2J8SD

Drug export pathway of multidrug exporter acrb revealed by darpin inhibitors
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
156
structure length
156
Chain Sequence
b'GSDLGKKLLEAARAGRDDEVRILMANGADVNAADVVGWTPLHLAAYWGHLEIVEVLLKNGADVNAYDTLGSTPLHLAAHFGHLEIVEVLLKNGADVNAKDDNGITPLHLAANRGHLEIVEVLLKYGADVNAQDKFGKTAFDISINNGNEDLAEILQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACRIFLAVINE RESISTANCE PROTEIN B
publication title Drug Export Pathway of Multidrug Exporter Acrb Revealed by Darpin Inhibitors.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
total genus 48
structure length 156
sequence length 156
chains with identical sequence E
ec nomenclature
pdb deposition date 2006-10-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 2j8sD00
1MJ0A 1K1AA 2F8YA 4U8YD 5CBOA 3JXIA 4DX7D 2BKGA 3TWUA 3TWSA 4N5QA 4QFVA 3EU9A 4DX6D 4F1PA 1YMPA 1SW6A 5D66A 5AAOA 1BI7B 1AP7A 1AWCB 4HI8A 2XEHA 4DX2A 3EHQA 5KNGA 5HKPA 5JA4D 4LG6A 3T9KA 5CERB 1MX4A 2KBXA 3F6QA 4HQDA 1G3NB 1MX2A 4O60A 2Y0BG 3J5QB 1YCSB 4QQIA 2HE0A 3TWWA 5ENRD 1TR4A 4YDYA 1NFIE 1WDYA 1MX6A 4NIKA 3UTMA 1BI8B 3KEAA 5KWDA 5HS0A 1N0RA 3B95A 4C48B 3TWXA 3ZU7B 4BSZB 4CYMD 1YYHA 2J8SD 4OAVB 5AN8A 2XZDG 2ZGDA 3V2OA 3W9GA 1BD8A 4ATZD 2DVWA 5JMND 5BXOA 3HRAA 3W9FA 1UOHA 3V30A 1IKND 2MYOA 2FO1E 1QYMA 5CEAA 3IXEA 4U95D 3TWVA 1MYOA 5KNHD 3J5PA 3V2XA 1BU9A 2F8XK 3JXJA 5CBNA 2RFMA 4CZ2D 3TWRA 4OAUC 1SVXA 2L6BA 5EIDA 4DRXE 1DCQA 2QC9A 4HB5A 1S70B 4HNAD 2QYJA 5ENSD 4JB8P 4TUMA 4BEPA 2KXPC 5AQBA 3JUEA 3AAAC 2F37A 4G8KA 4HLLA 3AJIA 5BXUA 4K5CA 1DC2A 5EILA 3T8KA 2RFAA 4BETA 4J7WA 1N11A 4HRLA 5AARA 4Z68A 5ITZF 1OY3D 4G8LA 3Q9UC 2XENA 2JABA 2Y1LE 4U96D 3NOGD 3UI2A 4YDWA 2V5QC 3NOCD 1K3ZD 3Q9NC 3B7BA 1IXVA 1BLXB 4O1PA 2V4HC 5KBAA 4RLYA 4B93B 5FINA 1OT8A 4DX5D 2PNNA 3DEPA 3UXGA 3V31A 3DEOA 3V79K 2DZOA 2VGEA 4DUIA 2ETBA 4F6RD 4UUCA 4GMRA 5ENPD 2XEEA 4A63B 5ENOD 3ZKJA 1A5EA 3ZNGA 5CECB 5HRYA 5AQ9A 2ZGGA 5CEDB 1K1BA 2P2CP 4LNUD 3NBNB 5AQAA 4K5AB 5ENQD 4LSZE 4GPMA 4ZHBA 5EYPF 3HG0D 3C5RA 2BKKB 4ZFHA 2NYJA 5AQ7A 2AJAA 4U8VD 3TWQA 3ZUVB 2DWZA 4HBDA 2ETCA 1D9SA 3LJNA 4HI9A 2ETAA 4HRMB 5EYLA 1N0QA 5FIOA 2A5EA 3TWTA 2DZNA 4BESA 4DX1A 1IHBA 5EIBE 1WG0A 3EHRA 4HRNA 3SO8A 4BERA 2B0OE 3D9HA 4O1OA 5EN5D 4K5BA 5ENTD 4J8YA 2XZTG
chains in the Genus database with same CATH superfamily
4FHJA 3TAXA 3JXIA 2IOLA 4GA0A 3EU9A 3S2AA 4DX6D 5D66A 2PZIA 2NSZA 4HI8A 4B94A 2R17C 4UWFA 2Y4TA 2DBAA 2J9QA 2RD0A 2WXRA 4P29A 3ASOE 4HXIA 4LERA 3FU0A 3KEAA 2L0TB 3L16A 4MLPA 4BSZB 2WXQA 3KSQA 4JD2G 4OAVB 3W9GA 3QWPA 3EJNA 4EBAG 3FUNA 3P1UA 1O5MA 3Q49B 3UPVA 3FFLA 3AG2E 1IQUA 4DPRA 5AQBA 2IO2C 5ARGA 2CG3A 3G2WA 5ITZF 2F0YA 3PUKA 2VYIA 1B89A 4FP7A 3NOGD 1XGWA 3NOCD 4PS8A 3FTWA 1UG3A 1KT1A 1OT8A 3UT8A 2WM9A 3LY7A 4F6RD 1LD8A 4CDMA 4PS7A 1PY1A 3BEEA 3QC1A 4GYWA 4AY6A 4ZFHA 5C2YA 3CQCB 4L1BA 4A1GA 2IY0C 1O1SA 3FDHA 5CCMA 2ETAA 4JHJA 3SF4A 5FIOA 1IHBA 2A5UA 2KC7A 3CK7A 3DRAA 4O1OA 3ISMC 5ENTD 3ZFWA 1MJ0A 4TXPA 4AOFA 1ZB1A 4N5QA 3ASHA 1OWMA 1FCHA 5ENNA 5FZQA 4LUNU 4CDRA 3TG5A 1YCSB 2YNQA 4YDYA 4I1MA 1WDYA 3P2BA 5B3SE 2WQ7A 5AN8A 4IULA 3SZ7A 2KATA 5KJMA 5JMND 4U07A 1UOHA 3DSUA 3AS8A 1U3CA 5E76A 3UUXA 1HE8A 4U95D 4ANWA 5D2MC 1OWLA 4RQIA 3JXJA 4BX8A 3PNTB 1Z3YA 2VSYA 1SZ9A 5C1DA 3ULQA 2XGSA 1INZA 2P9KG 2KM4A 3N71A 3Q9NC 4AVXA 4B0ZA 5AJDA 4N3AA 2XCCA 2V4HC 4UI9C 2OEVA 1TNZA 2CFUA 4MS6A 5KCMA 5AQAA 2P9PG 4GPMA 1HG5A 1U3DA 1TN6A 3HXCA 3GZSA 1K8KG 1O1RA 3APCA 1H2TC 3LJNA 4DJAA 4JPSA 3AU5A 4BESA 4GYYA 3DBSA 3HIZA 3PUJA 1EPUA 3TWSA 1E96B 5ANRA 2QYUA 3SHFA 4O60A 4EBAA 5AIJA 4UI9K 5T3RA 3D9KA 1OUVA 4O6FA 4LRZA 3S7DA 3UX4A 4EQFA 2R02A 5D0OD 2P9SG 3QNKA 3I4RB 4Y6WA 3NF1A 3SD5A 4I6JA 4CGWA 3S7JA 4JW1A 1JWGA 4TUMA 5BV1A 3FH5A 4HLLA 4F1SA 2X6HA 5AARA 4CRWA 5JHBA 4WAFA 4K03A 4YDWA 2WQ6A 