2J91A

Crystal structure of human adenylosuccinate lyase in complex with amp
Total Genus 182
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
182
sequence length
470
structure length
457
Chain Sequence
GDHGSPDSYRSPLASRYASPEMCFVFSDRYKFRTWRQLWLWLAEAEQTLGLPITDEQIREMKSNLENIDFKMAAEEEKRLRHDVMAHVHTFGHCCPKAAGIIHLGATSCYVGDNTDLIILRNALDLLLPKLARVISRLADFAKERASLPTLGFTHFQPAQLTTVGKRCCLWIQDLCMDLQNLKRVRDDLRFRGVKGTTGTQASFLQLFEGDDHKVEQLDKMVTEKAGFKRAFIITGQTYTRKVDIEVLSVLASLGASVHKICTDIRLLANLKEMEEPFYKRNPMRSERCCSLARHLMTLVMDPLQTASVQWFERTLDDSANRRICLAEAFLTADTILNTLQNISEGLVVYPKVIERRIRQELPFMATENIIMAMVGGSRQDCHEKIRVLSQQAASVVKQEGGDNDLIERIQVDAYFSPIHSQLDHLLDPSSFTGRASQQVQRFLEEEVYPLLKPYES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADENYLOSUCCINATE LYASE
publication title Crystal Structure of Human Adenylosuccinate Lyase
rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 182
structure length 457
sequence length 470
chains with identical sequence B, C, D
ec nomenclature ec 4.3.2.2: Adenylosuccinate lyase.
pdb deposition date 2006-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00206 Lyase_1 Lyase
A PF10397 ADSL_C Adenylosuccinate lyase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.275.10 Mainly Alpha Orthogonal Bundle Fumarase C; Chain B, domain 1 Fumarase/aspartase (N-terminal domain) 2j91A01
1.20.200.10 Mainly Alpha Up-down Bundle Fumarase C; Chain A, domain 2 Fumarase/aspartase (Central domain) 2j91A02
1GKMA 1YFEA 1YFMA 4C6GA 1GK3A 2QGAB 2RJSA 1Q5NA 1TJVA 1Y2MA 4EFCA 3E04A 5F91A 3UNVA 1FUOA 4BABA 4C5UA 2QVEA 2FUSA 3RD8A 4V2QA 1GK2A 1W27A 4NSLA 2VD6A 1U15A 1XWOA 1I0AA 2O7BA 2J91A 3R6QA 2YIIA 1YISA 1C3CA 1C3UA 1RE5A 1KQ7A 2O6YA 4MX2A 5F92A 2E9FA 3R6YA 2HVGA 2PTSA 4FLCA 1JSWA 1FUPA 3RRPA 1U16A 1J3UA 4EEIA 3GZHA 3KDZA 1FURA 3OCEA 1HY1A 3NO9A 1AUWA 4BAAA 1T6JA 4C5RA 1DOFA 4C5SA 5EYTA 2RJRA 2O78A 1EB4A 1GKJA 5D6BA 1T6PA 1K62A 3OCFA 4ADMA 4V2RA 4FFXA 2PTQA 3R6VA 5HW2A 3QBPA 2O7DA 2PFMA 4CQ5A 3C8TA 4ADLA 3GTDA 2OHYA 3BHGA 1TJ7A 3NZ4A 1B8FA 4APBA 1HY0A 1FUQA 2X75A 2NYNA 2NYFA 1TJWA 3TV2A 2O7FA 4APAA 3KDYA 5EYVA 1TJUA 4NLEA 3CZOA 1DCNA 1VDKA 4HGVA 1K7WA 2PTRA 2O7EA
chains in the Genus database with same CATH superfamily
