2J8WA

The crystal structure of cytochrome c' from rubrivivax gelatinosus at 1.3 a resolution and ph 8.0
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
128
structure length
128
Chain Sequence
QFQKPGDAIEYRQSAFTLIANHFGRVAAMAQGKAPFDAKVAAENIALVSTLSKLPLTAFGPGTDKGHGTEAKPAVWSDAAGFKAAADKFAAAVDKLDAAGKTGDFAQIKAAVGETGGACKGCHDKFKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C'
publication title High resolution crystal structure of Rubrivivax gelatinosus cytochrome c'.
pubmed doi rcsb
molecule tags Electron transport
total genus 52
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 2j8wA00
1RCPA 2XLDA 2XL8A 3QW1A 2YLDA 4CX9A 1A7VA 1M6TA 3ZQVA 3HNKA 4IB4A 2YLGA 1QQ3A 5AGFA 3U8PA 4N6HA 3DE9A 1CGOA 3DE8A 4JE9A 1CPQA 1MQVA 1YYJA 2XLEA 4ER9A 4IARA 5JT4A 4U9DA 1E83A 2XLMA 3NMJA 3QVZA 4N4WA 2BC5A 1LM3B 3L1MA 2XLOA 4WGZA 3ZTMA 1E86A 1YYXA 2YL1A 2YLIA 1EKYA 2YL3A 4EIYA 2CCYA 4U9EA 1BBHA 3M15A 256BA 3FOOA 5B3IA 3ZTZA 2XLHA 5JRAA 3M4BA 2YL0A 4CDAA 2XLVA 3NMIA 4WGYA 3HNLA 1NBBA 4NC3A 3IQ6A 2YL7A 4CDVA 1YZAA 1CPRA 3NMKA 5JLIA 1GQAA 4L6RA 5JVEA 3TOLA 5JSLA 3QVYA 4D4NA 1S05A 3VRCA 4IAQA 3FOPA 2XLWA 5JUAA 4CDYA 4ULVA 4CIPA 4CJGA 1APCA 3C62A 1E84A 4JEAA 2J9BA 3ZQYA 4JEBA 2XM0A 2XL6A 3C63A 3TOMA 3IQ5A 3ZWIA 2J8WA 4CJOA 1YZCA 3HNJA 1QPUA 2YKZA 1CGNA 2XM4A 5JP7A 2QLAA 3HNIA 3QW0A 3M4CA 4JKVA 1JAFA 1E85A 4D4XA 5JS5A 3M79A
chains in the Genus database with same CATH superfamily
4MTFA 1NSGB 3VF0A 4DBQA 3R7CA 3QW1A 3TJ6A 1D1AA 3K1IC 1ORYA 5KYNA 1M6TA 3W2VA 1L3PA 1OCCC 3S84A 4CS9C 2BE5F 3QTHA 3QZCA 2D4UA 4JVSA 4I44A 2F22A 3LEVA 1HW2A 3UMKA 4AX2A 3EFOB 2R9RB 3K1HA 3K6BA 3ZG1A 3BRJA 4AE4A 2KK1A 1LPEA 2LIGA 2V26A 2Y3GA 3DM5A 3EPVA 1OW8A 3LAYA 4O6YA 5AGFA 5COGA 1A41A 2H7VC 3DJUB 1M2VB 4N6HA 3IQCA 1AEPA 2M64A 5FCLA 2J0XA 4MW3A 4W8PA 1BZ4A 4LLCA 4YWQA 3I4UA 3SXMA 1YYJA 2MHRA 2XLEA 4XLPF 3M1CB 5JT4A 3RH3A 3EJNA 2LQGA 2VASA 3I5QA 3G4XA 1OQCA 4O6MA 1E83A 1YARO 2XLMA 3NMJA 3BEHA 3GEEA 3T6BA 3VM6A 2AWCA 5D91A 3WAQA 5AC5A 4AL0A 3HTKC 5TJ5E 1LE4A 5DLJA 1E86A 3JT1A 1DOWA 4DJ9A 5L0FA 5DS5A 2P6VA 2J7PA 4JURI 3GODA 2YEVA 3O39A 3LLKA 1ZHYA 4W8KA 4EIYA 4EWCA 1J8YF 3ASNC 2HJ3A 2W9YA 3KPHA 3W2WA 4RBNA 3U2MA 3GM3A 1RJ9A 2J7PD 4XLNF 3NKDA 1Z23A 1TWGA 1OXKA 3NDBB 2WVNA 4CDAA 2R7UA 2R02A 1UG7A 4WGYA 4DVYP 1TWHA 1Z5ZA 2QE9A 3V5XA 1WGWA 5E33A 3VAYA 5DQZA 1OR2A 5KYWA 2PBEA 2YL7A 4JTCB 4N6CA 4U5BE 4CDVA 4AK9A 3NMKA 2XSEA 1EI7A 5JLIA 3FHDA 1VTMP 1LI7A 2B0JA 1HY5A 2EPMX 1GQAA 4QI2A 2HKVA 2R7SA 4EBJA 2H7OA 4MVOA 2Y3DA 5JSLA 3TOLA 5JVEA 4D4NA 2HSBA 2HJMA 4IAQA 2JPUA 4JCHA 2P7VA 2J9UA 3EHMA 3L0IA 4XQ1A 3Q7LA 3IPMO 4NTAA 5JUAA 1YDIA 3DXJF 4HFFB 3DD7A 3HKKA 4CSAA 1HMDA 3K66A 3RQEA 3UMHA 4BPMA 1Y6DA 3AG2C 4C3EA 5EHHA 3AG1C 1JPNA 3C8GA 4IRUA 2EPKX 3NYLA 4JEAA 4P6IC 3ZQYA 1MNDA 3ABKC 4YL0A 2GAQA 3VYWA 3IQ5A 4UDVA 4BEMJ 5A6AA 