5ANLA 4M3OA 3AS4A 5FINA 4JA9A 3B13A 3DEPA 4GA2A 3UXGA 1UW4B 3FWVA 5B1BE 1NA0A 3QJZA 3C5RA 1MHQA 2GRLA 1TNUA 3UINC 2DWZA 4HOSA 2FEZA 3U9WA 4GMLA 3SO8A 3CSFA 1QNFA 3LPZA 1YMPA 2PQRA 4BFRA 5LCWC 3EHQA 4OVVA 3CVQA 2KZTA 5EX3A 4I2ZA 1HG2A 3MKQB 4GMJA 4U04A 2PM7A 5A6CA 2WXIA 3Q4AB 2WQHA 1TR4A 3G2SA 5HS0A 4H7YA 1JCQA 1YYHA 3T5VA 3G2TA 4ACLA 2X6KA 3MEKA 1IKND 2JEKA 3PREA 3TGOA 4NQ0A 4I17A 3CHOA 3KAEA 2VSOE 3GYZA 2KXPC 3MZLB 2FO7A 3PE4A 4UI9J 4XEIG 4G8LA 1OCRE 2JABA 3KS2A 3Q78A 2V0PA 3UM1A 3L13A 5DIZA 3Q7FA 2IQCA 4O1PA 3D9IA 4A3TA 3DSTA 1H2UA 4ACKA 2CHXA 4A3VA 3JYSA 2ZGGA 2MRIA 4TXRA 4TV3A 1P5QA 4TUUA 3PEVB 3R9MA 2X3MA 4G25A 4DX1A 4W9RA 2OVFA 2YQ8A 5CBOA 2BKGA 3ZYMA 3TWUA 4GTPA 4QFVA 4F1PA 1SW6A 3UM2A 4ABNA 1AP7A 1UN9A 4J8FA 3PZ2A 1KPSB 1BI8B 2H6GA 1E8YA 1IHGA 2I2OA 4G23A 4CYMD 1ELRA 2I9CA 3Q73A 4WWPA 3PZDA 3PDNA 2B6CA 3Q7AA 4GTMA 1MYOA 3OAWA 3CQGB 2WXMA 3FH8A 2HR2A 1TJFA 4HB5A 4M7CA 2J4DA 4BEPA 1N4QA 3RO2A 3AAAC 4K5CA 1DC2A 2RFAA 4BETA 1N11A 4HRLA 3QAQA 3DWLG 3C3QA 4N2SA 3FY4A 2GRNB 3FTZA 4B8AA 2R03A 1IXVA 1BLXB 3CGHA 3EUVA 1NZNA 3OXLA 3E30A 4WNFA 2R59A 2DZOA 5ENPD 3L82A 3S7BA 4L23A 4KVMA 4I9CA 3CVWA 4Q69A 1N95A 2BF0X 4IRUA 2AXVA 1HH8A 3CVYA 3C3RA 3R9AB 1A17A 1U2VG 3QDNA 2LXLA 4AXHA 5LCWJ 3HDXA 5CMYA 5KJNA 2XGOA 4U8YD 2UY1A 4DX7D 3FEXA 2WXGA 4H7XA 2VGXB 2WB2A 1TJCA 4HLEA 3UIOC 3UQ3A 4DX2A 1WAO1 3LEWA 1G3NB 4F53A 4URKA 2XS1A 3UT7A 3DSSA 1H6OA 4NURA 2I6HA 3T8MA 4GTRA 3I5PA 2L9BA 3CVVA 1MZCA 3FUDA 3ZYLA 1N9AA 5CBNA 4OAUC 1QBQA 2L6BA 2DYSE 2VTBA 3Q47B 4HNAD 3ZPJA 2R05A 5T4YA 3ZHEA 3CV0A 4J7WA 1HU3A 3CSTA 4EPZA 3DXKG 5J08A 1ZU2A 3UI2A 4FJYA 1EYHA 1K3ZD 4F3VA 4HVBA 4KZ0A 3LVRE 1MQSA 2V4LA 1E7UA 2LSVA 4RLYA 4XIFA 2XRZA 4AV7A 2QY7A 2EINE 3B7UX 2XEVA 4J8EA 2WXFA 1YA0A 2WVIA 3T5XA 4UQXA 1O1TA 2BKKB 3ASFA 3RU0A 5EYLA 3R7RA 1E8XA 4UWLA 3FTVA 4E85A 5CERB 3UKUG 1MX2A 4GA1A 5IY5E 1H0AA 4XI9A 3RO3A 3UTMA 2WXJA 1D8EA 4G24A 3ZRHA 4RVBA 3KSLA 5BXOA 2XS8A 3HRAA 2R5SA 5BPPA 1E7VA 4GAAA 2F8XK 3L54A 2RFMA 3TWRA 3C3OA 3DSVA 5G55A 1V55E 3RK6A 5ENSD 4JB8P 3TG4A 5CHEE 3E34A 3BUAA 3FU6A 4CCAA 4EZKA 4L9PA 4XZ4A 3B7BA 3D9NA 1FT2A 3ZW3A 3D9MA 4GZDA 2LSUA 4DX5D 3RSEG 3V79K 4PDXA 1V54E 3FTSA 1JPLA 4TRQA 5CECB 4IYPA 2P2CP 1OWOA 1OWNA 4GZCA 4AP2A 1UJKA 2XPYA 5EX0A 1H6KA 3SFXA 3Q15A 4HRMB 3PZ4A 4K5BA 2IOSA 3ZXPA 5FQ4A 3QOUA 2FULA 2WXOA 5H7PA 4MKTA 2LXMA 4L2LA 4UWHA 4AJWA 3UKRG 3ABKE 2PQNA 3ML8A 4FHKA 3FUMA 4BWRA 2OCCE 1JUQA 5T8IA 4I9EA 3B95A 1SA5A 2AXZA 2L6JA 4DI3A 4OYSA 1OCCE 3RIBA 1N4RA 4HS2A 2IFUA 4ANXA 4L7TA 1N4PA 2XPZA 2MYOA 2XPIA 4CZ2D 3CK9A 3E37A 4I6GA 2BUGA 4KMOA 3FTUA 3FTXA 1X81A 4PS3A 3AG4E 3IHYA 1S63A 1DVPA 4MBGA 4RG6A 3T8KA 4Z68A 3Q9UC 4JZYA 1QQEA 4C0EA 3L6AA 2WMOA 2EIME 4UWKA 4YNDA 3NZSA 3HVEB 3SFZA 3D9PA 3IKOB 4EHMA 3FUKA 3G2UA 2EQXA 3ULYA 4LNUD 2FI7A 3CVLA 2HYZA 4GU5A 2VQ2A 5EYPF 4AM9A 3LY9A 4LNGA 4UWGA 4AEZC 4UQYA 3WG7E 4BERA 3U64A 3HXEA 2YHEA 1XNFA 3CVNA 3ZEFA 3DXMG 3CLJA 4KT6B 3CVUA 5AAOA 3ENEA 3AS5A 4A1SA 5JA4D 3MV2B 3F6QA 2EIJE 4FU3A 4X8QA 2NXPA 2BTDA 1TN7A 3TXMA 4I43A 2LAHA 2GROB 2IJGX 2AWIA 4BT9A 4GCNA 1N0RA 3LKUA 2V8SE 1Z5SC 4JHRA 4GCOA 2MHKA 5CCLA 3IEGA 5HQ8A 3ZYKA 3ZYQA 1JCRA 2DIWA 5BXUA 2WXKA 2CHWA 2AVPA 3VTYA 2IEJA 2LNIA 4U0UA 1UN8A 2ZISA 4ANVA 1TNBA 2ETBA 3SQVA 4GMRA 2X38A 4U0ZA 3ZNGA 5ENQD 1GW6A 4WNGA 2I1JA 3FU5A 3EHMA 2ETCA 2XGMA 3I3NA 3D3MA 3LJ3A 4DLOA 4N3BA 3TWTA 1WG0A 2B0OE 2XZTG 1K1AA 3PZ1A 3FUFA 4A55A 4PH4B 1W3BA 2XEHA 4ATGA 2KCVA 3KEZA 2MOWA 5D0QD 3HXBA 4WNEA 1KLXA 3AG1E 3TWWA 5LP0A 1HO8A 3EIJA 4GZ5A 4TXQA 3QK0A 3FEYA 4I1AA 1N4SA 3U3WA 3MYVA 3TWXA 3ZU7B 2GRMA 5G04C 3V2OA 3RAUA 4J0UA 2XHEA 1EF1C 2XQ0A 5FZSA 4ANUA 2WPVA 2AXUA 3TJPA 5KNHD 3J5PA 4GTVA 1IYGA 1N52A 3UMVA 2VGYA 4WUYA 4J6IA 2WXLA 5AJLA 2LO6A 4FJZA 2NC9A 4Y6CA 4EECA 5FQ8A 3NQPA 1KZPA 1OY3D 2UWJG 3ML9A 2WXPA 2L0IA 1N54A 