2J98A

Human coronavirus 229e non structural protein 9 cys69ala mutant (nsp9)
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
106
structure length
106
Chain Sequence
EIMPGKMKVKATKGEGDGGITSEGNALYNNEGGRAFMYAYVTTKPGMKYVKWEHDSGVVTVELEPPARFVIDTPTGPQIKYLYFVKNLNNLRRGAVLGYIGATVRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Variable Oligomerization Modes in Coronavirus Non-Structural Protein 9.
pubmed doi rcsb
source organism Human coronavirus 229e
molecule tags Rna binding protein
molecule keywords REPLICASE POLYPROTEIN 1AB
total genus 21
structure length 106
sequence length 106
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2006-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08710 nsp9 nsp9 replicase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.250 Mainly Beta Beta Barrel Thrombin, subunit H Replicase NSP9 2j98A01
1QZ8A 2J98A 5HIYA 5HIZA 2J97A 1UW7A 3EE7A 5C94A 2J98B
chains in the Genus database with same CATH superfamily
1P2KA 1ANBA 2QIQA 2BLQA 1TX6A 3MH6A 1GWAA 2BOKA 3E0NB 3ENSB 3S9CA 1TX8A 1CT4E 1NPMA 3MNSA 2O8TA 2ZDAH 1LDTT 2WUBA 2F43B 4BNRA 2NU0E 3TITA 3L33A 1YPEH 1UVOA 3PM3A 3DFJA 3U8RH 4JYTA 1K28D 4X8VH 2FMJA 1A3EH 3QX5H 2VB0A 1TE0A 4QT8C 2IPQX 3A7XA 1TNJA 3SQEE 4DG4A 2Y7XA 2BVXH 3LGYA 2BD8A 4AZ2B 1UCYH 4D8NA 5A8YA 1NRPH 1WBGB 5HMAA 2RA0A 1JOUB 2AGEX 2G51A 1CGJE 4U2WA 1EP5A 1O5CB 4XBCA 1O2HA 1G30B 2GJGA 3VGCC 3I29A 3KQCA 4CRBA 1O5DH 1O3LA 3OYPA 4NCYA 1YYY1 1TRYA 2BY9X 1V2WT 1SGNE 4CRDA 1FONA 3A7TA 3RXPA 5C1UA 4ACAA 2EI7A 3UQVA 3MHWU 1ZR0A 4HI3A 1S83A 2DE9A 1FY1A 2BHGA 1CBWC 2BB4A 4FUDA 2OXSA 1O36A 3U28C 1T8NA 1EJNA 1E34B 1BJUA 3LGUA 2W7SA 1W0JD 1AHTH 1HNEE 2ZG0H 1O3JA 4FU7A 4ZUHA 1O2PA 3OEHD 5A8XA 4K1SA 3U8TH 1OS8A 1YCPK 3ATKA 2LELA 3EAJA 1AUJA 4XFQA 2QN5T 2ZPRA 1Y8TA 2BTCE 5C3NA 1GMDF 1UTQA 1BMAA 3KNXA 5AFYH 1OWKA 2ZU5A 4X8TH 1NTPA 3M7UA 5EJZA 3FKSD 3A8DA 4IW4E 1P09A 2FEQH 1C5LH 1GVZA 5HIYA 1AFQB 3KYGA 2OD3B 3CP7A 3TPIZ 4B73A 4GPGA 3T5FH 3F2HA 1K1NA 1AVWA 2UUYA 3UWIA 1O32A 1O5GH 3CNRA 3MFJA 3BTDE 2DUCA 1C2KA 3VB7A 2F3CE 1ORFA 1LVOA 3GOVB 1GJ7B 5PTPA 3W1EA 4D7FA 2CJIA 3SHCH 1LHGH 1S0RA 4ZHAA 4MLFB 1GVLA 1GVKB 3QTOH 1S5SA 2BXUH 1EAWA 2VIQA 1BTXA 1DWBH 2KX4A 3UUZA 5ABWA 9LPRA 5CDFE 1OYQA 5T3HA 4WWYA 5F8TA 1A61H 2TBSA 2H9HA 2V7QD 4WMDA 1D4PB 4VGCB 3TNTA 1QRZA 1SHHB 2TGPZ 1SGYE 1TA2A 1UK3A 5EU8A 3PLPA 2W26A 4RT1A 1XMNB 1BITA 1SVPA 2OK5A 2FWWA 1RS0A 4ZCNA 1L4ZA 3EE0B 1CGIE 3H7TA 2O8LA 4K3JA 3L3TA 2IN2A 2XOKD 3Q3XA 2Z9JA 1QB6A 1TRMA 1GJ4H 4BTUB 2VJ1A 1C2HA 1LVBA 3AVZA 1L0ZA 5JBBS 2ZDVH 2JKHA 3QLPH 2GGVB 1DUEA 3SOSA 4TPIZ 3U8OH 3IG6B 2KCPA 3U1IB 4MQAA 3BG8A 1Z71A 2ZI2H 1D9IA 4TYDA 5DGJA 3RXUA 4ABEA 1UCYE 3ATIA 1TBRH 3DD2H 1ETRH 5DP5A 1G32B 5AVDA 2BLOA 4Q80A 3UTUH 3URDA 2WUCA 4FETA 1QJ1B 5DP9A 3FP7E 4AORA 3RMOH 2BD4A 2Y5GA 1MD7A 1S0QA 4R0IA 4GHQA 1Y5BT 1VZQH 1VCPA 5DP4A 1P02A 4X6PA 4NSYA 2ANMH 1TGCA 3A89A 1O2SA 1ELTA 2AIPA 1K1PA 3ZVCA 1AQ7A 1TYNA 2XYAA 3FVFB 2WPHS 4NG9H 4A7IB 4Z1MD 1BJVA 1ZGVA 1BTPA 1L1GA 4GSOA 2PTCE 4X6NA 1XUKA 2FM2A 3SO3A 3M3VA 2TGAA 4ZXXH 3ZZBA 4IN1A 1S6FA 2PKAB 4FUFA 3BEUA 2OQ5A 3NK8A 1A7SA 2JETB 5SGAE 1HB0B 3GCTF 1FXYA 1XKBC 1WCZA 2WPDD 1DX5M 1LCYA 2OC7A 1T7CA 2WSSD 2XC0A 3LC3A 4ISIH 3DFLA 5GCHF 4IGDA 1GHXH 2FS9A 1P2OA 3LOXA 2XBVA 1G3EA 4BAHB 1Z8JB 1BZXE 2IOTA 4AGJA 3BEFB 2FYQA 4OS6A 1GI2A 2IPHA 3O8RA 3B8JA 1C5UA 5DK1A 5DPAA 4FVBA 1C5OH 1HAVB 4XE4A 1TMBH 2QXGA 1C4V2 1DANH 1ESAA 1P3CA 1C9TA 1P05A 5C1XA 4JZDH 5A2MH 3QWCH 2ZHDA 4OS1A 2RG3A 2GMTB 3H7OA 2ZP0H 5A0BA 1E0FD 1VGCC 2WYGA 2PHBA 2FDAA 1E38B 3FFGA 2J2UA 1XUJA 1C5QA 3Q76A 3KEEA 2WV9A 3N7OA 2ZFFH 2EI8A 1EX3A 2Z9KA 4F4OC 1SMFE 2ZO3H 1OWEA 4F48B 4I31A 3RMLH 4YTAA 2GX4A 2TIOA 1NT1A 1BQYA 1N8OC 3SQHE 1EAUA 1SC8U 3UPEA 3RMMH 2Z6BD 1NRSH 1SSXA 2EEKA 2JJ2D 1KTTB 1EASA 1PYTD 1TABE 1GDUA 3OX7U 5AHGH 4ZH8A 3M3SA 1LQDB 1Y3WA 1P0SH 1HFDA 4KP0A 1DFPA 1DOJA 2JJ1D 2GCHF 3SGQE 3TGJE 2ZHEH 1W14U 1GBDA 5IDKA 1NBMD 2FS8A 1V2ST 1THSH 1EJMA 7LPRA 1HJAB 4AYVB 1P57B 1GL0E 1QBOA 1DWCH 3RXSA 4DJZB 3DA9B 3MH4A 3KGPA 1O2MA 2ANWA 1WTHD 2C8YB 3QGNB 1ZLRA 1CHGA 1OP8A 1VJ9U 4GLYA 1H1BA 3OFND 3RDZA 1PJPA 2ZFQH 4Y71A 1RRKA 4NGAH 5TCCA 1Q3XA 1GMHG 1QY6A 2XNIA 3PTBA 3SORA 2PW8H 3SU2A 2G55A 4A92A 1V2JT 1BHXF 1RTKA 3BTQE 1MCVA 1YM0A 1IQEA 1NU7B 1SGIB 3A81A 4LK4A 1XKAC 3E90B 3SNEA 2TPIZ 4I86A 1HJ8A 3SBKA 4IC6A 2C8ZB 2YMSC 2Y5FA 1ELAA 1FPCH 1Z8GA 3PO1B 3RP2A 3VG8A 2B7DH 3PWBA 2BXTH 2GZ9A 5EPNA 1NY22 3K2UA 2O8MA 2Z3EA 1CA0C 3K9XB 4MVNA 3SN8A 1EQ9A 4NA8A 4E7NA 1YCPM 1GJ5H 3V0XA 1F0TA 3NKKA 1MTVA 5EG4A 4WH6A 1P3EA 3PO1C 3AW1A 3PRDA 3HATH 2AERH 1GHWH 2V0BA 4AG2A 1QB9A 3A83A 2Z9GA 2F83A 5EW1H 1GHYH 3TVJB 2Y81A 1OWDA 2C8XB 1BRUP 2HPQH 3TU7H 1BMMH 2UUFB 3ZZDA 1NRQH 4Y76A 2WPLS 2BZAA 5GCHG 3KL6A 1AI8H 1H4WA 1P11E 1UTNA 4MNWA 5HM9A 3VB5A 1RIWC 2PUXB 3OY6U 1MQ5A 1TGBA 1L1NA 1SR5C 4B6EA 1C2DA 1GJCB 1BB0B 1G3DA 4WY3A 1H8HD 5BRRE 1EJAA 3O8DA 3A85A 1UO6A 1F0UA 1GG6B 1SLVB 2ZPQA 3RLWH 2VVCA 2UWLA 1A0JA 1OP0A 2JH6D 2Q6DA 1Q2WA 1F5LA 2FTMA 4Q2KA 1GHZA 3ZVBA 1C4U2 5DN6D 3ZVGA 3GICB 1Y3XA 2R3YA 3F1SB 3ZIAD 1OOKB 2PKSB 3MU0A 5CE1A 4FUIA 2STBE 3SI4H 3G01A 2B0FA 4ABHA 2FXRA 1HAYB 5B6LA 5EJLA 2FTLE 3A7ZA 1AWFH 1KMHB 1PPEE 3PYHA 1O2QA 3SHAH 1OKXA 2FOFA 3BTME 2GDDA 4BAQB 3RUOA 7GCHF 3S7KB 1ZPZA 2ZNKH 5DO4H 2AIQA 1L4DA 2HWLB 2LPRA 2VVVA 3GCOA 3UY9A 2VIWA 1CU1A 1KXEA 1IOEA 4DT4A 