4MVMA 3C8GD 2R7VA 1JR8A 1HW1A 3EGDA 4E18A 1Z3IX 3GEIA 2G62A 2GWWA 3ZDLA 1BR2A 4JTDB 5DS6A 4A2NB 4OINF 3KL4A 2ASRA 2CGEA 1NLXA 3JRMO 1QPUA 1AVOB 1I4YA 1RKEA 1SMYF 5A6BA 1BDJB 1G4WR 4MTOA 5HV9A 3NG1A 3ASOC 3KH2A 2EPOA 4IAOA 5JP7A 4OIQF 2QLAA 3HNIA 2R7TA 1VK5A 3SXZA 3EH2A 1A7DA 3DZAA 1ZW2A 3HJCA 4FESA 5BQHA 5A6BD 2RD9A 1IW7F 2IM8A 3IHUA 5L0HA 3O55A 1RMVA 1JAFA 2XS1A 4PJJA 4YL3A 4BJ1A 4DOZA 1D0XA 3C18A 2XL4A 1FNTc 2XLDA 2YLDA 1YJGA 4AL1A 1A7VA 3L8JA 3CQZA 5E3CA 1ZHXA 2QUPA 4C3BA 2HV7A 5BQGA 4K7BA 2WZFA 2R7WA 2TMVP 1OCZC 4YK5A 3N24A 2PX3A 5DQTA 2NUTA 3U9JA 4X0RA 3HNKA 1NU9C 1Z63A 2RSEB 3ITFA 4CS7A 1Q0KA 2YHSA 4JZAA 2HSQA 3U5SA 4E0HA 2YQYA 4KI2A 1EA8A 3DJNB 1C17M 3DE9A 3LNMB 3ECSA 1ZHWA 3RKOF 2NPUA 4JE9A 1CPQA 4H4KC 1ZW3A 1D1CA 5KYXA 1E2XA 3LEOA 4IARA 3RQFA 4U9DA 4ONSA 1WOLA 4PJLA 5IY5C 3V5ZA 3Q7GA 3O6XA 3GM2A 4DBRA 2EIJC 2R7XA 2Q00A 4LDKA 2XXAB 2G3KA 3C7JA 4YT8A 1GS9A 1JRAA 1ZU4A 4BJ6A 4MTGA 4OD4A 1LM3B 3L1MA 1R5ID 1HE9A 4WGZA 4LERA 5DVWA 3OWTA 5L0IA 1QSPA 4C7OB 3T9OA 3F47A 2XS8A 2YL1A 2YLIA 1Z7Qc 1KNYA 2Q9AA 4OIPF 1NG1A 2R05A 4Q5SF 4U5DE 1D1BA 1OKKA 2CCYA 2Q9CA 1U6HA 3FOOA 1ST6A 2XLHA 4I3MA 2VH3A 5E3AA 3B9QA 2OJQA 1T6UA 3DKAA 1I4ZA 1OKKD 1YA9A 2W4BA 3EFOA 3NMIA 5L0JA 3EGXB 4FAPB 1NBBA 2I15A 1GM5A 3AG4C 4DRJB 2GDCA 4OIRF 3C8ZA 4JCZA 1VB5A 1ZZPA 1M2VA 2H8AA 4YT5A 2FFHA 3K33A 1MMGA 2V3CC 2KNHA 2IXPA 1HMOA 2KC3A 4LACB 4L6RA 2M4EA 3QVYA 1FFHA 4KNVA 5L3VA 1FTSA 3S9OA 5HSWA 3B29A 3G50A 1YVIA 1R4TA 1KU2A 4Z9JA 2NUPB 2XLWA 5GPGB 5DS4A 2P1AA 2LK4A 1LIHA 4U5GA 3DAGA 5T3WA 1NU7D 3U3FA 4NQFA 1Q0DA 5KYYB 1VYIA 1VLSA 3QMKA 1FMWA 2IXNA 4BJ5A 1OCOC 2J45A 2J9BA 2ZD9A 4O7GA 2CW0F 1TWCA 4FWVA 4JEBA 2L81A 3KMIA 4XPWA 1S7ZA 2I8BA 4BG0A 2IXMA 1G4US 2A69F 1HE1A 2IXOA 1YA7O 3L34A 1K05A 3GEHA 4BJ5C 1V54C 2J8WA 3JCUQ 4CJOA 3MX3A 2Y3HA 1YZCA 4QI0A 4PJNA 1FR0A 4EUKB 2L7AA 3O10A 3V7OA 2X0CA 3TQOA 1CGNA 1T9KA 2EPNA 3S28A 3CSKA 5L0CA 3POVA 2XM4A 1WWPA 4U5CE 4C3DA 1I5NA 2OCCC 3X1OA 5F5HA 5A6JA 1VYKA 3AGUA 3L8IA 2J0WA 5L0GA 2C03A 4G7HF 2HV6A 4O79A 4E0IA 1ZHTA 1O5HA 2A1DD 2WL8A 1TFKB 4D4XA 1DOVA 1KTMA 3CEXA 1TWAA 3AOUA 1PD0A 1RCPA 1SYQA 1D0ZA 1WN0A 3LS0A 4PFPA 4MVZA 4K0DA 2XL8A 4K1OA 1XZQA 4XPYA 4CX9A 4E17A 4PJMA 3PDMP 4CSAC 4HFKB 3RIPA 4OIOF 4KNWA 1K04A 3NRHA 3U8VA 3MYFA 1ORJA 3SNHA 4YT4A 2ICWG 5EK0A 2WVQA 2JD3A 4MS2A 1ZU5A 3RQGA 4F4BA 1NFNA 2P61A 2HS5A 2EIKC 2YLGA 4R32A 4XWJA 1QQ3A 2Q7RA 3SP1A 3U8PA 2A68F 1Z6AA 1LVKA 1QZXA 2D5RB 2HZ8A 3A11A 4NCQA 3S0XA 1H9GA 2EIMC 5F28E 4JIOA 1SR2A 2ZXWC 4BEJA 2L9JA 3AJMA 4GYTA 3SXYA 3W4YA 3N0TA 2GFHA 2JX0A 1XWJA 4JC7A 2IYLD 5D92A 1YLMA 2FGYA 4ANJA 1CGME 3DI5A 2HFIA 1C02A 3E70C 2AU5A 4CIHA 2YRFA 3PCVA 4DRHB 3QVZA 3GM1A 1NFOA 4WJ0A 3FDQA 2DYSC 2BC5A 1IZMA 3LUTB 4IGGA 5BQIA 2OG2A 3AGTA 2XLOA 3ZTMA 3B71A 2OEVA 4G0HA 2PNOA 3UNGC 3ABMC 1Q0MA 1OW6A 5KYUB 3PHF2 4WABA 4XEFA 