3IBEA 1NI1A 5FWQA 4GZ3A 2C2LA 4UUCA 3TL5A 1Z6TA 4LCTA 3MA5A 3D9LA 4NACA 1NL4A 2DCPA 3UM0A 3KD7A 2NYJA 5CRVA 4YVQC 4JXTA 5FTPA 4FLBA 4G1TA 2J07A 1LD7A 3D9HA 2BEDA 3JCKC 4APFA 3CHRA 3QB2A 4CDNA 3URZA 1BI7B 4XE0A 3ZGQA 3CHPA 5FQ6A 5G2NA 5KNGA 4LG6A 4B89A 3PNLB 2RG8A 3O4ZA 4HQDA 2Y0BG 3FUIA 3EIQC 2J4BA 2IONA 4CGVA 4ILGA 4C48B 3PS6A 2J8SD 2XZDG 3B7RL 1BD8A 4ATZD 2DVWA 2AW6A 2P9NG 5JJTA 4YDOA 4V3IA 2FBNA 3ZIMA 5CEAA 1LF8A 5A23A 3CKCA 1ZBPA 3JQ0A 1PC2A 3ZXSA 1S70B 2QYJA 2P9LG 4PUCA 3JUEA 2F37A 4G8KA 3X2QE 5EILA 1H6PA 5BNWA 4U96D 2ZXWE 3GZ2A 3MKQA 3VTXA 2VGEA 4MRUA 1NP7A 2XEEA 3MJWA 5LFAA 2EILE 3LYAA 4ZHBA 5G05C 2M63A 4GYOA 3BG1B 3FULA 3JUIA 4Q96A 2QZAA 2H6FA 2RKKA 3QARA 3CHQA 5CRUA 4BSXA 1E90A 4XX5A 1AWCB 2Y69E 3S7FA 3E4BA 3T9KA 2KBXA 4JL0A 5G04J 2FF4A 1TYQG 3SI5A 5KWDA 3L22A 3U66A 2GRRB 1EDUA 2OVBA 3AU4A 4HOTA 2ONDA 2H6IA 3SFYA 3PVLA 2P9IG 3IXEA 1BU9A 2IF4A 2KCLA 2R2LA 4L2YA 4FLHA 3UIPC 1N94A 3HHMA 2Y3AA 3K9IA 3ZN3A 3LY8A 1UJJA 3IHVA 1E8WA 2GRPB 2KZTB 4N39A 1HS6A 3FH7A 3LDZA 3CK8A 5KBAA 4N2QA 3DEOA 1Y8MA 3VLFA 1SQMA 4GTOA 4FA6A 3C72A 4ME2A 1A5EA 3HXFA 1K1BA 3SY2A 3NBNB 2E0IA 4I1OB 5B1AE 1S64A 3UT4A 4U8VD 3ABME 3TWQA 3ONKA 3PH0C 2P9UG 3APFA 3ONLA 3R7QA 2DZNA 5BV0A 2ZIRA 3CIAA 3EHRA 4HRNA 2J49A 1FPPA 3U4TA 3E32A 3OTNA 3CKBA 1KZOA 2JLBA 4Q94A 2VSXE 3WXXA 3FUJA 1HX8A 4GB9A 4RSYA 1X5BA 2QFCA 3J5QB 2DYRE 5ENRD 4WWNA 5KJKA 1HXIA 4BT8A 4RG9A 4GZ6A 2Y4UA 1WY6A 4D10C 3CVPA 5BT1A 4OVUA 3EU5A 3DPDA 3MX3A 1FVFA 4HOUA 1DNPA 3B7TA 3PRZA 5KJLA 1QYMA 4GTSA 3BG0B 3V2XA 4JA7A 4JVSA 3QWVA 5DBKA 3D9OA 1SZAA 3ULEG 3HYMB 3RKVA 1SA4A 3C98A 3OXFA 2Y1LE 2IU1A 3LS8A 2V5QC 2VGXA 2I1KA 2EIKE 4XKCA 5BW8C 4I6EA 5JJ6A 4YVOA 2WXNA 5E75A 3GZ1A 3ZVVA 3LVQE 5G05J 3AG3E 1HF8A 1HZ4A 5FT9A 1TN8A 4UQZA 4E6HA 3ASGA 3MV3B 5BUZA 5ARFA 3E33A 2A4ZA 3MCXA 4ILIA 3ZUVB 3LXUX 4FC8A 4HORA 3ASDA 4AIFA 2OEWA 1JCSA 3SBTB 1NA3A 2F8YA 1Z3XA 4GTQA 4G11A 4KZCA 2J09A 2V5FA 3APDA 3EDTB 1WM5A 3QKYA 2CHZA 3CEQA 5JHAA 3CVXA 4JEHA 4XKBA 3IV0A 3Q5MA 4QQIA 2HE0A 3SGHA 3FHEA 4K0RA 5M72A 2XRYA 4C0MA 2ZGDA 4CT4A 3VLDA 3DSXA 4KVOA 2X6IA 1ELWA 3DPYA 4YDEA 5EDSA 1OXJA 3CHMA 2FO1E 3DSWA 3ESKA 5EIDA 2QC9A 3L08A 3SBSA 3ESLA 2OOEA 2UY1B 5LOZA 2GRQB 2WMNA 4DI4A 3PZ3A 1TNYA 3Q79A 3FUEA 5A7DB 1Y6IA 1S0PA 3B7SA 3JQ1A 3NZUA 5LX8A 3MGBA 2HM8A 3PE3A 2HO1A 3L9TA 3VLEA 3V31A 3NB2A 5EKQD 1Q2ZA 5ENOD 3ZKJA 2YINA 1BPOA 5AQ9A 4BTAA 2LAIA 1OWPA 4GPKA 1HFAA 3HG0D 4JHKA 4DK5A 4B8CB 3PEUB 3I4GA 2VTBB 4HI9A 2CG2A 2A5EA 3NAWA 5J90A 5FJYA 3ZHEB 4DLQA 4AY5A 1RZ4A 4JC8A 1TEZA 2ILRA 1PAQA 3UM3A 3BU8A 4J8SA 4GTTA 2X6JA 5HKPA 1MX4A 3D9JA 1DCEA 3TXNA 3ASNE 5AYWD 2VJ8A 4HFGA 1FVHA 4EZLA 4NIKA 3BQOA 4I2WA 3FTYA 1LTXA 3FP3A 1H2VC 3HXDA 4HOQA 3W9FA 4EZJA 4APOA 2CFZA 3TWVA 1D8DA 1SVXA 1VDYA 1DCQA 2ZU6B 4CEMA 1L5JA 3L17A 3QWWA 4WWOA 2C0LA 3EHNA 5FQ7A 5HI7A 4R7LA 2XENA 4LEUA 4FULA 2C0MA 4KBQA 2KCKA 4B93B 2PNNA 3G2VA 1ELKA 1FT1A 1KT0A 4NRHB 2H6HA 4J8DA 5HRYA 4G2VA 2GGFA 4K5AB 4IN3B 5AQ7A 4FADA 2AJAA 2VSNA 4HBDA 1D9SA 5AENA 3SNXA 1RW2A 1QZ2A 1N0QA 5EN5D 4BY6A 2Q7FA 4ILHB 4F7AA 2P58C 3FUHA 5FZRA 1H19A 3OXGA 2OV8A 1E8ZA 3FU3A 3HVEA 1NFIE 1MX6A 2J08A 3RRNB 3ABLE 4U0SA 2PL2A 3V30A 2YHCA 4CT0A 3RRMB 3CR3A 4LNBA 4DRXE 2E2EA 2LUHA 4N5CA 2XCBA 3AJIA 1IQRA 4WNDA 4BTBA 2X6FA 4XI0A 2PM6A 3RJVA 1JWFA 5JJ7A 4G26A 4U63A 3LCAA 1TNOA 3RRUA 4KXKB 4C9BB 4N3CA 3CHSA 4DUIA 4JEUA 2IO3C 4A63B 2WXHA 4KYOB 5CEDB 4U8HA 4LSZE 2GW1A 5CMWA 4BX9A 1OCOE 4U7EB 3O48A 3Q75A 3MKRA 5EIBE 3GW4A 1OCZE 4J8YA
chains in the Genus database with same CATH topology
