2J91A

Crystal structure of human adenylosuccinate lyase in complex with amp
Total Genus 182
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
182
sequence length
470
structure length
457
Chain Sequence
b'GDHGSPDSYRSPLASRYASPEMCFVFSDRYKFRTWRQLWLWLAEAEQTLGLPITDEQIREMKSNLENIDFKMAAEEEKRLRHDVMAHVHTFGHCCPKAAGIIHLGATSCYVGDNTDLIILRNALDLLLPKLARVISRLADFAKERASLPTLGFTHFQPAQLTTVGKRCCLWIQDLCMDLQNLKRVRDDLRFRGVKGTTGTQASFLQLFEGDDHKVEQLDKMVTEKAGFKRAFIITGQTYTRKVDIEVLSVLASLGASVHKICTDIRLLANLKEMEEPFYKRNPMRSERCCSLARHLMTLVMDPLQTASVQWFERTLDDSANRRICLAEAFLTADTILNTLQNISEGLVVYPKVIERRIRQELPFMATENIIMAMVGGSRQDCHEKIRVLSQQAASVVKQEGGDNDLIERIQVDAYFSPIHSQLDHLLDPSSFTGRASQQVQRFLEEEVYPLLKPYES'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADENYLOSUCCINATE LYASE
publication title Crystal Structure of Human Adenylosuccinate Lyase
rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 182
structure length 457
sequence length 470
chains with identical sequence B, C, D
ec nomenclature ec 4.3.2.2: Adenylosuccinate lyase.
pdb deposition date 2006-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00206 Lyase_1 Lyase
A PF10397 ADSL_C Adenylosuccinate lyase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.275.10 Mainly Alpha Orthogonal Bundle Fumarase C; Chain B, domain 1 Fumarase/aspartase (N-terminal domain) 2j91A01
1.20.200.10 Mainly Alpha Up-down Bundle Fumarase C; Chain A, domain 2 Fumarase/aspartase (Central domain) 2j91A02
2PTQA 3OCFA 3QBPA 4MX2A 2O6YA 1KQ7A 3C8TA 4NSLA 5EYTA 4V2QA 1RE5A 1C3UA 4CQ5A 1K7WA 4ADLA 1W27A 4HGVA 4NLEA 1YISA 1FUOA 3R6QA 4BABA 4APAA 3CZOA 1VDKA 2FUSA 1DCNA 2PTRA 4ADMA 5F92A 1J3UA 3E04A 1K62A 4FLCA 3R6VA 1C3CA 1I0AA 4EEIA 3UNVA 1T6JA 1T6PA 2QVEA 2PFMA 4BAAA 1TJWA 4EFCA 1GK3A 3GZHA 4C5SA 1JSWA 3KDYA 3R6YA 3OCEA 4C5RA 1EB4A 4V2RA 3BHGA 1FUQA 1U15A 1HY1A 3RRPA 1YFEA 2PTSA 2RJRA 5EYVA 2QGAB 1XWOA 2OHYA 2RJSA 4APBA 2E9FA 3RD8A 1HY0A 3TV2A 1Y2MA 5D6BA 5HW2A 1FUPA 3NZ4A 2NYFA 3NO9A 2O78A 1TJ7A 1TJVA 1B8FA 4FFXA 4C5UA 1YFMA 2O7DA 1GKJA 1DOFA 3KDZA 1GKMA 3GTDA 1U16A 2NYNA 2O7FA 2O7EA 2YIIA 1AUWA 1FURA 2O7BA 2X75A 5F91A 1GK2A 2J91A 2VD6A 2HVGA 4C6GA 1Q5NA 1TJUA
chains in the Genus database with same CATH superfamily