1ZJDA 5FCKA 5GNDA 3V12A 1O2ZA 1C1VH 1DPOA 2ZFPH 2G52A 1C5XB 3B23B 1CT0E 1GG6C 3OAAD 1ZSJA 1D3TB 1COWD 1K22H 3SJ9A 2F9VA 3MMGA 3TK9A 3F0OA 1AE5A 1C2LA 2A5KA 1CVWH 5EXNA 5A8ZA 2ULLA 1SGQE 3P8NA 1LHDH 1SQAA 1IAUA 4Q7YA 4HZHA 1AN1E 1P9UA 2WPIS 1AIXH 2FX4A 1GI6A 3HKIB 1HYLA 1G3CA 5TJXA 2ALPA 3SV8A 1BA8B 2Q6FA 4U32A 3KQEA 1V2UT 2SGPE 2ZFSA 2AMPA 3M7TA 4RSPA 3LH1A 2AMQA 3BTKE 3T28A 3K65B 4CH8B 1K1OA 4OGXA 3ZZ9A 4LOYH 5I46H 3GY3A 2VH6A 1WTGH 4GHTA 4FUHA 1WAYB 1Z8RA 1W7XH 1P2QA 1BTHH 2BDHA 2DE8A 1V6DA 1WQVH 1LTOA 3PROA 1DLEA 2QXHA 1EUFA 2ZGBH 1YLCA 3MQKC 1ZTJA 4K1TA 4ZAEA 2L74A 1G3BA 2KCAA 1TRNA 3RXBA 1BRAA 1TALA 2GKVE 1EOLA 1QRWA 4CH2B 4E7RG 5A09A 4NZQA 1GJ9B 1TQ0B 3DUXH 3EE7A 1AE8H 2BDCA 2H1UA 3R0FA 4Z6AH 5C0UA 5E0JA 2VWOA 2J98B 3KN2A 1V2KT 1JRSA 2WPKS 4WMEA 3FZDA 1BTWA 5GWZA 2Z7FE 4SGAE 1YBWA 2ZDNA 3A7YA 1FAXA 4NFEA 1HAVA 2A4QA 1HDTH 3ZVAA 1O3EA 2B5TB 1C1TA 3NWUA 3LIWA 1C1QA 2EY4C 1FIZA 1QTFA 5LPFA 1LPKB 2BLWA 3E16B 4JYVH 1EATA 2ZIQH 3SV9A 3DHKH 2F4LA 3QTVH 1P01A 3SV7A 4KTCA 3UIRA 1BUIA 4YOGA 1YPJH 5HIZA 1O31A 3KQDA 1LPZB 1O34A 3GCHB 1SGEE 3E8LA 1SHYA 4OGYA 2AMDA 3BG4C 2J95A 4Y7AA 4NA7A 1O2LA 2HOBA 4O3UA 1ZOMA 1K1LA 3EGKH 2FOBA 2FYRA 4Q7XA 3VB4A 4Y0ZE 8LPRA 1O3NA 3BTGE 4XOJA 3F68H 5JDUB 1FQ3A 1W13U 1ELDE 1GL1A 2FZZA 4Y79A 5E0HA 2Y82A 3O8CA 3TH2H 1C1SA 2W6JD 2OBOA 1TMUH 4CHAB 2A4OA 3MO9A 1SOTA 4P02A 1W2KH 1TPAE 4ABBA 1O2GH 2L6OA 2WV5A 4X2VA 2V6NA 2NU4E 2C3SA 3TIUA 3LGVA 3BIVH 4K8BA 5CHBA 2UWPA 1YLDA 3EA9A 5I25A 3T62A 3MH7A 1SGTA 2ANYA 5C2ZA 1NFWA 3LDXH 1G9IE 1XUGA 1OX1A 4ASHA 1O5AB 2HLDD 4AX9H 1AVXA 1GMHF 1GI5A 1O0DH 1NFUA 4FUEA 1KXFA 3NUMA 1GPZA 1TOCB 2FOAA 1C2EA 2ZQ1A 1CO7E 6CHAB 1TGSZ 1IHTH 3JZ2B 1HPGA 1TNKA 1D6WA 2C90B 3NXPA 1GBAA 1NO9H 1GI3A 3FANA 3EQ0H 1F5KU 3RMNH 3V13A 2V3MA 1GI8B 1TFXA 4JZFH 5G4BA 1YC0A 2PKAA 2GCHG 2FODA 3I78A 2OC1A 3Q3KA 2OLGA 1KLJH 1C1MA 4X1NU 4HG6A 2EI6A 1AO5A 3A8BA 4J1YA 2PR3A 1G36A 5CMXH 3QZQA 2CGAA 2BVRH 2OQUA 2P3FH 4FXGH 4E06H 1KTSB 3V3MA 2AFQB 1LQEA 2GCTB 3TJNA 1EZQA 5ESTE 1EOJA 3TGIE 2NU2E 1AFEH 4Q4LA 5C20A 3VXFH 5A0CA 1DM4B 3R3GB 1JXPA 2ZU3A 2BVSH 2QA9E 5EGMA 1RIWB 2CHAB 2PGBB 2B8OH 3WWBA 2RDLA 2XTTB 3SUGA 1Y3UA 4ZXYH 3SJIA 1O30A 2GDEH 1HCGA 4KGAA 2I6SA 4Y8ZA 3RU4E 1F2SE 3JZ1B 1O2VA 2P8OC 2SNVA 4YOIA 1EP6A 1H8IH 1O2XA 1UVSH 1C5WB 2PLXA 3PV4A 3S9AA 2THFB 2FI4E 3BTFE 1ZMLA 5DP3A 2ZPSA 1H9HE 1Y3YA 2QF3A 2ZTXA 2VIVA 3P70B 1G2LA 2IJOB 2XBWA 5E2PA 3AASA 5GXPA 1MKXK 4ABIA 1GCTB 4YOJA 3VB3A 2RA3A 4DURA 3VPKA 1EPTA 4WXVA 5F8XA 5EJ1A 4Q63A 1C1UH 1C9PA 4ABJA 1B7XB 1XUHA 1EAIA 1O3GA 4FVDA 3T27A 1BDAA 1NBME 3H5CB 1GBTA 3E3TA 1MUEB 1SGFG 1B0FA 3SJOA 5JB8S 1MU8B 4TWWA 1QB1A 3URCA 1ESBA 2Z94A 1BTYA 4CRAA 5JBAS 1TX7A 1HJ9A 1Z8IB 1N8OB 1CA0B 3DT0H 1YPLH 2OINA 1P9SA 1EZUC 4K1EA 5JB9S 2G8TA 4RKJB 1YF4A 2Q6GA 2Q1JA 3GYMA 4F49A 2F9BH 4ZKSU 4JCNA 3MNBA 3T2NA 1AFQC 1ZHPA 5FXLA 3A84A 4INHA 4NIYA 4YT7H 3A88A 1SLXB 1C5VA 1O2WA 1UJ1A 4YT6H 3ATLA 3NZIA 3A8AA 8GCHF 5GIBA 1O3IA 1WOFA 1W10U 1TWXB 1GCTC 2WZQA 4PROA 1LMWB 2A31A 4FU8A 5C5OA 2VU8E 2C93B 4NWLA 1PQ8A 4D9RA 1LHFH 5FCRA 3KYFA 2YNAA 3E1XB 2P95A 4RI0A 4UEHH 1MABB 1VITH 3PMHB 5C0TA 5F03A 4AB8A 1AKSA 2ZHQH 1TGTA 4X1PU 2ZGXH 4HGCA 1VR1H 1P04A 2KR7A 3K6ZA 1UVTH 1MBQA 4FU9A 1W11U 4UDWH 5DG6A 2SFAA 3WY8A 1GJAB 4CR5A 3TH3H 2PKSC 1AZZA 3NPSA 1A0LA 1A5IA 2BD3A 1ANCA 5H4IB 2LNCA 1PPGE 4YO9A 1XVMA 1GI9B 2ZU1A 3QDZB 2WV4A 3TJUA 2W7UA 2CK3D 3T29A 1ELCA 1GHAG 2JH5D 4TY7A 4CR9A 3M5OA 4RKOB 4XSKU 3F9HA 1BTZA 3RM2H 1EAXA 1GI1A 4Y10E 1GBEA 1MKWH 1QRXA 3SZNA 1GI4A 4DT7B 1QHRB 3ZZ3A 4NIXA 1BMLA 4K2YA 1CSOE 2CF9H 2PP6A 1E1QD 1LKBA 4LXBH 3RXVA 2OTVA 5L30H 2ZECA 2ODPA 3UREA 1SLWB 1YGCH 3IWMA 4DOQA 2FLRH 7GCHG 3KHVA 1SLUB 2KM0A 5C67A 2XNDD 1GBKA 4BXSA 4XRNA 1WXRA 1AGJA 3UAIC 3P8GA 4X0WU 1QJ7B 3UOPA 1F7ZA 1TQ7B 2GZ7A 2H5DA 2VIPA 2ZDLA 3LPRA 3OSYA 4XBBA 3GY2A 4X1QU 1HRTH 1C1OA 2K1QA 2ODQA 1C2MA 1TB6H 1ZTKA 2AHME 4FUGA 4CRFA 1ACBE 1CQQA 1MTWA 2P94A 3FP6E 5FAHA 3LJJA 2H2ZA 3Q00A 5GDSH 2QAAA 1HAZB 2CN0H 1O3OA 1GMDG 1MBMA 2ZHWH 2F9OA 3SJ8A 2ZCLP 3BIUH 2HGTH 3FN8A 2ODYB 1FY8E 1K21H 1A0HB 2R0KA 4NFFA 1KYNA 3ATMA 1IQHA 3RXMA 2KAIB 1DSTA 3MYWA 1UTMA 3QGJA 3PLKA 1WU1A 1DUAA 1SGFA 1JWTA 3P8OA 1GHAF 2RDEA 3A87A 1FMGA 2W6ID 2SGDE 1FNIA 3F6UH 4WVPE 4B2AA 3M36A 3O8BA 2Z9LA 1AZ8A 3ATWA 4MNVA 1RXPA 1KLTA 2EQNA 4J2YB 5LH8A 2CHAC 1HXEH 3WW7A 2VH0A 1PYTC 2NU3E 1MTNC 3KQBA 4NIVA 3LKWA 1W3CA 3UB0A 5AF9H 2ZHFH 2GZ8A 3FP8E 4B2CA 1T4UH 1MZDA 2ZCHP 2D2DA 4ACBA 8GCHG 2ILNA 1ARBA 2PTNA 4YZUA 1ZSKA 3U9AH 1V2RT 1KY9A 1XVOA 5DP6A 3I77A 4JK6A 5KECA 2AGIX 3QUMP 1VCWA 1UHBB 4IS5A 3TH4H 3MU4A 1MZAA 3CS0A 3GY8A 1O3DA 4I33A 4WH8A 1QFKH 3SJKA 4Y0YE 2CMYA 3ELAH 3RU4T 3TNSA 1O3AA 1EPTB 1OXGA 3VEQB 1OWHA 5DP7A 1AD8H 2KFWA 3P6ZB 1QBVH 1HIAB 3RXTA 1GBBA 3SI3H 1KDQA 1RTFB 1V2MT 1ELFA 3OTJE 5EOKA 3AW0A 1TNGA 1YY3A 1ZPCA 5C5NA 5GPIB 4X6OA 1O2NA 3PV2A 2J5UA 2GMTC 1UCYK 2G4UA 4WXIA 2QXJA 1NROH 5EQQA 4AFQA 2F9UA 2WPJS 4HFPB 2XWBI 3SUFA 2A2XH 2HVYB 1P10A 4RN6A 1O33A 1YPGH 1N6YA 4JMYA 1INCA 1SFQB 1O2JA 1ZHMA 1UK2A 2A7JA 1QJ6B 3K6YA 7ESTE 1O5EH 1WDIA 4OS2A 4THNH 4UFEH 2FOEA 1XUIA 1HAPH 2ZDMA 1BBRH 3ODDA 1THRH 1P8VC 5F6MA 4UONA 2FX6A 1MKXH 1SQTA 1VITF 3MTYA 1TBQH 4XBDA 3F9GA 2WYJA 5EQSA 1Y59T 4Y11E 2ZCKP 3SU5A 5C17A 2D1JA 2ZGCA 2ZGJA 2PUQH 2XC5A 2WHXA 1IQMA 5C1YA 4ASUD 1H8ED 5F8ZA 2P16A 5CHAB 3RXJA 1ZTLA 1X7AC 4P00A 3RXLA 6ESTA 1YPKH 1QA0A 