1MJ0A 1K1AA 2F8YA 4U8YD 5CBOA 3JXIA 4DX7D 2BKGA 3TWUA 3TWSA 4N5QA 4QFVA 3EU9A 4DX6D 4F1PA 1YMPA 1SW6A 5D66A 5AAOA 1BI7B 1AP7A 1AWCB 4HI8A 2XEHA 4DX2A 3EHQA 5KNGA 5HKPA 5JA4D 4LG6A 3T9KA 5CERB 1MX4A 2KBXA 3F6QA 4HQDA 1G3NB 1MX2A 4O60A 2Y0BG 3J5QB 1YCSB 4QQIA 2HE0A 3TWWA 5ENRD 1TR4A 4YDYA 1NFIE 1WDYA 1MX6A 4NIKA 3UTMA 1BI8B 3KEAA 5KWDA 5HS0A 1N0RA 3B95A 4C48B 3TWXA 3ZU7B 4BSZB 4CYMD 1YYHA 2J8SD 4OAVB 5AN8A 2XZDG 2ZGDA 3V2OA 3W9GA 1BD8A 4ATZD 2DVWA 5JMND 5BXOA 3HRAA 3W9FA 1UOHA 3V30A 1IKND 2MYOA 2FO1E 1QYMA 5CEAA 3IXEA 4U95D 3TWVA 1MYOA 5KNHD 3J5PA 3V2XA 1BU9A 2F8XK 3JXJA 5CBNA 2RFMA 4CZ2D 3TWRA 4OAUC 1SVXA 2L6BA 5EIDA 4DRXE 1DCQA 2QC9A 4HB5A 1S70B 4HNAD 2QYJA 5ENSD 4JB8P 4TUMA 4BEPA 2KXPC 5AQBA 3JUEA 3AAAC 2F37A 4G8KA 4HLLA 3AJIA 5BXUA 4K5CA 1DC2A 5EILA 3T8KA 2RFAA 4BETA 4J7WA 1N11A 4HRLA 5AARA 4Z68A 5ITZF 1OY3D 4G8LA 3Q9UC 2XENA 2JABA 2Y1LE 4U96D 3NOGD 3UI2A 4YDWA 2V5QC 3NOCD 1K3ZD 3Q9NC 3B7BA 1IXVA 1BLXB 4O1PA 2V4HC 5KBAA 4RLYA 4B93B 5FINA 1OT8A 4DX5D 2PNNA 3DEPA 3UXGA 3V31A 3DEOA 3V79K 2DZOA 2VGEA 4DUIA 2ETBA 4F6RD 4UUCA 4GMRA 5ENPD 2XEEA 4A63B 5ENOD 3ZKJA 1A5EA 3ZNGA 5CECB 5HRYA 5AQ9A 2ZGGA 5CEDB 1K1BA 2P2CP 4LNUD 3NBNB 5AQAA 4K5AB 5ENQD 4LSZE 4GPMA 4ZHBA 5EYPF 3HG0D 3C5RA 2BKKB 4ZFHA 2NYJA 5AQ7A 2AJAA 4U8VD 3TWQA 3ZUVB 2DWZA 4HBDA 2ETCA 1D9SA 3LJNA 4HI9A 2ETAA 4HRMB 5EYLA 1N0QA 5FIOA 2A5EA 3TWTA 2DZNA 4BESA 4DX1A 1IHBA 5EIBE 1WG0A 3EHRA 4HRNA 3SO8A 4BERA 2B0OE 3D9HA 4O1OA 5EN5D 4K5BA 5ENTD 4J8YA 2XZTG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MJ0 A;  1K1A A;  2F8Y A;  4U8Y D;  5CBO A;  3JXI A;  4DX7 D;  2BKG A;  3TWU A;  3TWS A;  4N5Q A;  4QFV A;  3EU9 A;  4DX6 D;  4F1P A;  1YMP A;  1SW6 A;  5D66 A;  5AAO A;  1BI7 B;  1AP7 A;  1AWC B;  4HI8 A;  2XEH A;  4DX2 A;  3EHQ A;  5KNG A;  5HKP A;  5JA4 D;  4LG6 A;  3T9K A;  5CER B;  1MX4 A;  2KBX A;  3F6Q A;  4HQD A;  1G3N B;  1MX2 A;  4O60 A;  2Y0B G;  3J5Q B;  1YCS B;  4QQI A;  2HE0 A;  3TWW A;  5ENR D;  1TR4 A;  4YDY A;  1NFI E;  1WDY A;  1MX6 A;  4NIK A;  3UTM A;  1BI8 B;  3KEA A;  5KWD A;  5HS0 A;  1N0R A;  3B95 A;  4C48 B;  3TWX A;  3ZU7 B;  4BSZ B;  4CYM D;  1YYH A;  2J8S D;  4OAV B;  5AN8 A;  2XZD G;  2ZGD A;  3V2O A;  3W9G A;  1BD8 A;  4ATZ D;  2DVW A;  5JMN D;  5BXO A;  3HRA A;  3W9F A;  1UOH A;  3V30 A;  1IKN D;  2MYO A;  2FO1 E;  1QYM A;  5CEA A;  3IXE A;  4U95 D;  3TWV A;  1MYO A;  5KNH D;  3J5P A;  3V2X A;  1BU9 A;  2F8X K;  3JXJ A;  5CBN A;  2RFM A;  4CZ2 D;  3TWR A;  4OAU C;  1SVX A;  2L6B A;  5EID A;  4DRX E;  1DCQ A;  2QC9 A;  4HB5 A;  1S70 B;  4HNA D;  2QYJ A;  5ENS D;  4JB8 P;  4TUM A;  4BEP A;  2KXP C;  5AQB A;  3JUE A;  3AAA C;  2F37 A;  4G8K A;  4HLL A;  3AJI A;  5BXU A;  4K5C A;  1DC2 A;  5EIL A;  3T8K A;  2RFA A;  4BET A;  4J7W A;  1N11 A;  4HRL A;  5AAR A;  4Z68 A;  5ITZ F;  1OY3 D;  4G8L A;  3Q9U C;  2XEN A;  2JAB A;  2Y1L E;  4U96 D;  3NOG D;  3UI2 A;  4YDW A;  2V5Q C;  3NOC D;  1K3Z D;  3Q9N C;  3B7B A;  1IXV A;  1BLX B;  4O1P A;  2V4H C;  5KBA A;  4RLY A;  4B93 B;  5FIN A;  1OT8 A;  4DX5 D;  2PNN A;  3DEP A;  3UXG A;  3V31 A;  3DEO A;  3V79 K;  2DZO A;  2VGE A;  4DUI A;  2ETB A;  4F6R D;  4UUC A;  4GMR A;  5ENP D;  2XEE A;  4A63 B;  5ENO D;  3ZKJ A;  1A5E A;  3ZNG A;  5CEC B;  5HRY A;  5AQ9 A;  2ZGG A;  5CED B;  1K1B A;  2P2C P;  4LNU D;  3NBN B;  5AQA A;  4K5A B;  5ENQ D;  4LSZ E;  4GPM A;  4ZHB A;  5EYP F;  3HG0 D;  3C5R A;  2BKK B;  4ZFH A;  2NYJ A;  5AQ7 A;  2AJA A;  4U8V D;  3TWQ A;  3ZUV B;  2DWZ A;  4HBD A;  2ETC A;  1D9S A;  3LJN A;  4HI9 A;  2ETA A;  4HRM B;  5EYL A;  1N0Q A;  5FIO A;  2A5E A;  3TWT A;  2DZN A;  4BES A;  4DX1 A;  1IHB A;  5EIB E;  1WG0 A;  3EHR A;  4HRN A;  3SO8 A;  4BER A;  2B0O E;  3D9H A;  4O1O A;  5EN5 D;  4K5B A;  5ENT D;  4J8Y A;  2XZT G; 
#chains in the Genus database with same CATH topology
