2J8JA

Solution structure of the a4 domain of blood coagulation factor xi
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
90
structure length
90
Chain Sequence
b'FCHSSFYHDTDFLGEELDIVAAKSHEACQKLCTNAVRCQFFTYTPAQASCNEGKGKCYLKLSSNGSPTKILHGRGGISGYTLRLCKMDNE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords COAGULATION FACTOR XI
publication title Solution Structure of the A4 Domain of Factor Xi Sheds Light on the Mechanism of Zymogen Activation.
pubmed doi rcsb
molecule tags Hydrolase
total genus 18
structure length 90
sequence length 90
chains with identical sequence B
ec nomenclature ec 3.4.21.27: Coagulation factor XIa.
pdb deposition date 2006-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00024 PAN_1 PAN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.4.10 Alpha Beta 3-Layer(bba) Sandwich Hepatocyte Growth Factor Hepatocyte Growth Factor 2j8jA00
2Y8RA 1GMOA 1GMNA 4A5TS 1BHTA 2K13X 2YILA 3HMRA 3MKPA 5CS9A 4Z0EA 5CS1A 3HMSA 3ZWZA 1GP9A 1I8NA 1W81A 2Z8VA 4R19A 4UAOA 4UV6A 4APLA 5EODA 4R1BA 4R1CA 2YIPA 5EOKA 2X2ZA 2Z8WA 3SRIA 2J8LA 2YIOA 2LL4M 1Z40A 2Q8BA 3ZLEA 5CS3A 4IUAA 5CT3A 4Z09A 3SRJA 5CT1A 2Q8AA 2QJ4A 4Z0DA 1W8KA 3HMTA 5I25A 5COEA 5CS5A 2J8JA 1NK1A 4Z0FA 2LL3A 2QJ2A 4R1AA 5CSQA 3SP8A 4DURA 1HKYA 2HGFA 5CT2A 4APMA 3HN4A 5CP9A 2F83A 1YXEA
chains in the Genus database with same CATH superfamily
2Y8RA 1GMOA 1GMNA 4A5TS 1BHTA 2K13X 2YILA 3HMRA 3MKPA 5CS9A 4Z0EA 5CS1A 3HMSA 3ZWZA 1GP9A 1I8NA 1W81A 2Z8VA 4R19A 4UAOA 4UV6A 4APLA 5EODA 4R1BA 4R1CA 2YIPA 5EOKA 2X2ZA 2Z8WA 2KL5A 3SRIA 2J8LA 2YIOA 2LL4M 1Z40A 2Q8BA 3ZLEA 5CS3A 4IUAA 5CT3A 4Z09A 3SRJA 5CT1A 2Q8AA 2QJ4A 4Z0DA 1W8KA 3HMTA 4YIVA 5I25A 5COEA 5CS5A 2J8JA 1NK1A 4Z0FA 2LL3A 2QJ2A 4R1AA 5CSQA 3SP8A 4DURA 1HKYA 2HGFA 5CT2A 4APMA 3HN4A 5CP9A 2F83A 1YXEA 4YIZA
chains in the Genus database with same CATH topology
2Y8RA 1GMOA 1GMNA 4A5TS 1BHTA 2K13X 2YILA 3HMRA 3MKPA 5CS9A 4Z0EA 5CS1A 3HMSA 3ZWZA 1GP9A 1I8NA 1W81A 2Z8VA 4R19A 4UAOA 4UV6A 4APLA 5EODA 4R1BA 4R1CA 2YIPA 5EOKA 2X2ZA 2Z8WA 2KL5A 3SRIA 2J8LA 2YIOA 2LL4M 1Z40A 2Q8BA 3ZLEA 5CS3A 4IUAA 5CT3A 4Z09A 3SRJA 5CT1A 2Q8AA 2QJ4A 4Z0DA 1W8KA 3HMTA 4YIVA 5I25A 5COEA 5CS5A 2J8JA 1NK1A 4Z0FA 2LL3A 2QJ2A 