2J8QA

Crystal structure of human cleavage and polyadenylation specificity factor 5 (cpsf5) in complex with a sulphate ion.
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
206
structure length
203
Chain Sequence
SMYIQQTKPLTLERTINLYPLTNYTFGTKEPLYEKDSSVAARFQRMREEFDKIGMRRTVEGVLIVHEHRLPHVLLLQLGTTFFKLPGGELNPGEDEVEGLKRLMTEILGRQDQDWVIDDCIGNWWRPNFEPPQYPYIPAHITKPKEHKKLFLVQLQEKALFAVPKNYKLVAAPLFELYDNAPGYGPIISSLPQLLSRFNFIYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CLEAVAGE AND POLYADENYLATION SPECIFICITY FACTOR 5
publication title The Crystal Structure of Human Cleavage and Polyadenylation Specific Factor-5 Reveals a Dimeric Nudix Protein with a Conserved Catalytic Site.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Nuclear protein
total genus 48
structure length 203
sequence length 206
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13869 NUDIX_2 Nucleotide hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 2j8qA01
3OGAA 3A6VA 2A8SA 4HFQA 4HVYA 3F6AA 3FJYA 3QSJA 5CFJA 2A8RA 3A6SA 1X84A 3E57A 3MDIA 2ICJA 4ICKA 4NFWA 5BONA 2J8QA 3MCFA 5CFIA 1RYAA 5DD4A 5I8UA 1K2EA 2Q9PA 3L85A 1RRQA 1F3YA 2AZWA 3HYQA 3GG6A 4YPHA 4C9WA 5GHIA 1MQEA 2O5FA 1V8UA 1VIQA 3BHOA 1QVJA 1U20A 2DSBA 5FSOA 3SMDA 4DYWA 1JKNA 3EF5A 2ICKA 1JRKA 3FCMA 4KTBA 1KTGA 4JZVA 5GHQA 3BM4A 1I9AA 3GZ6A 1PPWA 2DHOA 2FVVA 2I8UA 2XSQA 3DUPA 3FK9A 1MR2A 3A6TA 2DSDA 2QJOA 3Q4IA 3EESA 3X0QA 3Q2TA 5GHJA 1XSCA 1SU2A 2VNPA 4S2VA 1V8YA 1IRYA 3N9UA 2G73A 1X83A 1VHGA 3O52A 3KVHA 5FSMA 3BAPA 1HX3A 1VC8A 3X0PA 5FSLA 1X51A 1NFZA 3X0OA 5IW5A 1VC9A 1Q33A 5GHPA 2VNQA 1KT9A 3X0SA 3DKUA 4N1UA 3I7VA 3FSPA 3AC9A 3X0NA 2I6KA 3N77A 3Q91A 4IJXA 4JZTA 1VCDA 5GHOA 5C7TA 3O69A 2GT2A 3ACAA 3H95A 4ZG0A 4YOQA 1VRLA 2JVBA 3O6ZA 3O61A 1VIUA 4KYXA 5ANVA 1VK6A 2A8PA 2RRKA 4MPOA 1G9QA 5ANUA 5FSNA 4C9XA 2PNYA 1V8MA 1XSAA 1V8IA 2A8QA 3F13A 3A6UA 2O1CA 4K6EA 4JZUA 1V8VA 2FKBA 5LPGA 2GT4A 2DUKA 3CNGA 1G0SA 1GA7A 2KDVA 4ILQA 4KG4A 3GZ8A 1NQYA 5DEQA 5ANTA 5GHMA 1NQZA 2R5WA 2I8TA 3GZ5A 3SONA 2B0VA 