 4FHJ A;  3TAX A;  3JXI A;  2IOL A;  4GA0 A;  3EU9 A;  3S2A A;  4DX6 D;  5D66 A;  2PZI A;  2NSZ A;  4HI8 A;  4B94 A;  2R17 C;  4UWF A;  2Y4T A;  2DBA A;  2J9Q A;  2RD0 A;  2WXR A;  4P29 A;  3ASO E;  4HXI A;  4LER A;  3FU0 A;  3KEA A;  2L0T B;  3L16 A;  4MLP A;  4BSZ B;  2WXQ A;  3KSQ A;  4JD2 G;  4OAV B;  3W9G A;  3QWP A;  3EJN A;  4EBA G;  3FUN A;  3P1U A;  1O5M A;  3Q49 B;  3UPV A;  3FFL A;  3AG2 E;  1IQU A;  4DPR A;  5AQB A;  2IO2 C;  5ARG A;  2CG3 A;  3G2W A;  5ITZ F;  2F0Y A;  3PUK A;  2VYI A;  1B89 A;  4FP7 A;  3NOG D;  1XGW A;  3NOC D;  4PS8 A;  3FTW A;  1UG3 A;  1KT1 A;  1OT8 A;  3UT8 A;  2WM9 A;  3LY7 A;  4F6R D;  1LD8 A;  4CDM A;  4PS7 A;  1PY1 A;  3BEE A;  3QC1 A;  4GYW A;  4AY6 A;  4ZFH A;  5C2Y A;  3CQC B;  4L1B A;  4A1G A;  2IY0 C;  1O1S A;  3FDH A;  5CCM A;  2ETA A;  4JHJ A;  3SF4 A;  5FIO A;  1IHB A;  2A5U A;  2KC7 A;  3CK7 A;  3DRA A;  4O1O A;  3ISM C;  5ENT D;  3ZFW A;  1MJ0 A;  4TXP A;  4AOF A;  1ZB1 A;  4N5Q A;  3ASH A;  1OWM A;  1FCH A;  5ENN A;  5FZQ A;  4LUN U;  4CDR A;  3TG5 A;  1YCS B;  2YNQ A;  4YDY A;  4I1M A;  1WDY A;  3P2B A;  5B3S E;  2WQ7 A;  5AN8 A;  4IUL A;  3SZ7 A;  2KAT A;  5KJM A;  5JMN D;  4U07 A;  1UOH A;  3DSU A;  3AS8 A;  1U3C A;  5E76 A;  3UUX A;  1HE8 A;  4U95 D;  4ANW A;  5D2M C;  1OWL A;  4RQI A;  3JXJ A;  4BX8 A;  3PNT B;  1Z3Y A;  2VSY A;  1SZ9 A;  5C1D A;  3ULQ A;  2XGS A;  1INZ A;  2P9K G;  2KM4 A;  3N71 A;  3Q9N C;  4AVX A;  4B0Z A;  5AJD A;  4N3A A;  2XCC A;  2V4H C;  4UI9 C;  2OEV A;  1TNZ A;  2CFU A;  4MS6 A;  5KCM A;  5AQA A;  2P9P G;  4GPM A;  1HG5 A;  1U3D A;  1TN6 A;  3HXC A;  3GZS A;  1K8K G;  1O1R A;  3APC A;  1H2T C;  3LJN A;  4DJA A;  4JPS A;  3AU5 A;  4BES A;  4GYY A;  3DBS A;  3HIZ A;  3PUJ A;  1EPU A;  3TWS A;  1E96 B;  5ANR A;  2QYU A;  3SHF A;  4O60 A;  4EBA A;  5AIJ A;  4UI9 K;  5T3R A;  3D9K A;  1OUV A;  4O6F A;  4LRZ A;  3S7D A;  3UX4 A;  4EQF A;  2R02 A;  5D0O D;  2P9S G;  3QNK A;  3I4R B;  4Y6W A;  3NF1 A;  3SD5 A;  4I6J A;  4CGW A;  3S7J A;  4JW1 A;  1JWG A;  4TUM A;  5BV1 A;  3FH5 A;  4HLL A;  4F1S A;  2X6H A;  5AAR A;  4CRW A;  5JHB A;  4WAF A;  4K03 A;  4YDW A;  2WQ6 A;  5ANL A;  4M3O A;  3AS4 A;  5FIN A;  4JA9 A;  3B13 A;  3DEP A;  4GA2 A;  3UXG A;  1UW4 B;  3FWV A;  5B1B E;  1NA0 A;  3QJZ A;  3C5R A;  1MHQ A;  2GRL A;  1TNU A;  3UIN C;  2DWZ A;  4HOS A;  2FEZ A;  3U9W A;  4GML A;  3SO8 A;  3CSF A;  1QNF A;  3LPZ A;  1YMP A;  2PQR A;  4BFR A;  5LCW C;  3EHQ A;  4OVV A;  3CVQ A;  2KZT A;  5EX3 A;  4I2Z A;  1HG2 A;  3MKQ B;  4GMJ A;  4U04 A;  2PM7 A;  5A6C A;  2WXI A;  3Q4A B;  2WQH A;  1TR4 A;  3G2S A;  5HS0 A;  4H7Y A;  1JCQ A;  1YYH A;  3T5V A;  3G2T A;  4ACL A;  2X6K A;  3MEK A;  1IKN D;  2JEK A;  3PRE A;  3TGO A;  4NQ0 A;  4I17 A;  3CHO A;  3KAE A;  2VSO E;  3GYZ A;  2KXP C;  3MZL B;  2FO7 A;  3PE4 A;  4UI9 J;  4XEI G;  4G8L A;  1OCR E;  2JAB A;  3KS2 A;  3Q78 A;  2V0P A;  3UM1 A;  3L13 A;  5DIZ A;  3Q7F A;  2IQC A;  4O1P A;  3D9I A;  4A3T A;  3DST A;  1H2U A;  4ACK A;  2CHX A;  4A3V A;  3JYS A;  2ZGG A;  2MRI A;  4TXR A;  4TV3 A;  1P5Q A;  4TUU A;  3PEV B;  3R9M A;  2X3M A;  4G25 A;  4DX1 A;  4W9R A;  2OVF A;  2YQ8 A;  5CBO A;  2BKG A;  3ZYM A;  3TWU A;  4GTP A;  4QFV A;  4F1P A;  1SW6 A;  3UM2 A;  4ABN A;  1AP7 A;  1UN9 A;  4J8F A;  3PZ2 A;  1KPS B;  1BI8 B;  2H6G A;  1E8Y A;  1IHG A;  2I2O A;  4G23 A;  4CYM D;  1ELR A;  2I9C A;  3Q73 A;  4WWP A;  3PZD A;  3PDN A;  2B6C A;  3Q7A A;  4GTM A;  1MYO A;  3OAW A;  3CQG B;  2WXM A;  3FH8 A;  2HR2 A;  1TJF A;  4HB5 A;  4M7C A;  2J4D A;  4BEP A;  1N4Q A;  3RO2 A;  3AAA C;  4K5C A;  1DC2 A;  2RFA A;  4BET A;  1N11 A;  4HRL A;  3QAQ A;  3DWL G;  3C3Q A;  4N2S A;  3FY4 A;  2GRN B;  3FTZ A;  4B8A A;  2R03 A;  1IXV A;  1BLX B;  3CGH A;  3EUV A;  1NZN A;  3OXL A;  3E30 A;  4WNF A;  2R59 A;  2DZO A;  5ENP D;  3L82 A;  3S7B A;  4L23 A;  4KVM A;  4I9C A;  3CVW A;  4Q69 A;  1N95 A;  2BF0 X;  4IRU A;  2AXV A;  1HH8 A;  3CVY A;  3C3R A;  3R9A B;  1A17 A;  1U2V G;  3QDN A;  2LXL