3LJBA 3J06A 5B1AC 2YL3A 4QDLA 1BR1A 2QNLA 2VCAA 2WZLA 4IWBA 2AVKA 3CAXA 2YWAA 4U9EA 2R7OA 3US6A 2CNWA 2PP4A 2PX0A 2Q4FA 3M15A 1GGQA 5B3IA 2PF4E 5K0IA 3K7DA 1ORSC 2XLVA 2DI3A 3FAJA 3DAFA 2AP3A 2CNWD 1N1CA 3TJ5A 1M56C 1WASA 2R25A 3EH1A 3IEEA 3HNLA 3SYNA 3IQ6A 3EG9B 1YZAA 2G3VA 2Z15A 1CPRA 1BR4A 4IJJA 4BJTA 1U89A 5BUOA 2DGJA 4G78A 4MNDA 1MMNA 4CBEA 2LD6A 2CYDA 2OU6A 3GWLA 4OD5A 5COMA 1VLTA 4EKWA 3B0VC 2LCHA 3KYJA 3WODF 4JW1A 4BJ6C 1V55C 3I5PA 3RFYA 5COFA 1G8XA 2LFFA 3JYHA 4DVZA 3N2ZB 4LLEA 2L6HA 2XXAA 4I1MA 4EHPA 3FAPB 2VB6A 1QLEC 4CDYA 3RW0A 4JJFA 3EQLF 4JRZA 1APCA 1T6QA 1H6GA 2KGOA 4MQ9F 3ZSUA 1E84A 4C7OA 1JMWA 4AE4B 4XPXA 1FFTC 2L6FA 2ZXPA 2XM0A 3TOMA 3C63A 3FXHA 4J30B 1T01A 4ZLCA 2O9XA 3ZWIA 4Z9HA 3AQCA 2DYRC 2Y3BA 3Q6NA 1SZIA 1VOMA 3H2VA 3LNRA 3MFNA 1B68A 4RD9A 3DM9B 3FVYA 3LLIA 3V5YA 2IBFA 2Q3TA 3ZVRA 2ZXOA 1NZEA 2Q9BA 2YKZA 1AUEA 4B6IA 3EGXA 3T4RA 1TFOB 1WATA 3FMSA 2KQ9A 3GANA 4J7TA 3UR3C 3MLGA 3OA1A 4XEKA 1YAUO 3R2PA 2UUHA 4JKVA 3M4CA 3T6JA 4EBKA 1K40A 3CZ6A 3OEOA 4RDAA 2BL2A 4PACA 1UFBA 3JTLO 3SZRA 3JRTA 1J8MF 3W8HA 4MVQA 3Q6MA 3M79A 1QKRA 1TQGA 2ZPAA 2ETSA 3LESA 2KYHA 2YVKA 5F5FA 2WB7A 2WZGA 2KJGA 3GWNA 1EQ1A 1RJ9B 3TK0A 2NUPA 4MW8A 2X51A 3JYYA 2MYSA 4JTAB 1O87A 3ZQVA 5KYYA 2VC9A 3KKBA 1A0BA 2DB4A 2J9WA 1MMAA 2QY9A 4U5EE 4IB4A 3UGOA 2UUIA 1W2WA 3H2UA 3S27A 3B0PA 5KYWB 1M2OA 3E9VA 4NTFA 3AG3C 4M63A 3MYIA 1TKNA 1ZHZA 2NSFA 1XZPA 2ZXRA 5E2QA 1CGOA 1WTYA 1LS1A 3DE8A 1L7CA 4CS8A 1MQVA 4PR9A 5AC4A 5T1DB 3JZ0A 1G5ZA 3ZC4A 4ER9A 2VCBA 3NYJA 1H7IA 4N06A 4GQHA 1OW7A 3RVZA 4CS8C 3EZHA 4N4WA 5CI8A 3U0CA 1C03A 5B3SC 4ULWA 2L6GA 1PD1A 4O6NA 3ATPA 3WG7C 4A4AA 2J46A 3C8GB 4Z9IA 4EBBA 3EHNA 4E7SA 1YYXA 4DRIB 2NG1A 2CDQA 2QTVA 1MNEA 2A0BA 1EKYA 1OR3A 3S90A 1ZYRF 1SF8A 2HUJA 1LE2A 1OCRC 1T6IA 2HMQA 4P9FA 1JPJA 2OJED 1BBHA 3EGDB 3PMRA 256BA 3W8IA 3ZTZA 2GA0A 5JRAA 3M4BA 4G7OF 1PV3A 2C04A 2YL0A 3IQTA 5L3QA 1V4AA 4YL1A 3DMDA 1FAPB 3MBGA 1RKEB 4J7YA 1Q0FA 2OQMA 4KBLA 5B1BC 3B0UX 1RXQA 4MVRA 2IOQA 1U0BB 1D0YA 4PFOA 3ZIBA 4NC3A 5L0DA 2HMZA 2R03A 3TULA 1O3UA 2E87A 2R7QA 2Y69C 2WVOA 3NYMA 4HEAJ 1Q0GA 4YN0B 3S29A 4XTKA 1QVXA 3H65A 4U5HA 1T5OA 1OXBA 2AWYA 3NKEA 1V74B 4GEHA 1A7EA 1Y4CA 2H7BA 2B0HA 3T6GB 4I1OB 3U3BA 3G4ZA 3UMIA 4NY3A 4NTBA 5A6KA 3GORA 1S05A 3VRCA 1PCXA 2OEXA 2J9VA 3FOPA 3RYLA 3X2QC 4LDQA 2FAPB 3EZIA 3JSZA 4G7ZF 3JSEO 3U2LA 3A9CA 4KC9A 2EINC 1LS4A 1M57C 4ULVA 2LFDA 4CIPA 4CJGA 2NUTB 2XRHA 1RKCA 3C62A 3KYIA 4FX5A 5KYUA 2EILC 2MWQA 3AQBA 3WHNA 4ZLDA 3RF3A 1H9TA 4MVSA 3UGPA 1MMDA 4YT2A 2XL6A 4H54A 2NSGA 2W4MA 1LI5A 4E7ZA 4MVUA 3SXKA 2A0UA 3HLZA 2A6HF 3DWWA 2P0NA 4PK4A 4XEVA 1ZVZA 1JOGA 1FMVA 5A69A 4U5FE 4J32B 4LDRA 1TR2A 5T3TA 2YZSA 4Q7CA 3HNJA 5KYXB 4JJGA 2OKUA 3F46A 1LKXA 5CIVA 2LP4A 3LS1A 3SEOA 2W45A 3EG9A 2VCCA 3RVYA 3U9MA 4DXWA 2LSEA 2A6EF 5CI9A 3ABLC 2OOCA 3QW0A 1F1MA 4P9TA 3K1IA 2Y39A 4HE8D 1VMAA 2KSFA 4YJWA 5FZTA 3TD7A 5EGYA 2KW3C 2EPLX 2PFDA 1E85A 5JS5A 2R7RA 4CS9A 4Q4ZF