4R1AA 5CSQA 3SP8A 4DURA 1HKYA 2HGFA 5CT2A 4APMA 3HN4A 5CP9A 2F83A 1YXEA 4YIZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y8R A;  1GMO A;  1GMN A;  4A5T S;  1BHT A;  2K13 X;  2YIL A;  3HMR A;  3MKP A;  5CS9 A;  4Z0E A;  5CS1 A;  3HMS A;  3ZWZ A;  1GP9 A;  1I8N A;  1W81 A;  2Z8V A;  4R19 A;  4UAO A;  4UV6 A;  4APL A;  5EOD A;  4R1B A;  4R1C A;  2YIP A;  5EOK A;  2X2Z A;  2Z8W A;  3SRI A;  2J8L A;  2YIO A;  2LL4 M;  1Z40 A;  2Q8B A;  3ZLE A;  5CS3 A;  4IUA A;  5CT3 A;  4Z09 A;  3SRJ A;  5CT1 A;  2Q8A A;  2QJ4 A;  4Z0D A;  1W8K A;  3HMT A;  5I25 A;  5COE A;  5CS5 A;  2J8J A;  1NK1 A;  4Z0F A;  2LL3 A;  2QJ2 A;  4R1A A;  5CSQ A;  3SP8 A;  4DUR A;  1HKY A;  2HGF A;  5CT2 A;  4APM A;  3HN4 A;  5CP9 A;  2F83 A;  1YXE A; 
#chains in the Genus database with same CATH topology
 2Y8R A;  1GMO A;  1GMN A;  4A5T S;  1BHT A;  2K13 X;  2YIL A;  3HMR A;  3MKP A;  5CS9 A;  4Z0E A;  5CS1 A;  3HMS A;  3ZWZ A;  1GP9 A;  1I8N A;  1W81 A;  2Z8V A;  4R19 A;  4UAO A;  4UV6 A;  4APL A;  5EOD A;  4R1B A;  4R1C A;  2YIP A;  5EOK A;  2X2Z A;  2Z8W A;  2KL5 A;  3SRI A;  2J8L A;  2YIO A;  2LL4 M;  1Z40 A;  2Q8B A;  3ZLE A;  5CS3 A;  4IUA A;  5CT3 A;  4Z09 A;  3SRJ A;  5CT1 A;  2Q8A A;  2QJ4 A;  4Z0D A;  1W8K A;  3HMT A;  4YIV A;  5I25 A;  5COE A;  5CS5 A;  2J8J A;  1NK1 A;  4Z0F A;  2LL3 A;  2QJ2 A;  4R1A A;  5CSQ A;  3SP8 A;  4DUR A;  1HKY A;  2HGF A;  5CT2 A;  4APM A;  3HN4 A;  5CP9 A;  2F83 A;  1YXE A;  4YIZ A; 
#chains in the Genus database with same CATH homology
 2Y8R A;  1GMO A;  1GMN A;  4A5T S;  1BHT A;  2K13 X;  2YIL A;  3HMR A;  3MKP A;  5CS9 A;  4Z0E A;  5CS1 A;  3HMS A;  3ZWZ A;  1GP9 A;  1I8N A;  1W81 A;  2Z8V A;  4R19 A;  4UAO A;  4UV6 A;  4APL A;  5EOD A;  4R1B A;  4R1C A;  2YIP A;  5EOK A;  2X2Z A;  2Z8W A;  2KL5 A;  3SRI A;  2J8L A;  2YIO A;  2LL4 M;  1Z40 A;  2Q8B A;  3ZLE A;  5CS3 A;  4IUA A;  5CT3 A;  4Z09 A;  3SRJ A;  5CT1 A;  2Q8A A;  2QJ4 A;  4Z0D A;  1W8K A;  3HMT A;  4YIV A;  5I25 A;  5COE A;  5CS5 A;  2J8J A;  1NK1 A;  4Z0F A;  2LL3 A;  2QJ2 A;  4R1A A;  5CSQ A;  3SP8 A;  4DUR A;  1HKY A;  2HGF A;  5CT2 A;  4APM A;  3HN4 A;  5CP9 A;  2F83 A;  1YXE A;  4YIZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...