1TBZH 1M9UA 1ETSH 2ZF0H 1O2TA 1NN6A 1SGCA 1V2NT 1ID5H 2QF5A 4HTCH 3RXRA 4INLA 2R3UA 1SL3A 3ZZCA 1WQSA 3GCNA 3Q77A 6GCHG 1OPHB 1YPHC 5DP8A 9ESTA 5ETXA 3F2GA 1C5ZB 3GY7A 4XD7D 3IITA 2VWLA 4Y8YA 1O39A 2H5CA 3D62A 4KTUA 4LZ1H 2GTBA 1SGPE 2F9PA 2EA3A 2ZQ2A 3BF6H 4AYYB 1GI7B 2PFEA 3M35A 2RFKC 1TOMH 3UOUA 1C1PA 1XX9A 4BAOB 3EA7A 3B9FH 2AH4X 4CREA 5TCAA 1ABJH 1O3FA 5FPYA 1FX0B 1BIOA 5ESBA 2G5VA 3F0PA 2ZTYA 3GDVA 4M7GA 2O8WA 4KELA 4AFUA 1TPPA 2M2AA 2C8WB 1HBTH 3OTPA 4O97A 1FY5A 4A1TA 4AGKA 2ZDKA 4ISNA 2ZFTA 1RJXB 3NRLA 2Y5HA 3GISB 4M9FA 3RC6A 1ZRKA 2VGCB 1GJDB 5EPYA 3GDUA 1CGHA 4AOQA 3M3TA 2ZZUH 4YESB 1DWEH 2ANKH 2AGGX 1C5TA 1ELGA 3HPTB 3OU0A 1TPSA 1C2JA 1HGTH 1O2UA 1SQOA 3A82A 2BQWB 1GBLA 1L2EA 4X6MA 1EKBB 2BD5A 1V2TT 4X8UH 1P06A 5HXFA 1EFRD 2FP7B 1VGCB 4I8HA 4NA9H 2ZFRH 2OC0A 1VKYA 4DGJA 3RLYH 1SGDE 3E0PB 2XXLA 1F0SA 2FI5E 2V35A 3ZV8A 3D23A 2XWAA 1FY4A 2D26C 3SGAE 3RXDA 1OSSA 1VCQA 2R9PA 2Z9IA 2UUJB 2BZ6H 1P03A 1MU6B 2ZA5A 3RC4A 2A1DB 1LO6A 3TK6A 2BDIA 1WSSH 1NRNH 3WWFA 1P2MA 1T31A 1KXDA 2V3HH 1XM1A 2RCEA 4MPXA 1D3QB 5LPEA 1H9IE 4K60A 1J8AA 2JETC 2Z3DA 1FN8A 1IQLA 1C1WH 1DY9A 1JIMA 2BD9A 3PTNA 2A45B 2ESTE 1GMCF 3RXCA 4RT0A 1V2QT 3BTHE 3QN7A 5J4QA 1QL9A 5EQRA 4YLUA 2G81E 3F3BA 3N99A 3V7TA 1V2LT 2BD2A 2A2QH 2H6MA 2B9LA 1EXFA 1HXFH 4JZEH 3GCTG 1NZQH 3GDSA 1GBFA 5EW2H 2FI3E 4ZKOU 1HLTH 4ZHLU 1S82A 2FLBH 3PB1E 3RXEA 4MPUA 2P3TB 1YKTA 1UVPA 1RTLA 1ZPBA 1T8LA 3A7WA 3H09A 1RGQA 5JBCS 1TLDA 2F9NA 1DITH 1ZGIA 2XRCA 2SGEE 1J14A 2H9EH 3QO6A 1T8MA 1XUFA 1HAOH 4A1XA 3PMBB 4CBOA 2UUKB 1NRRH 2A7HA 1O3KA 4ZHMU 2HALA 5F53A 3SUEA 1FLEE 5HGGA 3UNQA 2Y80A 4ABGA 1HV7A 1BTUA 1WV7H 1FUJA 1EPTC 1PQ7A 3E6PH 1Z1JA 3VXEH 2P3UB 1LHEH 2BYAX 3ZV9A 4AC9A 4K5ZA 1SGRE 4UFFH 4K8YA 2OBQA 2I6QA 3SW2B 1FDPA 2CV3A 2UWOA 2A4GA 4JK5A 1J15A 2A5AA 1K0HA 1O2KA 1GDNA 5DJ7A 2ZU4A 4KKDA 1RD3B 1YLNA 2GP9B 4TWYA 4TT3D 1C5MD 3D65E 4JYUH 1NC6A 3BTEE 1S84A 1CE5A 3SZEA 5EODA 1GBHA 4MPWA 1S6HA 3F9FA 2VINA 5E8EH 5AFZH 5EXMA 3RXFA 3M61U 2GD4B 3GY6A 4UFDH 1SBWA 5KEDA 3U1JB 2VBCA 1DDJA 3SNDA 4BAKB 3LJOA 2WPMS 1MTSA 3MU5A 3ZVFA 1Z7KA 3S0NA 3LC5A 1EZXC 3DSPA 2BY8X 1AB9C 1HAIH 3PMAB 1KSNA 3LONA 2ZKSA 3UNSA 3OEED 2SGFE 3ODFA 4DW2U 1K1JA 3LT3A 1A2CH 3N7DA 3ZYDA 1FV9A 5B6OA 4Y6DA 3A7VA 3HKJB 2QV1A 1P2IA 1D3PB 1ABIH 2AEIH 1FY3A 1AY6H 1GHVH 1SG8B 4IMZA 1K9OE 1FPHH 1C4Y2 1V2VT 5FHTA 3UFAA 3SU3A 4BXWA 1H9LB 1E37B 4BOHA 1V2PT 2GCTC 1VJAU 6LPRA 3RXQA 1NU9A 3W95A 2G5NA 3ZVDA 4B76A 3MNXA 3STJA 2VIOA 5L2ZH 1QNJA 2FIRH 4ISHH 1W0YH 1BOQA 1E35B 3M5LA 2BD7A 3SV2H 2BM2A 3M5NA 3KIDU 1QURH 1TNIA 4A1VA 4CHAC 3SV6A 1GHBG 4O3TA 1C2IA 1JBUH 1W0ZU 3MWIU 2W3KA 3DSOA 1YPHE 5DKMA 2ZEBA 1OHHD 1DSUA 4E05H 2YMSD 3QZRA 1ZYOA 1YP9A 1T32A 2XCFA 1Z6JH 1GGDC 3F9EA 4GVUA 1C5NH 1G2MA 4R8TB 4CBNA 1C2GA 4MDSA 4MG3A 2BMGB 2KCOA 1UTKA 1F0RA 1CHOG 4D7GA 1IHSH 1HJAC 1QZ8A 1XXDA 1ZZZA 1BMFD 1P12E 2A5IA 4IMQA 2ALVA 1PPFE 1N6XA 1QL7A 2J34A 4GCHG 3SNCA 3KCGH 4CRCA 4AFSA 3DCLA 1CBWB 1KIGH 3BV9B 3MO3A 1CA8B 3MI4A 4ZKNU 1THPB 2QYIA 5HKKD 5T1VA 1TNLA 1F92A 3PRBA 1IQGA 3SU6A 3TJVA 2NU1E 2OCVB 2BY5X 4GCHF 1BHXB 3VB6A 6GCHF 1DXWA 4K69A 1GBMA 4ISOA 4OS7A 3RM0H 1UW7A 2ASUB 1ZRBA 2FOMB 3GYLB 1O3CA 1TA6A 3GY5A 2QF4A 1CHOF 1E1RD 3STIA 4X1RU 1XXFA 1NFXA 2XW9A 3S7HB 4ZMAH 1TNHA 2D8WA 4INKA 1DY8A 4D9QA 4OM9A 1O38A 1BRBE 1W7GH 1O2RA 2IJD1 3ITIA 1C1RA 1IQIA 5IYTA 3SUDA 1ZMNA 3ZVEA 1MD8A 1W8BH 3CS7A 1KXAA 3BTTE 1BBRK 1FAKH 4O9VA 1J16A 1V3XA 1QCPA 1KXBA 1O3HA 1PPZA 2HRVA 1GHBF 1E79D 1MKWK 2P59A 1DT2A 1HIAA 1HUTH 1HAXB 3PV5A 1LHCH 5FPTA 2CF8H 2J38A 3C27B 3M7QA 4I8GA 4I32A 1F5RA 1YCPH 5J4SA 3RC5A 1J17T 1KLIH 2YNBA 1EZSC 5A0AE 1K1MA 2EC9H 3LH3A 2BQ6B 1DVAH 1C2FA 3SYJA 1QA7A 3BG4B 4KTSA 1O5BB 1GBJA 1PPCE 1TIOA 4FUBA 1UHBA 4CRGA 2XC4A 1TMTH 3BEIB 4X8SH 8KME2 2QE7D 1TGNA 1Q31A 4U01A 3A86A 3FAOA 4TPYA 2J92A 1ARCA 3EDXB 4ABDA 2P8OB 5HYOA 1D3DB 2GV6A 1ETTH 3U69H 2JDID 4AN7A 2GV7A 4BTIB 1O35A 1AU8A 2GT8A 3MU1A 1OWIA 3A8CA 2K8IA 1MMJN 2BDGA 1UK4A 2J4IA 3HGNA 5IK2D 2ZC9H 1AKSB 3SU1A 1A46H 3VGCB 4AB9A 4UD9H 2YMSB 3RXOA 4MNYA 1MAYA 3ZZ5A 1MAXA 1EB1H 1A5GH 1O5FH 1CT2E 4H42U 5FBEA 1FIWA 4BTTB 5C94A 2LP6A 1UMAH 1NFYA 2KCYA 1S85A 5T6GA 1E36B 1JIRA 4H6TA 3SU0A 1LKAA 4IC5A 4VGCC 1VITG 3SGBE 4B75A 1A5HA 4WMFA 1KDQB 4YLQH 1DICA 2CXVA 2OUAA 4Y7BA 3RXKA 1GDQA 1O2YA 2XBYA 3D49H 5JPMH 4AG1A 1MTUA 1SOZA 1S6LA 3PMJA 3BSQA 3MOCA 3ZZAA 6CHAC 1QGFA 1O37A 1TPOA 1A1RA 1GJ6A 2GVFA 3KF2A 2J98A 1SFIA 5CHAC 4FUCA 1LVMA 2TGTA 1OP2A 2BDYA 4ZROA 1Y3VA 3BN9A 5K0HA 1QQUA 2AS9A 2W5EA 3U98H 1C5PA 4BANB 4A6LA 1ELEE 4U30A 4IBLH 4GAWA 5FX5A 1GCDA 5K7RA 2R2WU 5FL7D 2Y7ZA 1NS3A 2HVXA 1GJBB 2ZTZA 1ZHRA 1JRTA 1WUNH 3AK5A 2SGQE 1QL8A 3SNAA 2VIDA 3TJOA 1GJ8B 1UTOA 1DE7H 2QF0A 1MTNB 1SI5H 3ZZ7A 4MNXA 4NWKA 2PSXA 1C5RA 5L6NH 2BDAA 1FI8A 3LGIA 1TAWA 1ELVA 2KZ4A 3UR9A 2FO9A 5EIYA 2O9QA 2HPPH 2KAIA 3AAVA 1ZJKA 5FBIA 3RXGA 3QK1A 2P93A 3DSGA 3A80A 1G37A 1U6QA 4I8LA 3P95A 1C5YB 3AAUA 3MH5A 3P8FA 2BY7X 3ZYEA 1IQKA 2QCYA 2AYWA 2Z3CA 1UTLM 4H4FA 2FOCA 1Y5UT 1AWHB 4NZLA 1C5SA 1MH0A 3OY5U 3S9BA 2QGRA 3HGPA 3CENA 4TSFD 1O3MA 1K1IA 1QIXB 4ZKRU 2VGCC 3P92A 1GMCG 3ESTA 1BRCE 1RFNA 2BDBA 4B74A 2SGAA 2G4TA 2QY0B 1DLKB 3GS9A 1O2IA 2BX4A 1HAGE 1HAHH 1AVGH 3HK6B 4I8KA 1FN6A 4MTBA 1GGDB 3GY4A 4FUJA 1ZMJA 4O03A 1Z6EA 5JBTA 3GCHC 1B0EA 4NIWA 5E0GA 4I7YH 1AMHA 3NCLA 3E91A 3C1KA 1H8DH 1KXCA 1J9CH 1YWUA 1BT7A 1Y5AT 3RXIA 3PLBA 