC 5KSUB 5K59E 1LO2L 3NIFE 4XGZB 2ICWI 1OWWA 3DMMA 3C6SA 5CZXD 2Y36H 4Y19B 4UINL 3GSWA 1NFIA 2WBJB 2X10A 1ACZA 3H3KA 3P40A 2VLRD 3MACH 2FIKB 4UAOC 5JDSB 1P1ZA 1S9YB 1RIHL 1DANU 5JMRA 4P4KA 1NMBL 4WI8A 1M71A 3TBWA 3D85D 3MRGA 4JY4A 4YZFE 5DS8B 1TNNA 1CGSL 3IRZA 5FIEA 3BKJH 1Z9LA 4LVOB 2BNRE 3VFMA 1S7UB 4OLZL 4NCC2 4BH8A 4DN4L 2NY1B 3H0TA 4WEBL 1PKQA 2V2TB 3LZFL 2IPKA 1HH6B 5E1AB 3GMPA 4NHCH 3QDHA 2DWEB 5DJCB 3MLSH 3L3OA 2ZKHL 5GGTA 1VFBA 3IJHA 4XC3L 3JUZA 3RZCB 5DJ8B 5C0EB 2VLJE 3SN6N 4MD5A 1LDPL 1Q9WA 3S36L 2OL3B 4WWID 4KHXL 3U30B 4Q6IA 2AXFA 3IYLW 3RGVC 1N8ZA 3U4EB 3TBYA 2B1AL 4HFUL 1DBBH 2DQJH 4J7RA 4MD4A 4W6WB 3TH2T 5I15H 5E2UH 5CIPA 5FYKH 3IFOB 4QRRB 4KJYB 1PVHA 3CVHH 4HG4J 2IFFH 2VLRA 1CZ8H 2E9IA 4LF3B 3JTTB 1Z9SA 3O8XB 2A73A 3P4NB 2H1PH 3NCBB 5IMOB 3D85A 3QWOA 1FC2D 2F8VA 1OAXH 5C9KA 4OZHE 1EGJH 4LCYB 5C0JB 1DEDA 3LRHA 4Q9RH 4OLUH 1B88A 1RZIB 2DWDA 4UNTA 1NANH 2YZ1A 3EW3B 4YEFA 4U3HA 4XP5L 5IHZA 4EEEA 5IFJB 4ODXB 1EDQA 4S0SD 4WWKD 5E8EA 2HKHL 2ICEB 2ZUQC 3CSPA 5DEZA 1RSFA 1A6UH 2E9JA 3F7VB 3QHZH 4CJ0A 1Z6JT 3VFTA 3V4VL 4ZYKA 4ONGH 3R0MA 1E27A 2I9LB 3QEQE 3CXDL 3HZKA 3D9AH 3QNYA 4DVRL 2X4RA 1R3HB 4UQ3A 1D5ZA 3MLVL 5TF1H 3IFLH 4PREB 1ADQA 4H8WH 5E6ID 4ZNEE 2ZUTA 4JJ5A 2QHRH 4MCZB 3G08B 3A0OA 1IGTB 4NWUL 2X44D 3HAEA 4NFDA 5BV7H 4S1SL 3HRZB 4HDIB 5B8CB 3RVXC 4K7PL 3V6OA 4PJ9C 1DLHA 1MAML 3FO9A 4I0CC 4HKXA 5I1AB 4D2NA 3X17A 4QRSA 4XXDA 2IBGA 2F15A 4M7JL 3MXVL 4MMXC 4KZDL 2BY2A 4MQ7B 3N85H 3MRLB 4PRDA 2ZCHL 4XHJD 4EXKA 5IVXE 1X4YA 4HBQA 4WWKA 4ZUSA 2OI9C 1NGPH 4PPTA 3GIVA 2P42B 5A43C 1H3XA 1CICB 3B9AA 5CSGA 4P46D 2HT3D 1FZMA 5C0NC 1A7QL 1KLGB 1HXYA 1S8DB 4HZLA 1U8OA 5C0DA 3T4YB 3EO1A 4ZUUA 3O6FD 4N8PA 2OTUB 1BD2E 4WUUE 4LRIC 3QUYC 2GUOB 4F2MB 2DDQH 5BJTA 4M62L 1HHIB 3KJ4C 2VSCA 3HC0A 5E6IA 2QHLA 3EYQC 5GGVL 1TTUA 2JB6B 2IC2A 4BH7B 5IBLD 4UB0L 3STLA 1DQMH 4K7FB 3G6DH 1CDUA 2AEPH 1WWCA 4X9HA 5GHWL 3CMOL 3R06A 4E41E 2NY7H 1DBKH 1PYWB 2EH8L 3QWQB 5JW5B 2O5ZL 3QDJE 1BFOA 3ES6A 4Y5YA 5FB8A 3IVKA 3HZMB 3VWJD 4NDMA 5DHYA 3GBNL 2EXYC 5JHDD 4ONHB 3MODL 5DJDA 1OCWL 3E6FB 4U0RB 1AGFB 4TVPD 4ENED 1NBQA 5HJ3A 3RQ3A 1QRNB 3M8OL 5DRNA 4G42B 1X5YA 1R5WB 1BJ1J 5KZCD 1AHWC 1OTTC 2FRGP 4RGND 5DEFA 1H3WM 1ZXQA 1ZLVH 1OPGL 5DYOB 4NKQB 5B39A 3GMMB 3O6FA 4A6YL 1YN6B 4MXWH 1LDSA 3IDJA 4QOKB 4I0KA 5SWSE 1MJJA 1Z5LB 4P2RE 5E08L 3OJMB 4GUPB 2UWEE 4LQ1A 2XTJD 2BRRL 4PJEA 4WV1C 3D18A 5FYKU 4C55A 4NQEE 4TSCL 3GRWH 1KJ3H 4RAHA 4XZUB 5HYQB 5MEOA 3ULSB 4WFFE 5I1GL 2M8XA 2R39A 5HGDA 2IAMC 3GMQA 3QQ9C 3DX8A 3FB5A 1IEAB 4J4PD 5FECA 1NANI 3MBXL 1TVHA 4GG6B 1FHGA 1YEEL 5JHLH 3HUJB 5E9DD 2GTWB 1VPOH 2HP4A 4OZIB 2Y9RT 4PRID 3QZWB 3VWJA 2YK1H 2DIAA 4OCWL 4K23L 5JHDA 1EO8H 5C6TL 2IANE 1L7IL 3HS0B 4ELKB 4JREB 2YD7A 4L4VB 2P7TB 2QQKH 3CH1B 4DN3H 2G2RA 5F1NA 4OJFL 3ZZ1A 2D9QB 5E8PB 1AI1H 5J3HC 1A7NH 1CGUA 3KDMA 3KYAA 4YQXH 2CGRL 3WJLC 1XGYH 3ZHDA 4JG1L 5E7FA 3BYTA 4LLMB 4FG6D 5L9DH 3ULVL 4H1LH 3NFNA 1LO2H 4L4TD 1FP5A 4DZBB 2YPKB 3WMSA 3FO2B 1KT2A 2QQQA 2VRAA 1SM3L 4K9EL 2DRUA 3FT4A 2NY0B 4UINH 4J4PA 2WZPD 4YHPA 1I3UA 4L9LB 4HW6A 5B38B 1RIHH 4JO2H 2ITDB 5E24E 4QRPB 1NMBH 2AJUL 3VCLB 4PRIA 4OZGF 1PFCA 3BJLA 3ZE2E 4MQSB 4P23B 1CLOL 2LFGA 4OLZH 4GW4B 3RKPA 3HMXA 4LHQB 3QNXA 3U7YL 4DN4H 2YOCA 4HGWB 4A2MA 1CVRA 4WEBH 4F7CA 4H20L 1AFVL 3TCXA 2A0LC 3LZFH 1FZOB 5LGJB 4WTWA 1NEZA 4R0LA 4YH6A 1YEGH 2Z8VC 4JDVA 4N0CD 1Q9KB 3PABA 4PRHD 3KPSD 3HR6A 4FFWD 4XC3H 4RDQG 2VLKD 3HPLA 3DIFB 5KN5B 1HSBB 1IAOB 4L4TA 5E5MB 1B6DA 1LDPH 1Y0LB 2DBLH 3S36H 1OAKL 4OFIA 4KHXH 3R1GL 2XZCH 3GSNL 3HB3D 3QIBC 3RIAK 3WO3B 2P8PB 2B1AH 4HFUH 1OB1A 1F6FB 5C0CB 4M93C 3ORJA 4WU5A 1HIMH 3WO4B 2F8OA 3LKSB 2WBKA 1VA9A 4NN5C 1U3YA 4U6XA 5L8JB 1WZLA 3MA7B 3ME0A 2DL9A 4LVEA 4PG9A 5IB4B 1F13A 3ROOB 1OY3B 1NEUA 4MA3B 1G7LA 1CDCA 5TPWL 3EYSL 3CXHJ 4DOHB 4HUMB 3CFEA 4GMSH 4LCIL 1ES0A 3DMMB 3SDCC 2FHBA 3BOVA 1SY6A 3C8DA 1S7WA 1NFIB 3GSWB 3W0WB 3KPLB 4XP5H 1EEZA 1J5OL 4P4RA 5H37H 3SDYL 3DYPA 2VDNL 2HKHH 5EFIA 4KKLC 3KPMA 4PRHA 2QADD 3KPSA 5F1SA 3GSUA 1M71B 1UVQA 5D2NA 3L6FB 2VLKA 4LIQL 3V4VH 4OCLC 4QO1A 5F9DC 4BSWB 3CXDH 5K59F 3VFMB 1HKLL 3NIFF 3K46A 1AR2A 4LPYA 1PG7X 2UV3A 4DVRH 1BVKA 2L0DA 3VRIB 4X4YA 4MA1B 1PKQB 1KJMA 3WJJA 2I26N 5HYFA 3MLVH 4ZUWA 2Q7YA 2YKLL 4OUOA 3U48A 4OV6F 4MD0A 1UWGL 1MHCA 2XTLA 1EZVY 4KRMB 1NL0L 4NWUH 2IH3B 3IJHB 2DJ4A 5I74C 3BIBX 4S1SH 5SV4A 3BE1L 1MAMH 3IKKA 3MGOA 