chains in the Genus database with same CATH topology
1RCPA 2XLDA 2XL8A 3QW1A 2YLDA 4CX9A 1A7VA 1M6TA 3ZQVA 3HNKA 4IB4A 2YLGA 1QQ3A 5AGFA 3U8PA 4N6HA 3DE9A 1CGOA 3DE8A 4JE9A 1CPQA 1MQVA 1YYJA 2XLEA 4ER9A 4IARA 5JT4A 4U9DA 1E83A 2XLMA 3NMJA 3QVZA 4N4WA 2BC5A 1LM3B 3L1MA 2XLOA 4WGZA 3ZTMA 1E86A 1YYXA 2YL1A 2YLIA 1EKYA 2YL3A 4EIYA 2CCYA 4U9EA 1BBHA 3M15A 256BA 3FOOA 5B3IA 3ZTZA 2XLHA 5JRAA 3M4BA 2YL0A 4CDAA 2XLVA 3NMIA 4WGYA 3HNLA 1NBBA 4NC3A 3IQ6A 2YL7A 4CDVA 1YZAA 1CPRA 3NMKA 5JLIA 1GQAA 4L6RA 5JVEA 3TOLA 5JSLA 3QVYA 4D4NA 1S05A 3VRCA 4IAQA 3FOPA 2XLWA 5JUAA 4CDYA 4ULVA 4CIPA 4CJGA 1APCA 3C62A 1E84A 4JEAA 2J9BA 3ZQYA 4JEBA 2XM0A 2XL6A 3C63A 3TOMA 3IQ5A 3ZWIA 2J8WA 4CJOA 1YZCA 3HNJA 1QPUA 2YKZA 1CGNA 2XM4A 5JP7A 2QLAA 3HNIA 3QW0A 3M4CA 4JKVA 1JAFA 1E85A 4D4XA 5JS5A 3M79A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RCP A;  2XLD A;  2XL8 A;  3QW1 A;  2YLD A;  4CX9 A;  1A7V A;  1M6T A;  3ZQV A;  3HNK A;  4IB4 A;  2YLG A;  1QQ3 A;  5AGF A;  3U8P A;  4N6H A;  3DE9 A;  1CGO A;  3DE8 A;  4JE9 A;  1CPQ A;  1MQV A;  1YYJ A;  2XLE A;  4ER9 A;  4IAR A;  5JT4 A;  4U9D A;  1E83 A;  2XLM A;  3NMJ A;  3QVZ A;  4N4W A;  2BC5 A;  1LM3 B;  3L1M A;  2XLO A;  4WGZ A;  3ZTM A;  1E86 A;  1YYX A;  2YL1 A;  2YLI A;  1EKY A;  2YL3 A;  4EIY A;  2CCY A;  4U9E A;  1BBH A;  3M15 A;  256B A;  3FOO A;  5B3I A;  3ZTZ A;  2XLH A;  5JRA A;  3M4B A;  2YL0 A;  4CDA A;  2XLV A;  3NMI A;  4WGY A;  3HNL A;  1NBB A;  4NC3 A;  3IQ6 A;  2YL7 A;  4CDV A;  1YZA A;  1CPR A;  3NMK A;  5JLI A;  1GQA A;  4L6R A;  5JVE A;  3TOL A;  5JSL A;  3QVY A;  4D4N A;  1S05 A;  3VRC A;  4IAQ A;  3FOP A;  2XLW A;  5JUA A;  4CDY A;  4ULV A;  4CIP A;  4CJG A;  1APC A;  3C62 A;  1E84 A;  4JEA A;  2J9B A;  3ZQY A;  4JEB A;  2XM0 A;  2XL6 A;  3C63 A;  3TOM A;  3IQ5 A;  3ZWI A;  2J8W A;  4CJO A;  1YZC A;  3HNJ A;  1QPU A;  2YKZ A;  1CGN A;  2XM4 A;  5JP7 A;  2QLA A;  3HNI A;  3QW0 A;  3M4C A;  4JKV A;  1JAF A;  1E85 A;  4D4X A;  5JS5 A;  3M79 A; 
#chains in the Genus database with same CATH topology
 4MTF A;  1NSG B;  3VF0 A;  4DBQ A;  3R7C A;  3QW1 A;  3TJ6 A;  1D1A A;  3K1I C;  1ORY A;  5KYN A;  1M6T A;  3W2V A;  1L3P A;  1OCC C;  3S84 A;  4CS9 C;  2BE5 F;  3QTH A;  3QZC A;  2D4U A;  4JVS A;  4I44 A;  2F22 A;  3LEV A;  1HW2 A;  3UMK A;  4AX2 A;  3EFO B;  2R9R B;  3K1H A;  3K6B A;  3ZG1 A;  3BRJ A;  4AE4 A;  2KK1 A;  1LPE A;  2LIG A;  2V26 A;  2Y3G A;  3DM5 A;  3EPV A;  1OW8 A;  3LAY A;  4O6Y A;  5AGF A;  5COG A;  1A41 A;  2H7V C;  3DJU B;  1M2V B;  4N6H A;  3IQC A;  1AEP A;  2M64 A;  5FCL A;  2J0X A;  4MW3 A;  4W8P A;  1BZ4 A;  4LLC A;  4YWQ A;  3I4U A;  3SXM A;  1YYJ A;  2MHR A;  2XLE A;  4XLP F;  3M1C B;  5JT4 A;  3RH3 