4MPVA 1ANEA 2J9NA 3MU8A 3Q3YA 1ELBA 4UFGH 1WYKA 3FZZA 1MQ6A 4XDEA 1IQFA 3F2FA 3RXAA 2FOGA 1ANDA 1A3BH 1V2OT 3LU9B 1D6RA 2XBXA 5GJ4B 5DSFA 2A0QB 2J94A 3EA8A 4IN2A 5E2OA 4B71A 2A7CA 2FOHA 4X1SU 2Y6TA 2TRMA 1QQ4A 1IQJA 2ZU2A 3SNBA 4H6SB 1QBNA 2BQ7B 5T6DA 4TY6A 4X2YA 1OWJA 1BBRE 1FJSA 1IQNA 3RU4D 2OC8A 4OS4A 2TGDA 2HNTE 1LVYA 1L1JA 4ESTE 2J97A 2W3IA 1DXPA 5LGOA 3SU4A 2BX3A 1QR3E 3VFEA 3S69A 3TGKE 1A4WH 2YOLA 2GT7A 3OE7D 1SPJA 1EB2A 2ZGHA 1T4VH 2NWNA 2STAE 4WJG2 5LPRA 1FZZA 4UE7H 4NSVA 3PWCA 3T25A 5L2YH 1PQ5A 2JH0D 2XCNA 2FPZA 4WF8A 3W94A 2BY6X 4DCDA 4B2BA 2VWNA 1T8OA 1SQRA 4B1TA 2HNTC 1K2I1 2K0QA 4DVAU 2WINI 1ESTA 1P2NA 2PGQB 3MNCA 1GBIA 2A4RA 4ABFA 1BCUH 4X2WA 2SNWA 3UR6A 4JZIA 2HLCA 7KMEH 2JIZD 5JYIA 2F91A 3N7EA 1SKYE 3M5MA 2A32A 2M5TA 4DIHH 3EYDA 1PPHE 4I8JA 5KGOA 1O2OA 4JZ1A 2BOHB 1UTJA 3MO6A 1GBCA 4Q7ZA 1LPGB 1OYTH 8ESTE 1NM6A 1AUTC 3UQOA 3KQ5A 3RXHA 1P2JA 3BTWE 1JMOH 3TK5A 4BAMB 2FESH 1Z1IA 2V3OH 3ZZ6A 4DY7B 1PPBH 2ZWLH 1B5GH 4LZ4B 2HNTF 2QC2A 3FOAA 4GUXA 5FX6A 2PWXA 2PV9B 1SB1H 1TONA 2QXIA 5FPSA 1DWDH 1NESE 4YM9A 4FOUC 1C1NA 3LGTA 3FO8D 1O3BA 1W12U 1PQAA 1ZSLA 4A5TS 3ZZ4A 4AFZA 1N1LA 1AB9B 2VNTA 2R2MB 2BLVA 1MCTA 5T6FA 3HK3B 5HM2A 1S81A 3M37A 4YXWD 2OP9A 4ABAA 4SGBE 4DIIH 1UVUH 2VWMA 1PFXC 4OS5A 4F55A 2R0LA 3T26A 4X2XA 1BMNH 1GI0A 1DS2E 4B6FA 4D76A 2VVUA 1YPMH 2G00A 3L6PA 2O8UA 3TLOA 3UWJH 2C4FH 3P17H 2PSYA 1O3PB 5BPEA 2H9TH 3LGWA 3UNRA 1W0KD 4Z0KA 3ZZ8A 4Y8XA 4ISLA 5EXLA 1UTPA
chains in the Genus database with same CATH topology
1QZ8A 2J98A 5HIYA 5HIZA 2J97A 1UW7A 3EE7A 5C94A 2J98B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QZ8 A;  2J98 A;  5HIY A;  5HIZ A;  2J97 A;  1UW7 A;  3EE7 A;  5C94 A;  2J98 B; 
#chains in the Genus database with same CATH topology
 1P2K A;  1ANB A;  2QIQ A;  2BLQ A;  1TX6 A;  3MH6 A;  1GWA A;  2BOK A;  3E0N B;  3ENS B;  3S9C A;  1TX8 A;  1CT4 E;  1NPM A;  3MNS A;  2O8T A;  2ZDA H;  1LDT T;  2WUB A;  2F43 B;  4BNR A;  2NU0 E;  3TIT A;  3L33 A;  1YPE H;  1UVO A;  3PM3 A;  3DFJ A;  3U8R H;  4JYT A;  1K28 D;  4X8V H;  2FMJ A;  1A3E H;  3QX5 H;  2VB0 A;  1TE0 A;  4QT8 C;  2IPQ X;  3A7X A;  1TNJ A;  3SQE E;  4DG4 A;  2Y7X A;  2BVX H;  3LGY A;  2BD8 A;  4AZ2 B;  1UCY H;  4D8N A;  5A8Y A;  1NRP H;  1WBG B;  5HMA A;  2RA0 A;  1JOU B;  2AGE X;  2G51 A;  1CGJ E;  4U2W A;  1EP5 A;  1O5C B;  4XBC A;  1O2H A;  1G30 B;  2GJG A;  3VGC C;  3I29 A;  3KQC A;  4CRB A;  1O5D H;  1O3L A;  3OYP A;  4NCY A;  1YYY 1;  1TRY A;  2BY9 X;  1V2W T;  1SGN E;  4CRD A;  1FON A;  3A7T A;  3RXP A;  5C1U A;  4ACA A;  2EI7 A;  3UQV A;  3MHW U;  1ZR0 A;  4HI3 A;  1S83 A;  2DE9 A;  1FY1 A;  2BHG A;  1CBW C;  2BB4 A;  4FUD A;  2OXS A;  1O36 A;  3U28 C;  1T8N A;  1EJN A;  1E34 B;  1BJU A;  3LGU A;  2W7S A;  1W0J D;  1AHT H;  1HNE E;  2ZG0 H;  1O3J A;  4FU7 A;  4ZUH A;  1O2P A;  3OEH D;  5A8X A;  4K1S A;  3U8T H;  1OS8 A;  1YCP K;  3ATK A;  2LEL A;  3EAJ A;  1AUJ A;  4XFQ A;  2QN5 T;  2ZPR A;  1Y8T A;  2BTC E;  5C3N A;  1GMD F;  1UTQ A;  1BMA A;  3KNX A;  5AFY H;  1OWK A;  2ZU5 A;  4X8T H;  1NTP A;  3M7U A;  5EJZ A;  3FKS D;  3A8D A;  4IW4 E;  1P09 A;  2FEQ H;  1C5L H;  1GVZ A;  5HIY A;  1AFQ B;  3KYG A;  2OD3 B;  3CP7 A;  3TPI Z;  4B73 A;  4GPG A;  3T5F H;  3F2H A;  1K1N A;  1AVW A;  2UUY A;  3UWI A;  1O32 A;  1O5G H;  3CNR A;  3MFJ A;  3BTD E;  2DUC A;  1C2K A;  3VB7 A;  2F3C E;  1ORF A;  1LVO A;  3GOV B;  1GJ7 B;  5PTP A;  3W1E A;  4D7F A;  2CJI A;  3SHC H;  1LHG H;  1S0R A;  4ZHA A;  4MLF B;  1GVL A;  1GVK B;  3QTO H;  1S5S A;  2BXU H;  1EAW A;  2VIQ A;  1BTX A;  1DWB H;  2KX4 A;  3UUZ A;  5ABW A;  9LPR A;  5CDF E;  1OYQ A;  5T3H A;  4WWY A;  5F8T A;  1A61 H;  2TBS A;  2H9H A;  2V7Q D;  4WMD A;  1D4P B;  4VGC B;  3TNT A;  1QRZ A;  1SHH B;  2TGP Z;  1SGY E;  1TA2 A;  1UK3 A;  5EU8 A;  3PLP A;  2W26 A;  4RT1 A;  1XMN B;  1BIT A;  1SVP A;  2OK5 A;  2FWW A;  1RS0 A;  4ZCN A;  1L4Z A;  3EE0 B;  1CGI E;  3H7T A;  2O8L A;  4K3J A;  3L3T A;  2IN2 A;  2XOK D;  3Q3X A;  2Z9J A;  1QB6 A;  1TRM A;  1GJ4 H;  4BTU B;  2VJ1 A;  1C2H A;  1LVB A;  3AVZ A;  1L0Z A;  5JBB S;  2ZDV H;  2JKH A;  3QLP H;  2GGV B;  1DUE A;  3SOS A;  4TPI Z;  3U8O H;  3IG6 B;  2KCP A;  3U1I B;  4MQA A;  3BG8 A;  1Z71 A;  2ZI2 H;  1D9I A;  4TYD A;  5DGJ A;  3RXU A;  4ABE A;  1UCY E;  3ATI A;  1TBR H;  3DD2 H;  1ETR H;  5DP5 A;  1G32 B;  5AVD A;  2BLO A;  4Q80 A;  3UTU H;  3URD A;  2WUC A;  4FET A;  1QJ1 B;  5DP9 A;  3FP7 E;  4AOR A;  3RMO H;  2BD4 A;  2Y5G A;  1MD7 A;  1S0Q A;  4R0I A;  4GHQ A;  1Y5B T;  1VZQ H;  1VCP A;  5DP4 A;  1P02 A;  4X6P A;  4NSY A;  2ANM H;  1TGC A;  3A89 A;  1O2S A;  1ELT A;  2AIP A;  1K1P A;  3ZVC A;  1AQ7 A;  1TYN A;  2XYA A;  3FVF B;  2WPH S;  4NG9 H;  4A7I B;  4Z1M D;  1BJV A;  1ZGV A;  1BTP A;  1L1G A;  4GSO A;  2PTC E;  4X6N A;  1XUK A;  2FM2 A;  3SO3 A;  3M3V A;  2TGA A;  4ZXX H;  3ZZB A;  4IN1 A;  1S6F A;  2PKA B;  4FUF A;  3BEU A;  2OQ5 A;  3NK8 A;  1A7S A;  2JET B;  5SGA E;  1HB0 B;  3GCT F;  1FXY A;  1XKB C;  1WCZ A;  2WPD D;  1DX5 M;  1LCY A;  2OC7 A;  1T7C A;  2WSS D;  2XC0 A;  3LC3 A;  4ISI H;  3DFL A;  5GCH F;  4IGD A;  1GHX H;  2FS9 A;  1P2O A;  3LOX A;  2XBV A;  1G3E A;  4BAH B;  1Z8J B;  1BZX E;  2IOT A;  4AGJ A;  3BEF B;  2FYQ A;  4OS6 A;  1GI2 A;  2IPH A;  3O8R A;  3B8J A;  1C5U A;  5DK1 A;  5DPA A;  4FVB A;  