2J98A

Human coronavirus 229e non structural protein 9 cys69ala mutant (nsp9)
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
106
structure length
106
Chain Sequence
EIMPGKMKVKATKGEGDGGITSEGNALYNNEGGRAFMYAYVTTKPGMKYVKWEHDSGVVTVELEPPARFVIDTPTGPQIKYLYFVKNLNNLRRGAVLGYIGATVRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords REPLICASE POLYPROTEIN 1AB
publication title Variable Oligomerization Modes in Coronavirus Non-Structural Protein 9.
pubmed doi rcsb
source organism Human coronavirus 229e
molecule tags Rna binding protein
total genus 21
structure length 106
sequence length 106
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2006-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08710 nsp9 nsp9 replicase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.250 Mainly Beta Beta Barrel Thrombin, subunit H Replicase NSP9 2j98A01
2J98B 2J97A 1QZ8A 5HIYA 5HIZA 5C94A 1UW7A 2J98A 3EE7A
chains in the Genus database with same CATH superfamily
1T32A 3U8TH 1DSTA 3A7ZA 1GHBF 2ZECA 1GI3A 5C5OA 2WZQA 2ZDKA 3F2FA 3PV2A 1S83A 4DG4A 1TX6A 2ZO3H 2ZTZA 2P3TB 3OFND 2SGDE 4H42U 1ELDE 1AMHA 1FY5A 1G36A 2CXVA 4TSFD 2Y5FA 4WVPE 4D76A 4K60A 1VGCC 3F9FA 3RXUA 5A8XA 2LPRA 3DUXH 1ABIH 2OC8A 1GI2A 9LPRA 1VITH 4JYTA 2GCTB 1TGCA 1YLNA 4HFPB 2QF5A 2FS8A 3RLYH 1DVAH 5GJ4B 1YPEH 2VVUA 2QC2A 3PM3A 1BIOA 1O2QA 3M3SA 3SHCH 1GMDF 1SGYE 2XC5A 3S9AA 1IQGA 2KZ4A 1E1QD 3PMJA 1LPGB 1Y3XA 4ABIA 1C9PA 3A8AA 1SLWB 3SV8A 3RXCA 1ZR0A 2A5IA 4ABHA 2F9UA 2CMYA 2ALVA 4BTUB 2ZHFH 3RM2H 1QURH 2OCVB 5GPIB 1O2VA 3PO1B 3MTYA 1FLEE 1KXEA 2BD4A 3SJIA 3V0XA 3KQCA 2FTLE 5HXFA 5TJXA 4ABBA 2BOKA 1A0JA 3PLKA 5EGMA 3T2NA 1S6LA 2JJ2D 2O8WA 2Y7XA 3AVZA 4GCHG 3M35A 1W10U 3PRDA 1ZGVA 3LONA 1NPMA 3S0NA 1ZMJA 5ABWA 1ANCA 1CGJE 4H4FA 3V7TA 4R0IA 3LGWA 1V2NT 3DA9B 1WAYB 2ZCLP 2HVXA 3A86A 4GSOA 2PSXA 2OBQA 2Z6BD 4MTBA 8KME2 1EAIA 1SLUB 1BQYA 4H6TA 4K8BA 4I8JA 4X1PU 1Z6EA 1EJAA 2B8OH 2BXTH 8GCHG 1JOUB 4IC5A 1TGBA 2GT7A 1MCVA 2TGPZ 4A92A 1QB6A 4F55A 3LDXH 3UFAA 2RDEA 3Q76A 4Q63A 2ZDAH 1K21H 2KCAA 3GY7A 3O8DA 4DW2U 1O5GH 1Z1IA 2HALA 1P2IA 4RSPA 2BQ6B 2KAIB 2FYRA 1CQQA 5F6MA 1YPLH 4A7IB 1PPHE 4YLQH 