A;  3EJN A;  2LQG A;  2VAS A;  3I5Q A;  3G4X A;  1OQC A;  4O6M A;  1E83 A;  1YAR O;  2XLM A;  3NMJ A;  3BEH A;  3GEE A;  3T6B A;  3VM6 A;  2AWC A;  5D91 A;  3WAQ A;  5AC5 A;  4AL0 A;  3HTK C;  5TJ5 E;  1LE4 A;  5DLJ A;  1E86 A;  3JT1 A;  1DOW A;  4DJ9 A;  5L0F A;  5DS5 A;  2P6V A;  2J7P A;  4JUR I;  3GOD A;  2YEV A;  3O39 A;  3LLK A;  1ZHY A;  4W8K A;  4EIY A;  4EWC A;  1J8Y F;  3ASN C;  2HJ3 A;  2W9Y A;  3KPH A;  3W2W A;  4RBN A;  3U2M A;  3GM3 A;  1RJ9 A;  2J7P D;  4XLN F;  3NKD A;  1Z23 A;  1TWG A;  1OXK A;  3NDB B;  2WVN A;  4CDA A;  2R7U A;  2R02 A;  1UG7 A;  4WGY A;  4DVY P;  1TWH A;  1Z5Z A;  2QE9 A;  3V5X A;  1WGW A;  5E33 A;  3VAY A;  5DQZ A;  1OR2 A;  5KYW A;  2PBE A;  2YL7 A;  4JTC B;  4N6C A;  4U5B E;  4CDV A;  4AK9 A;  3NMK A;  2XSE A;  1EI7 A;  5JLI A;  3FHD A;  1VTM P;  1LI7 A;  2B0J A;  1HY5 A;  2EPM X;  1GQA A;  4QI2 A;  2HKV A;  2R7S A;  4EBJ A;  2H7O A;  4MVO A;  2Y3D A;  5JSL A;  3TOL A;  5JVE A;  4D4N A;  2HSB A;  2HJM A;  4IAQ A;  2JPU A;  4JCH A;  2P7V A;  2J9U A;  3EHM A;  3L0I A;  4XQ1 A;  3Q7L A;  3IPM O;  4NTA A;  5JUA A;  1YDI A;  3DXJ F;  4HFF B;  3DD7 A;  3HKK A;  4CSA A;  1HMD A;  3K66 A;  3RQE A;  3UMH A;  4BPM A;  1Y6D A;  3AG2 C;  4C3E A;  5EHH A;  3AG1 C;  1JPN A;  3C8G A;  4IRU A;  2EPK X;  3NYL A;  4JEA A;  4P6I C;  3ZQY A;  1MND A;  3ABK C;  4YL0 A;  2GAQ A;  3VYW A;  3IQ5 A;  4UDV A;  4BEM J;  5A6A A;  4MVM A;  3C8G D;  2R7V A;  1JR8 A;  1HW1 A;  3EGD A;  4E18 A;  1Z3I X;  3GEI A;  2G62 A;  2GWW A;  3ZDL A;  1BR2 A;  4JTD B;  5DS6 A;  4A2N B;  4OIN F;  3KL4 A;  2ASR A;  2CGE A;  1NLX A;  3JRM O;  1QPU A;  1AVO B;  1I4Y A;  1RKE A;  1SMY F;  5A6B A;  1BDJ B;  1G4W R;  4MTO A;  5HV9 A;  3NG1 A;  3ASO C;  3KH2 A;  2EPO A;  4IAO A;  5JP7 A;  4OIQ F;  2QLA A;  3HNI A;  2R7T A;  1VK5 A;  3SXZ A;  3EH2 A;  1A7D A;  3DZA A;  1ZW2 A;  3HJC A;  4FES A;  5BQH A;  5A6B D;  2RD9 A;  1IW7 F;  2IM8 A;  3IHU A;  5L0H A;  3O55 A;  1RMV A;  1JAF A;  2XS1 A;  4PJJ A;  4YL3 A;  4BJ1 A;  4DOZ A;  1D0X A;  3C18 A;  2XL4 A;  1FNT c;  2XLD A;  2YLD A;  1YJG A;  4AL1 A;  1A7V A;  3L8J A;  3CQZ A;  5E3C A;  1ZHX A;  2QUP A;  4C3B A;  2HV7 A;  5BQG A;  4K7B A;  2WZF A;  2R7W A;  2TMV P;  1OCZ C;  4YK5 A;  3N24 A;  2PX3 A;  5DQT A;  2NUT A;  3U9J A;  4X0R A;  3HNK A;  1NU9 C;  1Z63 A;  2RSE B;  3ITF A;  4CS7 A;  1Q0K A;  2YHS A;  4JZA A;  2HSQ A;  3U5S A;  4E0H A;  2YQY A;  4KI2 A;  1EA8 A;  3DJN B;  1C17 M;  3DE9 A;  3LNM B;  3ECS A;  1ZHW A;  3RKO F;  2NPU A;  4JE9 A;  1CPQ A;  4H4K C;  1ZW3 A;  1D1C A;  5KYX A;  1E2X A;  3LEO A;  4IAR A;  3RQF A;  4U9D A;  4ONS A;  1WOL A;  4PJL A;  5IY5 C;  3V5Z A;  3Q7G A;  3O6X A;  3GM2 A;  4DBR A;  2EIJ C;  2R7X A;  2Q00 A;  4LDK A;  2XXA B;  2G3K A;  3C7J A;  4YT8 A;  1GS9 A;  1JRA A;  1ZU4 A;  4BJ6 A;  4MTG A;  4OD4 A;  1LM3 B;  3L1M A;  1R5I D;  1HE9 A;  4WGZ A;  4LER A;  5DVW A;  3OWT A;  5L0I A;  1QSP A;  4C7O B;  3T9O A;  3F47 A;  2XS8 A;  2YL1 A;  2YLI A;  1Z7Q c;  1KNY A;  2Q9A A;  4OIP F;  1NG1 A;  2R05 A;  4Q5S F;  4U5D E;  1D1B A;  1OKK A;  2CCY A;  2Q9C A;  1U6H A;  3FOO A;  1ST6 A;  2XLH A;  4I3M A;  2VH3 A;  5E3A A;  3B9Q A;  2OJQ A;  1T6U A;  3DKA A;  1I4Z A;  1OKK D;  1YA9 A;  2W4B A;  3EFO A;  3NMI A;  5L0J A;  3EGX B;  4FAP B;  1NBB A;  2I15 A;  1GM5 A;  3AG4 C;  4DRJ B;  2GDC A;  4OIR F;  3C8Z A;  4JCZ A;  1VB5 A;  1ZZP A;  1M2V A;  2H8A A;  4YT5 A;  2FFH A;  3K33 A;  1MMG A;  2V3C C;  2KNH A;  2IXP A;  1HMO A;  2KC3 A;  4LAC B;  4L6R A;  2M4E A;  3QVY A;  1FFH A;  4KNV A;  5L3V A;  1FTS A;  3S9O A;  5HSW A;  3B29 A;  3G50 A;  1YVI A;  1R4T A;  1KU2 A;  4Z9J A;  2NUP B;  2XLW A;  5GPG B;  5DS4 A;  2P1A A;  2LK4 A;  1LIH A;  4U5G A;  3DAG A;  5T3W A;  1NU7 D;  3U3F A;  4NQF A;  1Q0D A;  5KYY B;  1VYI A;  1VLS A;  3QMK A;  1FMW A;  2IXN A;  4BJ5 A;  1OCO C;  2J45 A;  2J9B A;  2ZD9 A;  4O7G A;  2CW0 F;  1TWC A;  4FWV A;  4JEB A;  2L81 A;  3KMI A;  4XPW A;  1S7Z A;  2I8B A;  4BG0 A;  2IXM A;  1G4U S;  2A69 F;  1HE1 A;  2IXO A;  1YA7 O;  3L34 A;  1K05 A;  3GEH A;  4BJ5 C;  1V54 C;  2J8W A;  3JCU Q;  4CJO A;  3MX3 A;  2Y3H A;  1YZC A;  4QI0 A;  4PJN A;  1FR0 A;  4EUK B;  2L7A A;  3O10 A;  3V7O A;  2X0C A;  3TQO A;  1CGN A;  1T9K A;  2EPN A;  3S28 A;  3CSK A;  5L0C A;  3POV A;  2XM4 A;  1WWP A;  4U5C E;  4C3D A;  1I5N A;  2OCC C;  3X1O A;  5F5H A;  5A6J A;  1VYK A;  3AGU A;  3L8I A;  2J0W A;  5L0G A;  2C03 A;  4G7H F;  2HV6 A;  4O79 A;  4E0I A;  1ZHT A;  1O5H A;  2A1D D;  2WL8 A;  1TFK B;  4D4X A;  1DOV A;  1KTM A;  3CEX A;  1TWA A;  3AOU A;  1PD0 A;  1RCP A;  1SYQ A;  1D0Z A;  1WN0 A;  3LS0 A;  4PFP A;  4MVZ A;  4K0D A;  2XL8 A;  4K1O A;  1XZQ A;  4XPY A;  4CX9 A;  4E17 A;  4PJM A;  3PDM P;  4CSA C;  4HFK B;  3RIP A;  4OIO F;  4KNW A;  1K04 A;  3NRH A;  3U8V A;  3MYF A;  1ORJ A;  3SNH A;  4YT4 A;  2ICW G;  5EK0 A;  2WVQ A;  2JD3 A;  4MS2 A;  1ZU5 A;  3RQG A;  4F4B A;  1NFN A;  2P61 A;  2HS5 A;  2EIK C;  2YLG A;  4R32 A;  4XWJ A;  1QQ3 A;  2Q7R A;  3SP1 A;  3U8P A;  2A68 F;  1Z6A A;  1LVK A;  1QZX A;  2D5R B;  2HZ8 A;  3A11 A;  4NCQ A;  3S0X A;  1H9G A;  2EIM C;  5F28 E;  4JIO A;  1SR2 A;  2ZXW C;  4BEJ A;  2L9J A;  3AJM A;  4GYT A;  3SXY A;  3W4Y A;  3N0T A;  2GFH A;  2JX0 A;  1XWJ A;  4JC7 A;  2IYL D;  5D92 A;  1YLM A;  2FGY A;  4ANJ A;  1CGM E;  3DI5 A;  2HFI A;  1C02 A;  3E70 C;  2AU5 A;  4CIH A;  2YRF A;  3PCV A;  4DRH B;  3QVZ A;  3GM1 A;  1NFO A;  4WJ0 A;  3FDQ A;  2DYS C;  2BC5 A;  1IZM A;  3LUT B;  4IGG A;  5BQI A;  2OG2 A;  3AGT A;  2XLO A;  3ZTM A;  3B71 A;  2OEV A;  4G0H A;  2PNO A;  3UNG C;  3ABM C;  1Q0M A;  1OW6 A;  5KYU B;  3PHF 2;  4WAB A;  4XEF