1C5O H;  1HAV B;  4XE4 A;  1TMB H;  2QXG A;  1C4V 2;  1DAN H;  1ESA A;  1P3C A;  1C9T A;  1P05 A;  5C1X A;  4JZD H;  5A2M H;  3QWC H;  2ZHD A;  4OS1 A;  2RG3 A;  2GMT B;  3H7O A;  2ZP0 H;  5A0B A;  1E0F D;  1VGC C;  2WYG A;  2PHB A;  2FDA A;  1E38 B;  3FFG A;  2J2U A;  1XUJ A;  1C5Q A;  3Q76 A;  3KEE A;  2WV9 A;  3N7O A;  2ZFF H;  2EI8 A;  1EX3 A;  2Z9K A;  4F4O C;  1SMF E;  2ZO3 H;  1OWE A;  4F48 B;  4I31 A;  3RML H;  4YTA A;  2GX4 A;  2TIO A;  1NT1 A;  1BQY A;  1N8O C;  3SQH E;  1EAU A;  1SC8 U;  3UPE A;  3RMM H;  2Z6B D;  1NRS H;  1SSX A;  2EEK A;  2JJ2 D;  1KTT B;  1EAS A;  1PYT D;  1TAB E;  1GDU A;  3OX7 U;  5AHG H;  4ZH8 A;  3M3S A;  1LQD B;  1Y3W A;  1P0S H;  1HFD A;  4KP0 A;  1DFP A;  1DOJ A;  2JJ1 D;  2GCH F;  3SGQ E;  3TGJ E;  2ZHE H;  1W14 U;  1GBD A;  5IDK A;  1NBM D;  2FS8 A;  1V2S T;  1THS H;  1EJM A;  7LPR A;  1HJA B;  4AYV B;  1P57 B;  1GL0 E;  1QBO A;  1DWC H;  3RXS A;  4DJZ B;  3DA9 B;  3MH4 A;  3KGP A;  1O2M A;  2ANW A;  1WTH D;  2C8Y B;  3QGN B;  1ZLR A;  1CHG A;  1OP8 A;  1VJ9 U;  4GLY A;  1H1B A;  3OFN D;  3RDZ A;  1PJP A;  2ZFQ H;  4Y71 A;  1RRK A;  4NGA H;  5TCC A;  1Q3X A;  1GMH G;  1QY6 A;  2XNI A;  3PTB A;  3SOR A;  2PW8 H;  3SU2 A;  2G55 A;  4A92 A;  1V2J T;  1BHX F;  1RTK A;  3BTQ E;  1MCV A;  1YM0 A;  1IQE A;  1NU7 B;  1SGI B;  3A81 A;  4LK4 A;  1XKA C;  3E90 B;  3SNE A;  2TPI Z;  4I86 A;  1HJ8 A;  3SBK A;  4IC6 A;  2C8Z B;  2YMS C;  2Y5F A;  1ELA A;  1FPC H;  1Z8G A;  3PO1 B;  3RP2 A;  3VG8 A;  2B7D H;  3PWB A;  2BXT H;  2GZ9 A;  5EPN A;  1NY2 2;  3K2U A;  2O8M A;  2Z3E A;  1CA0 C;  3K9X B;  4MVN A;  3SN8 A;  1EQ9 A;  4NA8 A;  4E7N A;  1YCP M;  1GJ5 H;  3V0X A;  1F0T A;  3NKK A;  1MTV A;  5EG4 A;  4WH6 A;  1P3E A;  3PO1 C;  3AW1 A;  3PRD A;  3HAT H;  2AER H;  1GHW H;  2V0B A;  4AG2 A;  1QB9 A;  3A83 A;  2Z9G A;  2F83 A;  5EW1 H;  1GHY H;  3TVJ B;  2Y81 A;  1OWD A;  2C8X B;  1BRU P;  2HPQ H;  3TU7 H;  1BMM H;  2UUF B;  3ZZD A;  1NRQ H;  4Y76 A;  2WPL S;  2BZA A;  5GCH G;  3KL6 A;  1AI8 H;  1H4W A;  1P11 E;  1UTN A;  4MNW A;  5HM9 A;  3VB5 A;  1RIW C;  2PUX B;  3OY6 U;  1MQ5 A;  1TGB A;  1L1N A;  1SR5 C;  4B6E A;  1C2D A;  1GJC B;  1BB0 B;  1G3D A;  4WY3 A;  1H8H D;  5BRR E;  1EJA A;  3O8D A;  3A85 A;  1UO6 A;  1F0U A;  1GG6 B;  1SLV B;  2ZPQ A;  3RLW H;  2VVC A;  2UWL A;  1A0J A;  1OP0 A;  2JH6 D;  2Q6D A;  1Q2W A;  1F5L A;  2FTM A;  4Q2K A;  1GHZ A;  3ZVB A;  1C4U 2;  5DN6 D;  3ZVG A;  3GIC B;  1Y3X A;  2R3Y A;  3F1S B;  3ZIA D;  1OOK B;  2PKS B;  3MU0 A;  5CE1 A;  4FUI A;  2STB E;  3SI4 H;  3G01 A;  2B0F A;  4ABH A;  2FXR A;  1HAY B;  5B6L A;  5EJL A;  2FTL E;  3A7Z A;  1AWF H;  1KMH B;  1PPE E;  3PYH A;  1O2Q A;  3SHA H;  1OKX A;  2FOF A;  3BTM E;  2GDD A;  4BAQ B;  3RUO A;  7GCH F;  3S7K B;  1ZPZ A;  2ZNK H;  5DO4 H;  2AIQ A;  1L4D A;  2HWL B;  2LPR A;  2VVV A;  3GCO A;  3UY9 A;  2VIW A;  1CU1 A;  1KXE A;  1IOE A;  4DT4 A;  1ZJD A;  5FCK A;  5GND A;  3V12 A;  1O2Z A;  1C1V H;  1DPO A;  2ZFP H;  2G52 A;  1C5X B;  3B23 B;  1CT0 E;  1GG6 C;  3OAA D;  1ZSJ A;  1D3T B;  1COW D;  1K22 H;  3SJ9 A;  2F9V A;  3MMG A;  3TK9 A;  3F0O A;  1AE5 A;  1C2L A;  2A5K A;  1CVW H;  5EXN A;  5A8Z A;  2ULL A;  1SGQ E;  3P8N A;  1LHD H;  1SQA A;  1IAU A;  4Q7Y A;  4HZH A;  1AN1 E;  1P9U A;  2WPI S;  1AIX H;  2FX4 A;  1GI6 A;  3HKI B;  1HYL A;  1G3C A;  5TJX A;  2ALP A;  3SV8 A;  1BA8 B;  2Q6F A;  4U32 A;  3KQE A;  1V2U T;  2SGP E;  2ZFS A;  2AMP A;  3M7T A;  4RSP A;  3LH1 A;  2AMQ A;  3BTK E;  3T28 A;  3K65 B;  4CH8 B;  1K1O A;  4OGX A;  3ZZ9 A;  4LOY H;  5I46 H;  3GY3 A;  2VH6 A;  1WTG H;  4GHT A;  4FUH A;  1WAY B;  1Z8R A;  1W7X H;  1P2Q A;  1BTH H;  2BDH A;  2DE8 A;  1V6D A;  1WQV H;  1LTO A;  3PRO A;  1DLE A;  2QXH A;  1EUF A;  2ZGB H;  1YLC A;  3MQK C;  1ZTJ A;  4K1T A;  4ZAE A;  2L74 A;  1G3B A;  2KCA A;  1TRN A;  3RXB A;  1BRA A;  1TAL A;  2GKV E;  1EOL A;  1QRW A;  4CH2 B;  4E7R G;  5A09 A;  4NZQ A;  1GJ9 B;  1TQ0 B;  3DUX H;  3EE7 A;  1AE8 H;  2BDC A;  2H1U A;  3R0F A;  4Z6A H;  5C0U A;  5E0J A;  2VWO A;  2J98 B;  3KN2 A;  1V2K T;  1JRS A;  2WPK S;  4WME A;  3FZD A;  1BTW A;  5GWZ A;  2Z7F E;  4SGA E;  1YBW A;  2ZDN A;  3A7Y A;  1FAX A;  4NFE A;  1HAV A;  2A4Q A;  1HDT H;  3ZVA A;  1O3E A;  2B5T B;  1C1T A;  3NWU A;  3LIW A;  1C1Q A;  2EY4 C;  1FIZ A;  1QTF A;  5LPF A;  1LPK B;  2BLW A;  3E16 B;  4JYV H;  1EAT A;  2ZIQ H;  3SV9 A;  3DHK H;  2F4L A;  3QTV H;  1P01 A;  3SV7 A;  4KTC A;  3UIR A;  1BUI A;  4YOG A;  1YPJ H;  5HIZ A;  1O31 A;  3KQD A;  1LPZ B;  1O34 A;  3GCH B;  1SGE E;  3E8L A;  1SHY A;  4OGY A;  2AMD A;  3BG4 C;  2J95 A;  4Y7A A;  4NA7 A;  1O2L A;  2HOB A;  4O3U A;  1ZOM A;  1K1L A;  3EGK H;  2FOB A;  2FYR A;  4Q7X A;  3VB4 A;  4Y0Z E;  8LPR A;  1O3N A;  3BTG E;  4XOJ A;  3F68 H;  5JDU B;  1FQ3 A;  1W13 U;  1ELD E;  1GL1 A;  2FZZ A;  4Y79 A;  5E0H A;  2Y82 A;  3O8C A;  3TH2 H;  1C1S A;  2W6J D;  2OBO A;  1TMU H;  4CHA B;  2A4O A;  3MO9 A;  1SOT A;  4P02 A;  1W2K H;  1TPA E;  4ABB A;  1O2G H;  2L6O A;  2WV5 A;  4X2V A;  2V6N A;  2NU4 E;  2C3S A;  3TIU A;  3LGV A;  3BIV H;  4K8B A;  5CHB A;  2UWP A;  1YLD A;  3EA9 A;  5I25 A;  3T62 A;  3MH7 A;  1SGT A;  2ANY A;  5C2Z A;  1NFW A;  3LDX H;  1G9I E;  1XUG A;  1OX1 A;  4ASH A;  1O5A B;  2HLD D;  4AX9 H;  1AVX A;  1GMH F;  1GI5 A;  1O0D