2J8SD

Drug export pathway of multidrug exporter acrb revealed by darpin inhibitors
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
156
structure length
156
Chain Sequence
GSDLGKKLLEAARAGRDDEVRILMANGADVNAADVVGWTPLHLAAYWGHLEIVEVLLKNGADVNAYDTLGSTPLHLAAHFGHLEIVEVLLKNGADVNAKDDNGITPLHLAANRGHLEIVEVLLKYGADVNAQDKFGKTAFDISINNGNEDLAEILQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACRIFLAVINE RESISTANCE PROTEIN B
publication title Drug Export Pathway of Multidrug Exporter Acrb Revealed by Darpin Inhibitors.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
total genus 48
structure length 156
sequence length 156
chains with identical sequence E
ec nomenclature
pdb deposition date 2006-10-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 2j8sD00
1MJ0A 4CZ2D 4K5AB 3HRAA 1SVXA 4LNUD 3UTMA 3TWXA 4BERA 2FO1E 1A5EA 4DRXE 3NBNB 4GMRA 3LJNA 1OY3D 4N5QA 4K5CA 3TWTA 4A63B 5AN8A 5HS0A 1NFIE 4DX2A 5BXUA 4RLYA 2JABA 2L6BA 3IXEA 5EILA 3ZU7B 4B93B 2ETCA 2QYJA 3TWWA 1SW6A 5ENTD 2A5EA 1BLXB 1MYOA 1IHBA 1G3NB 5ENRD 4DX7D 5CBOA 4Z68A 1OT8A 1AWCB 5BXOA 3TWVA 1K1AA 5CERB 4NIKA 4J7WA 2DVWA 1N0RA 2VGEA 1N11A 3V2OA 4G8LA 5FIOA 4CYMD 1DC2A 4HI8A 4QFVA 3J5PA 3W9FA 1N0QA 1QYMA 5HKPA 2DZNA 3V2XA 1D9SA 3TWQA 4ZFHA 5ENSD 4JB8P 2RFMA 5HRYA 3DEPA 1BI7B 5EIDA 4DX6D 4F6RD 5CEDB 5ITZF 2P2CP 1S70B 3EHQA 2XEEA 1IKND 5JA4D 2HE0A 2F37A 5AQBA 3EU9A 4HLLA 4HQDA 1TR4A 4HRLA 4G8KA 3V30A 2DWZA 4F1PA 3JXIA 5AQ9A 4O1PA 5EYPF 3JXJA 2KXPC 4U8VD 4U8YD 5AQAA 3T8KA 3AJIA 4DX1A 3T9KA 2BKGA 4U95D 4GPMA 1K3ZD 2B0OE 3Q9NC 4O1OA 4UUCA 4ZHBA 4OAVB 3D9HA 3HG0D 3TWRA 3ZUVB 1MX2A 2ETAA 2QC9A 2Y0BG 3B7BA 3NOCD 4HI9A 4U96D 2BKKB 5EIBE 1AP7A 4J8YA 2ZGGA 3EHRA 5D66A 2AJAA 2DZOA 5ENPD 5KNHD 1K1BA 3NOGD 1WG0A 1YYHA 4LSZE 5CEAA 3ZKJA 3KEAA 3UXGA 5FINA 5JMND 2XZDG 4BETA 4HRMB 5ENQD 5KBAA 5KWDA 3SO8A 4DUIA 2RFAA 3TWSA 2F8XK 3W9GA 4HNAD 5CECB 5KNGA 4BSZB 2Y1LE 2XEHA 3V31A 2V5QC 5AAOA 4HRNA 1WDYA 2F8YA 3C5RA 4YDYA 3B95A 5AQ7A 4LG6A 3ZNGA 1BU9A 1BI8B 2XENA 3JUEA 4ATZD 1IXVA 4K5BA 4YDWA 1DCQA 4DX5D 3AAAC 1MX6A 3Q9UC 4BEPA 3F6QA 1BD8A 4C48B 5AARA 1MX4A 2ETBA 2PNNA 2XZTG 2ZGDA 1UOHA 2MYOA 2V4HC 5EYLA 4O60A 2J8SD 2KBXA 5ENOD 3UI2A 4QQIA 3DEOA 3V79K 1YMPA 4HB5A 3TWUA 3J5QB 5EN5D 4BESA 4OAUC 2NYJA 4TUMA 5CBNA 4HBDA 1YCSB
chains in the Genus database with same CATH superfamily
3CVYA 1WAO1 3HXBA 4GMRA 4GTMA 1TEZA 4GTTA 1OCOE 3FU0A 1NI1A 3K9IA 1KLXA 4UQYA 1SW6A 4HVBA 2GW1A 2MRIA 5ARFA 5T3RA 1H19A 3FUDA 4NIKA 4U7EB 1UN9A 1KT1A 1PC2A 4HI8A 1QYMA 2PL2A 3L82A 5D0QD 1S70B 2I1JA 2XEEA 2X6IA 4B0ZA 2Y69E 3FUEA 2VSYA 2IQCA 1TJFA 2IOSA 2EILE 4YDOA 3RAUA 3QDNA 2KATA 4ILIA 2FBNA 3ONLA 5FZQA 3PEUB 5AJDA 3FTZA 2Y0BG 3EHRA 1U3CA 3QWPA 2J49A 2JLBA 1NA0A 2DCPA 1XGWA 2IO2C 3D9NA 4HRNA 1WDYA 3C3QA 4ANWA 3B95A 3I3NA 4GZ3A 4HOTA 3PZDA 3CKCA 1HE8A 4ATZD 3ULEG 1ELRA 3R7QA 1OXJA 4JW1A 3HXDA 4C48B 2BTDA 3AU4A 1UOHA 5AIJA 2V4HC 4O60A 3FUJA 3D9KA 3LEWA 4JA9A 4V3IA 3DBSA 3MYVA 1A5EA 4NQ0A 4JPSA 1OY3D 3CVNA 3QNKA 2XGMA 4B93B 4WNFA 2LSVA 2R5SA 1BLXB 4FP7A 3PVLA 3PE4A 5CERB 2ONDA 3ZYKA 4GTQA 2VQ2A 2B6CA 3UM0A 3U9WA 3E32A 3P1UA 3DSXA 3TWQA 3FH7A 2PZIA 2VGXB 2F37A 3Q5MA 3HDXA 3FULA 4GZDA 5AQ9A 4BT9A 1KZPA 4UUCA 5CCLA 2H6GA 3HXFA 3ZHEB 3PRZA 3OXFA 2ZISA 1AP7A 4Q94A 2AJAA 3TL5A 5FTPA 4LNBA 1N95A 5DIZA 3CK7A 3NZSA 3SO8A 4K0RA 3TWSA 3O48A 3KAEA 2F8YA 3Q49B 3ZGQA 3FWVA 3AAAC 1NZNA 2LNIA 3CKBA 3U64A 2MYOA 3HXEA 2LO6A 3ML8A 2L0TB 1V55E 3RRUA 5FZSA 4N5CA 4GB9A 3FTVA 4I2ZA 4U63A 4YDEA 2V4LA 3SF4A 1HG5A 3ZYQA 5KCMA 1S63A 3FH8A 3NAWA 4E6HA 5CBOA 5BXOA 2A5UA 3DPDA 4GPKA 3ISMC 2DVWA 2WXQA 2XEVA 1S0PA 2VGXA 2FEZA 2XPYA 3MGBA 3AG1E 3ONKA 4KVOA 4F6RD 2P2CP 3ZHEA 2X3MA 1H2UA 5JA4D 4CRWA 2DWZA 2C2LA 2YNQA 1TYQG 3PZ4A 4DX1A 1NA3A 2AW6A 3PUJA 1N54A 1WM5A 2AXZA 5EX0A 3T5VA 2F0YA 3MA5A 3B7TA 