2ZUXA 4PV9A 4YZFF 4QTHA 1LEGB 3TO4C 3PIQB 1MI5D 4Q6IB 4MDIB 2AXFB 4BA8A 1U8NA 3MXVH 2AP2A 2BNQE 4M7JH 3UZQA 5BW7A 4KZDH 3TBYB 1RJYB 4MD4B 5D6DC 2ZCHH 4HJ0D 3FCTB 2RQ8A 3OV6A 4KKBC 5JNYA 2A73B 4NKOA 2DIBA 1A22B 4NQXA 1I75A 1XZ0A 1CXLA 5MEQA 1MJ8L 4JB9H 1A7QH 1F11B 3W9DA 1Q9LA 3RKDD 4MAYC 2D7OA 3EOYG 3D69B 1GZPA 2GFBA 3GSRA 1MLCA 1DFBH 1N0XL 1SEQH 1KFAL 3NCJL 2DWDB 2IH1A 4M62H 3PF2A 5IHZB 1W8OA 3RUGE 4MB3A 3AFLA 3GHBL 1QPPA 3JTSB 1QO3B 4F9LA 1P4BL 5GGVH 4UBDC 2J6EL 1A14L 5TE4L 1INDL 1T1XA 4NHUB 4UB0H 3QEHA 4ZSOA 1T4KB 1BOGB 4R4FL 2DYPA 4ZD3L 3F58L 4X6DB 4JFQA 3HE7D 1OW0C 4LSPL 1CWVA 1VERA 1B2WL 3JWDH 3UPAA 4AL8L 5GHWH 1NGQL 2X1XR 3CMOH 4RZCA 5M7QA 1J1PL 1E27B 3HZKB 2MCPL 5HHVL 2EH8H 3ARGD 1DR9A 2EC9T 2O5ZH 2OXHA 2ZSWA 2Q1EA 3I3DA 4K3GA 2Z92A 3QNYB 4RWHA 1MI5A 2R0KL 4OZHF 3NGBC 1LEIB 1D5ZB 4O2CA 4KMQA 3GBNH 1P4LA 5E4EC 3A6BL 2Z31D 1QUNA 2HFFB 2AXGB 3LV3A 3MODH 3ARZA 3MO1A 1OCWH 4M8QA 2MHAA 3HAEB 1HDMB 2UUDH 4HJGB 3B9KD 3M8OH 4PTUA 2ARJA 5DRZA 1YEDA 4TNWK 4QEGA 3FO9B 5DT1L 4PJHA 1NGYB 1FRGL 2A38A 1OPGH 3RBGA 4U6YA 4XXDB 3QFJE 4A6YH 1DE4B 3Q2CA 1S9KC 5E08H 3GFUA 2BRRH 3DXAA 4LMQE 4WWKB 3PUCA 5FV2A 4TSCH 3MGAA 3BO8A 1U41A 3V6BR 3P9LA 3GIVB 2WUCL 3U9PH 1PLGL 3JV4B 5I1GH 3OB8A 1IM3A 2BOCA 3HE7A 1FZMB 3IDMA 1VEPA 1CK0L 1R24A 3MBXH 3TN0D 5CUSL 1U8OB 1U3HD 5KVMC 1A0QH 4ZUUB 3SDXB 1YEEH 2BRQA 5HYSB 3FOLA 3QPQD 3QIUD 4EOWL 2AJYH 3S88H 1T0MA 3WDHA 1ZGLM 4OCWH 5E6YA 4K23H 5E6IB 3HC0B 2Z31A 3AS1A 5DDHA 1KTDA 5C6TH 1L7IH 1P6AB 3DNKA 3STLB 4M6OH 4GRWH 1KPRB 3B9KA 5IVXF 1MAKA 3AB0C 4Q7DA 4OJFH 3BHBB 3BFOA 3RL2B 2CGRH 4F9PC 3CC5A 4JG1H 1NMAL 2VDOH 4Y5YB 4NDMB 1MCPL 3NMEA 4K94L 2A6JA 3ULVH 4KROD 4JAMA 1AJ7L 2AJVL 3C09B 1JNHA 2CIIA 5I8KL 2HMIC 3DI2B 1SM3H 4K9EH 5HJ3B 1YECL 5DRNB 3HLAA 2AW2A 3L1OL 1G7PB 1OQXA 3PWPD 4P46B 4S1RL 2VYRE 4QF1A 2R2BA 4KRPD 2WINA 1U3HA 3JWOL 3B5GA 3O6FB 2PW1B 4KQ3L 3IDJB 5D8JL 2AAVA 1JZ7A 1MJJB 4HK3N 3ARBB 2AJUH 3DVNA 2MQ3A 3V0VA 5IHBA 3P9WB 4PJEB 3DUHA 5HDOA 1RJZA 3MV7A 2FO4A 4WW2B 5MEOB 1BOYA 5D1XB 5HGDB 1G7HB 3U7YH 4NRYA 4NRZA 4QRQA 1I8MA 2GIYA 3GMQB 2AI0L 3DX8B 3FB5B 4H20H 4RRPA 5FECB 4CUCA 4GAFB 3SDAC 1TVHB 4X7CC 1WISA 1KOAA 4LDLB 3WIIL 1AO7D 2C3GA 2QEJA 4FXGA 5J6HB 2NY3D 1ITBB 1JRHH 3OSKA 3VWJB 4APQD 3B3IB 2HVKB 3OG4B 5CHNB 5JHDB 2X89D 3QZWG 5F89A 1VB9A 2UWEF 1OAKH 4RAVA 3MTRA 3R1GH 2YC1A 3GSNH 1H5BA 2Q7NA 3IAGC 5EZOH 4OT1L 2G2RB 1J0JA 2BSRA 2IWGA 5F1NB 3X12A 1EJOL 3PWPA 4HUVB 3X13A 4RGNB 4XAKE 3KDMB 1S7QB 4FFVD 4FQ1L 3O41A 5F7UA 5E0QA 3PDGA 1QBAA 3K2UL 3O9WB 1Q0YL 4PLJD 4XCYA 2CXGA 3NFNB 2E7LC 4FHBD 3LRGA 2XTJB 1CDJA 5CINL 2F19L 2D7TL 5D7JC 1A21A 5TPWH 3EYSH 1KT2B 4JQXC 4UDUA 4OZGA 4JM2A 4LCIH 1P69B 5HVHC 2B2XL 5GIRA 3B5TA 1BJMA 4M6AA 1J5OH 5JW4R 3KAAA 1TPXB 4YHPB 5D2LF 4GAYA 2EDYA 2IADA 2FO1A 4ISVB 3SDYH 1MCSA 3IXAA 1F02I 2F54D 5E9DB 5F1IB 1JE6A 3MRHA 1FVEA 4PRIB 4WCYL 4APQA 5E2JA 5J11B 4LIQH 2X89A 4JKPL 1VACA 4IMKA 1WAAE 5A2KH 3T3PE 4G8GD 4UILL 2RAMA 2GJZA 2OZ4L 1QQDA 1HKLH 1RZ8B 2MQCA 3RWEB 1SVCP 4F7CB 5I73C 1PEZA 4QHKJ 3ZKXB 1WGOA 1DLFL 4M7ZC 4PIRF 2YKLH 3BPOC 2A6DA 1UWGH 4JDVB 4QLRA 3UBXB 3IB4A 3OGCA 2V5MA 5KJRL 1I7TA 1XGPA 3HPLB 1G7IB 1WK0A 3FL7A 4X9BA 3BE1H 4C83B 5BCAA 4L4TB 2CPCA 4LHUD 5CJ8A 3EGSA 1OTSC 1AGCB 3ZE2F 4N68A 4L3CA 1OB1B 3OPZH 3BKYL 3V7MA 3WNPA 1LWRA 4EI5C 1HHKB 2VO5A 2BNRD 3MYJB 4P5MA 1QACA 5F9AC 4U6XB 3IS0X 1DEEA 3FO0L 4Y1AB 5CILH 1WICA 5GGSY 3RIFK 1IJ9A 2EDLA 3T0DA 3BD3A 3PGDA 1MJ8H 3V0WL 2BOBB 4OBSA 4ZDHA 3CFEB 5CAYB 1MCHA 1N0XH 1MIEH 2AXHA 1KFAH 3NCJH 3MR9A 4KKNA 2VLJD 4R6UA 3V79C 1UG9A 5LCVL 2XZAL 5HHXL 5ADOL 4P4RB 1RFDH 3GHBH 2ZUWA 1P4BH 3S3PA 3GGWA 1A14H 5TE4H 3HCVA 4PRHB 1INDH 3KPSB 4R4FH 5I66B 4ZD3H 1XFPA 4LSPH 4NKMA 1B2WH 4AL8H 3SCMC 1J1PH 5I1IL 1U3ZA 4LHUA 2MCPH 5HHVH 3LPWA 4X4YB 1KJMB 4ZTPL 3BP4A 3C6LB 2FEEL 1OAZL 1FCCA 1K4DB 3A6BH 1MHCB 4K71B 3WHXA 1BIIA 5F88A 4U3XA 4YDVB 2MTPA 1T20B 2ILLA 1F58L 2Y4SA 5DT1H 3LEYL 3MGOB 5FYJU 3U2SA 1J0KA 1FRGH 4YWGL 3P0GB 4QTHB 4XNUL 4I48B 4GRLC 1U8NB 1U8HA 1GOFA 1WCQA 1U2HA 2VLJA 3BZEB 2BMKA 3TEUA 4ZXBC 3QEQD 3AS0A 5ID0A 3PNWA 3KLSA 1JI1A 4HG4K 1JGEB 2QADB 2WUCH 1PLGH 4ZO8A 1AD0B 1FFOA 1KJ2A 5KW9L 2J7LA 4PJDB 5TDPA 3CD4A 1BZ9A 3L3IA 1CK0H 1Q9LB 4KJQC 5CUSH 2D31A 1B4JL 3OX8B 1MLCB 1WZMA 2GFBB 2IH1B 2BNUA 4EOWH 4XX1E 2QSQA 3MRQB 1X5ZA 2P5EA 4OZHA 2AJXL 4RFEB 2EYSA 3RY4A 2FNBA 3QEHB 4QRTA 5M94B 4ZSOB 1NGXB 1QNZL 4JFQB 3I3EA 