2J8JA

Solution structure of the a4 domain of blood coagulation factor xi
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
90
structure length
90
Chain Sequence
FCHSSFYHDTDFLGEELDIVAAKSHEACQKLCTNAVRCQFFTYTPAQASCNEGKGKCYLKLSSNGSPTKILHGRGGISGYTLRLCKMDNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords COAGULATION FACTOR XI
publication title Solution Structure of the A4 Domain of Factor Xi Sheds Light on the Mechanism of Zymogen Activation.
pubmed doi rcsb
molecule tags Hydrolase
total genus 18
structure length 90
sequence length 90
chains with identical sequence B
ec nomenclature ec 3.4.21.27: Coagulation factor XIa.
pdb deposition date 2006-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00024 PAN_1 PAN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.4.10 Alpha Beta 3-Layer(bba) Sandwich Hepatocyte Growth Factor Hepatocyte Growth Factor 2j8jA00
5EODA 4R1AA 3SRJA 5CS9A 4R1CA 1BHTA 4Z0EA 4A5TS 2QJ4A 1HKYA 3HMSA 2X2ZA 4DURA 2Q8BA 5EOKA 3ZWZA 5CT1A 4UV6A 2LL4M 2Z8WA 4Z09A 5CS3A 3SRIA 5I25A 5CP9A 3MKPA 2Z8VA 1Z40A 3HMRA 5CS1A 4Z0DA 2Y8RA 2YILA 4R19A 2HGFA 1I8NA 1W8KA 2J8JA 1GMOA 1YXEA 4IUAA 3SP8A 2YIPA 2LL3A 1GMNA 5CS5A 2K13X 1W81A 5CT2A 5CSQA 4APMA 1GP9A 2J8LA 3HMTA 4Z0FA 2F83A 4R1BA 5CT3A 2QJ2A 2Q8AA 3HN4A 1NK1A 4UAOA 3ZLEA 4APLA 5COEA 2YIOA
chains in the Genus database with same CATH superfamily
5EODA 4R1AA 4YIVA 2KL5A 3SRJA 5CS9A 4R1CA 1BHTA 4Z0EA 4A5TS 2QJ4A 1HKYA 3HMSA 2X2ZA 4DURA 2Q8BA 5EOKA 3ZWZA 5CT1A 4UV6A 2LL4M 2Z8WA 4Z09A 5CS3A 4YIZA 3SRIA 5I25A 5CP9A 3MKPA 2Z8VA 1Z40A 3HMRA 5CS1A 4Z0DA 2Y8RA 2YILA 4R19A 2HGFA 1I8NA 1W8KA 2J8JA 1GMOA 1YXEA 4IUAA 3SP8A 2YIPA 2LL3A 1GMNA 5CS5A 2K13X 1W81A 5CT2A 5CSQA 4APMA 1GP9A 2J8LA 3HMTA 4Z0FA 2F83A 4R1BA 5CT3A 2QJ2A 2Q8AA 3HN4A 1NK1A 4UAOA 3ZLEA 4APLA 5COEA 2YIOA
chains in the Genus database with same CATH topology
5EODA 4R1AA 4YIVA 2KL5A 3SRJA 5CS9A 4R1CA 1BHTA 4Z0EA 4A5TS 2QJ4A 1HKYA 3HMSA 2X2ZA 4DURA 2Q8BA 5EOKA 3ZWZA 5CT1A 4UV6A 2LL4M 2Z8WA 4Z09A 5CS3A 4YIZA 3SRIA 5I25A 5CP9A 3MKPA 2Z8VA 1Z40A 3HMRA 5CS1A 4Z0DA 2Y8RA 2YILA 4R19A 2HGFA 1I8NA 1W8KA 2J8JA 1GMOA 1YXEA 4IUAA 3SP8A 2YIPA 2LL3A 1GMNA 5CS5A 2K13X 1W81A 5CT2A 5CSQA 4APMA 1GP9A 2J8LA 3HMTA 