2J91A

Crystal structure of human adenylosuccinate lyase in complex with amp
Total Genus 182
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
182
sequence length
470
structure length
457
Chain Sequence
GDHGSPDSYRSPLASRYASPEMCFVFSDRYKFRTWRQLWLWLAEAEQTLGLPITDEQIREMKSNLENIDFKMAAEEEKRLRHDVMAHVHTFGHCCPKAAGIIHLGATSCYVGDNTDLIILRNALDLLLPKLARVISRLADFAKERASLPTLGFTHFQPAQLTTVGKRCCLWIQDLCMDLQNLKRVRDDLRFRGVKGTTGTQASFLQLFEGDDHKVEQLDKMVTEKAGFKRAFIITGQTYTRKVDIEVLSVLASLGASVHKICTDIRLLANLKEMEEPFYKRNPMRSERCCSLARHLMTLVMDPLQTASVQWFERTLDDSANRRICLAEAFLTADTILNTLQNISEGLVVYPKVIERRIRQELPFMATENIIMAMVGGSRQDCHEKIRVLSQQAASVVKQEGGDNDLIERIQVDAYFSPIHSQLDHLLDPSSFTGRASQQVQRFLEEEVYPLLKPYES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Human Adenylosuccinate Lyase
rcsb
source organism Homo sapiens
molecule tags Lyase
molecule keywords ADENYLOSUCCINATE LYASE
total genus 182
structure length 457
sequence length 470
chains with identical sequence B, C, D
ec nomenclature ec 4.3.2.2: Adenylosuccinate lyase.
pdb deposition date 2006-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00206 Lyase_1 Lyase
A PF10397 ADSL_C Adenylosuccinate lyase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.275.10 Mainly Alpha Orthogonal Bundle Fumarase C; Chain B, domain 1 Fumarase/aspartase (N-terminal domain) 2j91A01
1.20.200.10 Mainly Alpha Up-down Bundle Fumarase C; Chain A, domain 2 Fumarase/aspartase (Central domain) 2j91A02
4C5RA 1KQ7A 2PTQA 2QGAB 1VDKA 1U15A 3KDZA 4FLCA 3RRPA 1TJ7A 4CQ5A 3BHGA 5EYVA 1DOFA 1GKJA 1FURA 2X75A 3GZHA 1GK3A 3GTDA 2O6YA 1DCNA 1T6JA 1XWOA 2RJRA 4C5UA 3RD8A 1EB4A 4BAAA 3C8TA 1FUPA 4BABA 2FUSA 1YISA 1K62A 1JSWA 5F92A 3NZ4A 4NSLA 1YFMA 3NO9A 1YFEA 2O7BA 2NYFA 1TJUA 4EFCA 1I0AA 1K7WA 3R6YA 1HY0A 1HY1A 1B8FA 2O7EA 3QBPA 2PFMA 4V2QA 1TJWA 2HVGA 2PTSA 4ADLA 1Q5NA 5D6BA 3R6QA 5HW2A 5EYTA 1T6PA 2RJSA 2PTRA 3KDYA 4APBA 2VD6A 3CZOA 3TV2A 1FUQA 1GK2A 2OHYA 1AUWA 1U16A 1TJVA 2NYNA 1C3UA 2O7FA 4FFXA 2J91A 2QVEA 3OCEA 4MX2A 4ADMA 4C6GA 1GKMA 1RE5A 3UNVA 2E9FA 4C5SA 4APAA 5F91A 1FUOA 3E04A 1J3UA 4EEIA 2YIIA 4V2RA 1C3CA 4HGVA 1W27A 2O7DA 4NLEA 1Y2MA 2O78A 3R6VA 3OCFA
chains in the Genus database with same CATH superfamily