2X9XA 4RZCB 2AEQH 2R1XA 5GRUL 3CFKA 3R4DA 2ZSWB 4OQTL 5FGRA 5D7SL 2NY5C 1NMAH 4S1QL 1MI5B 1NUGA 4V1DE 4G3YL 2P49B 3RGVA 4AK1A 1KIUA 2UY7A 4O2CB 5T1LD 4YHZL 1WTGT 1MCPH 1P4LB 4PR5A 4K94H 3VXTA 5EDXA 3LV3B 3QEQA 2APWA 2WNGA 1AJ7H 2AJVH 5I1CL 3MUGB 1BD2D 4WUUD 3RUGF 5KVGL 2ED9A 3WXVL 3HAEG 4UOW0 1YNTB 2ARJB 1I1YB 3RVXD 3T0BA 2NY2C 3L1OH 5DRZB 2B1HL 4Y4HA 4PJ9D 4ZNEA 4S1RH 4LLDA 3GDBA 2I5YL 3H42L 4JVWA 4WRLA 3JWOH 5JW4M 2D7PA 4U1SA 4KQ3H 2W0LA 5D8JH 3CLEL 4E41D 3ABZA 1M6OA 2NR6C 5JLZA 1FDLL 2PW2A 2E3VA 4XVSL 2I07A 3O4OB 2DLFL 4HWBA 3BO8B 1I3RB 3QDJD 3P9LB 1XCTA 4HH8A 3QO1A 3FFDA 3HE7B 2AI0H 4RQQA 5C0ND 4I18C 1R24B 5IVXA 5DFTA 3LD8C 4KDTC 3IETA 3SHSA 3WIIH 3ARGB 2CKBL 3W5MA 3QUYD 4F3FB 1NAML 3RWFA 4I0PA 1OOAA 3REVA 5T1LA 1VGEL 1H3UA 4JGUA 4XPFL 3EYQD 4TPRL 2RCSL 5FYJE 1I7RA 1OM3L 5EC2A 1BD2A 4WUUA 5SWSD 3B9KB 1VFOA 1ZLSL 2Z35B 4OT1H 1P5VA 3Q6FB 1EJOH 3L95A 3AXLA 4NQED 3RGHA 3ARQA 3CC5B 4FQ1H 5F70A 4WFFD 5DI8B 5F9WB 1RK1B 2OL3L 3K2UH 2EXYD 4E41A 1NMCB 2A6JB 1Q0YH 3QXUA 1YNKL 4PBVC 5FDYA 4JAMB 4P3CL 1Y18A 4X7DC 5CINH 1YEJL 4WFGE 2D7TH 1JNHB 1A7OH 3QXVA 4OIBA 3OGOE 3HLAB 4Q9CA 2B2XH 1CD0A 3GUTA 2FBJL 4YC2B 1JIBA 2PN5A 1OTTD 4Y8DC 1P5UA 2IAND 4HK0A 5ACZA 3TN0B 4GW1B 1U3HB 4JHAH 3DURA 1XR8A 5B39G 2G9HA 4LRIA 3QUYA 1KIRA 3QIUB 3DVNB 4TQEL 3PGCA 4WCYH 4JKPH 4RX4D 4UILH 2FCBA 2OZ4H 4NQSA 4EN3C 1V8HA 5SWSA 4QRQB 2IAMD 4P2RA 2W60B 3QQ9D 2NTFB 1D5XA 2UWEA 5IWLC 3ZKQD 2MOVA 3JUYA 4BQCA 4NQEA 1BLNA 3OR6A 3ALXA 4FXGB 2OR9L 2QR0B 5GJSL 4NBYB 2ENSA 3G6JE 4HS6A 5KJRH 1BEYL 1WZKA 2VABA 1FQ9C 1NCCL 4JFFB 3FFCE 3ZYOA 4KROB 4JFEA 1DCLA 3GNML 4JKLA 2ED8A 2YC1B 4NUGL 3MRPA 1JWUA 4TNWF 2BSRB 4X6BA 3B2UC 4WGWB 3PWPB 3BKYH 1AHWA 5J3HD 4TULL 5FYLE 2IANA 3O41B 4KRPB 1A1MA 4NQVA 3SKJH 3D3VE 1F5WA 4FQJL 1CGYA 1I9IL 2YS4A 3FO0H 5GS0C 3CFIC 2AJZA 3P77A 1BWMA 3ET9F 4WV1A 3V0WH 2WW8A 4RX4A 4UDUB 3I6KB 4OZGB 4O4YL 5EO9A 4LCCC 2VXUH 1TVDA 4PGBB 4PGEA 1TIUA 2IAMA 3CDGB 3NA9L 5LCVH 5HHXH 4MDJA 4PLNC 5ADOH 4GAYB 2ITCA 3OF6D 3IXAB 4JKWA 1AO7B 3WFZA 4QTIH 5JIPA 4AZ8A 3MV9B 1KB5H 4APQB 2C9AA 3VFUA 3DOSA 3QUMA 5HXMA 1VACB 4F7PB 4RBPK 1U0QA 2FX7L 4M9PA 1YQVL 1ZHNA 5CJOL 2EIZA 1JF5A 4ZTPH 2A0LD 3TCLA 4F33A 1OAZH 4RIRA 4J6RL 4F8TA 3WJLA 4QNPE 3Q5YA 1NEZG 43C9A 3NFPB 3OGCB 3BW9B 3HFML 4XNZC 3O3BA 3GMRB 2EDDA 2EE3A 3OAUL 4ZPVB 3U79A 1KTLA 3TJHC 2P5WA 3BN9C 4NQCA 1F58H 5GRJL 3EGSB 3QCVL 3T2NL 4YWGH 3T2OA 4XNUH 4KZEL 4NN7B 1HHJB 1UXWA 1XF5B 3GI9H 3QIBD 4JZJC 4IEFB 1WAAF 3T3PF 1ZVHA 5GS1C 2IF7A 2HT4C 3TLRA 2E6QA 4PS4H 4JHBA 5DGQA 3OF6A 4ZFFA 2F54B 4W68A 5HDQL 1AQKL 2XIDA 3SQOL 5J6GB 3ALPA 3PGDB 5KW9H 3OBAA 3VFVA 4AT6A 3O11A 5IOPA 4ZDHB 5MI0B 5BVPL 4G8GB 5DUML 1C08B 2AV1A 2P24B 3SDCD 3KPPA 1JBJA 3CXHK 3E3QC 1QBLL 1LP9B 3U83A 2PNDA 5EN2A 1P6FA 1WLHA 3CMGA 1FG2A 3H9SA 1EFXA 3GGWB 3KYNA 4KKLD 1M7IA 2AJXH 2B4CC 2BNQD 3HI5L 3RA7L 3V6ZA 2N56A 1QNZH 5A2JH 3ECBB 3NA4A 2BHUA 3BGFC 4NFBA 1E0OB 5L8KB 4LHUB 5GRUH 2XWTB 1EEYA 3TNMB 5D7SH 4S1QH 4WI6A 4G3YH 3QIBA 4JJHA 4YHZH 5T3ZE 4N9GA 5ESVA 2FGZA 3WHXB 3UP1A 5I1CH 2BNRB 1OTUC 5KVGH 3F65A 1WC7A 3E3QE 1J1OL 3VFWA 1SJXA 4GT7A 2B1HH 3ARDA 3HC4H 5DUBB 2YRPA 4IM8A 3ROLB 3U2SB 3GSVA 4WDIA 4P99A 3K8KA 2YXMA 3SDCA 1UA6L 5BZDB 5IK3A 3CLEH 1TTFA 1UQSA 3RWIB 3OAZH 4RMUA 5EWIL 5CBAA 1FDLH 1N59B 1G7MB 4KKBD 4XVSH 3ARWA 2DLFH 3PNWB 3S7GA 3STZA 3T08A 2BNQA 4EJ1C 1FO0A 1FFOB 5I9QB 1KJ2B 2J5LC 1GGUA 5TDPB 1QLRA 1HHHB 4YDIL 5TFSL 3BP7B 5J12C 1K5NA 2BSSB 3IU4L 2ZSVA 2D31B 3ARTA 4MAYD 1UH3A 4POZC 2CKBH 3UTPE 1NAMH 2C4XA 3BPCA 1VGEH 4DTGL 3OXSA 4OZHB 3IU3A 4XPFH 4TPRH 4UBDD 2RCSH 3QFJD 5CSZB 1OM3H 2EYSB 2VERN 4QRTB 4IS6B 2OTWA 2YPLE 5FO9A 3CFDB 4DKFL 3N06B 4PJ8A 1T1YA 5F7DA 5KSAB 1JWSA 3BQUC 5C07E 2R1XB 3CFKB 1KELL 3PQYE 3TO4A 2H41A 1R0AL 1P9MC 1KEML 4NRXA 5D6DA 4NNYA 4Y2DA 2D7MA 3VXTB 5KG9A 4JHWL 2XY1A 5CD3A 1YNKH 4FQ2L 3FN0L 1YEJH 1NFKA 5IKCB 5IBUB 4MJ6B 5JOEA 4ZOCA 4LSRL 1R3JA 2FBJH 4FQHA 5J1TC 2DQCL 5EOCL 3E6HA 3OKKB 4LLDB 5K9KA 4AEHL 2GY7B 3MLZL 5C3TA 4MAYA 3C9NA 4I5BA 1WIOA 1KF9B 3QJFA 3NTCH 4MJIE 1MAJA 4G6KL 4KTYA 2VXTL 4TQEH 5AAWA 4P9HL 2PW2B 4M61A 4ZO6A 2I07B 3QFJA 1U42A 1XCTB 3QO1B 4M48L 1OW0A 1H3VA 4MNGE 1KLFA 5IVXB 3IETB 1DUYB 4PB0L 4P9ML 3VFNB 2OR9H 1YEFL 5DZLA 1YEKL 1BEYH 4XAWL 1WZ1L 3REVB 5T1LB 3DO3A 4HS3A 4Q2ZA 3QEUA 1JWMB 1NCCH 3LAFA 2VZUA 3GNMH 3J8F7 1CFSA 1I7RB 4G5ZL 5EC2B 1BD2B 1CQKA 1MCQA 4NUGH 3TBTA 1QD0A 2YUWA 5GGTL 