1Q54A 1V8WA 3MDGA 4YPRA 1TUMA 1KHZA 1V8SA 3X0MA 3X0RA 1Q27A 1PPVA 2YVNA 1PUNA 4JZSA 1PUQA 3ZR0A 3R03A 2W4EA 5ISYA 1VHZA 2PQVA 5HZXA 1MUTA 5C7QA 2A8TA 1SOIA 2B06A 5DDGA 3FFUA 4S2YA 1MK1A 1PPXA 1XSBA 3P5TA 1V8LA 2GB5A 1HZTA 2YVOA 3X0KA 3G0QA 3X0IA 1OW2A 3O8SA 2B2KA 1K26A 1SZ3A 1MQWA 2CL3A 3ID9A 3EXQA 1RRSA 1V8RA 3COUA 3X0LA 5DPKA 2YVMA 3X0JA 5IW4A 3P6YA 4V14A 2KDWA 3RH7A 2FMLA 2YYHA 2YVPA 3WHWA 1V8TA 3Q1PA 5ANWA 3GWYA 5FSKA 3GRNA 1PUSA 3Q2SA 5BS6A 1V8NA 3SHDA 3U53A 1R67A 2DSCA 4S2WA 5FSIA 3Q93A 5C8LA 2QJTA 2G74A 3HHJA 1MP2A 3ZR1A 1NFSA 4NFXA 3I7UA 3J7Ye 4KG3A 4N1TA 4S2XA 2A6TA 3MGMA 1SJYA 5ANSA 5GHNA 3EEUA 2O5WA 1PVFA 3I9XA 2QKMB
chains in the Genus database with same CATH superfamily
3OGAA 3A6VA 2A8SA 4HFQA 4HVYA 3F6AA 3FJYA 3QSJA 5CFJA 2A8RA 3A6SA 1X84A 3E57A 3MDIA 2ICJA 4ICKA 4NFWA 5BONA 4J7HA 2J8QA 3MCFA 5CFIA 1RYAA 5DD4A 5I8UA 1K2EA 2Q9PA 3L85A 1RRQA 1F3YA 2AZWA 3HYQA 3GG6A 4YPHA 4C9WA 5GHIA 1MQEA 2O5FA 1V8UA 1VIQA 3BHOA 1QVJA 1U20A 2DSBA 5FSOA 3SMDA 4DYWA 1JKNA 3EF5A 2ICKA 1JRKA 3FCMA 4KTBA 1KTGA 4JZVA 5GHQA 3BM4A 1I9AA 3GZ6A 1PPWA 2DHOA 2FVVA 2I8UA 2XSQA 3DUPA 3FK9A 1MR2A 3A6TA 2DSDA 2QJOA 3Q4IA 3EESA 3X0QA 3Q2TA 5GHJA 1XSCA 1SU2A 2VNPA 4S2VA 1V8YA 1IRYA 4J7GA 3N9UA 2G73A 1X83A 1VHGA 3O52A 3KVHA 5FSMA 3BAPA 1HX3A 1VC8A 3X0PA 5FSLA 1X51A 1NFZA 3X0OA 5IW5A 1VC9A 1Q33A 5GHPA 2VNQA 1KT9A 3X0SA 3DKUA 4N1UA 3I7VA 3FSPA 3AC9A 3X0NA 2I6KA 3N77A 3Q91A 4IJXA 4JZTA 1VCDA 5GHOA 5C7TA 3O69A 2GT2A 3ACAA 3H95A 4ZG0A 4YOQA 1VRLA 2JVBA 3O6ZA 3O61A 1VIUA 4KYXA 5ANVA 1VK6A 2A8PA 2RRKA 4MPOA 1G9QA 5ANUA 5FSNA 4C9XA 2PNYA 1V8MA 1XSAA 1V8IA 2A8QA 3F13A 3A6UA 2O1CA 4K6EA 4JZUA 1V8VA 2FKBA 5LPGA 2GT4A 2DUKA 3CNGA 1G0SA 1GA7A 2KDVA 4ILQA 4KG4A 3GZ8A 1NQYA 5DEQA 5ANTA 5GHMA 1NQZA 2R5WA 2I8TA 3GZ5A 3SONA 2B0VA 1Q54A 1V8WA 3MDGA 4YPRA 1TUMA 1KHZA 1V8SA 3X0MA 3X0RA 1Q27A 1PPVA 2YVNA 1PUNA 4JZSA 1PUQA 3ZR0A 3R03A 2W4EA 5ISYA 1VHZA 2PQVA 5HZXA 1MUTA 5C7QA 2A8TA 1SOIA 2B06A 5DDGA 3FFUA 4S2YA 1MK1A 1PPXA 1XSBA 3P5TA 1V8LA 2GB5A 1HZTA 2YVOA 3X0KA 3G0QA 3X0IA 