H;  1NFU A;  4FUE A;  1KXF A;  3NUM A;  1GPZ A;  1TOC B;  2FOA A;  1C2E A;  2ZQ1 A;  1CO7 E;  6CHA B;  1TGS Z;  1IHT H;  3JZ2 B;  1HPG A;  1TNK A;  1D6W A;  2C90 B;  3NXP A;  1GBA A;  1NO9 H;  1GI3 A;  3FAN A;  3EQ0 H;  1F5K U;  3RMN H;  3V13 A;  2V3M A;  1GI8 B;  1TFX A;  4JZF H;  5G4B A;  1YC0 A;  2PKA A;  2GCH G;  2FOD A;  3I78 A;  2OC1 A;  3Q3K A;  2OLG A;  1KLJ H;  1C1M A;  4X1N U;  4HG6 A;  2EI6 A;  1AO5 A;  3A8B A;  4J1Y A;  2PR3 A;  1G36 A;  5CMX H;  3QZQ A;  2CGA A;  2BVR H;  2OQU A;  2P3F H;  4FXG H;  4E06 H;  1KTS B;  3V3M A;  2AFQ B;  1LQE A;  2GCT B;  3TJN A;  1EZQ A;  5EST E;  1EOJ A;  3TGI E;  2NU2 E;  1AFE H;  4Q4L A;  5C20 A;  3VXF H;  5A0C A;  1DM4 B;  3R3G B;  1JXP A;  2ZU3 A;  2BVS H;  2QA9 E;  5EGM A;  1RIW B;  2CHA B;  2PGB B;  2B8O H;  3WWB A;  2RDL A;  2XTT B;  3SUG A;  1Y3U A;  4ZXY H;  3SJI A;  1O30 A;  2GDE H;  1HCG A;  4KGA A;  2I6S A;  4Y8Z A;  3RU4 E;  1F2S E;  3JZ1 B;  1O2V A;  2P8O C;  2SNV A;  4YOI A;  1EP6 A;  1H8I H;  1O2X A;  1UVS H;  1C5W B;  2PLX A;  3PV4 A;  3S9A A;  2THF B;  2FI4 E;  3BTF E;  1ZML A;  5DP3 A;  2ZPS A;  1H9H E;  1Y3Y A;  2QF3 A;  2ZTX A;  2VIV A;  3P70 B;  1G2L A;  2IJO B;  2XBW A;  5E2P A;  3AAS A;  5GXP A;  1MKX K;  4ABI A;  1GCT B;  4YOJ A;  3VB3 A;  2RA3 A;  4DUR A;  3VPK A;  1EPT A;  4WXV A;  5F8X A;  5EJ1 A;  4Q63 A;  1C1U H;  1C9P A;  4ABJ A;  1B7X B;  1XUH A;  1EAI A;  1O3G A;  4FVD A;  3T27 A;  1BDA A;  1NBM E;  3H5C B;  1GBT A;  3E3T A;  1MUE B;  1SGF G;  1B0F A;  3SJO A;  5JB8 S;  1MU8 B;  4TWW A;  1QB1 A;  3URC A;  1ESB A;  2Z94 A;  1BTY A;  4CRA A;  5JBA S;  1TX7 A;  1HJ9 A;  1Z8I B;  1N8O B;  1CA0 B;  3DT0 H;  1YPL H;  2OIN A;  1P9S A;  1EZU C;  4K1E A;  5JB9 S;  2G8T A;  4RKJ B;  1YF4 A;  2Q6G A;  2Q1J A;  3GYM A;  4F49 A;  2F9B H;  4ZKS U;  4JCN A;  3MNB A;  3T2N A;  1AFQ C;  1ZHP A;  5FXL A;  3A84 A;  4INH A;  4NIY A;  4YT7 H;  3A88 A;  1SLX B;  1C5V A;  1O2W A;  1UJ1 A;  4YT6 H;  3ATL A;  3NZI A;  3A8A A;  8GCH F;  5GIB A;  1O3I A;  1WOF A;  1W10 U;  1TWX B;  1GCT C;  2WZQ A;  4PRO A;  1LMW B;  2A31 A;  4FU8 A;  5C5O A;  2VU8 E;  2C93 B;  4NWL A;  1PQ8 A;  4D9R A;  1LHF H;  5FCR A;  3KYF A;  2YNA A;  3E1X B;  2P95 A;  4RI0 A;  4UEH H;  1MAB B;  1VIT H;  3PMH B;  5C0T A;  5F03 A;  4AB8 A;  1AKS A;  2ZHQ H;  1TGT A;  4X1P U;  2ZGX H;  4HGC A;  1VR1 H;  1P04 A;  2KR7 A;  3K6Z A;  1UVT H;  1MBQ A;  4FU9 A;  1W11 U;  4UDW H;  5DG6 A;  2SFA A;  3WY8 A;  1GJA B;  4CR5 A;  3TH3 H;  2PKS C;  1AZZ A;  3NPS A;  1A0L A;  1A5I A;  2BD3 A;  1ANC A;  5H4I B;  2LNC A;  1PPG E;  4YO9 A;  1XVM A;  1GI9 B;  2ZU1 A;  3QDZ B;  2WV4 A;  3TJU A;  2W7U A;  2CK3 D;  3T29 A;  1ELC A;  1GHA G;  2JH5 D;  4TY7 A;  4CR9 A;  3M5O A;  4RKO B;  4XSK U;  3F9H A;  1BTZ A;  3RM2 H;  1EAX A;  1GI1 A;  4Y10 E;  1GBE A;  1MKW H;  1QRX A;  3SZN A;  1GI4 A;  4DT7 B;  1QHR B;  3ZZ3 A;  4NIX A;  1BML A;  4K2Y A;  1CSO E;  2CF9 H;  2PP6 A;  1E1Q D;  1LKB A;  4LXB H;  3RXV A;  2OTV A;  5L30 H;  2ZEC A;  2ODP A;  3URE A;  1SLW B;  1YGC H;  3IWM A;  4DOQ A;  2FLR H;  7GCH G;  3KHV A;  1SLU B;  2KM0 A;  5C67 A;  2XND D;  1GBK A;  4BXS A;  4XRN A;  1WXR A;  1AGJ A;  3UAI C;  3P8G A;  4X0W U;  1QJ7 B;  3UOP A;  1F7Z A;  1TQ7 B;  2GZ7 A;  2H5D A;  2VIP A;  2ZDL A;  3LPR A;  3OSY A;  4XBB A;  3GY2 A;  4X1Q U;  1HRT H;  1C1O A;  2K1Q A;  2ODQ A;  1C2M A;  1TB6 H;  1ZTK A;  2AHM E;  4FUG A;  4CRF A;  1ACB E;  1CQQ A;  1MTW A;  2P94 A;  3FP6 E;  5FAH A;  3LJJ A;  2H2Z A;  3Q00 A;  5GDS H;  2QAA A;  1HAZ B;  2CN0 H;  1O3O A;  1GMD G;  1MBM A;  2ZHW H;  2F9O A;  3SJ8 A;  2ZCL P;  3BIU H;  2HGT H;  3FN8 A;  2ODY B;  1FY8 E;  1K21 H;  1A0H B;  2R0K A;  4NFF A;  1KYN A;  3ATM A;  1IQH A;  3RXM A;  2KAI B;  1DST A;  3MYW A;  1UTM A;  3QGJ A;  3PLK A;  1WU1 A;  1DUA A;  1SGF A;  1JWT A;  3P8O A;  1GHA F;  2RDE A;  3A87 A;  1FMG A;  2W6I D;  2SGD E;  1FNI A;  3F6U H;  4WVP E;  4B2A A;  3M36 A;  3O8B A;  2Z9L A;  1AZ8 A;  3ATW A;  4MNV A;  1RXP A;  1KLT A;  2EQN A;  4J2Y B;  5LH8 A;  2CHA C;  1HXE H;  3WW7 A;  2VH0 A;  1PYT C;  2NU3 E;  1MTN C;  3KQB A;  4NIV A;  3LKW A;  1W3C A;  3UB0 A;  5AF9 H;  2ZHF H;  2GZ8 A;  3FP8 E;  4B2C A;  1T4U H;  1MZD A;  2ZCH P;  2D2D A;  4ACB A;  8GCH G;  2ILN A;  1ARB A;  2PTN A;  4YZU A;  1ZSK A;  3U9A H;  1V2R T;  1KY9 A;  1XVO A;  5DP6 A;  3I77 A;  4JK6 A;  5KEC A;  2AGI X;  3QUM P;  1VCW A;  1UHB B;  4IS5 A;  3TH4 H;  3MU4 A;  1MZA A;  3CS0 A;  3GY8 A;  1O3D A;  4I33 A;  4WH8 A;  1QFK H;  3SJK A;  4Y0Y E;  2CMY A;  3ELA H;  3RU4 T;  3TNS A;  1O3A A;  1EPT B;  1OXG A;  3VEQ B;  1OWH A;  5DP7 A;  1AD8 H;  2KFW A;  3P6Z B;  1QBV H;  1HIA B;  3RXT A;  1GBB A;  3SI3 H;  1KDQ A;  1RTF B;  1V2M T;  1ELF A;  3OTJ E;  5EOK A;  3AW0 A;  1TNG A;  1YY3 A;  1ZPC A;  5C5N A;  5GPI B;  4X6O A;  1O2N A;  3PV2 A;  2J5U A;  2GMT C;  1UCY K;  2G4U A;  4WXI A;  2QXJ A;  1NRO H;  5EQQ A;  4AFQ A;  2F9U A;  2WPJ S;  4HFP B;  2XWB I;  3SUF A;  2A2X H;  2HVY B;  1P10 A;  4RN6 A;  1O33 A;  1YPG H;  1N6Y A;  4JMY A;  1INC A;  1SFQ B;  1O2J A;  1ZHM A;  1UK2 A;  2A7J A;  1QJ6 B;  3K6Y A;  7EST E;  1O5E H;  1WDI A;  4OS2 A;  4THN H;  4UFE H;  2FOE A;  1XUI A;  1HAP H;  2ZDM A;  1BBR H;  3ODD A;  1THR H;  1P8V C;  5F6M A;  4UON A;  2FX6 A;  1MKX H;  1SQT A;  1VIT F;  3MTY A;  1TBQ H;  4XBD A;  3F9G