2PTQA 3OCFA 3QBPA 4MX2A 2O6YA 1KQ7A 3C8TA 4NSLA 5EYTA 4V2QA 1RE5A 1C3UA 2FELA 1XMCA 4CQ5A 1K7WA 4ADLA 1W27A 4HGVA 4NLEA 1YISA 1FUOA 3R6QA 4WNLA 4BABA 4APAA 3CZOA 1VDKA 2FUSA 1DCNA 1XL7A 2PTRA 4ADMA 5F92A 2VL7A 5M0IA 1J3UA 3CRVA 3E04A 1K62A 4FLCA 3R6VA 1C3CA 1I0AA 3CRW1 4EEIA 3UNVA 1T6JA 1T6PA 2QVEA 2PFMA 4BAAA 1TJWA 4EFCA 1GK3A 4A15A 3GZHA 4C5SA 1JSWA 3KDYA 3R6YA 3OCEA 4C5RA 1EB4A 4V2RA 3BHGA 1FUQA 5H8WA 1U15A 1HY1A 3RRPA 1YFEA 2PTSA 2RJRA 5EYVA 2QGAB 1XL8A 1XWOA 2OHYA 2RJSA 4APBA 1XLYA 2E9FA 3RD8A 1HY0A 3TV2A 1Y2MA 5D6BA 5HW2A 1FUPA 3NZ4A 2FENA 2NYFA 3NO9A 2O78A 1TJ7A 2VSFA 1TJVA 1B8FA 4FFXA 4C5UA 1YFMA 2O7DA 1GKJA 1DOFA 3KDZA 1GKMA 3GTDA 5M0JA 1U16A 1XMDA 2NYNA 2O7FA 2O7EA 2YIIA 1AUWA 1FURA 2O7BA 2X75A 5F91A 1GK2A 2J91A 2VD6A 2HVGA 4C6GA 1Q5NA 1TJUA
chains in the Genus database with same CATH topology
2PTQA 3OCFA 3QBPA 4MX2A 2O6YA 1KQ7A 3C8TA 4NSLA 5EYTA 4V2QA 1RE5A 1C3UA 4CQ5A 1K7WA 4ADLA 1W27A 4HGVA 4NLEA 1YISA 1FUOA 3R6QA 4BABA 4APAA 3CZOA 1VDKA 2FUSA 1DCNA 2PTRA 4ADMA 5F92A 1J3UA 3E04A 1K62A 4FLCA 3R6VA 1C3CA 1I0AA 4EEIA 3UNVA 1T6JA 1T6PA 2QVEA 2PFMA 4BAAA 1TJWA 4EFCA 1GK3A 3GZHA 4C5SA 1JSWA 3KDYA 3R6YA 3OCEA 4C5RA 1EB4A 4V2RA 3BHGA 1FUQA 1U15A 1HY1A 3RRPA 1YFEA 2PTSA 2RJRA 5EYVA 2QGAB 1XWOA 2OHYA 2RJSA 4APBA 2E9FA 3RD8A 1HY0A 3TV2A 1Y2MA 5D6BA 5HW2A 1FUPA 3NZ4A 2NYFA 3NO9A 2O78A 1TJ7A 1TJVA 1B8FA 4FFXA 4C5UA 1YFMA 2O7DA 1GKJA 1DOFA 3KDZA 1GKMA 3GTDA 1U16A 2NYNA 2O7FA 2O7EA 2YIIA 1AUWA 1FURA 2O7BA 2X75A 5F91A 1GK2A 2J91A 2VD6A 2HVGA 4C6GA 1Q5NA 1TJUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PTQ A;  3OCF A;  3QBP A;  4MX2 A;  2O6Y A;  1KQ7 A;  3C8T A;  4NSL A;  5EYT A;  4V2Q A;  1RE5 A;  1C3U A;  4CQ5 A;  1K7W A;  4ADL A;  1W27 A;  4HGV A;  4NLE A;  1YIS A;  1FUO A;  3R6Q A;  4BAB A;  4APA A;  3CZO A;  1VDK A;  2FUS A;  1DCN A;  2PTR A;  4ADM A;  5F92 A;  1J3U A;  3E04 A;  1K62 A;  4FLC A;  3R6V A;  1C3C A;  1I0A A;  4EEI A;  3UNV A;  1T6J A;  1T6P A;  2QVE A;  2PFM A;  4BAA A;  1TJW A;  4EFC A;  1GK3 A;  3GZH A;  4C5S A;  1JSW A;  3KDY A;  3R6Y A;  3OCE A;  4C5R A;  1EB4 A;  4V2R A;  3BHG A;  1FUQ A;  1U15 A;  1HY1 A;  3RRP A;  1YFE A;  2PTS A;  2RJR A;  5EYV A;  2QGA B;  1XWO A;  2OHY A;  2RJS A;  4APB A;  2E9F A;  3RD8 A;  1HY0 A;  3TV2 A;  1Y2M A;  5D6B A;  5HW2 A;  1FUP A;  3NZ4 A;  2NYF A;  3NO9 A;  2O78 A;  1TJ7 A;  1TJV A;  1B8F A;  4FFX A;  4C5U A;  1YFM A;  2O7D A;  1GKJ A;  1DOF A;  3KDZ A;  1GKM A;  3GTD A;  1U16 A;  2NYN A;  2O7F A;  2O7E A;  2YII A;  1AUW A;  1FUR A;  2O7B A;  2X75 A;  5F91 A;  1GK2 A;  2J91 A;  2VD6 A;  2HVG A;  4C6G A;  1Q5N A;  1TJU A; 