1OW2A 3O8SA 2B2KA 1K26A 1SZ3A 1MQWA 2CL3A 2CZRA 3ID9A 3EXQA 1RRSA 1V8RA 3COUA 3X0LA 5DPKA 2YVMA 3X0JA 5IW4A 3P6YA 4V14A 2KDWA 3RH7A 2FMLA 2YYHA 2YVPA 3WHWA 1V8TA 3Q1PA 5ANWA 3GWYA 5FSKA 3GRNA 1PUSA 3Q2SA 5BS6A 1V8NA 3SHDA 3U53A 1R67A 2DSCA 4S2WA 5FSIA 3Q93A 5C8LA 2QJTA 2G74A 3HHJA 1MP2A 3ZR1A 1NFSA 4NFXA 3I7UA 3J7Ye 4KG3A 4N1TA 4S2XA 2A6TA 3MGMA 1SJYA 5ANSA 5GHNA 3EEUA 2O5WA 1PVFA 3I9XA 2QKMB
chains in the Genus database with same CATH topology
3OGAA 3A6VA 2A8SA 4HFQA 4HVYA 3F6AA 3FJYA 3QSJA 5CFJA 2A8RA 3A6SA 1X84A 3E57A 3MDIA 2ICJA 4ICKA 4NFWA 5BONA 4J7HA 2J8QA 3MCFA 5CFIA 1RYAA 5DD4A 5I8UA 1K2EA 2Q9PA 3L85A 1RRQA 1F3YA 2AZWA 3HYQA 3GG6A 4YPHA 4C9WA 5GHIA 1MQEA 2O5FA 1V8UA 1VIQA 3BHOA 1QVJA 1U20A 2DSBA 5FSOA 3SMDA 4DYWA 1JKNA 3EF5A 2ICKA 1JRKA 3FCMA 4KTBA 1KTGA 4JZVA 5GHQA 3BM4A 1I9AA 3GZ6A 1PPWA 2DHOA 2FVVA 2I8UA 2XSQA 3DUPA 3FK9A 1MR2A 3A6TA 2DSDA 2QJOA 3Q4IA 3EESA 3X0QA 3Q2TA 5GHJA 1XSCA 1SU2A 2VNPA 4S2VA 1V8YA 1IRYA 4J7GA 3N9UA 2G73A 1X83A 1VHGA 3O52A 3KVHA 5FSMA 3BAPA 1HX3A 1VC8A 3X0PA 5FSLA 1X51A 1NFZA 3X0OA 5IW5A 1VC9A 1Q33A 5GHPA 2VNQA 1KT9A 3X0SA 3DKUA 4N1UA 3I7VA 3FSPA 3AC9A 3X0NA 2I6KA 3N77A 3Q91A 4IJXA 4JZTA 1VCDA 5GHOA 5C7TA 3O69A 2GT2A 3ACAA 3H95A 4ZG0A 4YOQA 1VRLA 2JVBA 3O6ZA 3O61A 1VIUA 4KYXA 5ANVA 1VK6A 2A8PA 2RRKA 4MPOA 1G9QA 5ANUA 5FSNA 4C9XA 2PNYA 1V8MA 1XSAA 1V8IA 2A8QA 3F13A 3A6UA 2O1CA 4K6EA 4JZUA 1V8VA 2FKBA 5LPGA 2GT4A 2DUKA 3CNGA 1G0SA 1GA7A 2KDVA 4ILQA 4KG4A 3GZ8A 1NQYA 5DEQA 5ANTA 5GHMA 1NQZA 2R5WA 2I8TA 3GZ5A 3SONA 2B0VA 1Q54A 1V8WA 3MDGA 4YPRA 1TUMA 1KHZA 1V8SA 3X0MA 3X0RA 1Q27A 1PPVA 2YVNA 1PUNA 4JZSA 1PUQA 3ZR0A 3R03A 2W4EA 5ISYA 1VHZA 2PQVA 5HZXA 1MUTA 5C7QA 2A8TA 1SOIA 2B06A 5DDGA 3FFUA 4S2YA 1MK1A 1PPXA 1XSBA 3P5TA 1V8LA 2GB5A 1HZTA 2YVOA 3X0KA 3G0QA 3X0IA 1OW2A 3O8SA 2B2KA 1K26A 1SZ3A 1MQWA 2CL3A 2CZRA 3ID9A 3EXQA 1RRSA 1V8RA 3COUA 3X0LA 5DPKA 2YVMA 3X0JA 5IW4A 3P6YA 4V14A 2KDWA 3RH7A 2FMLA 2YYHA 2YVPA 3WHWA 1V8TA 3Q1PA 5ANWA 3GWYA 5FSKA 3GRNA 1PUSA 3Q2SA 5BS6A 1V8NA 3SHDA 3U53A 1R67A 2DSCA 