4XCEB 3BVNA 5CD5C 2L4OA 3L95B 4PJ9B 5GRVL 4Y7MA 3ZT5A 1KCLA 1MFAL 1YMME 4RMWA 1W72A 1MCEA 2BXZA 1I9IH 2BVPA 4PG2C 1Y18B 4U0QB 2D7QA 5ITFA 2OI9B 4O4YH 3CH8A 3TP4A 3QDJB 2JJWA 2CLZA 2Y6SC 4J12A 3VXQA 1FLRL 3GUTB 4U1NA 1FFQA 5FGSA 1TNMA 3NA9H 3BMWA 2DI7A 2V9TA 5ACZB 2IALA 1BZ7A 3DURB 1XR8B 4XNMB 2Z8WC 1F6LL 4NKDA 3WIHA 2G9HB 1MY7A 3QUYB 1KIRB 3T1WA 5JPNA 3QISA 4XAKD 3NPSC 3KJ4B 1D6VL 1YPZE 1OP3H 5DJXA 2LQRA 2FX7H 4NQSB 1XF1A 1YQVH 4DK3A 5CJOH 1F2QA 4YDLB 3BI9X 4U1KB 3FQWB 5B3JE 4DCQB 2ZUSA 4J6RH 4RRPG 4NQEB 1BLNB 3OR6B 1N4XH 3OJVC 3RY5A 1C5BH 1OQOA 3HFMH 4HS6B 2VABB 3Q48A 4L5FH 1KSRA 1PEWA 1ADQL 1FNHA 1UJTA 5GRJH 3QCVH 4LCWA 3T2NH 1JZ5A 4KZEH 3F5WA 3MRPB 3MMEA 4G9FA 4JFOA 2XKUA 3GKWL 5DQ9A 2Y72A 3W2DL 1AHWB 3G5VB 2EZ0C 4HEPG 2CO7B 2IANB 2UVFA 4Y4KC 1A1MB 5DRXB 4NQVB 2R9HD 5D2LB 3CGTA 5HDQH 1AQKH 3SQOH 2AJZB 4LFHD 5BV7C 2OM5A 2JCCE 1U9KA 4WV1B 5SX5H 3ZDYE 2OS7A 5EO9B 3VGBA 2EXWC 5BVPH 5DUMH 1T7XA 3SGEH 1BFVL 4NJAH 3PP4H 1QBLH 2C5DC 5ICZB 5CP7A 3SDAA 3I50L 2ITCB 2P48B 5DJYB 2O93L 4I3SL 5C0FA 5GGRY 4OIAA 3VFUB 3QUMB 4AENA 3DRTA 2IJ0C 1DTUA 3HI1A 4AIZA 4BFBD 1NCUA 3NCYP 4U05A 1ZLVK 4TUOA 3SGDI 1ZHNB 3V6FB 1R3KA 2EIZB 3MRFB 3MREA 1C1EL 1WAAA 4U4BA 4Z76A 4M6ML 4NSKA 3F8UB 1DUZA 4YHIB 3O3BB 4HWNA 4MX7A 4OIIL 1SYVA 4W4NA 1KTLB 1J1OH 4S10A 2E7LA 1MCRA 3LKQB 2NY1C 2HRLA 5D7JA 7FABL 3B8YA 1JHLL 2OSLB 1OTSD 4JQXA 2V9RA 1UXWB 3MUY1 5T3XL 2Z8SA 4WI3A 1DQLL 5EO1B 4KK5C 4ODBD 4CNIA 1NLDH 2NYYC 1KEGL 1PZUB 4NO3B 4EI5D 5EWIH 5T1MB 1GAFH 2CK0L 5IB1A 3N50A 4AEFA 4QNPF 32C2A 5DSCA 2W92A 4IDJL 3VFVB 4QY8B 3U30C 5K9QI 4YDIH 5TFSH 5IOPB 4H5SA 3HZYA 3WKNA 3IU4H 4C54A 1TETL 1A9EB 3D25B 2AV1B 3LCYA 4ALAH 2MJWA 4DTGH 4X4ME 1FG2B 3VFRA 1I4FA 1A3RL 4NYLA 4R26L 5B21A 1M7IB 3VFPB 1A8JH 2ZOKB 1EXUA 4HX1A 5AG9A 2YZ8A 3OHXB 4DKFH 2CSPA 2XQYK 4XCFL 2OJZL 2VE6A 1HINH 1UWEL 2BVQA 2VXSL 4QHNA 3SCMD 1NGZA 1J10A 4QHMA 1T80A 1EEYB 4M02A 4LHUG 2A2QT 1R0AH 3VFSA 3BJ91 4TVPL 1KEMH 4M93B 1CVSC 3HN3A 4TTDC 4YBQC 3LMJL 4EI5A 4FQ2H 3FN0H 2ADJA 3U0PB 4NN5B 5DJAA 1CTOA 5JA9A 1FL5B 3WYRA 2DS4A 4LSRH 3SE9H 1TFHA 2AABL 2DQCH 4MCYB 2W65B 5EOCH 4B7IA 2DTML 1G9EA 4XPAH 4AEHH 2OMBA 1LE9A 4P2YA 4GRLD 4FS0A 4P57A 3SDCB 3FQXB 3H9HA 3KPOA 1Y6MR 4WJ5A 5IK3B 3HE6C 4G6KH 2VXTH 3OKOB 4OM0L 4ZXBD 1RULL 1U92B 4P9HH 5CBAB 2A6KA 2KH2B 1XIWC 1V7ML 3EOTL 5B8CC 3MCKA 3STZB 2BNQB 4JR9L 4M4PA 4O58L 3BKML 5L0QC 1HSAB 4M48H 3I02A 3NCMA 4ZFZA 1ZEAL 35C8L 3SCMA 3BRFA 1N5YL 3QULA 4KJQD 2APVA 5CBEA 4PB0H 4P9MH 5DLML 2YD5A 2HAZA 1YEFH 1EHAA 1YEKH 5C09E 1FL6A 4XAWH 1WZ1H 3TZVC 3HMXL 1PAMA 4FQIH 4Z95L 3VW3L 4UT7L 4ODHH 2V5TA 2HA1A 1U91A 2GT9A 4G5ZH 2QKIB 2ZUYA 4HWEL 2OTWB 5FO9B 1T1YB 5I74B 4WO4C 2FL5B 4M7KL 2LU3A 3RUGB 3WFBH 1U58A 5T1KD 4PRPE 1FFPA 3BH8A 3S97C 1QSEA 2FZ3B 2CUMA 1MFAH 1HEZA 1FNLA 4XC1L 3SGKC 1T3FA 3HNTL 1HYSC 2CR6A 4NRXB 1G7JB 1TJGL 2CMRL 2Z93A 1J1XL 4G80A 5L8LB 1BQHA 2RB8A 3BSZL 3EUUA 4ZXBA 2V2XA 1ZT1A 3P0VL 1MFDL 5CD3B 4H26B 4M7LT 5CIPH 3MLPA 1ZVSA 4V1DA 5D5ME 5J4MA 4JQVC 1Y6NR 4LLUA 1R3JB 2RBLA 1FLRH 5FA4B 2NY2D 4FQHB 2VIRB 1JPSL 5EOTA 5K9KB 1IL1A 5CP3H 1BX2A 3C9NB 4MAYB 1G0DA 5CS7A 4AM0A 1OGTA 3GM8A 4GLRH 1KYOJ 3IDYB 3LN5A 2XA3A 5L2JB 1I1FA 4OTXL 4TRPL 1SY6L 4M61B 3IDNB 4MZ3A 4XWGL 1ED3A 1HN1A 1NH6A 4U6HB 4DZ8B 3QFJB 3JWNC 3L3HA 2J8OA 3ILPA 3RHWK 1SJHA 5I8CB 3U7WL 4IMLA 2NZIA 3QI9C 5T1KA 4WFGD 2X4UB 3TBVA 2YUVA 1D3CA 2VLLA 2P45B 3NGBB 4R4ND 5DK2A 4Q2ZB 3AY4C 5E4EB 2G75A 3W82A 2BSTB 2HJKA 5JZ7C 1CFSB 1CL7L 2LVEA 2VN4A 3TBTB 1T04A 2Y23A 4X80L 5KANI 3HAEH 1T1ZA 3BVNB 3GKWH 3W2DH 5EZLA 2R1WA 1ZTXL 3P3YA 1F3DH 3RWHB 1TCRB 2R69L 2F5BL 2HJLB 3DGGB 3RWDB 1AIFA 4LAQL 1IGJA 2W1NA 5HYIA 1KACB 1MHEA 2FX9L 4FTVB 3S37X 3B6SA 4L8SC 2QQLL 3EOAA 4FFZL 2C3VA 4QOKE 4N90E 1FPTL 2JJUA 2X4QB 3KLHC 2CLZB 3L3KB 3VXQB 5JQHC 5EU6E 4U1NB 1TJIL 4ZNCD 1BFVH 3FFCD 1F42A 1U8QA 4MJ5B 1FYTE 4I18A 3RTQD 2IALB 1NFDE 1BZ7B 3Q1SL 4KDTA 4Z7QE 1CFNA 3STBA 4NKDB 2N7AA 5F96L 2EICA 2UUDK 5JPNB 2AXJA 4LSUH 4GG6E 3C5ZC 3HUJE 5FYLD 5EULV 4ZG1A 5J13B 4NJ9L 1MCKA 1MCOL 5AUMA 4OZIE 5F7LB 4XVJL 3D3VD 4EN3D 3UTQA 1JYNA 4L9LC 4LOUC 4XMPL 4NO5A 2K9UA 4L4VE 1C1EH 3WD5L 1MVUA 1R5IA 1OWRM 5DK0A 3BGMB 4JZOA 4OIIH 4PP2A 2JK5B 5F7KC 2ZOLA 3QR2A 3JWDC 7FABH 1JHLH 2W9DL 3G6JA 3F5WB 2UZYB 4IRSC 1T0NA 5T3XH 1U8LA 4JFOB 1DQLH 5DQ9B 4IIQC 2HWZL 5GZND 4CMMA 1PBYA 5JQ6L 4UIMB 3FFCA 1KEGH 4X8XA 4CU7A 5ESAA 2B8OT 2V6HA 1JTOA 