4C5RA 1KQ7A 2PTQA 2QGAB 1VDKA 1U15A 3KDZA 4FLCA 3RRPA 1TJ7A 4CQ5A 3BHGA 5EYVA 1DOFA 1GKJA 1FURA 2X75A 3GZHA 1GK3A 3GTDA 2O6YA 2FENA 1DCNA 1T6JA 1XL7A 1XWOA 2RJRA 5M0IA 4C5UA 3RD8A 1EB4A 4BAAA 3C8TA 1FUPA 1XMCA 4BABA 2FUSA 1YISA 1K62A 1JSWA 5F92A 3NZ4A 4NSLA 1XL8A 1YFMA 3NO9A 1YFEA 2O7BA 2NYFA 1TJUA 4EFCA 1I0AA 1K7WA 5M0JA 3R6YA 1HY0A 1HY1A 1B8FA 2O7EA 3QBPA 2PFMA 4V2QA 1TJWA 2HVGA 1XLYA 2VSFA 2PTSA 4ADLA 1Q5NA 5D6BA 4WNLA 3R6QA 5HW2A 5EYTA 1T6PA 2RJSA 2PTRA 3KDYA 4APBA 2VD6A 2FELA 3CZOA 3TV2A 4A15A 1FUQA 1GK2A 2OHYA 1AUWA 1U16A 1TJVA 2NYNA 1C3UA 2O7FA 4FFXA 2J91A 2QVEA 3OCEA 4MX2A 4ADMA 4C6GA 1GKMA 1RE5A 2E9FA 3UNVA 4C5SA 4APAA 5F91A 1FUOA 2VL7A 3E04A 3CRVA 3CRW1 5H8WA 1J3UA 4EEIA 2YIIA 1XMDA 4V2RA 1C3CA 4HGVA 1W27A 2O7DA 4NLEA 1Y2MA 2O78A 3R6VA 3OCFA
chains in the Genus database with same CATH topology
4C5RA 1KQ7A 2PTQA 2QGAB 1VDKA 1U15A 3KDZA 4FLCA 3RRPA 1TJ7A 4CQ5A 3BHGA 5EYVA 1DOFA 1GKJA 1FURA 2X75A 3GZHA 1GK3A 3GTDA 2O6YA 1DCNA 1T6JA 1XWOA 2RJRA 4C5UA 3RD8A 1EB4A 4BAAA 3C8TA 1FUPA 4BABA 2FUSA 1YISA 1K62A 1JSWA 5F92A 3NZ4A 4NSLA 1YFMA 3NO9A 1YFEA 2O7BA 2NYFA 1TJUA 4EFCA 1I0AA 1K7WA 3R6YA 1HY0A 1HY1A 1B8FA 2O7EA 3QBPA 2PFMA 4V2QA 1TJWA 2HVGA 2PTSA 4ADLA 1Q5NA 5D6BA 3R6QA 5HW2A 5EYTA 1T6PA 2RJSA 2PTRA 3KDYA 4APBA 2VD6A 3CZOA 3TV2A 1FUQA 1GK2A 2OHYA 1AUWA 1U16A 1TJVA 2NYNA 1C3UA 2O7FA 4FFXA 2J91A 2QVEA 3OCEA 4MX2A 4ADMA 4C6GA 1GKMA 1RE5A 3UNVA 2E9FA 4C5SA 4APAA 5F91A 1FUOA 3E04A 1J3UA 4EEIA 2YIIA 4V2RA 1C3CA 4HGVA 1W27A 2O7DA 4NLEA 1Y2MA 2O78A 3R6VA 3OCFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C5R A;  1KQ7 A;  2PTQ A;  2QGA B;  1VDK A;  1U15 A;  3KDZ A;  4FLC A;  3RRP A;  1TJ7 A;  4CQ5 A;  3BHG A;  5EYV A;  1DOF A;  1GKJ A;  1FUR A;  2X75 A;  3GZH A;  1GK3 A;  3GTD A;  2O6Y A;  1DCN A;  1T6J A;  1XWO A;  2RJR A;  4C5U A;  3RD8 A;  1EB4 A;  4BAA A;  3C8T A;  1FUP A;  4BAB A;  2FUS A;  1YIS A;  1K62 A;  1JSW A;  5F92 A;  3NZ4 A;  4NSL A;  1YFM A;  3NO9 A;  1YFE A;  2O7B A;  2NYF A;  1TJU A;  4EFC A;  1I0A A;  1K7W A;  3R6Y A;  1HY0 A;  1HY1 A;  1B8F A;  2O7E A;  3QBP A;  2PFM A;  4V2Q A;  1TJW A;  2HVG A;  2PTS A;  4ADL A;  1Q5N A;  5D6B A;  3R6Q A;  5HW2 A;  5EYT A;  1T6P A;  2RJS A;  2PTR A;  3KDY A;  4APB A;  2VD6 A;  3CZO A;  3TV2 A;  1FUQ A;  1GK2 A;  2OHY A;  1AUW A;  1U16 A;  1TJV A;  2NYN A;  1C3U A;  2O7F A;  4FFX A;  2J91 A;  2QVE A;  3OCE A;  4MX2 A;  4ADM A;  4C6G A;  1GKM A;  1RE5 A;  3UNV A;  2E9F A;  4C5S A;  4APA A;  5F91 A;  1FUO A;  3E04 A;  1J3U A;  4EEI A;  2YII A;  4V2R A;  1C3C A;  4HGV A;  1W27 A;  2O7D A;  4NLE A;  1Y2M A;  2O78 A;  3R6V A;  3OCF A; 