4K1SA 1DLKB 1F0TA 1ZTJA 1JRSA 4Q7XA 4FUCA 1CHGA 1P2OA 3ZZDA 4D9QA 1VCWA 2GV7A 1DXPA 1AFQC 1OOKB 3CS7A 2J95A 3UQOA 3GYLB 1O2YA 1P3CA 1Z1JA 2KFWA 1UTKA 2BZ6H 3B8JA 3NK8A 3L6PA 1QZ8A 1LPKB 4D9RA 1PYTD 2V3OH 2AGEX 2ZHWH 2WUBA 2PWXA 1AQ7A 3I77A 2KR7A 1TALA 4UFEH 3LGVA 2Z3EA 3SZEA 4B76A 3MOCA 3ATWA 2PTNA 3ZYDA 1P01A 1AVWA 1TQ0B 1LVOA 2JKHA 3F68H 4YOJA 2QN5T 3P92A 3M7TA 2XBVA 3QN7A 1ELGA 1C2JA 1S82A 1NTPA 4X8UH 2HNTE 4AN7A 4XE4A 2I6SA 1SGCA 1SB1H 1SOZA 1P9SA 2AEIH 3GY4A 4UFDH 7ESTE 1Q3XA 4DGJA 1ESTA 3LGUA 1TE0A 1QA0A 2F9VA 1SGTA 2ZP0H 3GCTF 1W3CA 1YPKH 4MNWA 1TNHA 4Z1MD 6LPRA 1QB1A 4DIIH 1SVPA 1GHZA 2F3CE 3FO8D 3RXLA 1VJ9U 7KMEH 1O5BB 3V3MA 1XM1A 1TPPA 4ABEA 3C1KA 4FU9A 2KX4A 1TNJA 5C1XA 4BAOB 1RTLA 2ZQ2A 4YT7H 3FANA 1G30B 1YPJH 2UUYA 2TIOA 4HZHA 2FMJA 1AO5A 1W8BH 1LTOA 2WPKS 1MU8B 4FOUC 5GXPA 2WPIS 3BEIB 2VJ1A 2Y81A 4WMDA 4CHAC 2RFKC 3W94A 2WINI 4NIXA 1O5AB 1PQAA 1S81A 4TY6A 1C4U2 3K65B 4GUXA 1BOQA 1QR3E 3LU9B 3RXFA 1H8HD 3ELAH 4YXWD 1GHYH 2FTMA 1S0RA 4BTTB 1TBQH 1QNJA 2R9PA 1TGNA 2CHAB 2ZFQH 2PFEA 3GY5A 3TH4H 1KMHB 3TU7H 3NZIA 1EPTC 1MTSA 1GJ8B 3PLBA 3ZZ5A 5K0HA 3TGKE 4CH8B 1QCPA 4BTIB 3MU1A 1XKAC 1OWJA 3F6UH 1A7SA 1PPBH 1RD3B 2FXRA 2NU4E 1HAPH 2BM2A 1KIGH 3VGCB 2SGFE 3HKIB 5F8ZA 4GAWA 1C2GA 1C5RA 4TPIZ 1C2HA 3ITIA 3MI4A 1CBWC 1XVOA 2C8YB 1BMAA 5HM2A 5FHTA 3BG8A 1O2MA 1AIXH 2BY9X 1A2CH 2HNTC 3O8CA 5C67A 4RN6A 2ZZUH 2ANMH 3MO9A 3U28C 3DD2H 1YGCH 1IQFA 2G5NA 3GCOA 3P95A 3SN8A 2ZDNA 1ZJDA 1G2LA 3U8OH 3M7UA 1ABJH 2XNIA 3ZZBA 2VGCC 1GL0E 1GJ4H 5HYOA 1Y59T 3KYGA 1VCPA 2BXUH 2ZTYA 3DFLA 3OEED 1OP2A 1LQDB 1UK2A 4D7FA 4KP0A 3PMAB 3VB7A 2NU3E 1WSSH 3MU4A 1GBFA 5FX5A 3UNRA 1KTSB 3WWFA 1HYLA 1L2EA 1C1UH 1P3EA 3P17H 5H4IB 2GKVE 3ZVAA 4ACAA 2JH5D 1D4PB 1H9LB 2AMQA 4ZKNU 3DSOA 3VXFH 1DY9A 3NKKA 2BTCE 1XKBC 3BEUA 1CA8B 3OYPA 9ESTA 2VIVA 1Y5UT 1LCYA 4AFUA 4JK6A 1WXRA 1CU1A 2J97A 4YO9A 2HVYB 2HPQH 1C1TA 1ZSJA 1V2WT 1A3BH 1O2JA 2QXJA 3QGJA 4JZ1A 1GBIA 1TOMH 4AYVB 1QB9A 4Y7AA 1TMUH 4AG1A 3FN8A 4WWYA 1MKWK 1SPJA 1RJXB 3A88A 2BHGA 3KL6A 1G2MA 1OWEA 3ATKA 1BTZA 1TYNA 1P04A 1SFQB 3A7WA 3BTEE 1HAXB 4SGAE 2EC9H 2RCEA 1HAGE 1TMBH 2G4TA 1HJAC 3S69A 3ZV8A 3EA7A 1HFDA 3SNBA 