1GKMA 1YFEA 1YFMA 4C6GA 1GK3A 2QGAB 2RJSA 1Q5NA 1TJVA 1Y2MA 4EFCA 3E04A 3CRVA 5F91A 3UNVA 1FUOA 2VSFA 4BABA 2FENA 2VL7A 4C5UA 2QVEA 2FUSA 3RD8A 4V2QA 1GK2A 1W27A 4NSLA 2VD6A 1U15A 1XWOA 1I0AA 2O7BA 2J91A 3R6QA 2YIIA 1YISA 1C3CA 1C3UA 1RE5A 1KQ7A 2O6YA 5H8WA 4MX2A 5F92A 2E9FA 3R6YA 5M0JA 2HVGA 2PTSA 4FLCA 1JSWA 1FUPA 3RRPA 2FELA 1U16A 1J3UA 4EEIA 3GZHA 3KDZA 1FURA 3OCEA 1HY1A 3NO9A 4A15A 1AUWA 4BAAA 1T6JA 4C5RA 1DOFA 1XLYA 4C5SA 5EYTA 2RJRA 2O78A 1EB4A 1GKJA 5D6BA 1XMDA 1T6PA 1K62A 3OCFA 4ADMA 4V2RA 4FFXA 2PTQA 3R6VA 5HW2A 3QBPA 1XL7A 2O7DA 2PFMA 1XMCA 4CQ5A 3C8TA 4ADLA 3GTDA 2OHYA 3BHGA 1TJ7A 3NZ4A 1B8FA 5M0IA 4APBA 1HY0A 1FUQA 1XL8A 3CRW1 4WNLA 2X75A 2NYNA 2NYFA 1TJWA 3TV2A 2O7FA 4APAA 3KDYA 5EYVA 1TJUA 4NLEA 3CZOA 1DCNA 1VDKA 4HGVA 1K7WA 2PTRA 2O7EA
chains in the Genus database with same CATH topology
1GKMA 1YFEA 1YFMA 4C6GA 1GK3A 2QGAB 2RJSA 1Q5NA 1TJVA 1Y2MA 4EFCA 3E04A 5F91A 3UNVA 1FUOA 4BABA 4C5UA 2QVEA 2FUSA 3RD8A 4V2QA 1GK2A 1W27A 4NSLA 2VD6A 1U15A 1XWOA 1I0AA 2O7BA 2J91A 3R6QA 2YIIA 1YISA 1C3CA 1C3UA 1RE5A 1KQ7A 2O6YA 4MX2A 5F92A 2E9FA 3R6YA 2HVGA 2PTSA 4FLCA 1JSWA 1FUPA 3RRPA 1U16A 1J3UA 4EEIA 3GZHA 3KDZA 1FURA 3OCEA 1HY1A 3NO9A 1AUWA 4BAAA 1T6JA 4C5RA 1DOFA 4C5SA 5EYTA 2RJRA 2O78A 1EB4A 1GKJA 5D6BA 1T6PA 1K62A 3OCFA 4ADMA 4V2RA 4FFXA 2PTQA 3R6VA 5HW2A 3QBPA 2O7DA 2PFMA 4CQ5A 3C8TA 4ADLA 3GTDA 2OHYA 3BHGA 1TJ7A 3NZ4A 1B8FA 4APBA 1HY0A 1FUQA 2X75A 2NYNA 2NYFA 1TJWA 3TV2A 2O7FA 4APAA 3KDYA 5EYVA 1TJUA 4NLEA 3CZOA 1DCNA 1VDKA 4HGVA 1K7WA 2PTRA 2O7EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GKM A;  1YFE A;  1YFM A;  4C6G A;  1GK3 A;  2QGA B;  2RJS A;  1Q5N A;  1TJV A;  1Y2M A;  4EFC A;  3E04 A;  5F91 A;  3UNV A;  1FUO A;  4BAB A;  4C5U A;  2QVE A;  2FUS A;  3RD8 A;  4V2Q A;  1GK2 A;  1W27 A;  4NSL A;  2VD6 A;  1U15 A;  1XWO A;  1I0A A;  2O7B A;  2J91 A;  3R6Q A;  2YII A;  1YIS A;  1C3C A;  1C3U A;  1RE5 A;  1KQ7 A;  2O6Y A;  4MX2 A;  5F92 A;  2E9F A;  3R6Y A;  2HVG A;  2PTS A;  4FLC A;  1JSW A;  1FUP A;  3RRP A;  1U16 A;  1J3U A;  4EEI A;  3GZH A;  3KDZ A;  1FUR A;  3OCE A;  1HY1 A;  3NO9 A;  1AUW A;  4BAA A;  1T6J A;  4C5R A;  1DOF A;  4C5S A;  5EYT A;  2RJR A;  2O78 A;  1EB4 A;  1GKJ A;  5D6B A;  1T6P A;  1K62 A;  3OCF A;  4ADM A;  4V2R A;  4FFX A;  2PTQ A;  3R6V A;  5HW2 A;  3QBP A;  2O7D A;  2PFM A;  4CQ5 A;  3C8T A;  4ADL A;  3GTD A;  2OHY A;  3BHG A;  1TJ7 A;  3NZ4 A;  1B8F A;  4APB A;  1HY0 A;  1FUQ A;  2X75 A;  2NYN A;  2NYF A;  1TJW A;  3TV2 A;  2O7F A;  4APA A;  3KDY A;  5EYV A;  1TJU A;  4NLE A;  3CZO A;  1DCN A;  1VDK A;  4HGV A;  1K7W A;  2PTR A;  2O7E A; 