3CVVA 4BETA 4KXKB 1HF8A 4I17A 2HR2A 4BY6A 3IHVA 3Q73A 2J07A 1DCQA 1H6KA 4DJAA 1ZB1A 3QAQA 3R9AB 2PM6A 4DI3A 4ME2A 1EF1C 5ENOD 3PDNA 3CGHA 4CEMA 4BESA 3ZXPA 3ABLE 3LXUX 4HXIA 5B1AE 4U0ZA 3OXLA 4WNDA 2ZXWE 4GTOA 4TXPA 3DPYA 3FTUA 1OWNA 3ZYMA 1N52A 2A5EA 3U66A 4A3TA 3SBSA 2XPZA 4EHMA 1MHQA 4I1OB 5FT9A 3ASGA 3EHMA 3J5PA 3KSQA 3BQOA 3HVEB 1Z6TA 4ACKA 3MKQB 3EU9A 3RIBA 5EYPF 3FDHA 3AJIA 4H7XA 4OYSA 2XHEA 3DSWA 4HI9A 4XKBA 5EDSA 3B7SA 4LSZE 2P9IG 2KCVA 5FINA 3EDTB 5BW8C 5KWDA 2YINA 3SY2A 2XRZA 4HNAD 5AQ7A 2LXMA 2XENA 4LUNU 4J8DA 4PUCA 3VTYA 2P9SG 3RJVA 5ARGA 2ETBA 3OTNA 4CDRA 3L9TA 5LP0A 2YHEA 3SZ7A 3HXCA 3L17A 4HORA 2WXNA 1PY1A 4XEIG 4RG9A 5HQ8A 2EQXA 1SA5A 4HBDA 2NC9A 4JZYA 2IU1A 1FCHA 3SD5A 3UPVA 2P9PG 4ILHB 4TRQA 3QJZA 4BWRA 3ZW3A 4A3VA 1EPUA 1DNPA 2WMNA 2I2OA 3HVEA 4F1SA 1JUQA 3MKQA 4CYMD 5EKQD 1N4PA 4U0UA 4MKTA 1D9SA 1FVHA 3X2QE 4U8HA 4FU3A 3DXMG 1IQUA 1HZ4A 5BPPA 4O6FA 4EECA 1K3ZD 2WQ7A 4HOUA 1FPPA 2QC9A 5FJYA 4U96D 5EIBE 5J90A 3G2SA 1P5QA 4GAAA 4J8YA 3VLFA 3ULQA 1K1BA 3KEAA 4OVUA 5ENQD 3QK0A 5G55A 4KZ0A 3ESLA 1X81A 5CRVA 2CHXA 4FJYA 4Q96A 3L54A 4A1SA 2BEDA 2KM4A 5CMWA 4HB5A 1Z3XA 2VSXE 4UWHA 3T5XA 1JWFA 4GYOA 3FU5A 1Y6IA 4K5AB 3HRAA 1Q2ZA 4J6IA 3TWXA 3MV2B 4FC8A 4TXQA 2CHZA 3CLJA 5C1DA 4PDXA 1MYOA 4N3CA 3S7DA 4LERA 1G3NB 3UT8A 3G2VA 4BSXA 3CQGB 5T8IA 1OUVA 1DC2A 5HKPA 1DVPA 4GTVA 1MZCA 4JC8A 5CEDB 1TN8A 3C3OA 3D9IA 4EBAA 3SFXA 3JXJA 3Q9NC 2H6HA 4UI9J 3RRNB 1H2VC 5KJLA 5KNHD 3QB2A 4GMLA 2LAHA 4HRMB 2GRLA 2E0IA 5LX8A 2R17C 1ZU2A 3EIQC 4JEHA 1BI8B 1ZBPA 2V0PA 4FADA 5EX3A 2EINE 1Z5SC 3NF1A 3Q9UC 2ILRA 3CHPA 5CCMA 4EQFA 1UG3A 1E7UA 3QKYA 3ZRHA 5D2MC 4FLBA 1YMPA 3TWUA 4G2VA 4CDNA 1D8DA 3FUMA 3SQVA 3G2UA 2LUHA 4MRUA 2X6HA 1E8XA 2WQHA 2R02A 4JA7A 3AS5A 2JABA 5EILA 2ETCA 3G2TA 3DWLG 5BUZA 4WAFA 5ANRA 3G2WA 5B3SE 1TJCA 3JQ1A 4K03A 1ELWA 1TN6A 4G23A 4GTSA 5LFAA 3LVRE 5ENSD 1TN7A 5HRYA 3FY4A 3FHEA 4GYWA 3TAXA 1NP7A 3CR3A 4HRLA 4IN3B 5AQAA 4URKA 5HI7A 2HO1A 4ANXA 4ILGA 3WG7E 1TNZA 4XE0A 4BX8A 1WG0A 5CEAA 4HS2A 3LPZA 4L7TA 2H6IA 2RFAA 3TG5A 4AIFA 3ZIMA 1TNYA 4ACLA 3OAWA 2QY7A 2XZTG 3FEYA 5CMYA 1ELKA 3FEXA 5EN5D 4YVQC 2WMOA 1VDYA 2WXOA 3ESKA 4FA6A 1MJ0A 3TXNA 2LAIA 4L2LA 3KD7A 4EZJA 3ASOE 3CEQA 3RO2A 3EUVA 1O5MA 4DX7D 4YVOA 1OT8A 4I43A 1K1AA 3WXXA 4C0MA 1UJJA 4TXRA 2VGEA 3ZXSA 3MX3A 4F7AA 4DK5A 1K8KG 1H6PA 2DZNA 4L23A 2OEWA 4B89A 3Q79A 3DEPA 4MBGA 2VYIA 4AV7A 1PAQA 1N4QA 2HE0A 3DSVA 2HM8A 4U8VD 3UM2A 4N2SA 1HO8A 3ML9A 4IYPA 4LNGA 2BF0X 4UI9K 4O1OA 4AJWA 3FUHA 1GW6A 2Y3AA 1O1RA 3ZUVB 1MX2A 2VJ8A 3NOCD 2BKKB 1JWGA 5D66A 5FQ7A 4PS7A 4XZ4A 3IHYA 4Y6WA 3ZKJA 4ABNA 2VGYA 2Y4TA 3I4GA 3LY9A 4HLEA 1SZ9A 2V5QC 4FLHA 5G05J 1SZAA 3Q4AB 4YDYA 1BU9A 1UW4B 3TGOA 5AENA 3ZFWA 2GRPB 2AXUA 1OWOA 2IF4A 5G04J 4ANUA 4GCOA 3DSSA 5FQ4A 4QQIA 4L9PA 4JHKA 3N71A 3KS2A 2LXLA 2FO1E 3KSLA 1N9AA 4N5QA 4K5CA 3PZ2A 3IXEA 2QYJA 3AG4E 3NZUA 4JVSA 3LDZA 4J0UA 1AWCB 1BPOA 1O1SA 2X6JA 2WXHA 4J7WA 5IY5E 1HFAA 3CQCB 2C0MA 1OWLA 3IBEA 3V2XA 4N3AA 2J4BA 5EIDA 3FUNA 4GMJA 4R7LA 1LD7A 1V54E 1X5BA 4HQDA 4G8KA 4AY6A 4I6EA 4JEUA 4JD2G 3MKRA 4WWOA 3CVLA 2FI7A 3B7BA 3ASNE 4G11A 2XPIA 5G04C 4MS6A 3AG3E 3U4TA 3FU3A 1YYHA 2R2LA 4TUUA 3QWVA 5LCWJ 3OXGA 3E37A 1N94A 3I5PA 2Y1LE 2OV8A 4AM9A 3FUKA 4P29A 2DBAA 4FULA 4GTRA 4AOFA 3TG4A 4FHJA 4NACA 3MEKA 5EYLA 2P9LG 3Q7AA 1S64A 3ZEFA 4EPZA 4G24A 5CBNA 3RKVA 3DSUA 4LNUD 3LJNA 3GYZA 2C0LA 3FTWA 4G26A 2J4DA 3DXKG 3ZU7B 1WY6A 4IULA 3MCXA 2WXPA 4FHKA 3L22A 1N11A 3D9MA 4G8LA 3ENEA 4LEUA 3SHFA 1JPLA 1H2TC 3P2BA 4E85A 1LD8A 3QC1A 1BI7B 3APCA 3D9PA 5JHBA 5LCWC 4D10C 4HLLA 5A7DB 4HFGA 3NQPA 4O1PA 3BU8A 3T8KA 2BUGA 2NXPA 2Q7FA 4ZHBA 4OAVB 2XCBA 1XNFA 3HG0D 3TWRA 2EIME 4GZ5A 5E76A 2E2EA 4F53A 3FP3A 5KBAA 4JHJA 3Q75A 3L16A 3TJPA 4Q69A 3QWWA 2WPVA 4K5BA 4DLQA 4BFRA 2OOEA 5ANLA 3C98A 4DX5D 3PZ3A 4UQZA 4KZCA 