#chains in the Genus database with same CATH topology
 4C5R A;  1KQ7 A;  2PTQ A;  2QGA B;  1VDK A;  1U15 A;  3KDZ A;  4FLC A;  3RRP A;  1TJ7 A;  4CQ5 A;  3BHG A;  5EYV A;  1DOF A;  1GKJ A;  1FUR A;  2X75 A;  3GZH A;  1GK3 A;  3GTD A;  2O6Y A;  2FEN A;  1DCN A;  1T6J A;  1XL7 A;  1XWO A;  2RJR A;  5M0I A;  4C5U A;  3RD8 A;  1EB4 A;  4BAA A;  3C8T A;  1FUP A;  1XMC A;  4BAB A;  2FUS A;  1YIS A;  1K62 A;  1JSW A;  5F92 A;  3NZ4 A;  4NSL A;  1XL8 A;  1YFM A;  3NO9 A;  1YFE A;  2O7B A;  2NYF A;  1TJU A;  4EFC A;  1I0A A;  1K7W A;  5M0J A;  3R6Y A;  1HY0 A;  1HY1 A;  1B8F A;  2O7E A;  3QBP A;  2PFM A;  4V2Q A;  1TJW A;  2HVG A;  1XLY A;  2VSF A;  2PTS A;  4ADL A;  1Q5N A;  5D6B A;  4WNL A;  3R6Q A;  5HW2 A;  5EYT A;  1T6P A;  2RJS A;  2PTR A;  3KDY A;  4APB A;  2VD6 A;  2FEL A;  3CZO A;  3TV2 A;  4A15 A;  1FUQ A;  1GK2 A;  2OHY A;  1AUW A;  1U16 A;  1TJV A;  2NYN A;  1C3U A;  2O7F A;  4FFX A;  2J91 A;  2QVE A;  3OCE A;  4MX2 A;  4ADM A;  4C6G A;  1GKM A;  1RE5 A;  2E9F A;  3UNV A;  4C5S A;  4APA A;  5F91 A;  1FUO A;  2VL7 A;  3E04 A;  3CRV A;  3CRW 1;  5H8W A;  1J3U A;  4EEI A;  2YII A;  1XMD A;  4V2R A;  1C3C A;  4HGV A;  1W27 A;  2O7D A;  4NLE A;  1Y2M A;  2O78 A;  3R6V A;  3OCF A; 
#chains in the Genus database with same CATH homology
 4C5R A;  1KQ7 A;  2PTQ A;  2QGA B;  1VDK A;  1U15 A;  3KDZ A;  4FLC A;  3RRP A;  1TJ7 A;  4CQ5 A;  3BHG A;  5EYV A;  1DOF A;  1GKJ A;  1FUR A;  2X75 A;  3GZH A;  1GK3 A;  3GTD A;  2O6Y A;  1DCN A;  1T6J A;  1XWO A;  2RJR A;  4C5U A;  3RD8 A;  1EB4 A;  4BAA A;  3C8T A;  1FUP A;  4BAB A;  2FUS A;  1YIS A;  1K62 A;  1JSW A;  5F92 A;  3NZ4 A;  4NSL A;  1YFM A;  3NO9 A;  1YFE A;  2O7B A;  2NYF A;  1TJU A;  4EFC A;  1I0A A;  1K7W A;  3R6Y A;  1HY0 A;  1HY1 A;  1B8F A;  2O7E A;  3QBP A;  2PFM A;  4V2Q A;  1TJW A;  2HVG A;  2PTS A;  4ADL A;  1Q5N A;  5D6B A;  3R6Q A;  5HW2 A;  5EYT A;  1T6P A;  2RJS A;  2PTR A;  3KDY A;  4APB A;  2VD6 A;  3CZO A;  3TV2 A;  1FUQ A;  1GK2 A;  2OHY A;  1AUW A;  1U16 A;  1TJV A;  2NYN A;  1C3U A;  2O7F A;  4FFX A;  2J91 A;  2QVE A;  3OCE A;  4MX2 A;  4ADM A;  4C6G A;  1GKM A;  1RE5 A;  3UNV A;  2E9F A;  4C5S A;  4APA A;  5F91 A;  1FUO A;  3E04 A;  1J3U A;  4EEI A;  2YII A;  4V2R A;  1C3C A;  4HGV A;  1W27 A;  2O7D A;  4NLE A;  1Y2M A;  2O78 A;  3R6V A;  3OCF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...