A;  4AXH A;  5LCW J;  3HDX A;  5CMY A;  5KJN A;  2XGO A;  4U8Y D;  2UY1 A;  4DX7 D;  3FEX A;  2WXG A;  4H7X A;  2VGX B;  2WB2 A;  1TJC A;  4HLE A;  3UIO C;  3UQ3 A;  4DX2 A;  1WAO 1;  3LEW A;  1G3N B;  4F53 A;  4URK A;  2XS1 A;  3UT7 A;  3DSS A;  1H6O A;  4NUR A;  2I6H A;  3T8M A;  4GTR A;  3I5P A;  2L9B A;  3CVV A;  1MZC A;  3FUD A;  3ZYL A;  1N9A A;  5CBN A;  4OAU C;  1QBQ A;  2L6B A;  2DYS E;  2VTB A;  3Q47 B;  4HNA D;  3ZPJ A;  2R05 A;  5T4Y A;  3ZHE A;  3CV0 A;  4J7W A;  1HU3 A;  3CST A;  4EPZ A;  3DXK G;  5J08 A;  1ZU2 A;  3UI2 A;  4FJY A;  1EYH A;  1K3Z D;  4F3V A;  4HVB A;  4KZ0 A;  3LVR E;  1MQS A;  2V4L A;  1E7U A;  2LSV A;  4RLY A;  4XIF A;  2XRZ A;  4AV7 A;  2QY7 A;  2EIN E;  3B7U X;  2XEV A;  4J8E A;  2WXF A;  1YA0 A;  2WVI A;  3T5X A;  4UQX A;  1O1T A;  2BKK B;  3ASF A;  3RU0 A;  5EYL A;  3R7R A;  1E8X A;  4UWL A;  3FTV A;  4E85 A;  5CER B;  3UKU G;  1MX2 A;  4GA1 A;  5IY5 E;  1H0A A;  4XI9 A;  3RO3 A;  3UTM A;  2WXJ A;  1D8E A;  4G24 A;  3ZRH A;  4RVB A;  3KSL A;  5BXO A;  2XS8 A;  3HRA A;  2R5S A;  5BPP A;  1E7V A;  4GAA A;  2F8X K;  3L54 A;  2RFM A;  3TWR A;  3C3O A;  3DSV A;  5G55 A;  1V55 E;  3RK6 A;  5ENS D;  4JB8 P;  3TG4 A;  5CHE E;  3E34 A;  3BUA A;  3FU6 A;  4CCA A;  4EZK A;  4L9P A;  4XZ4 A;  3B7B A;  3D9N A;  1FT2 A;  3ZW3 A;  3D9M A;  4GZD A;  2LSU A;  4DX5 D;  3RSE G;  3V79 K;  4PDX A;  1V54 E;  3FTS A;  1JPL A;  4TRQ A;  5CEC B;  4IYP A;  2P2C P;  1OWO A;  1OWN A;  4GZC A;  4AP2 A;  1UJK A;  2XPY A;  5EX0 A;  1H6K A;  3SFX A;  3Q15 A;  4HRM B;  3PZ4 A;  4K5B A;  2IOS A;  3ZXP A;  5FQ4 A;  3QOU A;  2FUL A;  2WXO A;  5H7P A;  4MKT A;  2LXM A;  4L2L A;  4UWH A;  4AJW A;  3UKR G;  3ABK E;  2PQN A;  3ML8 A;  4FHK A;  3FUM A;  4BWR A;  2OCC E;  1JUQ A;  5T8I A;  4I9E A;  3B95 A;  1SA5 A;  2AXZ A;  2L6J A;  4DI3 A;  4OYS A;  1OCC E;  3RIB A;  1N4R A;  4HS2 A;  2IFU A;  4ANX A;  4L7T A;  1N4P A;  2XPZ A;  2MYO A;  2XPI A;  4CZ2 D;  3CK9 A;  3E37 A;  4I6G A;  2BUG A;  4KMO A;  3FTU A;  3FTX A;  1X81 A;  4PS3 A;  3AG4 E;  3IHY A;  1S63 A;  1DVP A;  4MBG A;  4RG6 A;  3T8K A;  4Z68 A;  3Q9U C;  4JZY A;  1QQE A;  4C0E A;  3L6A A;  2WMO A;  2EIM E;  4UWK A;  4YND A;  3NZS A;  3HVE B;  3SFZ A;  3D9P A;  3IKO B;  4EHM A;  3FUK A;  3G2U A;  2EQX A;  3ULY A;  4LNU D;  2FI7 A;  3CVL A;  2HYZ A;  4GU5 A;  2VQ2 A;  5EYP F;  4AM9 A;  3LY9 A;  4LNG A;  4UWG A;  4AEZ C;  4UQY A;  3WG7 E;  4BER A;  3U64 A;  3HXE A;  2YHE A;  1XNF A;  3CVN A;  3ZEF A;  3DXM G;  3CLJ A;  4KT6 B;  3CVU A;  5AAO A;  3ENE A;  3AS5 A;  4A1S A;  5JA4 D;  3MV2 B;  3F6Q A;  2EIJ E;  4FU3 A;  4X8Q A;  2NXP A;  2BTD A;  1TN7 A;  3TXM A;  4I43 A;  2LAH A;  2GRO B;  2IJG X;  2AWI A;  4BT9 A;  4GCN A;  1N0R A;  3LKU A;  2V8S E;  1Z5S C;  4JHR A;  4GCO A;  2MHK A;  5CCL A;  3IEG A;  5HQ8 A;  3ZYK A;  3ZYQ A;  1JCR A;  2DIW A;  5BXU A;  2WXK A;  2CHW A;  2AVP A;  3VTY A;  2IEJ A;  2LNI A;  4U0U A;  1UN8 A;  2ZIS A;  4ANV A;  1TNB A;  2ETB A;  3SQV A;  4GMR A;  2X38 A;  4U0Z A;  3ZNG A;  5ENQ D;  1GW6 A;  4WNG A;  2I1J A;  3FU5 A;  3EHM A;  2ETC A;  2XGM A;  3I3N A;  3D3M A;  3LJ3 A;  4DLO A;  4N3B A;  3TWT A;  1WG0 A;  2B0O E;  2XZT G;  1K1A A;  3PZ1 A;  3FUF A;  4A55 A;  4PH4 B;  1W3B A;  2XEH A;  4ATG A;  2KCV A;  3KEZ A;  2MOW A;  5D0Q D;  3HXB A;  4WNE A;  1KLX A;  3AG1 E;  3TWW A;  5LP0 A;  1HO8 A;  3EIJ A;  4GZ5 A;  4TXQ A;  3QK0 A;  3FEY A;  4I1A A;  1N4S A;  3U3W A;  3MYV A;  3TWX A;  3ZU7 B;  2GRM A;  5G04 C;  3V2O A;  3RAU A;  4J0U A;  2XHE A;  1EF1 C;  2XQ0 A;  5FZS A;  4ANU A;  2WPV A;  2AXU A;  3TJP A;  5KNH D;  3J5P A;  4GTV A;  1IYG A;  1N52 A;  3UMV A;  2VGY A;  4WUY A;  4J6I A;  2WXL A;  5AJL A;  2LO6 A;  4FJZ A;  2NC9 A;  4Y6C A;  4EEC A;  5FQ8 A;  3NQP A;  1KZP A;  1OY3 D;  