3T8XA 2CK0H 4MJ2A 3IDUA 5B3JF 4LKCB 3WL9A 5IR1B 4NQDE 5EU5A 2BFVL 5GS0D 1MEXL 4AEEA 3UTSB 3RI5F 1K8IA 4G8EB 5ILTL 4CADA 4QRPE 3MJ8B 1BQSA 1NUNB 4X0KB 5KBNC 1TETH 4EN3A 3BZ4B 3ZDZF 1IMHC 5IWLA 1YUHA 5CP7B 4C56E 5K9OA 4HKBA 3U0TA 1A3RH 1IAIM 4R26H 4TSBL 3PG2A 3FQTB 3QUXC 5ICYA 4X4ZA 2V17L 5IVZA 4XCFH 2OJZH 5I19L 1QEWB 1UWEH 2VXSH 1KNOA 4AIZB 5M95B 4I77L 3QWRD 1U93A 2C1PB 2JCCF 5EZIL 1E6JH 4FZ8L 4CMHC 2EDFA 4TVPH 5I76A 4K3JL 3ZDYF 4YFLI 2R29L 3O3AB 3LMJH 1JUFB 4Z76B 1FZKB 4TUJA 3V5HB 5F7NC 5C0CE 1A3LL 1JYWA 1SYVB 4U2YA 3L5IA 4G43B 1KPVB 3TJHD 3BN9D 5I1LB 4NNXA 1WIUA 1WBYA 2DTMH 4LLWA 4OD3L 2MNUA 3LQZA 4LCCA 3W5NA 3TYFB 3G5XA 1V3KA 3G04B 4UZGA 5FUCC 2EC8A 4CNIB 5LKNA 3CU1A 2HT4D 4JFHE 4OM0H 5DO2C 2I27N 1RULH 4XB7A 4P48A 3LQAL 4U1HB 5DFWH 4M6NL 5TQ0L 1V7MH 3EOTH 4P3DA 2RR3A 3PV6B 2DKUA 5EPMB 4D3CL 4OI7A 5T3ZD 4JR9H 4D9RE 32C2B 4O58H 3BKMH 4K9EC 3N1GC 1DN0B 1EPFA 1ZEAH 35C8H 3BEWA 3F6IA 2DKSA 1N5YH 3HZYB 4X99B 3IDGA 5DLMH 3QWRA 1TZHA 5I73B 4M7ZB 3HMXH 4GKSA 1J0ZA 3MUJA 3BPOB 4GRWE 4Z95H 5IEHB 1I4FB 4UTAL 1EUTA 4UT7H 2AEIT 5DVLA 4N0FB 1I7ZA 1H9VA 4AMKH 1EXUB 3GI8L 4HWEH 5C92A 3LIZL 2YD6A 1XCQB 2VE6B 5FUCE 4OZ4A 2OJEA 4LLVA 2BVQB 5D9SB 4M7KH 3FQNB 4QHNB 4BSVA 5DQJA 1NGZB 4QHMB 5GRWA 4DWHA 4CVZB 4XC1H 3VFSB 3HNTH 3KXFE 2JELH 5GS1A 1TJGH 2CMRH 5EIVA 1J1XH 3BSZH 1MRFL 1MFDH 1LD9B 1OTUD 2VUYA 2EIEA 3UTPD 1IKFL 4X9IA 2N4IA 2YD4A 3F7RA 4RMQA 3BIAX 4QHUA 3IFPA 1JPSH 3WLBB 2EE9A 4OZFB 1LE9B 4PJ7E 4GAGL 2YPLD 4L1DA 4P57B 3H9HB 3KPOB 4WJ5B 4U3CA 3IJSB 4OTXH 1D9KC 5C07D 1LO0L 1SY6H 3HZVA 3PQYD 1UADC 2YMXL 1CFBA 2WK2A 3MCKB 1MCJA 4KY1L 4WNQA 3AC0A 2EDRA 3U7WH 3MRMA 4ZFZB 2Y07L 3OB0K 3K80A 4YHOL 2A83B 3LPGA 4NNPL 3H3BC 4POZD 4X7TB 3I2CL 3VXSE 3H7BA 5F72S 1ZGLA 4XXCC 1FL6B 1CDHA 3QDME 4JFZL 3EYUL 4HULB 1U91B 2GT9B 3IF1B 1CL7H 4MJID 2CD0A 4J3TA 2WP3O 1MREL 1OLZA 4X80H 4U7SA 1U58B 3VMNA 2BJML 1ZTXH 2R69H 1NCAL 4R96B 2X4SB 2YPLA 1T89C 4GRLB 1T3FB 5IMKB 5LWYL 3TT1L 1YC7A 2BP3A 4LAQH 2FX9H 5A1AA 2Z93B 4WI4A 1BQHB 2QQLH 5C07A 4ZXBB 2V2XB 1ZT1B 5A2IH 3EFDL 3MJ7A 4FFZH 4JVPA 2G5BA 6CGTA 3PQYA 2ZPKL 1VENA 1QFWL 3ZYIA 2VLME 3L3DA 4LLUB 1TJIH 3GJFA 4KH2A 2NXYC 3LSOA 4U1MA 5EOTB 1TZIA 3Q1SH 3TIDB 2UVEA 1BX2B 1U8PA 4K7PY 5H2BB 4AM0B 5F96H 5KSBA 3C2SA 2ZG3A 3LN5B 1I1FB 2CDGA 3SDXE 5EOCJ 2IQ9H 3FT3A 5I30L 1ED3B 4HH9A 4NJ9H 4HAGA 3JBG7 1MCOH 1YMMD 2XFXA 2ZCLL 1AXSA 4ETYA 3L3HB 2XPGA 4LP4A 4XVJH 3L5HA 1Q8MA 1BBDH 4MJIA 2IBZX 3U4AA 4X98A 2ZG1A 1SJHB 4XMPH 2X9WA 4KMLB 2MCG1 2WIIA 3BQUA 5D5MF 5T1KB 4LLYB 3ARBC 4HKZA 3VE0A 1IM9D 3DUUA 5CCKL 1KLUA 3WD5H 3P4MA 3SOBL 1FLTX 4YXHL 1P9MA 4HUUA 4YHKL 5DK2B 4WW2C 2VISA 4YJZL 4MNGA 4YK4B 4Z0XA 5D1XC 1EHLL 3ISWA 3S34L 2AK1L 3WFEL 3L7FA 2HJKB 1W0VA 3C60C 3RBSA 3SJVE 1PG7L 4RAUA 5DHVH 4JZNB 2W9DH 1SJEA 4E42B 5JXAL 4GXUN 3PHQA 5GGVY 1YJDC 5HSFA 1T1ZB 1I7UA 2HWZH 2NY2B 5CD5D 5JQ6H 4U1LA 9CGTA 2R1WB 4F7EA 2IPTL 1AKJD 4KAQL 4M5YL 1AIFB 3BD4A 1MHEB 2BFVH 2YHGA 1MEXH 4WU7B 2GITA 5AEAA 3KPQA 1HH9A 5IB3A 4NOFA 2NTSP 3H9ZA 1YMMA 2VKWA 3C08H 2Y6SD 4RGNC 4ZOAA 4NP4L 3SKOA 2ADGA 4OF0A 1F4AA 1EJ6A 3O9WC 2XG5A 3LD8B 2HJFA 4TSBH 1IM9A 1CFNB 4I2XE 1VSCA 4XTRC 1S9XA 3AS2A 1UB6A 2F9BT 4YHLL 5I19H 4W6YB 3FQRA 3KYOA 4DQOL 4UDTB 2YN3A 4B7LA 5HI5C 1TPXC 5EBMA 5EZIH 4FZ8H 3M45A 4K3JH 4NO5B 1ZLWK 4ZFOA 1YPZA 3TGXA 2CRZA 3SPVA 4P5TC 2DD8H 5F8RC 1AKJA 4HAFA 3OKDA 1MVUB 2GJJA 1QYGL 1A3LH 3SKUD 1NFDF 4Z7QF 4ERSL 4HPOL 3HG1E 4PP2B 5FUZL 2AGJL 5IHLB 1AC6A 4PG2A 4Q0XH 3X3FL 3ZKXC 4GG6F 4OD3H 1A2YA 3HUJF 4DUWA 1U8LB 3RWJA 4S2SA 4OZIF 4ZODA 3MJ9H 3FFCB 1BAFL 3LQMA 4PJ5E 2EZ0D 5IF0B 5DHXB 1DBML 3WS6C 3RTQB 3LQAH 4Y4KD 4FG6C 2FATL 1XGUB 4M6NH 5TQ0H 3WEXA 2GEEA 1FIGL 1U8JB 3CVHA 3WL9B 5EU5B 4D3CH 5HHPA 4LNVA 1MWAB 1F3DJ 3ZMRA 3FN9A 2DLGA 3OL2A 3FZUC 5HY9A 3VD5A 2EXWD 2H26A 3D3VB 4EN3B 1JI2A 1EGJA 4HWBL 3O6LH 4BKLA 3JWOC 2I25N 2JCCA 3QXTA 1YUHB 4YLQT 3K4AA 4K55A 4HKBB 3U0TB 5IW1B 4UTAH 4LKXA 3MUZ1 3V9FA 3QFDA 1TENA 4OFYD 3GI8H 5IVZB 3LIZH 3IJYB 2VAAB 2B7DT 2W59A 5HGAA 2PTVA 4YGAB 3VGHA 2H45A 3WV0A 3WUZA 3RNQA 5I2IA 1FCGA 1RZKC 3T77A 4N0CC 1QTYT 1INEL 4F7MB 1MRFH 4FFWC 4TUJB 1M05A 4Y4KA 5EBLA 3VU2A 1IKFH 5JTWA 2Y1VA 3DROB 4BQ6A 1MRCL 1E28A 1MF2H 2J2ZA 3QP3A 4RGMC 4S0TD 2IPUG 4NM4L 4LFHG 3C6LC 4Y1AE 1ZSDA 4PYHA 4GAGH 2YD9A 3WNOA 3G5XB 3N1PC 3HA0A 1WF5A 4KK5D 2NYYD 2DM2A 3QUZC 3MPCA 4RNRB 5KSUA 2YMXH 4XPBL 4KY1H 1YDPA 4PRNB 3MOBL 4M1GL 1T83C 