2WVIA 1BD8A 2XRYA 3FFLA 2PNNA 4H7YA 2GRNB 5B1BE 3BEEA 2UY1A 2IY0C 3R7RA 4GZ6A 4A55A 5JHAA 2IJGX 3EJNA 1N4RA 1D8EA 4HOQA 5AN8A 4IRUA 3CHSA 4RLYA 1E8WA 4GU5A 2IO3C 3U3WA 1INZA 5ENRD 4B8CB 3RSEG 4AY5A 5KJMA 3GZ2A 3L08A 3QARA 1N0QA 2WQ6A 3L6AA 2LSUA 5AYWD 3EHQA 4M7CA 2Y4UA 3EHNA 3FH5A 3R9MA 4U8YD 3HIZA 1TNOA 3T9KA 4KMOA 4U04A 4APFA 1HH8A 4DPRA 2EIKE 4MLPA 3CVWA 3FU6A 3ZYLA 2XQ0A 3RRMB 5FQ6A 5JMND 3URZA 3LY7A 3UM3A 2GRMA 5KNGA 3SFYA 5DBKA 4I6GA 3BUAA 4I1MA 1LTXA 4M3OA 4L2YA 3VLDA 2CG2A 3F6QA 2FO7A 3JYSA 3IKOB 3V79K 2IONA 3CV0A 1RW2A 3PNLB 3UX4A 3D3MA 3D9LA 3NBNB 1HG2A 4RQIA 3CHQA 3CK9A 1UN8A 2DIWA 3CSFA 5HS0A 1NFIE 5BXUA 2IFUA 3UM1A 4B8AA 1OCCE 3ULYA 2WB2A 2VSOE 4Z68A 3TWVA 3D9JA 1OWPA 3ZN3A 1EDUA 3ASHA 4TV3A 1B89A 1FVFA 4AVXA 4RSYA 3IEGA 1MQSA 4ZFHA 4JB8P 2RFMA 3PZ1A 3C3RA 3LVQE 3GZ1A 3DSTA 3JXIA 4BTAA 2BKGA 4U95D 4N3BA 3L13A 5C2YA 3D9HA 3APDA 2ZIRA 4CT4A 4UI9C 2VTBA 3VTXA 3LYAA 2ZGGA 1HX8A 3UUXA 3NOGD 1FT2A 2GROB 3UXGA 4CGVA 2P9KG 2GRRB 2MHKA 5CECB 4BSZB 5AAOA 2PM7A 2OCCE 4EZLA 5A23A 5KJKA 4BEPA 2XGSA 3PEVB 1E7VA 4NRHB 3Q47B 2ZU6B 5G2NA 3FTYA 3IV0A 4TUMA 2DYSE 5E75A 4GA0A 2WXLA 4XX5A 3EIJA 2RD0A 4A63B 1E8YA 2L6BA 5ENTD 5CHEE 2L0IA 5LOZA 4F3VA 5J08A 4UQXA 2AXVA 3CVPA 4KT6B 1UJKA 3RK6A 2XCCA 3PREA 3LCAA 1EYHA 4J8FA 3W9FA 3RO3A 2WXKA 2L6JA 3E30A 4WNEA 4C0EA 3V30A 2WM9A 5AQBA 1TNUA 1TR4A 2YQ8A 2R03A 5M72A 4NURA 3UT7A 2UWJG 3ZVVA 2B0OE 4FJZA 4KVMA 4PH4B 3AU5A 1QBQA 3FUFA 4RG6A 4XKCA 4GA2A 3PS6A 3LY8A 4ATGA 1JCQA 2XZDG 1L5JA 3LJ3A 2KC7A 3HHMA 3SBTB 2OEVA 3V31A 2L9BA 1HXIA 4B94A 4BT8A 2WXMA 3EU5A 5ENNA 1E90A 4PS3A 3KEZA 2NSZA 1QQEA 3FUIA 2WXRA 2ZGDA 3ABME 1OCRE 4I9CA 3UKRG 1QZ2A 2EIJE 4UWFA 5T4YA 2WXJA 3ZPJA 2A4ZA 1SVXA 3UTMA 4AP2A 2JEKA 3TWTA 2P58C 2PQRA 3UINC 2KZTB 4G25A 4I6JA 4J8EA 3BG1B 1FT1A 4GCNA 4CDMA 3CHRA 5D0OD 4UWLA 2CFUA 2QYUA 1N0RA 3CIAA 2FF4A 5FIOA 2X38A 4JL0A 2P9NG 4XI0A 4QFVA 2AWIA 1IHGA 3CVQA 5AJLA 2CHWA 3CVXA 5FWQA 3UQ3A 5BV1A 3I4RB 2KXPC 3ABKE 3UIPC 4WUYA 4DI4A 1U2VG 1QNFA 5ENPD 3MJWA 5FQ8A 1KT0A 3B7UX 3S7FA 3ASDA 1RZ4A 2FULA 5JJTA 1OCZE 4Y6CA 4RVBA 2XEHA 3QOUA 4GA1A 5G05C 4JXTA 3S2AA 3ASFA 4LG6A 3ZNGA 5BNWA 2V8SE 2YHCA 4LRZA 3CVUA 2IEJA 1H0AA 5A6CA 4XI9A 2WXIA 3CHMA 2RG8A 3VLEA 2KBXA 1O1TA 2KZTA 2AVPA 4KBQA 4APOA 3B7RL 2R05A 3BG0B 1YCSB 1H6OA 2V5FA 1DCEA 4BERA 4DRXE 3UIOC 2X6FA 3PUKA 3CHOA 4YNDA 3AS4A 4U07A 4DX2A 3Q7FA 3TWWA 1HU3A 4A1GA 3S7JA 1KZOA 4DLOA 3O4ZA 2OVFA 4CT0A 4N2QA 3V2OA 4WWPA 3SFZA 4XIFA 3CSTA 3AS8A 4L1BA 2RKKA 2UY1B 5CRUA 3FTSA 5ITZF 4N39A 2CFZA 3PE3A 1IKND 1Z3YA 4F1PA 4GPMA 5JJ6A 1Y8MA 3LS8A 2M63A 4EZKA 1YA0A 2I9CA 4G1TA 2XS1A 3S7BA 1E96B 4GZCA 4JHRA 3LKUA 4PS8A 2OVBA 3Q15A 4DUIA 3CK8A 4U0SA 3W9GA 3RU0A 4CGWA 1HS6A 2J09A 1IYGA 3C5RA 4I1AA 3E33A 2CG3A 3NB2A 2XGOA 4EBAG 3APFA 4YDWA 2MOWA 2XS8A 2WXGA 5AARA 5BT1A 5BV0A 1OWMA 1A17A 2DYRE 3UI2A 3J5QB 4OAUC 2NYJA 5KJNA 5H7PA 4WNGA 4OVVA 2WXFA 4UWGA 4CZ2D 1U3DA 3PH0C 3FTXA 4X8QA 4I2WA 2GRQB 2KCKA 3JQ0A 3SI5A 3DRAA 1KPSB 2H6FA 4KYOB 1IHBA 1TNBA 4LCTA 2PQNA 4AEZC 1SQMA 2GGFA 3SNXA 1E8ZA 3JCKC 4DX6D 2I6HA 3D9OA 1NL4A 3GW4A 2KCLA 3MV3B 3B13A 2I1KA 4GTPA 2QFCA 3TXMA 4UWKA 2R59A 4AXHA 2ETAA 1IQRA 1N4SA 3MZLB 1SA4A 4GYYA 2P9UG 2J9QA 2DZOA 4BTBA 3UMVA 2HYZA 2QZAA 5JJ7A 3GZSA 4I9EA 4C9BB 2F8XK 1JCSA 4J8SA 2J08A 3PNTB 4W9RA 4ANVA 3C72A 3JUEA 3UT4A 1IXVA 3E4BA 3Q78A 1LF8A 1MX6A 1W3BA 2IOLA 3E34A 4WWNA 1MX4A 5FZRA 3UKUG 4HOSA 2J8SD 3DEOA 3AG2E 3JUIA 3SGHA 2X6KA 3HYMB 1JCRA 4CCAA 4BX9A 2VSNA 3T8MA 2VTBB
chains in the Genus database with same CATH topology