4S2WA 5FSIA 3Q93A 5C8LA 2QJTA 2G74A 3HHJA 1MP2A 3ZR1A 1NFSA 4NFXA 3I7UA 3J7Ye 4KG3A 4N1TA 4S2XA 2A6TA 3MGMA 1SJYA 5ANSA 5GHNA 3EEUA 2O5WA 1PVFA 3I9XA 2QKMB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OGA A;  3A6V A;  2A8S A;  4HFQ A;  4HVY A;  3F6A A;  3FJY A;  3QSJ A;  5CFJ A;  2A8R A;  3A6S A;  1X84 A;  3E57 A;  3MDI A;  2ICJ A;  4ICK A;  4NFW A;  5BON A;  2J8Q A;  3MCF A;  5CFI A;  1RYA A;  5DD4 A;  5I8U A;  1K2E A;  2Q9P A;  3L85 A;  1RRQ A;  1F3Y A;  2AZW A;  3HYQ A;  3GG6 A;  4YPH A;  4C9W A;  5GHI A;  1MQE A;  2O5F A;  1V8U A;  1VIQ A;  3BHO A;  1QVJ A;  1U20 A;  2DSB A;  5FSO A;  3SMD A;  4DYW A;  1JKN A;  3EF5 A;  2ICK A;  1JRK A;  3FCM A;  4KTB A;  1KTG A;  4JZV A;  5GHQ A;  3BM4 A;  1I9A A;  3GZ6 A;  1PPW A;  2DHO A;  2FVV A;  2I8U A;  2XSQ A;  3DUP A;  3FK9 A;  1MR2 A;  3A6T A;  2DSD A;  2QJO A;  3Q4I A;  3EES A;  3X0Q A;  3Q2T A;  5GHJ A;  1XSC A;  1SU2 A;  2VNP A;  4S2V A;  1V8Y A;  1IRY A;  3N9U A;  2G73 A;  1X83 A;  1VHG A;  3O52 A;  3KVH A;  5FSM A;  3BAP A;  1HX3 A;  1VC8 A;  3X0P A;  5FSL A;  1X51 A;  1NFZ A;  3X0O A;  5IW5 A;  1VC9 A;  1Q33 A;  5GHP A;  2VNQ A;  1KT9 A;  3X0S A;  3DKU A;  4N1U A;  3I7V A;  3FSP A;  3AC9 A;  3X0N A;  2I6K A;  3N77 A;  3Q91 A;  4IJX A;  4JZT A;  1VCD A;  5GHO A;  5C7T A;  3O69 A;  2GT2 A;  3ACA A;  3H95 A;  4ZG0 A;  4YOQ A;  1VRL A;  2JVB A;  3O6Z A;  3O61 A;  1VIU A;  4KYX A;  5ANV A;  1VK6 A;  2A8P A;  2RRK A;  4MPO A;  1G9Q A;  5ANU A;  5FSN A;  4C9X A;  2PNY A;  1V8M A;  1XSA A;  1V8I A;  2A8Q A;  3F13 A;  3A6U A;  2O1C A;  4K6E A;  4JZU A;  1V8V A;  2FKB A;  5LPG A;  2GT4 A;  2DUK A;  3CNG A;  1G0S A;  1GA7 A;  2KDV A;  4ILQ A;  4KG4 A;  3GZ8 A;  1NQY A;  5DEQ A;  5ANT A;  5GHM A;  1NQZ A;  2R5W A;  2I8T A;  3GZ5 A;  3SON A;  2B0V A;  1Q54 A;  1V8W A;  3MDG A;  4YPR A;  1TUM A;  1KHZ A;  1V8S A;  3X0M A;  3X0R A;  1Q27 A;  1PPV A;  2YVN A;  1PUN A;  4JZS A;  1PUQ A;  3ZR0 A;  3R03 A;  2W4E A;  5ISY A;  1VHZ A;  2PQV A;  5HZX A;  1MUT A;  5C7Q A;  2A8T A;  1SOI A;  