#chains in the Genus database with same CATH topology
 2PTQ A;  3OCF A;  3QBP A;  4MX2 A;  2O6Y A;  1KQ7 A;  3C8T A;  4NSL A;  5EYT A;  4V2Q A;  1RE5 A;  1C3U A;  2FEL A;  1XMC A;  4CQ5 A;  1K7W A;  4ADL A;  1W27 A;  4HGV A;  4NLE A;  1YIS A;  1FUO A;  3R6Q A;  4WNL A;  4BAB A;  4APA A;  3CZO A;  1VDK A;  2FUS A;  1DCN A;  1XL7 A;  2PTR A;  4ADM A;  5F92 A;  2VL7 A;  5M0I A;  1J3U A;  3CRV A;  3E04 A;  1K62 A;  4FLC A;  3R6V A;  1C3C A;  1I0A A;  3CRW 1;  4EEI A;  3UNV A;  1T6J A;  1T6P A;  2QVE A;  2PFM A;  4BAA A;  1TJW A;  4EFC A;  1GK3 A;  4A15 A;  3GZH A;  4C5S A;  1JSW A;  3KDY A;  3R6Y A;  3OCE A;  4C5R A;  1EB4 A;  4V2R A;  3BHG A;  1FUQ A;  5H8W A;  1U15 A;  1HY1 A;  3RRP A;  1YFE A;  2PTS A;  2RJR A;  5EYV A;  2QGA B;  1XL8 A;  1XWO A;  2OHY A;  2RJS A;  4APB A;  1XLY A;  2E9F A;  3RD8 A;  1HY0 A;  3TV2 A;  1Y2M A;  5D6B A;  5HW2 A;  1FUP A;  3NZ4 A;  2FEN A;  2NYF A;  3NO9 A;  2O78 A;  1TJ7 A;  2VSF A;  1TJV A;  1B8F A;  4FFX A;  4C5U A;  1YFM A;  2O7D A;  1GKJ A;  1DOF A;  3KDZ A;  1GKM A;  3GTD A;  5M0J A;  1U16 A;  1XMD A;  2NYN A;  2O7F A;  2O7E A;  2YII A;  1AUW A;  1FUR A;  2O7B A;  2X75 A;  5F91 A;  1GK2 A;  2J91 A;  2VD6 A;  2HVG A;  4C6G A;  1Q5N A;  1TJU A; 
#chains in the Genus database with same CATH homology
 2PTQ A;  3OCF A;  3QBP A;  4MX2 A;  2O6Y A;  1KQ7 A;  3C8T A;  4NSL A;  5EYT A;  4V2Q A;  1RE5 A;  1C3U A;  4CQ5 A;  1K7W A;  4ADL A;  1W27 A;  4HGV A;  4NLE A;  1YIS A;  1FUO A;  3R6Q A;  4BAB A;  4APA A;  3CZO A;  1VDK A;  2FUS A;  1DCN A;  2PTR A;  4ADM A;  5F92 A;  1J3U A;  3E04 A;  1K62 A;  4FLC A;  3R6V A;  1C3C A;  1I0A A;  4EEI A;  3UNV A;  1T6J A;  1T6P A;  2QVE A;  2PFM A;  4BAA A;  1TJW A;  4EFC A;  1GK3 A;  3GZH A;  4C5S A;  1JSW A;  3KDY A;  3R6Y A;  3OCE A;  4C5R A;  1EB4 A;  4V2R A;  3BHG A;  1FUQ A;  1U15 A;  1HY1 A;  3RRP A;  1YFE A;  2PTS A;  2RJR A;  5EYV A;  2QGA B;  1XWO A;  2OHY A;  2RJS A;  4APB A;  2E9F A;  3RD8 A;  1HY0 A;  3TV2 A;  1Y2M A;  5D6B A;  5HW2 A;  1FUP A;  3NZ4 A;  2NYF A;  3NO9 A;  2O78 A;  1TJ7 A;  1TJV A;  1B8F A;  4FFX A;  4C5U A;  1YFM A;  2O7D A;  1GKJ A;  1DOF A;  3KDZ A;  1GKM A;  3GTD A;  1U16 A;  2NYN A;  2O7F A;  2O7E A;  2YII A;  1AUW A;  1FUR A;  2O7B A;  2X75 A;  5F91 A;  1GK2 A;  2J91 A;  2VD6 A;  2HVG A;  4C6G A;  1Q5N A;  1TJU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...