1MJ0A 4CZ2D 4K5AB 3HRAA 1SVXA 4LNUD 3UTMA 3TWXA 4BERA 2FO1E 1A5EA 4DRXE 3NBNB 4GMRA 3LJNA 1OY3D 4N5QA 4K5CA 3TWTA 4A63B 5AN8A 5HS0A 1NFIE 4DX2A 5BXUA 4RLYA 2JABA 2L6BA 3IXEA 5EILA 3ZU7B 4B93B 2ETCA 2QYJA 3TWWA 1SW6A 5ENTD 2A5EA 1BLXB 1MYOA 1IHBA 1G3NB 5ENRD 4DX7D 5CBOA 4Z68A 1OT8A 1AWCB 5BXOA 3TWVA 1K1AA 5CERB 4NIKA 4J7WA 2DVWA 1N0RA 2VGEA 1N11A 3V2OA 4G8LA 5FIOA 4CYMD 1DC2A 4HI8A 4QFVA 3J5PA 3W9FA 1N0QA 1QYMA 5HKPA 2DZNA 3V2XA 1D9SA 3TWQA 4ZFHA 5ENSD 4JB8P 2RFMA 5HRYA 3DEPA 1BI7B 5EIDA 4DX6D 4F6RD 5CEDB 5ITZF 2P2CP 1S70B 3EHQA 2XEEA 1IKND 5JA4D 2HE0A 2F37A 5AQBA 3EU9A 4HLLA 4HQDA 1TR4A 4HRLA 4G8KA 3V30A 2DWZA 4F1PA 3JXIA 5AQ9A 4O1PA 5EYPF 3JXJA 2KXPC 4U8VD 4U8YD 5AQAA 3T8KA 3AJIA 4DX1A 3T9KA 2BKGA 4U95D 4GPMA 1K3ZD 2B0OE 3Q9NC 4O1OA 4UUCA 4ZHBA 4OAVB 3D9HA 3HG0D 3TWRA 3ZUVB 1MX2A 2ETAA 2QC9A 2Y0BG 3B7BA 3NOCD 4HI9A 4U96D 2BKKB 5EIBE 1AP7A 4J8YA 2ZGGA 3EHRA 5D66A 2AJAA 2DZOA 5ENPD 5KNHD 1K1BA 3NOGD 1WG0A 1YYHA 4LSZE 5CEAA 3ZKJA 3KEAA 3UXGA 5FINA 5JMND 2XZDG 4BETA 4HRMB 5ENQD 5KBAA 5KWDA 3SO8A 4DUIA 2RFAA 3TWSA 2F8XK 3W9GA 4HNAD 5CECB 5KNGA 4BSZB 2Y1LE 2XEHA 3V31A 2V5QC 5AAOA 4HRNA 1WDYA 2F8YA 3C5RA 4YDYA 3B95A 5AQ7A 4LG6A 3ZNGA 1BU9A 1BI8B 2XENA 3JUEA 4ATZD 1IXVA 4K5BA 4YDWA 1DCQA 4DX5D 3AAAC 1MX6A 3Q9UC 4BEPA 3F6QA 1BD8A 4C48B 5AARA 1MX4A 2ETBA 2PNNA 2XZTG 2ZGDA 1UOHA 2MYOA 2V4HC 5EYLA 4O60A 2J8SD 2KBXA 5ENOD 3UI2A 4QQIA 3DEOA 3V79K 1YMPA 4HB5A 3TWUA 3J5QB 5EN5D 4BESA 4OAUC 2NYJA 4TUMA 5CBNA 4HBDA 1YCSB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MJ0 A;  4CZ2 D;  4K5A B;  3HRA A;  1SVX A;  4LNU D;  3UTM A;  3TWX A;  4BER A;  2FO1 E;  1A5E A;  4DRX E;  3NBN B;  4GMR A;  3LJN A;  1OY3 D;  4N5Q A;  4K5C A;  3TWT A;  4A63 B;  5AN8 A;  5HS0 A;  1NFI E;  4DX2 A;  5BXU A;  4RLY A;  2JAB A;  2L6B A;  3IXE A;  5EIL A;  3ZU7 B;  4B93 B;  2ETC A;  2QYJ A;  3TWW A;  1SW6 A;  5ENT D;  2A5E A;  1BLX B;  1MYO A;  1IHB A;  1G3N B;  5ENR D;  4DX7 D;  5CBO A;  4Z68 A;  1OT8 A;  1AWC B;  5BXO A;  3TWV A;  1K1A A;  5CER B;  4NIK A;  4J7W A;  2DVW A;  1N0R A;  2VGE A;  1N11 A;  3V2O A;  4G8L A;  5FIO A;  4CYM D;  1DC2 A;  4HI8 A;  4QFV A;  3J5P A;  3W9F A;  1N0Q A;  1QYM A;  5HKP A;  2DZN A;  3V2X A;  1D9S A;  3TWQ A;  4ZFH A;  5ENS D;  4JB8 P;  2RFM A;  5HRY A;  3DEP A;  1BI7 B;  5EID A;  4DX6 D;  4F6R D;  5CED B;  5ITZ F;  2P2C P;  1S70 B;  3EHQ A;  2XEE A;  1IKN D;  5JA4 D;  2HE0 A;  2F37 A;  5AQB A;  3EU9 A;  4HLL A;  4HQD A;  1TR4 A;  4HRL A;  4G8K A;  3V30 A;  2DWZ A;  4F1P A;  3JXI A;  5AQ9 A;  4O1P A;  5EYP F;  3JXJ A;  2KXP C;  4U8V D;  4U8Y D;  5AQA A;  3T8K A;  3AJI A;  4DX1 A;  3T9K A;  2BKG A;  4U95 D;  4GPM A;  1K3Z D;  2B0O E;  3Q9N C;  4O1O A;  4UUC A;  4ZHB A;  4OAV B;  3D9H A;  3HG0 D;  3TWR A;  3ZUV B;  1MX2 A;  2ETA A;  2QC9 A;  2Y0B G;  3B7B A;  3NOC D;  4HI9 A;  4U96 D;  2BKK B;  5EIB E;  1AP7 A;  4J8Y A;  2ZGG A;  3EHR A;  5D66 A;  2AJA A;  2DZO A;  5ENP D;  5KNH D;  1K1B A;  3NOG D;  1WG0 A;  1YYH A;  4LSZ E;  5CEA A;  3ZKJ A;  3KEA A;  3UXG A;  5FIN A;  5JMN D;  2XZD G;  4BET A;  4HRM B;  5ENQ D;  5KBA A;  5KWD A;  3SO8 A;  4DUI A;  2RFA A;  3TWS A;  2F8X K;  3W9G A;  4HNA D;  5CEC B;  5KNG A;  4BSZ B;  2Y1L E;  2XEH A;  3V31 A;  2V5Q C;  5AAO A;  4HRN A;  1WDY A;  2F8Y A;  3C5R A;  4YDY A;  3B95 A;  5AQ7 A;  4LG6 A;  3ZNG A;  1BU9 A;  1BI8 B;  2XEN A;  3JUE A;  4ATZ D;  1IXV A;  4K5B A;  4YDW A;  1DCQ A;  4DX5 D;  3AAA C;  1MX6 A;  3Q9U C;  4BEP A;  3F6Q A;  1BD8 A;  4C48 B;  5AAR A;  1MX4 A;  2ETB A;  2PNN A;  2XZT G;  2ZGD A;  1UOH A;  2MYO A;  2V4H C;  5EYL A;  4O60 A;  2J8S D;  2KBX A;  5ENO D;  3UI2 A;  4QQI A;  3DEO A;  3V79 K;  1YMP A;  4HB5 A;  3TWU A;  3J5Q B;  5EN5 D;  4BES A;  4OAU C;  2NYJ A;  4TUM A;  5CBN A;  4HBD A;  1YCS B; 
#chains in the Genus database with same CATH topology