4M5ZL 5FA3B 2Y07H 2BY1A 2OR7A 4YHOH 1QFUL 3IDGB 3K3QA 3I2CH 1TZHB 4BK4A 2EO1A 4JFZH 1S9YA 3LY6A 3EYUH 4N0UE 4NC2B 4D0CB 5GQBA 1I7ZB 2C3WA 3CPLA 3DHJA 1MREH 4PRAB 5F9JB 4BSVB 2Y5EA 4X4MA 1S7UA 3QG6A 5JOPE 3F62A 2BJMH 4Z7WB 4O51A 5FGCE 4ESKA 2V2TA 1JMZA 3CU7A 1HH6A 1TQCB 4JZJB 5LWYH 3TT1H 4OF5A 3DGCR 1RZJC 5GS1B 1UH4A 4TTDD 4YBQD 4NO2A 3EFDH 3PXJA 1DL7L 3RZCA 5DJ8A 5L2KE 2ZPKH 3S8WA 4RISL 3OKLA 1QFWH 4GRWF 5C09D 2C26A 4YNYA 4QHUB 3U4EA 4KVNH 3LEVL 3IFOA 4PJDE 2NLJB 1FBIL 3HE6D 4TYUA 4PRPD 1ZWIA 1UYWL 1CGXA 3JTTA 5E6ZA 1XIWD 5I30H 3HZVB 5HYEA 5IMOA 3DVGA 4WHYG 3IAQA 4J3OC 4HLJA 1PY4A 1G9NL 3FO1A 3WFCL 5C0JA 3MRMB 3WUWA 1IAKA 1FAIL 3MRJA 3QUML 1XEDA 5CCKH 1C5DB 1PKOA 5IFJA 1O7SA 3SOBH 1ZGLB 4U6TA 3TZVD 4YHKH 1MPAL 4PJ7F 3MBEB 4D0DB 1EHLH 3S34H 2AK1H 2YRLA 3WFEH 4XVTL 5FAAA 4RWYL 1PG7H 1IC4L 1V3LA 2NXZB 2QJDA 5JXAH 2I9LA 4WO4D 4RA3A 3ARGC 2DIJA 2J1KA 1ZS8B 3P9MA 4KI5F 1IC5L 2IPTH 5E95B 3TT3L 4KAQH 4PREA 4M5YH 4QYOA 2YPLB 1HYSD 3HE6A 4IRJC 1IGTA 1ZHLB 3S9DB 2VDPH 5SX4I 3KPTA 3ZKMC 3MJ7B 2VDKL 2G5BB 2YA0A 1BQHG 1P84J 3PQYB 2V9QA 4HDIA 5B8CA 4H1LA 4MHHI 1FJ1B 5HD8C 4X6EB 4JG0L 5HGBB 6FABL 4U1JA 5I1AA 5I17B 3GJFB 4H0IA 5DZNA 4U1MB 4TUKL 5ESQB 1TZIB 5J12B 4MQ7A 3KHOA 1U8PB 2I60L 5D5MA 5E8NB 2NX5E 1JNJA 3KYMA 1I9RL 5HHOE 3IXTB 4LSVL 4YHLH 2CDGB 1WEJL 4YE4H 1KYOK 2XN9D 1RQ5A 2XFXB 4YC2C 1IT9L 2XPGB 3O3DB 4MJIB 1KLGA 5AZEL 3RVTC 2H32H 4X98B 5A2LH 4WO4A 3T4YA 2GK0B 3O0RL 3QI9D 2WIIB 3QYCA 4QOKD 4HIXL 4N90D 2GUOA 3NAAL 3QPQC 4F2MA 3BUYA 3F12A 1KLUB 3ZT7A 1QYGH 5HPMB 3SGKA 5EU6D 4ZS6C 4HUUB 1FYTD 4PJXF 1JGVL 4HPOH 5FUZH 2AGJH 2J4WL 2YEZA 2CO6B 4PRBB 1X7QA 3L7FB 4DAGL 4YO0B 1SHMA 1W0VB 3X3FH 5JZ7D 4S11A 3SDXF 25C8L 4U7MA 4JQVA 3PHQB 5BQ7B 3RX5A 4CGTA 4U1LB 1BAFH 2ATPA 5SV3A 4F7EB 3HZMA 1A6ZA 2FATH 1GGCL 3ZYJA 5DTFB 4ONHA 4OCYL 1FIGH 4LGSB 3E6FA 3KPRE 3LRSA 2V2WB 5AG8A 5F7YC 3KPQB 1HH9B 2EIDA 1YMMB 3BKCH 3L3JA 3KLHD 1EX0A 4HWBH 3SKOB 4KRPC 3GMMA 3SQBA 1FO0L 1ODAA 3QI9A 4QOKA 5GSVA 4GOSA 1LNUA 1Z5LA 2HJFB 1CDBA 1IM9B 2R23A 5IFAL 4GUPA 1S9XB 1UB6B 5EU6A 1CQYA 2B5IB 3C5ZD 1FYTA 4XZUA 5IW3A 4HIJA 3AY4A 1VGKB 3T65A 5HYQA 4D9QE 3FQRB 3ULSA 1NFDA 4NBXB 2GJ6E 4XP1L 2CIKB 2BVUA 1IEAA 5E00A 4NQDD 4JFFE 3ULUL 4HT1L 2OLDA 3D39E 4LOUD 4MA8L 1IC1A 4GG6A 3HUJA 1MCFA 2VZOA 3HR5A 1INEH 1OT1A 2GTWA 3SPVB 3WS3A 4OZIA 1AKJB 4WW2F 1GXEA 1J8HE 1FNSH 5D7LE 3AU1B 2MKLC 4EUPA 1MRCH 4L8SA 4OCRH 4C56D 4HWZB 1Q0XL 4L4VA 5CSBA 1A5FL 2P7TA 3CH1A 4NM4H 1A4KB 5E5RB 4J8RA 5D72L 4JDTL 4IRSD 5E8PA 3MLWL 2XT1B 1QZ1A 4Z5RB 4KDVA 4OSUL 2YD3A 4N8VB 1CR9L 2XY2A 2CUHA 2WLZA 4LLMA 2X6MA 2VDRH 3JV6A 2E27L 3CVHB 4QXTA 4XPBH 5HHPB 3MOBH 4HMCA 4AY0A 4M1GH 3FO2A 3C5ZA 3NPSB 5J89A 2ZJSL 1B0GA 3MV9E 1KBGL 4HUXA 1QFUH 1U8MB 5C0CD 4NQDA 4L4JA 4Q74A 4L9LA 4Z7OE 5B38A 2JCCB 1ZMYA 1OD7A 5FDWA 2ITDA 1F6AA 4QRPA 2GAZA 2IQAB 5GGQL 1GRWA 4LKXB 3VCLA 3QUXD 3FTGB 1DSFL 1HNFA 2Q76A 4G9DB 3GSXA 2W07A 4P23A 4JFHD 2DB8A 4GW4A 3A67L 4LLQB 5AWNL 2EH7L 1FZOA 5LGJA 4D9RD 1UENA 1AC0A 3N1MC 3T77B 4IIQA 1EUUA 1Q9KA 1IEBB 1CF8L 3MRNB 1DL7H 3DIFA 3ILQD 1OP3K 3ALWA 3VXUE 5KN5A 3WN5B 1HSBA 1IAOA 4YXKL 2EEDA 5E5MA 5LJYH 1D6EA 1Y0LA 2GCYB 1E28B 1W72L 5BV7B 3OR7B 3BZFB 3V4PL 2P8PA 3MQIA 1ZSDB 2K7QA 5C0CA 3LEVH 1IGMH 3CSYB 3KLDA 4RGOH 5CFHA 1FBIH 1I3VA 5DO2D 1G6RH 4G8GE 4EZMA 5GZOC 4MNQB 2V5SA 5IB4A 3DETC 1LP9E 3QUXA 1YDPB 3ROOA 3KXFD 4MA3A 5LBSL 5I6XB 1QSZA 1G9NH 5TQ2L 3WFCH 3WIHL 3TPKA 1RZFL 1FAIH 3QUMH 5GXBB 3W0WA 1UM5L 3KPLA 3Q6GL 1PQZB 4PD4J 2CUIA 2P43B 1I3GL 3FRUA 5FEBA 5I9QC 4ZOEA 2L7JA 4R7DA 3L6FA 2DQGL 2DL2A 1A9BB 3CPLB 1WQVT 4RWYH 4XVTH 5SX5K 2AVGA 2FGWL 2ED7A 1IC4H 1ZLUH 4BSWA 5DD6A 1QOKA 2KZWA 3QG6B 5CJQL 3GEWB 4Y5VB 4O51B 1JPGA 3VRIA 5DVOA 4KTDL 1IC5H 4M3KB 5E7BA 3NCYS 4PV8A 3TT3H 4KI5D 1I1AC 3WNLA 3MXWL 2IH3A 4NO2B 4ZMAT 2VDKH 5I0DA 3VXSD 5KSAC 3OKLB 2D03L 3S4SG 1MCIA 4JG0H 6FABH 4DFHA 3QDMD 4YNYB 3VH8B 1JHKL 5HVGB 1LEGA 1TXKA 3PIQA 4ZAKD 4F80A 4MDIA 4TUKH 4FMKA 1RJYA 2I60H 2YD2A 1GYAA 3FCTA 1D9KD 1ZWIB 3O4LB 2KUTA 3PDOB 3MGTA 5C86A 2N1KA 2WUBH 3QJHA 2CDEB 4PJ7A 3DVGB 3UEZA 1IT9H 3AMLA 1F11A 3FO1B 5AZEH 5DMIL 3WUWB 1IAKB 3O0RH 3D69A 4HIXH 1CIDA 3MRJB 3NAAH 2PCPA 3O6ML 4FZEL 2VITB 2XA8L 2VLMD 3BD5A 3GO1L 3JTSA 1QO3A 1MH5B 1A4JB 3MFFB 1JGVH 1JFQL 4PJDF 4NHUA 1T4KA 1BOGA 2J4WH 4K8RC 4PFEA 3UO1L 4X6DA 4DAGH 2V7NB 5LGHH 1U95B 5GRXG 3VXSA 1AGEA 1VDGA 2AEWA 4HK3J 1P7KA 5C09B 2H9GA 4WW1A 