2B06 A;  5DDG A;  3FFU A;  4S2Y A;  1MK1 A;  1PPX A;  1XSB A;  3P5T A;  1V8L A;  2GB5 A;  1HZT A;  2YVO A;  3X0K A;  3G0Q A;  3X0I A;  1OW2 A;  3O8S A;  2B2K A;  1K26 A;  1SZ3 A;  1MQW A;  2CL3 A;  3ID9 A;  3EXQ A;  1RRS A;  1V8R A;  3COU A;  3X0L A;  5DPK A;  2YVM A;  3X0J A;  5IW4 A;  3P6Y A;  4V14 A;  2KDW A;  3RH7 A;  2FML A;  2YYH A;  2YVP A;  3WHW A;  1V8T A;  3Q1P A;  5ANW A;  3GWY A;  5FSK A;  3GRN A;  1PUS A;  3Q2S A;  5BS6 A;  1V8N A;  3SHD A;  3U53 A;  1R67 A;  2DSC A;  4S2W A;  5FSI A;  3Q93 A;  5C8L A;  2QJT A;  2G74 A;  3HHJ A;  1MP2 A;  3ZR1 A;  1NFS A;  4NFX A;  3I7U A;  3J7Y e;  4KG3 A;  4N1T A;  4S2X A;  2A6T A;  3MGM A;  1SJY A;  5ANS A;  5GHN A;  3EEU A;  2O5W A;  1PVF A;  3I9X A;  2QKM B; 
#chains in the Genus database with same CATH topology
 3OGA A;  3A6V A;  2A8S A;  4HFQ A;  4HVY A;  3F6A A;  3FJY A;  3QSJ A;  5CFJ A;  2A8R A;  3A6S A;  1X84 A;  3E57 A;  3MDI A;  2ICJ A;  4ICK A;  4NFW A;  5BON A;  4J7H A;  2J8Q A;  3MCF A;  5CFI A;  1RYA A;  5DD4 A;  5I8U A;  1K2E A;  2Q9P A;  3L85 A;  1RRQ A;  1F3Y A;  2AZW A;  3HYQ A;  3GG6 A;  4YPH A;  4C9W A;  5GHI A;  1MQE A;  2O5F A;  1V8U A;  1VIQ A;  3BHO A;  1QVJ A;  1U20 A;  2DSB A;  5FSO A;  3SMD A;  4DYW A;  1JKN A;  3EF5 A;  2ICK A;  1JRK A;  3FCM A;  4KTB A;  1KTG A;  4JZV A;  5GHQ A;  3BM4 A;  1I9A A;  3GZ6 A;  1PPW A;  2DHO A;  2FVV A;  2I8U A;  2XSQ A;  3DUP A;  3FK9 A;  1MR2 A;  3A6T A;  2DSD A;  2QJO A;  3Q4I A;  3EES A;  3X0Q A;  3Q2T A;  5GHJ A;  1XSC A;  1SU2 A;  2VNP A;  4S2V A;  1V8Y A;  1IRY A;  4J7G A;  3N9U A;  2G73 A;  1X83 A;  1VHG A;  3O52 A;  3KVH A;  5FSM A;  3BAP A;  1HX3 A;  1VC8 A;  3X0P A;  5FSL A;  1X51 A;  1NFZ A;  3X0O A;  5IW5 A;  1VC9 A;  1Q33 A;  5GHP A;  2VNQ A;  1KT9 A;  3X0S A;  3DKU A;  4N1U A;  3I7V A;  3FSP A;  3AC9 A;  3X0N A;  2I6K A;  3N77 A;  3Q91 A;  4IJX A;  4JZT A;  1VCD A;  5GHO A;  5C7T A;  3O69 A;  2GT2 A;  3ACA A;  3H95 A;  4ZG0 A;  4YOQ A;  1VRL A;  2JVB A;  3O6Z A;  3O61 A;  1VIU A;  4KYX A;  5ANV A;  1VK6 A;  