A;  3LJB A;  3J06 A;  5B1A C;  2YL3 A;  4QDL A;  1BR1 A;  2QNL A;  2VCA A;  2WZL A;  4IWB A;  2AVK A;  3CAX A;  2YWA A;  4U9E A;  2R7O A;  3US6 A;  2CNW A;  2PP4 A;  2PX0 A;  2Q4F A;  3M15 A;  1GGQ A;  5B3I A;  2PF4 E;  5K0I A;  3K7D A;  1ORS C;  2XLV A;  2DI3 A;  3FAJ A;  3DAF A;  2AP3 A;  2CNW D;  1N1C A;  3TJ5 A;  1M56 C;  1WAS A;  2R25 A;  3EH1 A;  3IEE A;  3HNL A;  3SYN A;  3IQ6 A;  3EG9 B;  1YZA A;  2G3V A;  2Z15 A;  1CPR A;  1BR4 A;  4IJJ A;  4BJT A;  1U89 A;  5BUO A;  2DGJ A;  4G78 A;  4MND A;  1MMN A;  4CBE A;  2LD6 A;  2CYD A;  2OU6 A;  3GWL A;  4OD5 A;  5COM A;  1VLT A;  4EKW A;  3B0V C;  2LCH A;  3KYJ A;  3WOD F;  4JW1 A;  4BJ6 C;  1V55 C;  3I5P A;  3RFY A;  5COF A;  1G8X A;  2LFF A;  3JYH A;  4DVZ A;  3N2Z B;  4LLE A;  2L6H A;  2XXA A;  4I1M A;  4EHP A;  3FAP B;  2VB6 A;  1QLE C;  4CDY A;  3RW0 A;  4JJF A;  3EQL F;  4JRZ A;  1APC A;  1T6Q A;  1H6G A;  2KGO A;  4MQ9 F;  3ZSU A;  1E84 A;  4C7O A;  1JMW A;  4AE4 B;  4XPX A;  1FFT C;  2L6F A;  2ZXP A;  2XM0 A;  3TOM A;  3C63 A;  3FXH A;  4J30 B;  1T01 A;  4ZLC A;  2O9X A;  3ZWI A;  4Z9H A;  3AQC A;  2DYR C;  2Y3B A;  3Q6N A;  1SZI A;  1VOM A;  3H2V A;  3LNR A;  3MFN A;  1B68 A;  4RD9 A;  3DM9 B;  3FVY A;  3LLI A;  3V5Y A;  2IBF A;  2Q3T A;  3ZVR A;  2ZXO A;  1NZE A;  2Q9B A;  2YKZ A;  1AUE A;  4B6I A;  3EGX A;  3T4R A;  1TFO B;  1WAT A;  3FMS A;  2KQ9 A;  3GAN A;  4J7T A;  3UR3 C;  3MLG A;  3OA1 A;  4XEK A;  1YAU O;  3R2P A;  2UUH A;  4JKV A;  3M4C A;  3T6J A;  4EBK A;  1K40 A;  3CZ6 A;  3OEO A;  4RDA A;  2BL2 A;  4PAC A;  1UFB A;  3JTL O;  3SZR A;  3JRT A;  1J8M F;  3W8H A;  4MVQ A;  3Q6M A;  3M79 A;  1QKR A;  1TQG A;  2ZPA A;  2ETS A;  3LES A;  2KYH A;  2YVK A;  5F5F A;  2WB7 A;  2WZG A;  2KJG A;  3GWN A;  1EQ1 A;  1RJ9 B;  3TK0 A;  2NUP A;  4MW8 A;  2X51 A;  3JYY A;  2MYS A;  4JTA B;  1O87 A;  3ZQV A;  5KYY A;  2VC9 A;  3KKB A;  1A0B A;  2DB4 A;  2J9W A;  1MMA A;  2QY9 A;  4U5E E;  4IB4 A;  3UGO A;  2UUI A;  1W2W A;  3H2U A;  3S27 A;  3B0P A;  5KYW B;  1M2O A;  3E9V A;  4NTF A;  3AG3 C;  4M63 A;  3MYI A;  1TKN A;  1ZHZ A;  2NSF A;  1XZP A;  2ZXR A;  5E2Q A;  1CGO A;  1WTY A;  1LS1 A;  3DE8 A;  1L7C A;  4CS8 A;  1MQV A;  4PR9 A;  5AC4 A;  5T1D B;  3JZ0 A;  1G5Z A;  3ZC4 A;  4ER9 A;  2VCB A;  3NYJ A;  1H7I A;  4N06 A;  4GQH A;  1OW7 A;  3RVZ A;  4CS8 C;  3EZH A;  4N4W A;  5CI8 A;  3U0C A;  1C03 A;  5B3S C;  4ULW A;  2L6G A;  1PD1 A;  4O6N A;  3ATP A;  3WG7 C;  4A4A A;  2J46 A;  3C8G B;  4Z9I A;  4EBB A;  3EHN A;  4E7S A;  1YYX A;  4DRI B;  2NG1 A;  2CDQ A;  2QTV A;  1MNE A;  2A0B A;  1EKY A;  1OR3 A;  3S90 A;  1ZYR F;  1SF8 A;  2HUJ A;  1LE2 A;  1OCR C;  1T6I A;  2HMQ A;  4P9F A;  1JPJ A;  2OJE D;  1BBH A;  3EGD B;  3PMR A;  256B A;  3W8I A;  3ZTZ A;  2GA0 A;  5JRA A;  3M4B A;  4G7O F;  1PV3 A;  2C04 A;  2YL0 