2UWJ G;  3ML9 A;  2WXP A;  2L0I A;  1N54 A;  3IBE A;  1NI1 A;  5FWQ A;  4GZ3 A;  2C2L A;  4UUC A;  3TL5 A;  1Z6T A;  4LCT A;  3MA5 A;  3D9L A;  4NAC A;  1NL4 A;  2DCP A;  3UM0 A;  3KD7 A;  2NYJ A;  5CRV A;  4YVQ C;  4JXT A;  5FTP A;  4FLB A;  4G1T A;  2J07 A;  1LD7 A;  3D9H A;  2BED A;  3JCK C;  4APF A;  3CHR A;  3QB2 A;  4CDN A;  3URZ A;  1BI7 B;  4XE0 A;  3ZGQ A;  3CHP A;  5FQ6 A;  5G2N A;  5KNG A;  4LG6 A;  4B89 A;  3PNL B;  2RG8 A;  3O4Z A;  4HQD A;  2Y0B G;  3FUI A;  3EIQ C;  2J4B A;  2ION A;  4CGV A;  4ILG A;  4C48 B;  3PS6 A;  2J8S D;  2XZD G;  3B7R L;  1BD8 A;  4ATZ D;  2DVW A;  2AW6 A;  2P9N G;  5JJT A;  4YDO A;  4V3I A;  2FBN A;  3ZIM A;  5CEA A;  1LF8 A;  5A23 A;  3CKC A;  1ZBP A;  3JQ0 A;  1PC2 A;  3ZXS A;  1S70 B;  2QYJ A;  2P9L G;  4PUC A;  3JUE A;  2F37 A;  4G8K A;  3X2Q E;  5EIL A;  1H6P A;  5BNW A;  4U96 D;  2ZXW E;  3GZ2 A;  3MKQ A;  3VTX A;  2VGE A;  4MRU A;  1NP7 A;  2XEE A;  3MJW A;  5LFA A;  2EIL E;  3LYA A;  4ZHB A;  5G05 C;  2M63 A;  4GYO A;  3BG1 B;  3FUL A;  3JUI A;  4Q96 A;  2QZA A;  2H6F A;  2RKK A;  3QAR A;  3CHQ A;  5CRU A;  4BSX A;  1E90 A;  4XX5 A;  1AWC B;  2Y69 E;  3S7F A;  3E4B A;  3T9K A;  2KBX A;  4JL0 A;  5G04 J;  2FF4 A;  1TYQ G;  3SI5 A;  5KWD A;  3L22 A;  3U66 A;  2GRR B;  1EDU A;  2OVB A;  3AU4 A;  4HOT A;  2OND A;  2H6I A;  3SFY A;  3PVL A;  2P9I G;  3IXE A;  1BU9 A;  2IF4 A;  2KCL A;  2R2L A;  4L2Y A;  4FLH A;  3UIP C;  1N94 A;  3HHM A;  2Y3A A;  3K9I A;  3ZN3 A;  3LY8 A;  1UJJ A;  3IHV A;  1E8W A;  2GRP B;  2KZT B;  4N39 A;  1HS6 A;  3FH7 A;  3LDZ A;  3CK8 A;  5KBA A;  4N2Q A;  3DEO A;  1Y8M A;  3VLF A;  1SQM A;  4GTO A;  4FA6 A;  3C72 A;  4ME2 A;  1A5E A;  3HXF A;  1K1B A;  3SY2 A;  3NBN B;  2E0I A;  4I1O B;  5B1A E;  1S64 A;  3UT4 A;  4U8V D;  3ABM E;  3TWQ A;  3ONK A;  3PH0 C;  2P9U G;  3APF A;  3ONL A;  3R7Q A;  2DZN A;  5BV0 A;  2ZIR A;  3CIA A;  3EHR A;  4HRN A;  2J49 A;  1FPP A;  3U4T A;  3E32 A;  3OTN A;  3CKB A;  1KZO A;  2JLB A;  4Q94 A;  2VSX E;  3WXX A;  3FUJ A;  1HX8 A;  4GB9 A;  4RSY A;  1X5B A;  2QFC A;  3J5Q B;  2DYR E;  5ENR D;  4WWN A;  5KJK A;  1HXI A;  4BT8 A;  4RG9 A;  4GZ6 A;  2Y4U A;  1WY6 A;  4D10 C;  3CVP A;  5BT1 A;  4OVU A;  3EU5 A;  3DPD A;  3MX3 A;  1FVF A;  4HOU A;  1DNP A;  3B7T A;  3PRZ A;  5KJL A;  1QYM A;  4GTS A;  3BG0 B;  3V2X A;  4JA7 A;  4JVS A;  3QWV A;  5DBK A;  3D9O A;  1SZA A;  3ULE G;  3HYM B;  3RKV A;  1SA4 A;  3C98 A;  3OXF A;  2Y1L E;  2IU1 A;  3LS8 A;  2V5Q C;  2VGX A;  2I1K A;  2EIK E;  4XKC A;  5BW8 C;  4I6E A;  5JJ6 A;  4YVO A;  2WXN A;  5E75 A;  3GZ1 A;  3ZVV A;  3LVQ E;  5G05 J;  3AG3 E;  1HF8 A;  1HZ4 A;  5FT9 A;  1TN8 A;  4UQZ A;  4E6H A;  3ASG A;  3MV3 B;  5BUZ A;  5ARF A;  3E33 A;  2A4Z A;  3MCX A;  4ILI A;  3ZUV B;  3LXU X;  4FC8 A;  4HOR A;  3ASD A;  4AIF A;  2OEW A;  1JCS A;  3SBT B;  1NA3 A;  2F8Y A;  1Z3X A;  4GTQ A;  4G11 A;  4KZC A;  2J09 A;  2V5F A;  3APD A;  3EDT B;  1WM5 A;  3QKY A;  2CHZ A;  3CEQ A;  5JHA A;  3CVX A;  4JEH A;  4XKB A;  3IV0 A;  3Q5M A;  4QQI A;  2HE0 A;  3SGH A;  3FHE A;  4K0R A;  5M72 A;  2XRY A;  4C0M A;  2ZGD A;  4CT4 A;  3VLD A;  3DSX A;  4KVO A;  2X6I A;  1ELW A;  3DPY A;  4YDE A;  5EDS A;  1OXJ A;  3CHM A;  2FO1 E;  3DSW A;  3ESK A;  5EID A;  2QC9 A;  3L08 A;  3SBS A;  3ESL A;  2OOE A;  2UY1 B;  5LOZ A;  2GRQ B;  2WMN A;  4DI4 A;  3PZ3 A;  1TNY A;  3Q79 A;  3FUE A;  5A7D B;  1Y6I A;  1S0P A;  3B7S A;  3JQ1 A;  3NZU A;  5LX8 A;  3MGB A;  2HM8 A;  3PE3 A;  2HO1 A;  3L9T A;  3VLE A;  3V31 A;  3NB2 A;  5EKQ D;  1Q2Z A;  5ENO D;  3ZKJ A;  2YIN A;  1BPO A;  5AQ9 A;  4BTA A;  2LAI A;  1OWP A;  4GPK A;  1HFA A;  3HG0 D;  4JHK A;  4DK5 A;  4B8C B;  3PEU B;  3I4G A;  2VTB B;  4HI9 A;  2CG2 A;  2A5E A;  3NAW A;  5J90 A;  5FJY A;  3ZHE B;  4DLQ A;  