2A8P A;  2RRK A;  4MPO A;  1G9Q A;  5ANU A;  5FSN A;  4C9X A;  2PNY A;  1V8M A;  1XSA A;  1V8I A;  2A8Q A;  3F13 A;  3A6U A;  2O1C A;  4K6E A;  4JZU A;  1V8V A;  2FKB A;  5LPG A;  2GT4 A;  2DUK A;  3CNG A;  1G0S A;  1GA7 A;  2KDV A;  4ILQ A;  4KG4 A;  3GZ8 A;  1NQY A;  5DEQ A;  5ANT A;  5GHM A;  1NQZ A;  2R5W A;  2I8T A;  3GZ5 A;  3SON A;  2B0V A;  1Q54 A;  1V8W A;  3MDG A;  4YPR A;  1TUM A;  1KHZ A;  1V8S A;  3X0M A;  3X0R A;  1Q27 A;  1PPV A;  2YVN A;  1PUN A;  4JZS A;  1PUQ A;  3ZR0 A;  3R03 A;  2W4E A;  5ISY A;  1VHZ A;  2PQV A;  5HZX A;  1MUT A;  5C7Q A;  2A8T A;  1SOI A;  2B06 A;  5DDG A;  3FFU A;  4S2Y A;  1MK1 A;  1PPX A;  1XSB A;  3P5T A;  1V8L A;  2GB5 A;  1HZT A;  2YVO A;  3X0K A;  3G0Q A;  3X0I A;  1OW2 A;  3O8S A;  2B2K A;  1K26 A;  1SZ3 A;  1MQW A;  2CL3 A;  2CZR A;  3ID9 A;  3EXQ A;  1RRS A;  1V8R A;  3COU A;  3X0L A;  5DPK A;  2YVM A;  3X0J A;  5IW4 A;  3P6Y A;  4V14 A;  2KDW A;  3RH7 A;  2FML A;  2YYH A;  2YVP A;  3WHW A;  1V8T A;  3Q1P A;  5ANW A;  3GWY A;  5FSK A;  3GRN A;  1PUS A;  3Q2S A;  5BS6 A;  1V8N A;  3SHD A;  3U53 A;  1R67 A;  2DSC A;  4S2W A;  5FSI A;  3Q93 A;  5C8L A;  2QJT A;  2G74 A;  3HHJ A;  1MP2 A;  3ZR1 A;  1NFS A;  4NFX A;  3I7U A;  3J7Y e;  4KG3 A;  4N1T A;  4S2X A;  2A6T A;  3MGM A;  1SJY A;  5ANS A;  5GHN A;  3EEU A;  2O5W A;  1PVF A;  3I9X A;  2QKM B; 
#chains in the Genus database with same CATH homology
 3OGA A;  3A6V A;  2A8S A;  4HFQ A;  4HVY A;  3F6A A;  3FJY A;  3QSJ A;  5CFJ A;  2A8R A;  3A6S A;  1X84 A;  3E57 A;  3MDI A;  2ICJ A;  4ICK A;  4NFW A;  5BON A;  4J7H A;  2J8Q A;  3MCF A;  5CFI A;  1RYA A;  5DD4 A;  5I8U A;  1K2E A;  2Q9P A;  3L85 A;  1RRQ A;  1F3Y A;  2AZW A;  3HYQ A;  3GG6 A;  4YPH A;  4C9W A;  5GHI A;  1MQE A;  2O5F A;  1V8U A;  1VIQ A;  3BHO A;  1QVJ A;  1U20 A;  2DSB A;  5FSO A;  3SMD A;  4DYW A;  1JKN A;  3EF5 A;  2ICK A;  1JRK A;  3FCM A;  4KTB A;  1KTG A;  4JZV A;  5GHQ A;  3BM4 A;  1I9A A;  3GZ6 A;  1PPW A;  2DHO A;  2FVV A;  2I8U A;  2XSQ A;  3DUP A;  3FK9 A;  