A;  3IQT A;  5L3Q A;  1V4A A;  4YL1 A;  3DMD A;  1FAP B;  3MBG A;  1RKE B;  4J7Y A;  1Q0F A;  2OQM A;  4KBL A;  5B1B C;  3B0U X;  1RXQ A;  4MVR A;  2IOQ A;  1U0B B;  1D0Y A;  4PFO A;  3ZIB A;  4NC3 A;  5L0D A;  2HMZ A;  2R03 A;  3TUL A;  1O3U A;  2E87 A;  2R7Q A;  2Y69 C;  2WVO A;  3NYM A;  4HEA J;  1Q0G A;  4YN0 B;  3S29 A;  4XTK A;  1QVX A;  3H65 A;  4U5H A;  1T5O A;  1OXB A;  2AWY A;  3NKE A;  1V74 B;  4GEH A;  1A7E A;  1Y4C A;  2H7B A;  2B0H A;  3T6G B;  4I1O B;  3U3B A;  3G4Z A;  3UMI A;  4NY3 A;  4NTB A;  5A6K A;  3GOR A;  1S05 A;  3VRC A;  1PCX A;  2OEX A;  2J9V A;  3FOP A;  3RYL A;  3X2Q C;  4LDQ A;  2FAP B;  3EZI A;  3JSZ A;  4G7Z F;  3JSE O;  3U2L A;  3A9C A;  4KC9 A;  2EIN C;  1LS4 A;  1M57 C;  4ULV A;  2LFD A;  4CIP A;  4CJG A;  2NUT B;  2XRH A;  1RKC A;  3C62 A;  3KYI A;  4FX5 A;  5KYU A;  2EIL C;  2MWQ A;  3AQB A;  3WHN A;  4ZLD A;  3RF3 A;  1H9T A;  4MVS A;  3UGP A;  1MMD A;  4YT2 A;  2XL6 A;  4H54 A;  2NSG A;  2W4M A;  1LI5 A;  4E7Z A;  4MVU A;  3SXK A;  2A0U A;  3HLZ A;  2A6H F;  3DWW A;  2P0N A;  4PK4 A;  4XEV A;  1ZVZ A;  1JOG A;  1FMV A;  5A69 A;  4U5F E;  4J32 B;  4LDR A;  1TR2 A;  5T3T A;  2YZS A;  4Q7C A;  3HNJ A;  5KYX B;  4JJG A;  2OKU A;  3F46 A;  1LKX A;  5CIV A;  2LP4 A;  3LS1 A;  3SEO A;  2W45 A;  3EG9 A;  2VCC A;  3RVY A;  3U9M A;  4DXW A;  2LSE A;  2A6E F;  5CI9 A;  3ABL C;  2OOC A;  3QW0 A;  1F1M A;  4P9T A;  3K1I A;  2Y39 A;  4HE8 D;  1VMA A;  2KSF A;  4YJW A;  5FZT A;  3TD7 A;  5EGY A;  2KW3 C;  2EPL X;  2PFD A;  1E85 A;  5JS5 A;  2R7R A;  4CS9 A;  4Q4Z F; 
#chains in the Genus database with same CATH homology
 1RCP A;  2XLD A;  2XL8 A;  3QW1 A;  2YLD A;  4CX9 A;  1A7V A;  1M6T A;  3ZQV A;  3HNK A;  4IB4 A;  2YLG A;  1QQ3 A;  5AGF A;  3U8P A;  4N6H A;  3DE9 A;  1CGO A;  3DE8 A;  4JE9 A;  1CPQ A;  1MQV A;  1YYJ A;  2XLE A;  4ER9 A;  4IAR A;  5JT4 A;  4U9D A;  1E83 A;  2XLM A;  3NMJ A;  3QVZ A;  4N4W A;  2BC5 A;  1LM3 B;  3L1M A;  2XLO A;  4WGZ A;  3ZTM A;  1E86 A;  1YYX A;  2YL1 A;  2YLI A;  1EKY A;  2YL3 A;  4EIY A;  2CCY A;  4U9E A;  1BBH A;  3M15 A;  256B A;  3FOO A;  5B3I A;  3ZTZ A;  2XLH A;  5JRA A;  3M4B A;  2YL0 A;  4CDA A;  2XLV A;  3NMI A;  4WGY A;  3HNL A;  1NBB A;  4NC3 A;  3IQ6 A;  2YL7 A;  4CDV A;  1YZA A;  1CPR A;  3NMK A;  5JLI A;  1GQA A;  4L6R A;  5JVE A;  3TOL A;  5JSL A;  3QVY A;  4D4N A;  1S05 A;  3VRC A;  4IAQ A;  3FOP A;  2XLW A;  5JUA A;  4CDY A;  4ULV A;  4CIP A;  4CJG A;  1APC A;  3C62 A;  1E84 A;  4JEA A;  2J9B A;  3ZQY A;  4JEB A;  2XM0 A;  2XL6 A;  3C63 A;  3TOM A;  3IQ5 A;  3ZWI A;  2J8W A;  4CJO A;  1YZC A;  3HNJ A;  1QPU A;  2YKZ A;  1CGN A;  2XM4 A;  5JP7 A;  2QLA A;  3HNI A;  3QW0 A;  3M4C A;  4JKV A;  1JAF A;  1E85 A;  4D4X A;  5JS5 A;  3M79 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...