2MKWA 2EDQA 1CD8A 3P9MB 4F7TB 1ND0B 3ZKSD 1NCNA 2LU7A 5F7FA 1LEIA 4TNVF 1GGCH 1YY9C 4QYOB 4OD2A 3LKRB 4XPTL 3L9RB 2HFFA 2AXGA 4OCYH 2SEBA 3TFKC 3HE6B 4PRPB 1EERB 1HDMA 4HJGA 1NDMA 2PUQT 2R8SL 1BGXL 4O5LL 1XIWB 2A1WL 4H1LB 5IVOA 3T0XA 3UMTA 4D8PB 2M1KA 4U1JB 1NGYA 5L0QB 3DO7B 2GTZA 2NXYD 1XGQB 1FO0H 3RX7A 5KAQF 1DE4A 5JORB 4BQ8A 3SJVD 4HLZG 4WI2A 5D5MB 5IFAH 3KYMB 3EBAA 4XXCA 4RMVA 4XPGL 2VDML 3TZVB 4OFPA 3OMZA 3HRPA 4QHLA 2Y25A 2WSKA 3ZTJG 3JV4A 4YHML 4XP1H 5IQ9A 4OCMC 1Z0MA 1R5VA 3HMWL 1TZGL 1MCBA 3ULUH 4HT1H 4WO4B 1NGWB 3BWUC 4MA8H 4KTEL 3SDXA 4CDGC 4UTBH 2NMSA 5HYSA 1IARB 3ARBD 3BUYB 3F12B 2AQ1A 1NAKL 1T89A 3TWCL 4MGXA 4IOIA 5H35B 2M26A 3E8UL 5DJZB 1BZQK 43CAB 5D1XD 1G0XA 2YEZB 3K4ZA 1X7QB 1KPRA 1A5FH 3C60D 4YDLC 3MRIB 4KKCC 5KOVC 1XF3A 4JDTH 5D72H 5ANME 2DM4A 1B6UA 3BHBA 3MLWH 1UZ8A 3RL2A 3G9VA 4KUZL 4OSUH 5HVFB 1CR9H 2ATPB 2D2OA 1A6ZB 3SJVA 5T5FL 5TE7L 2E27H 3BPLC 3LRSB 5D7KE 3BPNC 3D6GA 5C9JA 1QBBA 1EA9C 3CJJA 2XN9B 2ZJSH 1J87A 1G7PA 4LPUA 5GRVK 3UDWC 3L3JB 5L6YL 4P46A 1OSPL 4Z7VE 3BXNA 3HG1D 5T1DL 3A6OA 3T4AB 3SBWC 4HCRA 4L29A 4P2OB 1P7HL 3QI9B 1VCAA 1ONQB 2PW1A 3QCTL 2HLFD 5GSVB 3O9WD 2PYEE 1LNUB 5GGQH 3ARBA 5I8EB 2AKRB 2R23B 1FAKT 5DD0L 4R4BB 1DSFH 4XTRD 4G8FA 5EU6B 1AQDB 4WW2A 1FYTB 1MVFA 3FHAA 4HIJB 4PJ5D 1L9MA 3T65B 5E56A 5D1XA 4O2EA 1NFDB 1A7RL 1G7HA 4Z0BL 4P4KC 3A67H 3C60A 5AWNH 2DBJA 2EH7H 4I2XA 5E00B 1S3KH 5HI5D 2X1PA 2YRZA 1VFUA 4TOYL 1QFHA 5J6HA 3MRDB 3HR5B 3S35X 5EORL 1ZT4A 3MCG1 4P5TD 4YPGA 3WS3B 3B3IA 2HVKA 5CHNA 5C1MB 4JPVH 4YXKH 4EUPB 4L8SB 2W0PA 1W72H 5D2LE 3V4PH 4J8RB 4GQPH 4PBWD 1CBVL 4HUVA 2VUOA 2P1YA 1S7QA 3HG1A 1OARL 1D5MB 1WFUA 5BO1L 2BXYA 3CSBA 3O9WA 5IG7A 5CZVL 1I1CA 3VXMB 2A9ML 3JV6B 4DUXA 4OM1L 3V52L 4QXTB 3UROR 1NUDA 5LBSH 2KBGA 5TQ2H 3WIHH 3C5ZB 4PJ5A 4QGYA 5ADPL 3S98A 1RZFH 1UKTA 1B0GB 3FZUD 1FN4B 1SBBA 4HIIB 4HUXB 2X4TB 2Y06L 5EUOE 1UM5H 1LGVA 3L7EB 3Q6GH 4NQDB 3SY0B 2FBOJ 4LPTA 3GMLB 4ISVA 4LAJH 5CLTA 4JO1L 1NBVL 5E9DA 5F1IA 3BRGC 3RL1A 1FC1A 2BY3A 5FDWB 2EYRA 1F6AB 1I3GH 2GAZB 4Y1AD 4CN6A 4U1GB 2DQGH 2ICWJ 4JDZA 3FOMB 2Q76B 4WGVB 2ZNWA 2FGWH 1CGSH 3GSXB 3GB7B 2NY5L 5AYQA 2VAJA 4C56B 5CJQH 3NZ8A 4YDKL 4PGCB 1RZ8A 3RWEA 4NCDA 4LL9A 4KTDH 1OP9A 4WUKL 2KL6A 3B5HA 4Z77A 4IRSB 3ARRA 1CXIA 4KPHL 1NCDL 4IIQB 3UBXA 2J88L 4HQQL 2ZKHH 4NQTA 3WS6A 4NKIL 4GMTL 4Z7OF 1G7IA 5FYJL 4U1IA 1DZBA 1SBSL 4C83A 2D03H 3MRKB 1D6EB 3E0GA 1JHKH 1AGCA 3OKYA 2L7UA 3C6LD 2CQVA 1GGIL 2M2DA 1HHKA 1FGNL 1KCUL 1S7RA 1J11A 3MYJA 4A6YB 5JOPD 3QUZD 2A6IA 4QCIB 4R2GC 4X9FA 2MMXA 2R0LL 4Y1AA 2P47B 1WFTA 4N5UA 3OTTA 3P2TA 3QUXB 1E6OL 1JNLL 4JFPA 2BOBA 5DMIH 5HHNA 1X4ZA 2EDXA 1X9QA 5CWSA 2YD8A 3RWGB 2Q86B 5L2KD 4FZEH 3O6MH 4DKAA 2XA8H 1V7NL 2FH8A 4Q97A 4LMQI 1UB5B 3GO1H 4CMHB 1FORL 2D7NA 3BDBA 4PLOB 1JFQH 3DJ9A 3FRUB 5D7IE 5I66A 1JN6B 4R7DB 5EU7C 4X6CE 1FH5L 3AM8C 1F97A 5DD6B 3LB6D 1LP9F 4GRWB 2FLBT 4N0UA 4MMZC 1JPGB 4QXGL 1JTPA 2P4AB 4PV8B 3C6LA 4XRCA 3QQNA 1K4DA 4G6AC 4XPTH 5EO0A 1DBJL 1TJHL 4XBEL 3QUZA 1WUNT 4YDVA 3B8SA 1Y6KR 1T7ZA 2PF6A 2R8SH 1BGXH 4O5LH 2R1YA 2A1WH 3SE3C 2H8PA 1V3MA 3MCLL 4K7PH 3L5XL 4QXWA 1T20A 5EBGA 1G1YA 3KXFB 2IG2L 4I48A 1NC2D 3QXAA 5T5NF 1S78C 5EZJB 5L2KA 4O2FB 4XT1C 3LKNA 1MFBL 5EU7E 3BZEA 3LEXB 3UZEA 4XPGH 2VDMH 3MGTB 4I8DA 1HI6A 1JGEA 3QJHB 1AD0A 3NN8B 2V7HB 4PJ7B 5F3BA 1T7YA 3GIZL 4JE4B 4OBRA 4PJDA 4XMLL 3SGJC 3TYGL 3U4BL 3HMWH 1S5IL 1TZGH 1F4HA 3TA3B 3TJEL 4FN0A 4E5XB 2OZ4A 3OX8A 4KTEH 4BFGA 4UMGA 3WUWG 3LHPL 5CZKA 3IDYC 2PCPB 4GXVL 4OF6A 4UNUA 2AV7A 1NAKH 4KQ4L 4ODUB 5B3NA 1YN7B 3MRQA 2Z91B 4N0RA 3TWCH 1J0IA 1T22B 3E8UH 2LTQB 4RFEA 3ZTNL 4DJMA 1RHFA 1J0HA 1NGXA 5T3XE 2NX5D 4L3AA 3QDGE 3VXSB 1AGEB 5IROC 4HJJL 2KQNA 2D0HA 5HHOD 1P7KB 4GH7B 3VGDA 2H9GB 4WW1B 3QDMB 3GSNB 4ZAKB 2PXYC 1NC2A 2D0FA 5GS0L 1BF8A 1F3JA 1IGYA 2CK2A 1WBZB 1U8KB 5T5FH 4OD2B 4YDJA 5TE7H 3HNVL 2SEBB 4IRJD 5D1QB 3MUGA 1L7TL 1T1WB 1D9KB 4Y16C 1JCKA 3ZKMD 1NDMB 1PX4A 5F6IC 3OZ9L 4NQUA 1YNTA 1I1YA 4OI9A 5HD8D 3NZHL 4UNVA 4WHYH 5L6YH 4H1LG 1OSPH 1P84K 2RGSA 4Z7NE 5T1DH 2GTZB 4AQ1B 4FP8L 3QCTH 2DQFA 4X5LA 3W39B 5JMOC 1EIBA 3ZHLA 1UM4L 3SDDB 5DD0H 3WKML 3V95A 2APTA 1VADB 1I3RA 1KUMA 2ATKA 4OQ1A 4QHLB 3QRGL 1EZVX 4DW2L 5IMMB 1A7RH 1J12A 1KB5A 4PJXB 4Z0BH 3U0WL 5K9QG 1PD6A 5EB9A 4Y5XC 5IQ9B 2JLLA 1HHGB 2NX5A 4LPVA 1R5VB 3KPRD 3RVTD 5D1ZD 3UPCA 3FB7A 4TOYH 5E94A 1XGRB 3ARGA 1K85A 4F3FA 5EORH 1C16A 1YY8B 