A;  2WYJ A;  5EQS A;  1Y59 T;  4Y11 E;  2ZCK P;  3SU5 A;  5C17 A;  2D1J A;  2ZGC A;  2ZGJ A;  2PUQ H;  2XC5 A;  2WHX A;  1IQM A;  5C1Y A;  4ASU D;  1H8E D;  5F8Z A;  2P16 A;  5CHA B;  3RXJ A;  1ZTL A;  1X7A C;  4P00 A;  3RXL A;  6EST A;  1YPK H;  1QA0 A;  1TBZ H;  1M9U A;  1ETS H;  2ZF0 H;  1O2T A;  1NN6 A;  1SGC A;  1V2N T;  1ID5 H;  2QF5 A;  4HTC H;  3RXR A;  4INL A;  2R3U A;  1SL3 A;  3ZZC A;  1WQS A;  3GCN A;  3Q77 A;  6GCH G;  1OPH B;  1YPH C;  5DP8 A;  9EST A;  5ETX A;  3F2G A;  1C5Z B;  3GY7 A;  4XD7 D;  3IIT A;  2VWL A;  4Y8Y A;  1O39 A;  2H5C A;  3D62 A;  4KTU A;  4LZ1 H;  2GTB A;  1SGP E;  2F9P A;  2EA3 A;  2ZQ2 A;  3BF6 H;  4AYY B;  1GI7 B;  2PFE A;  3M35 A;  2RFK C;  1TOM H;  3UOU A;  1C1P A;  1XX9 A;  4BAO B;  3EA7 A;  3B9F H;  2AH4 X;  4CRE A;  5TCA A;  1ABJ H;  1O3F A;  5FPY A;  1FX0 B;  1BIO A;  5ESB A;  2G5V A;  3F0P A;  2ZTY A;  3GDV A;  4M7G A;  2O8W A;  4KEL A;  4AFU A;  1TPP A;  2M2A A;  2C8W B;  1HBT H;  3OTP A;  4O97 A;  1FY5 A;  4A1T A;  4AGK A;  2ZDK A;  4ISN A;  2ZFT A;  1RJX B;  3NRL A;  2Y5H A;  3GIS B;  4M9F A;  3RC6 A;  1ZRK A;  2VGC B;  1GJD B;  5EPY A;  3GDU A;  1CGH A;  4AOQ A;  3M3T A;  2ZZU H;  4YES B;  1DWE H;  2ANK H;  2AGG X;  1C5T A;  1ELG A;  3HPT B;  3OU0 A;  1TPS A;  1C2J A;  1HGT H;  1O2U A;  1SQO A;  3A82 A;  2BQW B;  1GBL A;  1L2E A;  4X6M A;  1EKB B;  2BD5 A;  1V2T T;  4X8U H;  1P06 A;  5HXF A;  1EFR D;  2FP7 B;  1VGC B;  4I8H A;  4NA9 H;  2ZFR H;  2OC0 A;  1VKY A;  4DGJ A;  3RLY H;  1SGD E;  3E0P B;  2XXL A;  1F0S A;  2FI5 E;  2V35 A;  3ZV8 A;  3D23 A;  2XWA A;  1FY4 A;  2D26 C;  3SGA E;  3RXD A;  1OSS A;  1VCQ A;  2R9P A;  2Z9I A;  2UUJ B;  2BZ6 H;  1P03 A;  1MU6 B;  2ZA5 A;  3RC4 A;  2A1D B;  1LO6 A;  3TK6 A;  2BDI A;  1WSS H;  1NRN H;  3WWF A;  1P2M A;  1T31 A;  1KXD A;  2V3H H;  1XM1 A;  2RCE A;  4MPX A;  1D3Q B;  5LPE A;  1H9I E;  4K60 A;  1J8A A;  2JET C;  2Z3D A;  1FN8 A;  1IQL A;  1C1W H;  1DY9 A;  1JIM A;  2BD9 A;  3PTN A;  2A45 B;  2EST E;  1GMC F;  3RXC A;  4RT0 A;  1V2Q T;  3BTH E;  3QN7 A;  5J4Q A;  1QL9 A;  5EQR A;  4YLU A;  2G81 E;  3F3B A;  3N99 A;  3V7T A;  1V2L T;  2BD2 A;  2A2Q H;  2H6M A;  2B9L A;  1EXF A;  1HXF H;  4JZE H;  3GCT G;  1NZQ H;  3GDS A;  1GBF A;  5EW2 H;  2FI3 E;  4ZKO U;  1HLT H;  4ZHL U;  1S82 A;  2FLB H;  3PB1 E;  3RXE A;  4MPU A;  2P3T B;  1YKT A;  1UVP A;  1RTL A;  1ZPB A;  1T8L A;  3A7W A;  3H09 A;  1RGQ A;  5JBC S;  1TLD A;  2F9N A;  1DIT H;  1ZGI A;  2XRC A;  2SGE E;  1J14 A;  2H9E H;  3QO6 A;  1T8M A;  1XUF A;  1HAO H;  4A1X A;  3PMB B;  4CBO A;  2UUK B;  1NRR H;  2A7H A;  1O3K A;  4ZHM U;  2HAL A;  5F53 A;  3SUE A;  1FLE E;  5HGG A;  3UNQ A;  2Y80 A;  4ABG A;  1HV7 A;  1BTU A;  1WV7 H;  1FUJ A;  1EPT C;  1PQ7 A;  3E6P H;  1Z1J A;  3VXE H;  2P3U B;  1LHE H;  2BYA X;  3ZV9 A;  4AC9 A;  4K5Z A;  1SGR E;  4UFF H;  4K8Y A;  2OBQ A;  2I6Q A;  3SW2 B;  1FDP A;  2CV3 A;  2UWO A;  2A4G A;  4JK5 A;  1J15 A;  2A5A A;  1K0H A;  1O2K A;  1GDN A;  5DJ7 A;  2ZU4 A;  4KKD A;  1RD3 B;  1YLN A;  2GP9 B;  4TWY A;  4TT3 D;  1C5M D;  3D65 E;  4JYU H;  1NC6 A;  3BTE E;  1S84 A;  1CE5 A;  3SZE A;  5EOD A;  1GBH A;  4MPW A;  1S6H A;  3F9F A;  2VIN A;  5E8E H;  5AFZ H;  5EXM A;  3RXF A;  3M61 U;  2GD4 B;  3GY6 A;  4UFD H;  1SBW A;  5KED A;  3U1J B;  2VBC A;  1DDJ A;  3SND A;  4BAK B;  3LJO A;  2WPM S;  1MTS A;  3MU5 A;  3ZVF A;  1Z7K A;  3S0N A;  3LC5 A;  1EZX C;  3DSP A;  2BY8 X;  1AB9 C;  1HAI H;  3PMA B;  1KSN A;  3LON A;  2ZKS A;  3UNS A;  3OEE D;  2SGF E;  3ODF A;  4DW2 U;  1K1J A;  3LT3 A;  1A2C H;  3N7D A;  3ZYD A;  1FV9 A;  5B6O A;  4Y6D A;  3A7V A;  3HKJ B;  2QV1 A;  1P2I A;  1D3P B;  1ABI H;  2AEI H;  1FY3 A;  1AY6 H;  1GHV H;  1SG8 B;  4IMZ A;  1K9O E;  1FPH H;  1C4Y 2;  1V2V T;  5FHT A;  3UFA A;  3SU3 A;  4BXW A;  1H9L B;  1E37 B;  4BOH A;  1V2P T;  2GCT C;  1VJA U;  6LPR A;  3RXQ A;  1NU9 A;  3W95 A;  2G5N A;  3ZVD A;  4B76 A;  3MNX A;  3STJ A;  2VIO A;  5L2Z H;  1QNJ A;  2FIR H;  4ISH H;  1W0Y H;  1BOQ A;  1E35 B;  3M5L A;  2BD7 A;  3SV2 H;  2BM2 A;  3M5N A;  3KID U;  1QUR H;  1TNI A;  4A1V A;  4CHA C;  3SV6 A;  1GHB G;  4O3T A;  1C2I A;  1JBU H;  1W0Z U;  3MWI U;  2W3K A;  3DSO A;  1YPH E;  5DKM A;  2ZEB A;  1OHH D;  1DSU A;  4E05 H;  2YMS D;  3QZR A;  1ZYO A;  1YP9 A;  1T32 A;  2XCF A;  1Z6J H;  1GGD C;  3F9E A;  4GVU A;  1C5N H;  1G2M A;  4R8T B;  4CBN A;  1C2G A;  4MDS A;  4MG3 A;  2BMG B;  2KCO A;  1UTK A;  1F0R A;  1CHO G;  4D7G A;  1IHS H;  1HJA C;  1QZ8 A;  1XXD A;  1ZZZ A;  1BMF D;  1P12 E;  2A5I A;  4IMQ A;  2ALV A;  1PPF E;  1N6X A;  1QL7 A;  2J34 A;  4GCH G;  3SNC A;  3KCG H;  4CRC A;  4AFS A;  3DCL A;  1CBW B;  1KIG H;  3BV9 B;  3MO3 A;  1CA8 B;  3MI4 A;  4ZKN U;  1THP B;  2QYI A;  5HKK D;  5T1V A;  1TNL A;  1F92 A;  3PRB A;  1IQG A;  3SU6 A;  3TJV A;  2NU1 E;  2OCV B;  2BY5 X;  4GCH F;  1BHX B;  3VB6 A;  6GCH F;  1DXW A;  4K69 A;  1GBM A;  4ISO A;  4OS7 A;  3RM0 H;  1UW7 A;  2ASU B;  1ZRB A;  2FOM B;  3GYL B;  1O3C A;  1TA6 A;  3GY5 A;  2QF4 A;  1CHO F;  1E1R D;  3STI A;  4X1R U;  1XXF A;  1NFX A;  2XW9 A;  3S7H B;  4ZMA H;  1TNH A;  2D8W A;  4INK A;  1DY8 A;  4D9Q A;  4OM9 A;  1O38 A;  1BRB E;  1W7G H;  1O2R A;  2IJD 1;  3ITI A;  1C1R A;  1IQI A;  5IYT A;  3SUD A;  1ZMN A;  3ZVE A;  1MD8 A;  1W8B H;  3CS7 A;  1KXA A;  