1MR2 A;  3A6T A;  2DSD A;  2QJO A;  3Q4I A;  3EES A;  3X0Q A;  3Q2T A;  5GHJ A;  1XSC A;  1SU2 A;  2VNP A;  4S2V A;  1V8Y A;  1IRY A;  4J7G A;  3N9U A;  2G73 A;  1X83 A;  1VHG A;  3O52 A;  3KVH A;  5FSM A;  3BAP A;  1HX3 A;  1VC8 A;  3X0P A;  5FSL A;  1X51 A;  1NFZ A;  3X0O A;  5IW5 A;  1VC9 A;  1Q33 A;  5GHP A;  2VNQ A;  1KT9 A;  3X0S A;  3DKU A;  4N1U A;  3I7V A;  3FSP A;  3AC9 A;  3X0N A;  2I6K A;  3N77 A;  3Q91 A;  4IJX A;  4JZT A;  1VCD A;  5GHO A;  5C7T A;  3O69 A;  2GT2 A;  3ACA A;  3H95 A;  4ZG0 A;  4YOQ A;  1VRL A;  2JVB A;  3O6Z A;  3O61 A;  1VIU A;  4KYX A;  5ANV A;  1VK6 A;  2A8P A;  2RRK A;  4MPO A;  1G9Q A;  5ANU A;  5FSN A;  4C9X A;  2PNY A;  1V8M A;  1XSA A;  1V8I A;  2A8Q A;  3F13 A;  3A6U A;  2O1C A;  4K6E A;  4JZU A;  1V8V A;  2FKB A;  5LPG A;  2GT4 A;  2DUK A;  3CNG A;  1G0S A;  1GA7 A;  2KDV A;  4ILQ A;  4KG4 A;  3GZ8 A;  1NQY A;  5DEQ A;  5ANT A;  5GHM A;  1NQZ A;  2R5W A;  2I8T A;  3GZ5 A;  3SON A;  2B0V A;  1Q54 A;  1V8W A;  3MDG A;  4YPR A;  1TUM A;  1KHZ A;  1V8S A;  3X0M A;  3X0R A;  1Q27 A;  1PPV A;  2YVN A;  1PUN A;  4JZS A;  1PUQ A;  3ZR0 A;  3R03 A;  2W4E A;  5ISY A;  1VHZ A;  2PQV A;  5HZX A;  1MUT A;  5C7Q A;  2A8T A;  1SOI A;  2B06 A;  5DDG A;  3FFU A;  4S2Y A;  1MK1 A;  1PPX A;  1XSB A;  3P5T A;  1V8L A;  2GB5 A;  1HZT A;  2YVO A;  3X0K A;  3G0Q A;  3X0I A;  1OW2 A;  3O8S A;  2B2K A;  1K26 A;  1SZ3 A;  1MQW A;  2CL3 A;  2CZR A;  3ID9 A;  3EXQ A;  1RRS A;  1V8R A;  3COU A;  3X0L A;  5DPK A;  2YVM A;  3X0J A;  5IW4 A;  3P6Y A;  4V14 A;  2KDW A;  3RH7 A;  2FML A;  2YYH A;  2YVP A;  3WHW A;  1V8T A;  3Q1P A;  5ANW A;  3GWY A;  5FSK A;  3GRN A;  1PUS A;  3Q2S A;  5BS6 A;  1V8N A;  3SHD A;  3U53 A;  1R67 A;  2DSC A;  4S2W A;  5FSI A;  3Q93 A;  5C8L A;  2QJT A;  2G74 A;  3HHJ A;  1MP2 A;  3ZR1 A;  1NFS A;  4NFX A;  3I7U A;  3J7Y e;  4KG3 A;  4N1T A;  4S2X A;  2A6T A;  3MGM A;  1SJY A;  5ANS A;  5GHN A;  3EEU A;  2O5W A;  1PVF A;  3I9X A;  2QKM B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...