 3CVY A;  1WAO 1;  3HXB A;  4GMR A;  4GTM A;  1TEZ A;  4GTT A;  1OCO E;  3FU0 A;  1NI1 A;  3K9I A;  1KLX A;  4UQY A;  1SW6 A;  4HVB A;  2GW1 A;  2MRI A;  5ARF A;  5T3R A;  1H19 A;  3FUD A;  4NIK A;  4U7E B;  1UN9 A;  1KT1 A;  1PC2 A;  4HI8 A;  1QYM A;  2PL2 A;  3L82 A;  5D0Q D;  1S70 B;  2I1J A;  2XEE A;  2X6I A;  4B0Z A;  2Y69 E;  3FUE A;  2VSY A;  2IQC A;  1TJF A;  2IOS A;  2EIL E;  4YDO A;  3RAU A;  3QDN A;  2KAT A;  4ILI A;  2FBN A;  3ONL A;  5FZQ A;  3PEU B;  5AJD A;  3FTZ A;  2Y0B G;  3EHR A;  1U3C A;  3QWP A;  2J49 A;  2JLB A;  1NA0 A;  2DCP A;  1XGW A;  2IO2 C;  3D9N A;  4HRN A;  1WDY A;  3C3Q A;  4ANW A;  3B95 A;  3I3N A;  4GZ3 A;  4HOT A;  3PZD A;  3CKC A;  1HE8 A;  4ATZ D;  3ULE G;  1ELR A;  3R7Q A;  1OXJ A;  4JW1 A;  3HXD A;  4C48 B;  2BTD A;  3AU4 A;  1UOH A;  5AIJ A;  2V4H C;  4O60 A;  3FUJ A;  3D9K A;  3LEW A;  4JA9 A;  4V3I A;  3DBS A;  3MYV A;  1A5E A;  4NQ0 A;  4JPS A;  1OY3 D;  3CVN A;  3QNK A;  2XGM A;  4B93 B;  4WNF A;  2LSV A;  2R5S A;  1BLX B;  4FP7 A;  3PVL A;  3PE4 A;  5CER B;  2OND A;  3ZYK A;  4GTQ A;  2VQ2 A;  2B6C A;  3UM0 A;  3U9W A;  3E32 A;  3P1U A;  3DSX A;  3TWQ A;  3FH7 A;  2PZI A;  2VGX B;  2F37 A;  3Q5M A;  3HDX A;  3FUL A;  4GZD A;  5AQ9 A;  4BT9 A;  1KZP A;  4UUC A;  5CCL A;  2H6G A;  3HXF A;  3ZHE B;  3PRZ A;  3OXF A;  2ZIS A;  1AP7 A;  4Q94 A;  2AJA A;  3TL5 A;  5FTP A;  4LNB A;  1N95 A;  5DIZ A;  3CK7 A;  3NZS A;  3SO8 A;  4K0R A;  3TWS A;  3O48 A;  3KAE A;  2F8Y A;  3Q49 B;  3ZGQ A;  3FWV A;  3AAA C;  1NZN A;  2LNI A;  3CKB A;  3U64 A;  2MYO A;  3HXE A;  2LO6 A;  3ML8 A;  2L0T B;  1V55 E;  3RRU A;  5FZS A;  4N5C A;  4GB9 A;  3FTV A;  4I2Z A;  4U63 A;  4YDE A;  2V4L A;  3SF4 A;  1HG5 A;  3ZYQ A;  5KCM A;  1S63 A;  3FH8 A;  3NAW A;  4E6H A;  5CBO A;  5BXO A;  2A5U A;  3DPD A;  4GPK A;  3ISM C;  2DVW A;  2WXQ A;  2XEV A;  1S0P A;  2VGX A;  2FEZ A;  2XPY A;  3MGB A;  3AG1 E;  3ONK A;  4KVO A;  4F6R D;  2P2C P;  3ZHE A;  2X3M A;  1H2U A;  5JA4 D;  4CRW A;  2DWZ A;  2C2L A;  2YNQ A;  1TYQ G;  3PZ4 A;  4DX1 A;  1NA3 A;  2AW6 A;  3PUJ A;  1N54 A;  1WM5 A;  2AXZ A;  5EX0 A;  3T5V A;  2F0Y A;  3MA5 A;  3B7T A;  3CVV A;  4BET A;  4KXK B;  1HF8 A;  4I17 A;  2HR2 A;  4BY6 A;  3IHV A;  3Q73 A;  2J07 A;  1DCQ A;  1H6K A;  4DJA A;  1ZB1 A;  3QAQ A;  3R9A B;  2PM6 A;  4DI3 A;  4ME2 A;  1EF1 C;  5ENO D;  3PDN A;  3CGH A;  4CEM A;  4BES A;  3ZXP A;  3ABL E;  3LXU X;  4HXI A;  5B1A E;  4U0Z A;  3OXL A;  4WND A;  2ZXW E;  4GTO A;  4TXP A;  3DPY A;  3FTU A;  1OWN A;  3ZYM A;  1N52 A;  2A5E A;  3U66 A;  4A3T A;  3SBS A;  2XPZ A;  4EHM A;  1MHQ A;  4I1O B;  5FT9 A;  3ASG A;  3EHM A;  3J5P A;  3KSQ A;  3BQO A;  3HVE B;  1Z6T A;  4ACK A;  3MKQ B;  3EU9 A;  3RIB A;  5EYP F;  3FDH A;  3AJI A;  4H7X A;  4OYS A;  2XHE A;  3DSW A;  4HI9 A;  4XKB A;  5EDS A;  3B7S A;  4LSZ E;  2P9I G;  2KCV A;  5FIN A;  3EDT B;  5BW8 C;  5KWD A;  2YIN A;  3SY2 A;  2XRZ A;  4HNA D;  5AQ7 A;  2LXM A;  2XEN A;  4LUN U;  4J8D A;  4PUC A;  3VTY A;  2P9S G;  3RJV A;  5ARG A;  2ETB A;  3OTN A;  4CDR A;  3L9T A;  5LP0 A;  2YHE A;  3SZ7 A;  3HXC A;  3L17 A;  4HOR A;  2WXN A;  1PY1 A;  4XEI G;  4RG9 A;  5HQ8 A;  2EQX A;  1SA5 A;  4HBD A;  2NC9 A;  4JZY A;  2IU1 A;  1FCH A;  3SD5 A;  3UPV A;  2P9P G;  4ILH B;  4TRQ A;  3QJZ A;  4BWR A;  3ZW3 A;  4A3V A;  1EPU A;  1DNP A;  2WMN A;  2I2O A;  3HVE A;  4F1S A;  1JUQ A;  3MKQ A;  4CYM D;  5EKQ D;  1N4P A;  4U0U A;  4MKT A;  1D9S A;  1FVH A;  3X2Q E;  4U8H A;  4FU3 A;  3DXM G;  1IQU A;  1HZ4 A;  5BPP A;  4O6F A;  4EEC A;  1K3Z D;  2WQ7 A;  4HOU A;  1FPP A;  2QC9 A;  5FJY A;  4U96 D;  5EIB E;  5J90 A;  3G2S A;  1P5Q A;  4GAA A;  4J8Y A;  3VLF A;  3ULQ A;  1K1B A;  3KEA A;  4OVU A;  5ENQ D;  3QK0 A;  5G55 A;  4KZ0 A;  3ESL A;  1X81 A;  5CRV A;  2CHX A;  4FJY A;  4Q96 A;  3L54 A;  4A1S A;  2BED A;  2KM4 A;  5CMW A;  4HB5 A;  1Z3X A;  2VSX E;  4UWH A;  3T5X A;  1JWF A;  4GYO A;  3FU5 A;  1Y6I A;  4K5A B;  3HRA A;  1Q2Z A;  4J6I A;  3TWX A;  3MV2 B;  4FC8 A;  4TXQ A;  2CHZ A;  3CLJ A;  5C1D A;  4PDX A;  1MYO A;  4N3C A;  3S7D A;  4LER A;  1G3N B;  3UT8 A;  3G2V A;  4BSX A;  3CQG B;  5T8I A;  1OUV A;  1DC2 A;  5HKP A;  1DVP A;  4GTV A;  1MZC A;  4JC8 A;  5CED B;  1TN8 A;  3C3O A;  3D9I A;  4EBA A;  3SFX A;  3JXJ A;  3Q9N C;  2H6H A;  4UI9 J;  3RRN B;  1H2V C;  5KJL A;  5KNH D;  3QB2 A;  4GML A;  2LAH A;  4HRM B;  2GRL A;  2E0I A;  5LX8 A;  2R17 C;  1ZU2 A;  3EIQ C;  4JEH A;  1BI8 B;  1ZBP A;  2V0P A;  4FAD A;  5EX3 A;  2EIN E;  1Z5S C;  3NF1 A;  3Q9U C;  2ILR A;  3CHP A;  5CCM A;  4EQF A;  1UG3 A;  1E7U A;  3QKY A;  3ZRH A;  5D2M C;  4FLB A;  1YMP A;  3TWU A;  4G2V A;  4CDN A;  1D8D A;  3FUM A;  3SQV A;  3G2U A;  2LUH A;  4MRU A;  2X6H A;  1E8X A;  2WQH A;  2R02 A;  4JA7 A;  3AS5 A;  2JAB A;  5EIL A;  2ETC A;  3G2T A;  3DWL G;  5BUZ A;  4WAF A;  5ANR A;  3G2W A;  5B3S E;  1TJC A;  3JQ1 A;  4K03 A;  1ELW A;  1TN6 A;  4G23 A;  4GTS A;  5LFA A;  3LVR E;  5ENS D;  1TN7 A;  5HRY A;  3FY4 A;  3FHE A;  4GYW A;  3TAX A;  1NP7 A;  3CR3 A;  4HRL A;  4IN3 B;  5AQA A;  4URK A;  5HI7 A;  2HO1 A;  4ANX A;  4ILG A;  3WG7 E;  1TNZ A;  4XE0 A;  4BX8 A;  1WG0 A;  5CEA A;  4HS2 A;  3LPZ A;  4L7T A;  2H6I A;  2RFA A;  3TG5 A;  4AIF A;  3ZIM A;  1TNY A;  4ACL A;  3OAW A;  2QY7 A;  2XZT G;  3FEY A;  5CMY A;  1ELK A;  3FEX A;  5EN5 D;  4YVQ C;  2WMO A;  1VDY A;  2WXO A;  3ESK A;  4FA6 A;  1MJ0 A;  3TXN A;  2LAI A;  4L2L A;  3KD7 A;  4EZJ A;  3ASO E;  3CEQ A;  3RO2 A;  3EUV A;  1O5M A;  4DX7 D;  4YVO A;  1OT8 A;  4I43 A;  1K1A A;  3WXX A;  4C0M A;  1UJJ A;  4TXR A;  2VGE A;  3ZXS A;  3MX3 A;  4F7A A;  4DK5 A;  1K8K G;  1H6P A;  2DZN A;  4L23 A;  2OEW A;  4B89 A;  3Q79 A;  3DEP A;  4MBG A;  2VYI A;  4AV7 A;  1PAQ A;  1N4Q A;  2HE0 A;  3DSV A;  2HM8 A;  4U8V D;  3UM2 A;  4N2S A;  1HO8 A;  3ML9 A;  4IYP A;  4LNG A;  2BF0 X;  4UI9 K;  4O1O A;  4AJW A;  3FUH A;  1GW6 A;  2Y3A A;  1O1R A;  3ZUV B;  1MX2 A;  2VJ8 A;  3NOC D;  2BKK B;  1JWG A;  5D66 A;  5FQ7 A;  4PS7 A;  4XZ4 A;  3IHY A;  4Y6W A;  3ZKJ A;  4ABN A;  2VGY A;  2Y4T A;  3I4G A;  3LY9 A;  4HLE A;  1SZ9 A;  2V5Q C;  4FLH A;  5G05 J;  1SZA A;  3Q4A B;  4YDY A;  1BU9 A;  1UW4 B;  3TGO A;  5AEN A;  3ZFW A;  2GRP B;  2AXU A;  1OWO A;  2IF4 A;  5G04 J;  4ANU A;  4GCO A;  3DSS A;  5FQ4 A;  4QQI A;  4L9P A;  4JHK A;  3N71 A;  3KS2 A;  2LXL A;  2FO1 E;  3KSL A;  1N9A A;  4N5Q A;  4K5C A;  3PZ2 A;  3IXE A;  2QYJ A;  3AG4 E;  3NZU A;  4JVS A;  3LDZ A;  4J0U A;  1AWC B;  1BPO A;  1O1S A;  2X6J A;  2WXH A;  4J7W A;  5IY5 E;  1HFA A;  3CQC B;  2C0M A;  1OWL A;  3IBE A;  3V2X A;  4N3A A;  2J4B A;  5EID A;  3FUN A;  4GMJ A;  4R7L A;  1LD7 A;  1V54 E;  1X5B A;  4HQD A;  4G8K A;  4AY6 A;  4I6E A;  4JEU A;  4JD2 G;  3MKR A;  4WWO A;  3CVL A;  2FI7 A;  3B7B A;  3ASN E;  4G11 A;  2XPI A;  5G04 C;  4MS6 A;  3AG3 E;  3U4T A;  3FU3 A;  1YYH A;  2R2L A;  4TUU A;  3QWV A;  5LCW J;  3OXG A;  3E37 A;  1N94 A;  3I5P A;  2Y1L E;  2OV8 A;  4AM9 A;  3FUK A;  4P29 A;  2DBA A;  4FUL A;  4GTR A;  4AOF A;  3TG4 A;  4FHJ A;  4NAC A;  3MEK A;  5EYL A;  2P9L G;  3Q7A A;  1S64 A;  3ZEF A;  4EPZ A;  4G24 A;  5CBN A;  3RKV A;  3DSU A;  4LNU D;  3LJN A;  3GYZ A;  2C0L A;  3FTW A;  4G26 A;  2J4D A;  3DXK G;  3ZU7 B;  1WY6 A;  4IUL A;  3MCX A;  2WXP A;  4FHK A;  3L22 A;  1N11 A;  3D9M A;  4G8L A;  3ENE A;  4LEU A;  3SHF A;  1JPL A;  1H2T C;  3P2B A;  4E85 A;  1LD8 A;  3QC1 A;  1BI7 B;  3APC A;  3D9P A;  5JHB A;  5LCW C;  4D10 C;  4HLL A;  5A7D B;  4HFG A;  3NQP A;  4O1P A;  3BU8 A;  3T8K A;  2BUG A;  2NXP A;  2Q7F A;  4ZHB A;  4OAV B;  2XCB A;  1XNF A;  3HG0 D;  3TWR A;  2EIM E;  4GZ5 A;  5E76 A;  2E2E A;  4F53 A;  3FP3 A;  5KBA A;  4JHJ A;  3Q75 A;  3L16 A;  3TJP A;  4Q69 A;  3QWW A;  2WPV A;  4K5B A;  4DLQ A;  4BFR A;  2OOE A;  5ANL A;  3C98 