#chains in the Genus database with same CATH topology
 1GKM A;  1YFE A;  1YFM A;  4C6G A;  1GK3 A;  2QGA B;  2RJS A;  1Q5N A;  1TJV A;  1Y2M A;  4EFC A;  3E04 A;  3CRV A;  5F91 A;  3UNV A;  1FUO A;  2VSF A;  4BAB A;  2FEN A;  2VL7 A;  4C5U A;  2QVE A;  2FUS A;  3RD8 A;  4V2Q A;  1GK2 A;  1W27 A;  4NSL A;  2VD6 A;  1U15 A;  1XWO A;  1I0A A;  2O7B A;  2J91 A;  3R6Q A;  2YII A;  1YIS A;  1C3C A;  1C3U A;  1RE5 A;  1KQ7 A;  2O6Y A;  5H8W A;  4MX2 A;  5F92 A;  2E9F A;  3R6Y A;  5M0J A;  2HVG A;  2PTS A;  4FLC A;  1JSW A;  1FUP A;  3RRP A;  2FEL A;  1U16 A;  1J3U A;  4EEI A;  3GZH A;  3KDZ A;  1FUR A;  3OCE A;  1HY1 A;  3NO9 A;  4A15 A;  1AUW A;  4BAA A;  1T6J A;  4C5R A;  1DOF A;  1XLY A;  4C5S A;  5EYT A;  2RJR A;  2O78 A;  1EB4 A;  1GKJ A;  5D6B A;  1XMD A;  1T6P A;  1K62 A;  3OCF A;  4ADM A;  4V2R A;  4FFX A;  2PTQ A;  3R6V A;  5HW2 A;  3QBP A;  1XL7 A;  2O7D A;  2PFM A;  1XMC A;  4CQ5 A;  3C8T A;  4ADL A;  3GTD A;  2OHY A;  3BHG A;  1TJ7 A;  3NZ4 A;  1B8F A;  5M0I A;  4APB A;  1HY0 A;  1FUQ A;  1XL8 A;  3CRW 1;  4WNL A;  2X75 A;  2NYN A;  2NYF A;  1TJW A;  3TV2 A;  2O7F A;  4APA A;  3KDY A;  5EYV A;  1TJU A;  4NLE A;  3CZO A;  1DCN A;  1VDK A;  4HGV A;  1K7W A;  2PTR A;  2O7E A; 
#chains in the Genus database with same CATH homology
 1GKM A;  1YFE A;  1YFM A;  4C6G A;  1GK3 A;  2QGA B;  2RJS A;  1Q5N A;  1TJV A;  1Y2M A;  4EFC A;  3E04 A;  5F91 A;  3UNV A;  1FUO A;  4BAB A;  4C5U A;  2QVE A;  2FUS A;  3RD8 A;  4V2Q A;  1GK2 A;  1W27 A;  4NSL A;  2VD6 A;  1U15 A;  1XWO A;  1I0A A;  2O7B A;  2J91 A;  3R6Q A;  2YII A;  1YIS A;  1C3C A;  1C3U A;  1RE5 A;  1KQ7 A;  2O6Y A;  4MX2 A;  5F92 A;  2E9F A;  3R6Y A;  2HVG A;  2PTS A;  4FLC A;  1JSW A;  1FUP A;  3RRP A;  1U16 A;  1J3U A;  4EEI A;  3GZH A;  3KDZ A;  1FUR A;  3OCE A;  1HY1 A;  3NO9 A;  1AUW A;  4BAA A;  1T6J A;  4C5R A;  1DOF A;  4C5S A;  5EYT A;  2RJR A;  2O78 A;  1EB4 A;  1GKJ A;  5D6B A;  1T6P A;  1K62 A;  3OCF A;  4ADM A;  4V2R A;  4FFX A;  2PTQ A;  3R6V A;  5HW2 A;  3QBP A;  2O7D A;  2PFM A;  4CQ5 A;  3C8T A;  4ADL A;  3GTD A;  2OHY A;  3BHG A;  1TJ7 A;  3NZ4 A;  1B8F A;  4APB A;  1HY0 A;  1FUQ A;  2X75 A;  2NYN A;  2NYF A;  1TJW A;  3TV2 A;  2O7F A;  4APA A;  3KDY A;  5EYV A;  1TJU A;  4NLE A;  3CZO A;  1DCN A;  1VDK A;  4HGV A;  1K7W A;  2PTR A;  2O7E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...