4AY5 A;  1RZ4 A;  4JC8 A;  1TEZ A;  2ILR A;  1PAQ A;  3UM3 A;  3BU8 A;  4J8S A;  4GTT A;  2X6J A;  5HKP A;  1MX4 A;  3D9J A;  1DCE A;  3TXN A;  3ASN E;  5AYW D;  2VJ8 A;  4HFG A;  1FVH A;  4EZL A;  4NIK A;  3BQO A;  4I2W A;  3FTY A;  1LTX A;  3FP3 A;  1H2V C;  3HXD A;  4HOQ A;  3W9F A;  4EZJ A;  4APO A;  2CFZ A;  3TWV A;  1D8D A;  1SVX A;  1VDY A;  1DCQ A;  2ZU6 B;  4CEM A;  1L5J A;  3L17 A;  3QWW A;  4WWO A;  2C0L A;  3EHN A;  5FQ7 A;  5HI7 A;  4R7L A;  2XEN A;  4LEU A;  4FUL A;  2C0M A;  4KBQ A;  2KCK A;  4B93 B;  2PNN A;  3G2V A;  1ELK A;  1FT1 A;  1KT0 A;  4NRH B;  2H6H A;  4J8D A;  5HRY A;  4G2V A;  2GGF A;  4K5A B;  4IN3 B;  5AQ7 A;  4FAD A;  2AJA A;  2VSN A;  4HBD A;  1D9S A;  5AEN A;  3SNX A;  1RW2 A;  1QZ2 A;  1N0Q A;  5EN5 D;  4BY6 A;  2Q7F A;  4ILH B;  4F7A A;  2P58 C;  3FUH A;  5FZR A;  1H19 A;  3OXG A;  2OV8 A;  1E8Z A;  3FU3 A;  3HVE A;  1NFI E;  1MX6 A;  2J08 A;  3RRN B;  3ABL E;  4U0S A;  2PL2 A;  3V30 A;  2YHC A;  4CT0 A;  3RRM B;  3CR3 A;  4LNB A;  4DRX E;  2E2E A;  2LUH A;  4N5C A;  2XCB A;  3AJI A;  1IQR A;  4WND A;  4BTB A;  2X6F A;  4XI0 A;  2PM6 A;  3RJV A;  1JWF A;  5JJ7 A;  4G26 A;  4U63 A;  3LCA A;  1TNO A;  3RRU A;  4KXK B;  4C9B B;  4N3C A;  3CHS A;  4DUI A;  4JEU A;  2IO3 C;  4A63 B;  2WXH A;  4KYO B;  5CED B;  4U8H A;  4LSZ E;  2GW1 A;  5CMW A;  4BX9 A;  1OCO E;  4U7E B;  3O48 A;  3Q75 A;  3MKR A;  5EIB E;  3GW4 A;  1OCZ E;  4J8Y A; 
#chains in the Genus database with same CATH homology
 1MJ0 A;  1K1A A;  2F8Y A;  4U8Y D;  5CBO A;  3JXI A;  4DX7 D;  2BKG A;  3TWU A;  3TWS A;  4N5Q A;  4QFV A;  3EU9 A;  4DX6 D;  4F1P A;  1YMP A;  1SW6 A;  5D66 A;  5AAO A;  1BI7 B;  1AP7 A;  1AWC B;  4HI8 A;  2XEH A;  4DX2 A;  3EHQ A;  5KNG A;  5HKP A;  5JA4 D;  4LG6 A;  3T9K A;  5CER B;  1MX4 A;  2KBX A;  3F6Q A;  4HQD A;  1G3N B;  1MX2 A;  4O60 A;  2Y0B G;  3J5Q B;  1YCS B;  4QQI A;  2HE0 A;  3TWW A;  5ENR D;  1TR4 A;  4YDY A;  1NFI E;  1WDY A;  1MX6 A;  4NIK A;  3UTM A;  1BI8 B;  3KEA A;  5KWD A;  5HS0 A;  1N0R A;  3B95 A;  4C48 B;  3TWX A;  3ZU7 B;  4BSZ B;  4CYM D;  1YYH A;  2J8S D;  4OAV B;  5AN8 A;  2XZD G;  2ZGD A;  3V2O A;  3W9G A;  1BD8 A;  4ATZ D;  2DVW A;  5JMN D;  5BXO A;  3HRA A;  3W9F A;  1UOH A;  3V30 A;  1IKN D;  2MYO A;  2FO1 E;  1QYM A;  5CEA A;  3IXE A;  4U95 D;  3TWV A;  1MYO A;  5KNH D;  3J5P A;  3V2X A;  1BU9 A;  2F8X K;  3JXJ A;  5CBN A;  2RFM A;  4CZ2 D;  3TWR A;  4OAU C;  1SVX A;  2L6B A;  5EID A;  4DRX E;  1DCQ A;  2QC9 A;  4HB5 A;  1S70 B;  4HNA D;  2QYJ A;  5ENS D;  4JB8 P;  4TUM A;  4BEP A;  2KXP C;  5AQB A;  3JUE A;  3AAA C;  2F37 A;  4G8K A;  4HLL A;  3AJI A;  5BXU A;  4K5C A;  1DC2 A;  5EIL A;  3T8K A;  2RFA A;  4BET A;  4J7W A;  1N11 A;  4HRL A;  5AAR A;  4Z68 A;  5ITZ F;  1OY3 D;  4G8L A;  3Q9U C;  2XEN A;  2JAB A;  2Y1L E;  4U96 D;  3NOG D;  3UI2 A;  4YDW A;  2V5Q C;  3NOC D;  1K3Z D;  3Q9N C;  3B7B A;  1IXV A;  1BLX B;  4O1P A;  2V4H C;  5KBA A;  4RLY A;  4B93 B;  5FIN A;  1OT8 A;  4DX5 D;  2PNN A;  3DEP A;  3UXG A;  3V31 A;  3DEO A;  3V79 K;  2DZO A;  2VGE A;  4DUI A;  2ETB A;  4F6R D;  4UUC A;  4GMR A;  5ENP D;  2XEE A;  4A63 B;  5ENO D;  3ZKJ A;  1A5E A;  3ZNG A;  5CEC B;  5HRY A;  5AQ9 A;  2ZGG A;  5CED B;  1K1B A;  2P2C P;  4LNU D;  3NBN B;  5AQA A;  4K5A B;  5ENQ D;  4LSZ E;  4GPM A;  4ZHB A;  5EYP F;  3HG0 D;  3C5R A;  2BKK B;  4ZFH A;  2NYJ A;  5AQ7 A;  2AJA A;  4U8V D;  3TWQ A;  3ZUV B;  2DWZ A;  4HBD A;  2ETC A;  1D9S A;  3LJN A;  4HI9 A;  2ETA A;  4HRM B;  5EYL A;  1N0Q A;  5FIO A;  2A5E A;  3TWT A;  2DZN A;  4BES A;  4DX1 A;  1IHB A;  5EIB E;  1WG0 A;  3EHR A;  4HRN A;  3SO8 A;  4BER A;  2B0O E;  3D9H A;  4O1O A;  5EN5 D;  4K5B A;  5ENT D;  4J8Y A;  2XZT G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...