A;  4DX5 D;  3PZ3 A;  4UQZ A;  4KZC A;  2WVI A;  1BD8 A;  2XRY A;  3FFL A;  2PNN A;  4H7Y A;  2GRN B;  5B1B E;  3BEE A;  2UY1 A;  2IY0 C;  3R7R A;  4GZ6 A;  4A55 A;  5JHA A;  2IJG X;  3EJN A;  1N4R A;  1D8E A;  4HOQ A;  5AN8 A;  4IRU A;  3CHS A;  4RLY A;  1E8W A;  4GU5 A;  2IO3 C;  3U3W A;  1INZ A;  5ENR D;  4B8C B;  3RSE G;  4AY5 A;  5KJM A;  3GZ2 A;  3L08 A;  3QAR A;  1N0Q A;  2WQ6 A;  3L6A A;  2LSU A;  5AYW D;  3EHQ A;  4M7C A;  2Y4U A;  3EHN A;  3FH5 A;  3R9M A;  4U8Y D;  3HIZ A;  1TNO A;  3T9K A;  4KMO A;  4U04 A;  4APF A;  1HH8 A;  4DPR A;  2EIK E;  4MLP A;  3CVW A;  3FU6 A;  3ZYL A;  2XQ0 A;  3RRM B;  5FQ6 A;  5JMN D;  3URZ A;  3LY7 A;  3UM3 A;  2GRM A;  5KNG A;  3SFY A;  5DBK A;  4I6G A;  3BUA A;  4I1M A;  1LTX A;  4M3O A;  4L2Y A;  3VLD A;  2CG2 A;  3F6Q A;  2FO7 A;  3JYS A;  3IKO B;  3V79 K;  2ION A;  3CV0 A;  1RW2 A;  3PNL B;  3UX4 A;  3D3M A;  3D9L A;  3NBN B;  1HG2 A;  4RQI A;  3CHQ A;  3CK9 A;  1UN8 A;  2DIW A;  3CSF A;  5HS0 A;  1NFI E;  5BXU A;  2IFU A;  3UM1 A;  4B8A A;  1OCC E;  3ULY A;  2WB2 A;  2VSO E;  4Z68 A;  3TWV A;  3D9J A;  1OWP A;  3ZN3 A;  1EDU A;  3ASH A;  4TV3 A;  1B89 A;  1FVF A;  4AVX A;  4RSY A;  3IEG A;  1MQS A;  4ZFH A;  4JB8 P;  2RFM A;  3PZ1 A;  3C3R A;  3LVQ E;  3GZ1 A;  3DST A;  3JXI A;  4BTA A;  2BKG A;  4U95 D;  4N3B A;  3L13 A;  5C2Y A;  3D9H A;  3APD A;  2ZIR A;  4CT4 A;  4UI9 C;  2VTB A;  3VTX A;  3LYA A;  2ZGG A;  1HX8 A;  3UUX A;  3NOG D;  1FT2 A;  2GRO B;  3UXG A;  4CGV A;  2P9K G;  2GRR B;  2MHK A;  5CEC B;  4BSZ B;  5AAO A;  2PM7 A;  2OCC E;  4EZL A;  5A23 A;  5KJK A;  4BEP A;  2XGS A;  3PEV B;  1E7V A;  4NRH B;  3Q47 B;  2ZU6 B;  5G2N A;  3FTY A;  3IV0 A;  4TUM A;  2DYS E;  5E75 A;  4GA0 A;  2WXL A;  4XX5 A;  3EIJ A;  2RD0 A;  4A63 B;  1E8Y A;  2L6B A;  5ENT D;  5CHE E;  2L0I A;  5LOZ A;  4F3V A;  5J08 A;  4UQX A;  2AXV A;  3CVP A;  4KT6 B;  1UJK A;  3RK6 A;  2XCC A;  3PRE A;  3LCA A;  1EYH A;  4J8F A;  3W9F A;  3RO3 A;  2WXK A;  2L6J A;  3E30 A;  4WNE A;  4C0E A;  3V30 A;  2WM9 A;  5AQB A;  1TNU A;  1TR4 A;  2YQ8 A;  2R03 A;  5M72 A;  4NUR A;  3UT7 A;  2UWJ G;  3ZVV A;  2B0O E;  4FJZ A;  4KVM A;  4PH4 B;  3AU5 A;  1QBQ A;  3FUF A;  4RG6 A;  4XKC A;  4GA2 A;  3PS6 A;  3LY8 A;  4ATG A;  1JCQ A;  2XZD G;  1L5J A;  3LJ3 A;  2KC7 A;  3HHM A;  3SBT B;  2OEV A;  3V31 A;  2L9B A;  1HXI A;  4B94 A;  4BT8 A;  2WXM A;  3EU5 A;  5ENN A;  1E90 A;  4PS3 A;  3KEZ A;  2NSZ A;  1QQE A;  3FUI A;  2WXR A;  2ZGD A;  3ABM E;  1OCR E;  4I9C A;  3UKR G;  1QZ2 A;  2EIJ E;  4UWF A;  5T4Y A;  2WXJ A;  3ZPJ A;  2A4Z A;  1SVX A;  3UTM A;  4AP2 A;  2JEK A;  3TWT A;  2P58 C;  2PQR A;  3UIN C;  2KZT B;  4G25 A;  4I6J A;  4J8E A;  3BG1 B;  1FT1 A;  4GCN A;  4CDM A;  3CHR A;  5D0O D;  4UWL A;  2CFU A;  2QYU A;  1N0R A;  3CIA A;  2FF4 A;  5FIO A;  2X38 A;  4JL0 A;  2P9N G;  4XI0 A;  4QFV A;  2AWI A;  1IHG A;  3CVQ A;  5AJL A;  2CHW A;  3CVX A;  5FWQ A;  3UQ3 A;  5BV1 A;  3I4R B;  2KXP C;  3ABK E;  3UIP C;  4WUY A;  4DI4 A;  1U2V G;  1QNF A;  5ENP D;  3MJW A;  5FQ8 A;  1KT0 A;  3B7U X;  3S7F A;  3ASD A;  1RZ4 A;  2FUL A;  5JJT A;  1OCZ E;  4Y6C A;  4RVB A;  2XEH A;  3QOU A;  4GA1 A;  5G05 C;  4JXT A;  3S2A A;  3ASF A;  4LG6 A;  3ZNG A;  5BNW A;  2V8S E;  2YHC A;  4LRZ A;  3CVU A;  2IEJ A;  1H0A A;  5A6C A;  4XI9 A;  2WXI A;  3CHM A;  2RG8 A;  3VLE A;  2KBX A;  1O1T A;  2KZT A;  2AVP A;  4KBQ A;  4APO A;  3B7R L;  2R05 A;  3BG0 B;  1YCS B;  1H6O A;  2V5F A;  1DCE A;  4BER A;  4DRX E;  3UIO C;  2X6F A;  3PUK A;  3CHO A;  4YND A;  3AS4 A;  4U07 A;  4DX2 A;  3Q7F A;  3TWW A;  1HU3 A;  4A1G A;  3S7J A;  1KZO A;  4DLO A;  3O4Z A;  2OVF A;  4CT0 A;  4N2Q A;  3V2O A;  4WWP A;  3SFZ A;  4XIF A;  3CST A;  3AS8 A;  4L1B A;  2RKK A;  2UY1 B;  5CRU A;  3FTS A;  