4Z0FA 2F83A 4R1BA 5CT3A 2QJ2A 2Q8AA 3HN4A 1NK1A 4UAOA 3ZLEA 4APLA 5COEA 2YIOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EOD A;  4R1A A;  3SRJ A;  5CS9 A;  4R1C A;  1BHT A;  4Z0E A;  4A5T S;  2QJ4 A;  1HKY A;  3HMS A;  2X2Z A;  4DUR A;  2Q8B A;  5EOK A;  3ZWZ A;  5CT1 A;  4UV6 A;  2LL4 M;  2Z8W A;  4Z09 A;  5CS3 A;  3SRI A;  5I25 A;  5CP9 A;  3MKP A;  2Z8V A;  1Z40 A;  3HMR A;  5CS1 A;  4Z0D A;  2Y8R A;  2YIL A;  4R19 A;  2HGF A;  1I8N A;  1W8K A;  2J8J A;  1GMO A;  1YXE A;  4IUA A;  3SP8 A;  2YIP A;  2LL3 A;  1GMN A;  5CS5 A;  2K13 X;  1W81 A;  5CT2 A;  5CSQ A;  4APM A;  1GP9 A;  2J8L A;  3HMT A;  4Z0F A;  2F83 A;  4R1B A;  5CT3 A;  2QJ2 A;  2Q8A A;  3HN4 A;  1NK1 A;  4UAO A;  3ZLE A;  4APL A;  5COE A;  2YIO A; 
#chains in the Genus database with same CATH topology
 5EOD A;  4R1A A;  4YIV A;  2KL5 A;  3SRJ A;  5CS9 A;  4R1C A;  1BHT A;  4Z0E A;  4A5T S;  2QJ4 A;  1HKY A;  3HMS A;  2X2Z A;  4DUR A;  2Q8B A;  5EOK A;  3ZWZ A;  5CT1 A;  4UV6 A;  2LL4 M;  2Z8W A;  4Z09 A;  5CS3 A;  4YIZ A;  3SRI A;  5I25 A;  5CP9 A;  3MKP A;  2Z8V A;  1Z40 A;  3HMR A;  5CS1 A;  4Z0D A;  2Y8R A;  2YIL A;  4R19 A;  2HGF A;  1I8N A;  1W8K A;  2J8J A;  1GMO A;  1YXE A;  4IUA A;  3SP8 A;  2YIP A;  2LL3 A;  1GMN A;  5CS5 A;  2K13 X;  1W81 A;  5CT2 A;  5CSQ A;  4APM A;  1GP9 A;  2J8L A;  3HMT A;  4Z0F A;  2F83 A;  4R1B A;  5CT3 A;  2QJ2 A;  2Q8A A;  3HN4 A;  1NK1 A;  4UAO A;  3ZLE A;  4APL A;  5COE A;  2YIO A; 
#chains in the Genus database with same CATH homology
 5EOD A;  4R1A A;  4YIV A;  2KL5 A;  3SRJ A;  5CS9 A;  4R1C A;  1BHT A;  4Z0E A;  4A5T S;  2QJ4 A;  1HKY A;  3HMS A;  2X2Z A;  4DUR A;  2Q8B A;  5EOK A;  3ZWZ A;  5CT1 A;  4UV6 A;  2LL4 M;  2Z8W A;  4Z09 A;  5CS3 A;  4YIZ A;  3SRI A;  5I25 A;  5CP9 A;  3MKP A;  2Z8V A;  1Z40 A;  3HMR A;  5CS1 A;  4Z0D A;  2Y8R A;  2YIL A;  4R19 A;  2HGF A;  1I8N A;  1W8K A;  2J8J A;  1GMO A;  1YXE A;  4IUA A;  3SP8 A;  2YIP A;  2LL3 A;  1GMN A;  5CS5 A;  2K13 X;  1W81 A;  5CT2 A;  5CSQ A;  4APM A;  1GP9 A;  2J8L A;  3HMT A;  4Z0F A;  2F83 A;  4R1B A;  5CT3 A;  2QJ2 A;  2Q8A A;  3HN4 A;  1NK1 A;  4UAO A;  3ZLE A;  4APL A;  5COE A;  2YIO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...