3BTT E;  1BBR K;  1FAK H;  4O9V A;  1J16 A;  1V3X A;  1QCP A;  1KXB A;  1O3H A;  1PPZ A;  2HRV A;  1GHB F;  1E79 D;  1MKW K;  2P59 A;  1DT2 A;  1HIA A;  1HUT H;  1HAX B;  3PV5 A;  1LHC H;  5FPT A;  2CF8 H;  2J38 A;  3C27 B;  3M7Q A;  4I8G A;  4I32 A;  1F5R A;  1YCP H;  5J4S A;  3RC5 A;  1J17 T;  1KLI H;  2YNB A;  1EZS C;  5A0A E;  1K1M A;  2EC9 H;  3LH3 A;  2BQ6 B;  1DVA H;  1C2F A;  3SYJ A;  1QA7 A;  3BG4 B;  4KTS A;  1O5B B;  1GBJ A;  1PPC E;  1TIO A;  4FUB A;  1UHB A;  4CRG A;  2XC4 A;  1TMT H;  3BEI B;  4X8S H;  8KME 2;  2QE7 D;  1TGN A;  1Q31 A;  4U01 A;  3A86 A;  3FAO A;  4TPY A;  2J92 A;  1ARC A;  3EDX B;  4ABD A;  2P8O B;  5HYO A;  1D3D B;  2GV6 A;  1ETT H;  3U69 H;  2JDI D;  4AN7 A;  2GV7 A;  4BTI B;  1O35 A;  1AU8 A;  2GT8 A;  3MU1 A;  1OWI A;  3A8C A;  2K8I A;  1MMJ N;  2BDG A;  1UK4 A;  2J4I A;  3HGN A;  5IK2 D;  2ZC9 H;  1AKS B;  3SU1 A;  1A46 H;  3VGC B;  4AB9 A;  4UD9 H;  2YMS B;  3RXO A;  4MNY A;  1MAY A;  3ZZ5 A;  1MAX A;  1EB1 H;  1A5G H;  1O5F H;  1CT2 E;  4H42 U;  5FBE A;  1FIW A;  4BTT B;  5C94 A;  2LP6 A;  1UMA H;  1NFY A;  2KCY A;  1S85 A;  5T6G A;  1E36 B;  1JIR A;  4H6T A;  3SU0 A;  1LKA A;  4IC5 A;  4VGC C;  1VIT G;  3SGB E;  4B75 A;  1A5H A;  4WMF A;  1KDQ B;  4YLQ H;  1DIC A;  2CXV A;  2OUA A;  4Y7B A;  3RXK A;  1GDQ A;  1O2Y A;  2XBY A;  3D49 H;  5JPM H;  4AG1 A;  1MTU A;  1SOZ A;  1S6L A;  3PMJ A;  3BSQ A;  3MOC A;  3ZZA A;  6CHA C;  1QGF A;  1O37 A;  1TPO A;  1A1R A;  1GJ6 A;  2GVF A;  3KF2 A;  2J98 A;  1SFI A;  5CHA C;  4FUC A;  1LVM A;  2TGT A;  1OP2 A;  2BDY A;  4ZRO A;  1Y3V A;  3BN9 A;  5K0H A;  1QQU A;  2AS9 A;  2W5E A;  3U98 H;  1C5P A;  4BAN B;  4A6L A;  1ELE E;  4U30 A;  4IBL H;  4GAW A;  5FX5 A;  1GCD A;  5K7R A;  2R2W U;  5FL7 D;  2Y7Z A;  1NS3 A;  2HVX A;  1GJB B;  2ZTZ A;  1ZHR A;  1JRT A;  1WUN H;  3AK5 A;  2SGQ E;  1QL8 A;  3SNA A;  2VID A;  3TJO A;  1GJ8 B;  1UTO A;  1DE7 H;  2QF0 A;  1MTN B;  1SI5 H;  3ZZ7 A;  4MNX A;  4NWK A;  2PSX A;  1C5R A;  5L6N H;  2BDA A;  1FI8 A;  3LGI A;  1TAW A;  1ELV A;  2KZ4 A;  3UR9 A;  2FO9 A;  5EIY A;  2O9Q A;  2HPP H;  2KAI A;  3AAV A;  1ZJK A;  5FBI A;  3RXG A;  3QK1 A;  2P93 A;  3DSG A;  3A80 A;  1G37 A;  1U6Q A;  4I8L A;  3P95 A;  1C5Y B;  3AAU A;  3MH5 A;  3P8F A;  2BY7 X;  3ZYE A;  1IQK A;  2QCY A;  2AYW A;  2Z3C A;  1UTL M;  4H4F A;  2FOC A;  1Y5U T;  1AWH B;  4NZL A;  1C5S A;  1MH0 A;  3OY5 U;  3S9B A;  2QGR A;  3HGP A;  3CEN A;  4TSF D;  1O3M A;  1K1I A;  1QIX B;  4ZKR U;  2VGC C;  3P92 A;  1GMC G;  3EST A;  1BRC E;  1RFN A;  2BDB A;  4B74 A;  2SGA A;  2G4T A;  2QY0 B;  1DLK B;  3GS9 A;  1O2I A;  2BX4 A;  1HAG E;  1HAH H;  1AVG H;  3HK6 B;  4I8K A;  1FN6 A;  4MTB A;  1GGD B;  3GY4 A;  4FUJ A;  1ZMJ A;  4O03 A;  1Z6E A;  5JBT A;  3GCH C;  1B0E A;  4NIW A;  5E0G A;  4I7Y H;  1AMH A;  3NCL A;  3E91 A;  3C1K A;  1H8D H;  1KXC A;  1J9C H;  1YWU A;  1BT7 A;  1Y5A T;  3RXI A;  3PLB A;  4MPV A;  1ANE A;  2J9N A;  3MU8 A;  3Q3Y A;  1ELB A;  4UFG H;  1WYK A;  3FZZ A;  1MQ6 A;  4XDE A;  1IQF A;  3F2F A;  3RXA A;  2FOG A;  1AND A;  1A3B H;  1V2O T;  3LU9 B;  1D6R A;  2XBX A;  5GJ4 B;  5DSF A;  2A0Q B;  2J94 A;  3EA8 A;  4IN2 A;  5E2O A;  4B71 A;  2A7C A;  2FOH A;  4X1S U;  2Y6T A;  2TRM A;  1QQ4 A;  1IQJ A;  2ZU2 A;  3SNB A;  4H6S B;  1QBN A;  2BQ7 B;  5T6D A;  4TY6 A;  4X2Y A;  1OWJ A;  1BBR E;  1FJS A;  1IQN A;  3RU4 D;  2OC8 A;  4OS4 A;  2TGD A;  2HNT E;  1LVY A;  1L1J A;  4EST E;  2J97 A;  2W3I A;  1DXP A;  5LGO A;  3SU4 A;  2BX3 A;  1QR3 E;  3VFE A;  3S69 A;  3TGK E;  1A4W H;  2YOL A;  2GT7 A;  3OE7 D;  1SPJ A;  1EB2 A;  2ZGH A;  1T4V H;  2NWN A;  2STA E;  4WJG 2;  5LPR A;  1FZZ A;  4UE7 H;  4NSV A;  3PWC A;  3T25 A;  5L2Y H;  1PQ5 A;  2JH0 D;  2XCN A;  2FPZ A;  4WF8 A;  3W94 A;  2BY6 X;  4DCD A;  4B2B A;  2VWN A;  1T8O A;  1SQR A;  4B1T A;  2HNT C;  1K2I 1;  2K0Q A;  4DVA U;  2WIN I;  1EST A;  1P2N A;  2PGQ B;  3MNC A;  1GBI A;  2A4R A;  4ABF A;  1BCU H;  4X2W A;  2SNW A;  3UR6 A;  4JZI A;  2HLC A;  7KME H;  2JIZ D;  5JYI A;  2F91 A;  3N7E A;  1SKY E;  3M5M A;  2A32 A;  2M5T A;  4DIH H;  3EYD A;  1PPH E;  4I8J A;  5KGO A;  1O2O A;  4JZ1 A;  2BOH B;  1UTJ A;  3MO6 A;  1GBC A;  4Q7Z A;  1LPG B;  1OYT H;  8EST E;  1NM6 A;  1AUT C;  3UQO A;  3KQ5 A;  3RXH A;  1P2J A;  3BTW E;  1JMO H;  3TK5 A;  4BAM B;  2FES H;  1Z1I A;  2V3O H;  3ZZ6 A;  4DY7 B;  1PPB H;  2ZWL H;  1B5G H;  4LZ4 B;  2HNT F;  2QC2 A;  3FOA A;  4GUX A;  5FX6 A;  2PWX A;  2PV9 B;  1SB1 H;  1TON A;  2QXI A;  5FPS A;  1DWD H;  1NES E;  4YM9 A;  4FOU C;  1C1N A;  3LGT A;  3FO8 D;  1O3B A;  1W12 U;  1PQA A;  1ZSL A;  4A5T S;  3ZZ4 A;  4AFZ A;  1N1L A;  1AB9 B;  2VNT A;  2R2M B;  2BLV A;  1MCT A;  5T6F A;  3HK3 B;  5HM2 A;  1S81 A;  3M37 A;  4YXW D;  2OP9 A;  4ABA A;  4SGB E;  4DII H;  1UVU H;  2VWM A;  1PFX C;  4OS5 A;  4F55 A;  2R0L A;  3T26 A;  4X2X A;  1BMN H;  1GI0 A;  1DS2 E;  4B6F A;  4D76 A;  2VVU A;  1YPM H;  2G00 A;  3L6P A;  2O8U A;  3TLO A;  3UWJ H;  2C4F H;  3P17 H;  2PSY A;  1O3P B;  5BPE A;  2H9T H;  3LGW A;  3UNR A;  1W0K D;  4Z0K A;  3ZZ8 A;  4Y8X A;  4ISL A;  5EXL A;  1UTP A; 
#chains in the Genus database with same CATH homology
 1QZ8 A;  2J98 A;  5HIY A;  5HIZ A;  2J97 A;  1UW7 A;  3EE7 A;  5C94 A;  2J98 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...