5ITZ F;  4N39 A;  2CFZ A;  3PE3 A;  1IKN D;  1Z3Y A;  4F1P A;  4GPM A;  5JJ6 A;  1Y8M A;  3LS8 A;  2M63 A;  4EZK A;  1YA0 A;  2I9C A;  4G1T A;  2XS1 A;  3S7B A;  1E96 B;  4GZC A;  4JHR A;  3LKU A;  4PS8 A;  2OVB A;  3Q15 A;  4DUI A;  3CK8 A;  4U0S A;  3W9G A;  3RU0 A;  4CGW A;  1HS6 A;  2J09 A;  1IYG A;  3C5R A;  4I1A A;  3E33 A;  2CG3 A;  3NB2 A;  2XGO A;  4EBA G;  3APF A;  4YDW A;  2MOW A;  2XS8 A;  2WXG A;  5AAR A;  5BT1 A;  5BV0 A;  1OWM A;  1A17 A;  2DYR E;  3UI2 A;  3J5Q B;  4OAU C;  2NYJ A;  5KJN A;  5H7P A;  4WNG A;  4OVV A;  2WXF A;  4UWG A;  4CZ2 D;  1U3D A;  3PH0 C;  3FTX A;  4X8Q A;  4I2W A;  2GRQ B;  2KCK A;  3JQ0 A;  3SI5 A;  3DRA A;  1KPS B;  2H6F A;  4KYO B;  1IHB A;  1TNB A;  4LCT A;  2PQN A;  4AEZ C;  1SQM A;  2GGF A;  3SNX A;  1E8Z A;  3JCK C;  4DX6 D;  2I6H A;  3D9O A;  1NL4 A;  3GW4 A;  2KCL A;  3MV3 B;  3B13 A;  2I1K A;  4GTP A;  2QFC A;  3TXM A;  4UWK A;  2R59 A;  4AXH A;  2ETA A;  1IQR A;  1N4S A;  3MZL B;  1SA4 A;  4GYY A;  2P9U G;  2J9Q A;  2DZO A;  4BTB A;  3UMV A;  2HYZ A;  2QZA A;  5JJ7 A;  3GZS A;  4I9E A;  4C9B B;  2F8X K;  1JCS A;  4J8S A;  2J08 A;  3PNT B;  4W9R A;  4ANV A;  3C72 A;  3JUE A;  3UT4 A;  1IXV A;  3E4B A;  3Q78 A;  1LF8 A;  1MX6 A;  1W3B A;  2IOL A;  3E34 A;  4WWN A;  1MX4 A;  5FZR A;  3UKU G;  4HOS A;  2J8S D;  3DEO A;  3AG2 E;  3JUI A;  3SGH A;  2X6K A;  3HYM B;  1JCR A;  4CCA A;  4BX9 A;  2VSN A;  3T8M A;  2VTB B; 
#chains in the Genus database with same CATH homology
 1MJ0 A;  4CZ2 D;  4K5A B;  3HRA A;  1SVX A;  4LNU D;  3UTM A;  3TWX A;  4BER A;  2FO1 E;  1A5E A;  4DRX E;  3NBN B;  4GMR A;  3LJN A;  1OY3 D;  4N5Q A;  4K5C A;  3TWT A;  4A63 B;  5AN8 A;  5HS0 A;  1NFI E;  4DX2 A;  5BXU A;  4RLY A;  2JAB A;  2L6B A;  3IXE A;  5EIL A;  3ZU7 B;  4B93 B;  2ETC A;  2QYJ A;  3TWW A;  1SW6 A;  5ENT D;  2A5E A;  1BLX B;  1MYO A;  1IHB A;  1G3N B;  5ENR D;  4DX7 D;  5CBO A;  4Z68 A;  1OT8 A;  1AWC B;  5BXO A;  3TWV A;  1K1A A;  5CER B;  4NIK A;  4J7W A;  2DVW A;  1N0R A;  2VGE A;  1N11 A;  3V2O A;  4G8L A;  5FIO A;  4CYM D;  1DC2 A;  4HI8 A;  4QFV A;  3J5P A;  3W9F A;  1N0Q A;  1QYM A;  5HKP A;  2DZN A;  3V2X A;  1D9S A;  3TWQ A;  4ZFH A;  5ENS D;  4JB8 P;  2RFM A;  5HRY A;  3DEP A;  1BI7 B;  5EID A;  4DX6 D;  4F6R D;  5CED B;  5ITZ F;  2P2C P;  1S70 B;  3EHQ A;  2XEE A;  1IKN D;  5JA4 D;  2HE0 A;  2F37 A;  5AQB A;  3EU9 A;  4HLL A;  4HQD A;  1TR4 A;  4HRL A;  4G8K A;  3V30 A;  2DWZ A;  4F1P A;  3JXI A;  5AQ9 A;  4O1P A;  5EYP F;  3JXJ A;  2KXP C;  4U8V D;  4U8Y D;  5AQA A;  3T8K A;  3AJI A;  4DX1 A;  3T9K A;  2BKG A;  4U95 D;  4GPM A;  1K3Z D;  2B0O E;  3Q9N C;  4O1O A;  4UUC A;  4ZHB A;  4OAV B;  3D9H A;  3HG0 D;  3TWR A;  3ZUV B;  1MX2 A;  2ETA A;  2QC9 A;  2Y0B G;  3B7B A;  3NOC D;  4HI9 A;  4U96 D;  2BKK B;  5EIB E;  1AP7 A;  4J8Y A;  2ZGG A;  3EHR A;  5D66 A;  2AJA A;  2DZO A;  5ENP D;  5KNH D;  1K1B A;  3NOG D;  1WG0 A;  1YYH A;  4LSZ E;  5CEA A;  3ZKJ A;  3KEA A;  3UXG A;  5FIN A;  5JMN D;  2XZD G;  4BET A;  4HRM B;  5ENQ D;  5KBA A;  5KWD A;  3SO8 A;  4DUI A;  2RFA A;  3TWS A;  2F8X K;  3W9G A;  4HNA D;  5CEC B;  5KNG A;  4BSZ B;  2Y1L E;  2XEH A;  3V31 A;  2V5Q C;  5AAO A;  4HRN A;  1WDY A;  2F8Y A;  3C5R A;  4YDY A;  3B95 A;  5AQ7 A;  4LG6 A;  3ZNG A;  1BU9 A;  1BI8 B;  2XEN A;  3JUE A;  4ATZ D;  1IXV A;  4K5B A;  4YDW A;  1DCQ A;  4DX5 D;  3AAA C;  1MX6 A;  3Q9U C;  4BEP A;  3F6Q A;  1BD8 A;  4C48 B;  5AAR A;  1MX4 A;  2ETB A;  2PNN A;  2XZT G;  2ZGD A;  1UOH A;  2MYO A;  2V4H C;  5EYL A;  4O60 A;  2J8S D;  2KBX A;  5ENO D;  3UI2 A;  4QQI A;  3DEO A;  3V79 K;  1YMP A;  4HB5 A;  3TWU A;  3J5Q B;  5EN5 D;  4BES A;  4OAU C;  2NYJ A;  4TUM A;  5CBN A;  4HBD A;  1YCS B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...