4PTTA 5DUPL 5J13C 4ZS6D 4IOIB 1O5DT 4WI5A 4IRJA 3MRRA 4JQIL 4MXVE 4XNXL 5C0AB 4I4WA 2Z35A 4JRXB 1CBVH 1XF3B 4FTVE 3Q6FA 1UZ8B 3O2VL 4IOSD 1HILA 4D9QD 2NXYB 5T3ZL 5DI8A 3V7AE 1FIEA 1LO3L 1OAYL 1RK1A 2GJ6D 3AMKA 5BO1H 4EIGB 5CZVH 2APBA 4R97C 4JFFD 3SJVB 5FKAB 2A9MH 3DX9A 4OM1H 2DAVA 3D39D 3V52H 4GKOA 3VXNA 5HI3C 2X70B 3F7PC 2J8UE 3MX0A 5C9JB 5ADPH 1M7DB 4Y4FC 3S5LB 4GO6B 1J8HD 5D7LD 3TIEA 3WE6B 3BP6B 3BXNB 5C0BB 3HC3L 3EYOA 3KPRA 1CN4A 2B4CL 4LNRA 3F7QA 3TN0A 4GW1A 1JV5A 4JO1H 4L29B 4LEXL 1NBVH 4GBXC 3QIUA 3SO3C 8FABA 3SKMB 5DEGA 3FONB 4G8FB 4OGYL 4IRZL 1M1SA 2NY5H 3U36B 1CLOH 1L0XA 4NIKB 3LH2L 4O2EB 3VXOB 1MJUL 4YEEA 4KU1A 3C60B 2W60A 2NTFA 4AEIL 5DMKB 4WUKH 1AFVH 4I2XB 5D2NC 4KPHH 1NCDH 2VB5A 1LEKB 2J88H 2QR0A 4Z7VF 2YA2A 3MV9D 4HQQH 4HFWB 1ZT4B 1CYGA 4UIKL 4YPGB 4NKIH 4GMTH 3WJJC 4JFFA 5FYJH 4KHTL 1K4CA 1SBSH 4HMDA 5E8DL 1MCLA 4M03A 4CN1A 1EBPA 1WBXA 3DV4A 4EUPG 3KVQA 4ZTOL 3BZDA 5LG1A 1J8HA 3UTSE 4JY6B 1GGIH 3HG1B 1FGNH 1KCUH 4MSWA 4YFDB 1UWXH 2R9HC 5IG7B 4LPCA 3ARFC 5D2NE 2CJUL 5D71L 1E6OH 1JNLH 3GMOB 4M7LL 4P2QB 4UOW1 5AD0A 1AP2A 3I6KA 4PJ5B 3CUPA 3CFJA 1YEHL 1ZK9A 4PGBA 2X4NA 4YR6A 3VXUD 5KVFL 3HTLX 3CDGA 1SMAA 3NIGE 2NW2A 1V7NH 1YA5A 1BWWA 1FORH 2VDNH 2WM0A 1AO7A 2CKBA 3RL1B 4JO3L 2EYRB 5B38G 3MV9A 2QLVB 5KS9B 4P5TB 1I9JL 3X3GL 4JDZB 4OGXL 4YBLB 1FH5H 4F7PA 5CEZL 3V2AR 1A7PL 5EH1A 3V8CA 1DQJB 5DD3L 4CJ1A 3NZ8B 4QXGH 4XP9L 2KDGA 4W4OC 2DN7A 4LPWA 1ZHBB 4JKKA 3T2PA 4Z77B 5FXCH 2DMBA 4KDWA 3EDEA 4YHYC 2WQ8A 3OG6B 4KFZC 5EUOF 3NFPA 1UXSB 1DBJH 1TJHH 4XBEH 1NL0H 3BW9A 2W0KA 2B0SL 1R3LB 3GMRA 3KS0H 4ZPVA 4OLXL 3MCLH 4U1IB 1RHHA 4M9OA 2IG2H 5DFVC 2VH5L 5KANG 1HHJA 3EJYC 1XF5A 4LGRB 5KTEL 3OB0H 3RWCA 1MFBH 1AGBB 3S37L 5I0ZA 1S7RB 4JKMA 3PWLA 4KI1A 2A6IB 2F54A 3V5KB 5GZOD 4GXUM 1GIGL 3PWVB 2Y36L 4LHJB 3DETD 4BQ9A 5J6GA 2ZUVA 4AQOA 2H2SC 2VDQL 3EZJB 3GIZH 4XMLH 5D70L 3U9UA 4JFPB 4CRPA 1S5IH 3QUKB 1MUJA 3TJEH 5HHNB 3CVIL 1XMWA 4G8GA 5CWSB 1C08A 2P24A 4GXVH 1LP9A 4KQ4H 5HBBA 3VXRE 4WFEE 3MV8E 4EVNA 4R3SA 4X83A 2J6EH 5GPRA 5C6PB 4R8WL 3LN4A 3S6CA 4PD4K 3TPUA 4WTZA 3RDTB 3ZTNH 3QQ3B 4ZFOL 3F58H 3U7AA 1JGDB 1W8NA 3DWTA 4GG8A 3ECBA 4HJJH 1MHHB 1NGQH 1YNLL 1MQ8A 2XWTA 3IDXL 4PJHE 1K6QL 1BFSA 5J57B 4N0UB 3TNMA 1MELA 3MROB 2FWOA 5GS0H 2R0KH 4RGMB 5DVMA 2ERJC 4XRCB 1IQWL 5TE6L 4HC1L 1EVTC 5JDJA 1I1AD 4PB9L 5EO0B 3HNVH 3OXRB 2BNRA 1L7TH 3QUZB 5JPMA 5FGCB 3OZ9H 2R1YB 2H8PB 5KSAD 1I1RA 1MCDA 4BZ1L 1J88A 4ZQKA 3NZHH 1CDIA 3UAJC 4I3GA 5D7IF 5DUBA 3ROLA 1D7FA 4FP8H 1OGAB 4X6CF 4FXKB 3QXAB 5IB2A 5BZDA 4D0BB 1J8KA 5L2KB 1N5AB 5E1HB 4IJ3C 3LKNB 3JV0A 5C0IB 3RWIA 1UM4H 2DM3A 2IGFL 4IOFC 3LQAC 5JUEL 4BELD 3WKMH 1IGCL 1G7MA 1MCWM 1N59A 3PHOA 1EGJL 3DSNA 2Z8RA 4KV5E 4LCUB 1HI6B 3QRGH 4DW2H 1OHQA 2GI7A 3U0WH 5F3BB 4JANB 1HHHA 3BP7A 2ICCA 5F44A 1FNGB 2BSSA 4DEPC 5ENWB 3W9EA 1D5BB 5IJVB 2GHWB 5JOFB 2AV7B 1UGNA 4Z7UE 4GKZA 1I1AA 1JF1A 2HFTA 3HHRB 4HIHA 5CSZA 5E70A 5C6WH 4K8RD 4IS6A 3D9AL 3CFDA 4JQIH 4XNXH 3C87A 5GS3A 4HZAA 4KJPD 5KSAA 5TF1L 3IFLL 4PGZA 1A47A 1AY1L 2Q6WA 1KENL 3O2VH 5IFHL 3RIAF 1QR4A 5IW6B 3RPIA 1NC2B 5ACMA 1F3JB 1IGYB 1LO3H 1OAYH 4O02L 3QEGL 1YEIL 1Z0NA 1H5BC 1YY9D 4YK4C 1PY9A 4YDJB 3SKNB 2EE6A 3TFKD 2DI8A 4NPYA 5IKCA 5I8KH 5F1OB 3MV7E 4MJ6A 3X11B 3O81A 1YECH 2XNAA 4ZFGL 4P49A 1CE1L 4D9LL 4JEGB 4MXQC 3P4LA 1CLCA 3OKKA 3HC3H 4YIQB 4GRMB 5J56B 1CT8A 4LEXH 2R15A 2DQFB 4JM2C 1ZLWH 4WVRA 2JJVA 3G6AB 4OGYH 4IRZH 1DQTA 2HVJB 2ATKB 3K1KC 4BFIB 2BDNL 2X1WL 5FK9A 2XV6B 1GZQA 1KB5B 1MJUH 3DV6B 4P0DA 4L3EE 5IP4A 2DDQL 2NX5B 3MNVA 4AEIH 3AREB 5HHOB 5D7KD 1DUYA 3FB7B 4DGYL 5E94B 1LILA 2H6PA 3VFNA 5T33L 4CVWA 3K1DA 3IKCB 1C16B 4R4NC 5EOQL 4Z7NF 5HYSG 1XGTA 4PTTB 5HTSA 4IDLA 1JWMA 4KHTH 2RFXB 3IDIA 2LVCA 4IRJB 4GW5B 5E8DH 1DBKL 4CVXA 1NKOA 2PYED 1F00I 1S7VB 3MRRB 3VG9C 1O7VA 4ZTOH 4I4WB 4KKCD 4XCEA 3ARPA 4PJ9A 3P30L 3HKFA 4KXZI 1RZGA 5IHUL 1HILB 5MENE 5ISZE 1J0YA 4NM8L 1JYVA 2C4FT 5C2BL 1AE6L 4HLZH 4UU9B 1A1OB 3DX9B 5ANMA 2CJUH 5D71H 2EKSB 4M7LH 4PJAE 1L6ZA 2F19H 3UJIL 3VXNB 1U6AL 3WFHB 2QSCL 2PTUA 4Y88A 3QDJA 5IM7A 1YEHH 4XMKL 2XZZA 4MXWL 3ZTJH 2KPNA 3TIEB 5F8QC 5J9PB 2YUZA 3EYOB 3KPRB 4LNRB 4MXVF 2WV3A 5D1ZB 3RTQC 1JV5B 4XNMA 1IQDB 4JO3H 1CLZL 1CDGA 8FABB 1I9JH 3X3GH 5DEGB 4H88L 4OGXH 3LOWA 1HE7A 4HHAA 5CEZH 1A7PH 1KJVB 5JIIA 4JFXA 5DD3H 2VN7A 2PYEA 5EIIA 4P4KD 4X6FB 1ACYL 3AROA 4OLWL 1HZHL 1MCCA 4XP9H 1DLFH 4U1KA 2J8UF 3FQWA