2TBSA 2QA9E 5F8XA 2ZGJA 1DX5M 4LOYH 5EJLA 2ZFPH 3U1IB 4M7GA 5A2MH 3AW1A 1A1RA 2V3HH 3B9FH 3F2HA 3RMMH 3W95A 1VGCB 1UVPA 1NRPH 3A80A 4Y79A 2A7JA 5C5NA 2PKSB 1ZOMA 2CK3D 2RA0A 3RXRA 1JWTA 3SUDA 1D3TB 1MZAA 1O3MA 1G3CA 5E0GA 1UTQA 1D9IA 2OINA 3STIA 1UK4A 3LH1A 5SGAE 2EI8A 3FAOA 3O8RA 2HPPH 2OD3B 1SI5H 1YC0A 5AFYH 2GTBA 3KHVA 2ZFSA 1KTTB 4ABAA 2GDEH 2RG3A 5EODA 5I46H 1HAVB 1ZHMA 3BTWE 5AFZH 3TITA 1TX7A 4Y7BA 4U30A 2D2DA 1QIXB 2ZCHP 1QGFA 1WTHD 1FAKH 3SU1A 4WJG2 3GY2A 1ORFA 3ZZ9A 1C1QA 5FCKA 4K3JA 1F5LA 1UHBB 4DT4A 1UO6A 3GYMA 1Y3YA 5C0UA 2OC7A 1C5WB 2BDIA 1ZHPA 1TOCB 3AAUA 1O35A 3P6ZB 4DY7B 3T25A 4XBBA 5AHGH 1EATA 2P8OC 1C1OA 2J94A 1AZZA 2CF8H 3AW0A 1MKWH 4X1NU 1BDAA 1BRCE 1QL8A 2GCHG 2FO9A 2H9EH 5T6DA 1MD8A 2GD4B 1V2VT 5EG4A 2G4UA 4FU7A 3DSGA 1NN6A 5EJZA 2XNDD 2JH6D 1KYNA 1T4VH 2NWNA 1CHOG 5EOKA 1PJPA 4MQAA 1AKSA 1OP8A 4INLA 2FOCA 1TBRH 4SGBE 3ZYEA 1HAOH 2OK5A 1AD8H 2ZFTA 3PWBA 2FEQH 1PQ8A 2BB4A 2QXIA 1J9CH 1W0ZU 2QF3A 1LMWB 5LPEA 2KCOA 3VB3A 5C94A 2VBCA 3A82A 3VB4A 1OXGA 1W14U 2Y80A 4PROA 2V7QD 3EE7A 5GDSH 1P05A 5E2OA 3ATMA 1O3CA 1TNGA 3A7YA 1ESAA 1NBME 3RXQA 1GBLA 5EU8A 3SU2A 1Y3VA 1P2JA 2BDHA 1FY8E 4K8YA 1ZRKA 1KXDA 4FXGH 1ELVA 1YLCA 2Z9KA 4XDEA 4AOQA 4CRCA 3O8BA 1LHFH 2A0QB 2BZAA 2BDGA 3F9EA 1P06A 6CHAC 1PPZA 1W0JD 4CR9A 1TX8A 1P12E 2NU2E 1GDQA 1GJ9B 1GJCB 4MG3A 1P02A 4WH8A 3U98H 1MTNB 1O2LA 1BMLA 1XUFA 3ZZ6A 2SNWA 1EOJA 3UR9A 1FQ3A 4CBOA 2XTTB 2ZPRA 2FX4A 3RXEA 3KGPA 1BTHH 1FY3A 2QXHA 3P8GA 1C5SA 1C1VH 3A7XA 1O38A 1O2WA 1ETTH 2W3KA 2H9TH 3QZQA 3KQDA 1MAYA 5FXLA 4O97A 3LT3A 3RMOH 1TPOA 2EQNA 1GI4A 2W3IA 2BD9A 3M7QA 5FAHA 1SGDE 3S7KB 4I8KA 1YLDA 1TRNA 1FNIA 2H2ZA 4M9FA 1VCQA 1GHBG 1GHXH 1V2MT 1GI7B 1SC8U 2Z9IA 4B6FA 3K6ZA 1EZUC 2FLBH 2PKAB 1BZXE 1A61H 5DP7A 2CN0H 2C8XB 3E1XB 1C4V2 3QDZB 1DY8A 1V2RT 3ZIAD 2ZTXA 1GI5A 3RXKA 3QTOH 1HAHH 3T62A 2D26C 5J4SA 2Q1JA 2H5DA 2BLOA 4O03A 1YPHE 4OS6A 4F48B 2ZHQH 2TGDA 3A89A 4FETA 5DGJA 5PTPA 2XBWA 2CV3A 2FP7B 3GCNA 1H9IE 2OBOA 8ESTE 4NA9H 4INHA 3SU4A 2QYIA 4ZKRU 4Y0YE 5JB8S 4JYUH 1YBWA 1EPTB 1YCPM 2ESTE 1GMDG 1C2KA 4DT7B 1G9IE 2BMGB 1P2QA 1O2TA 3BTGE 2VU8E 3RU4D 5C3NA 3NRLA 4I8GA 1BJUA 1GHAF 2VH6A 3UTUH 2Z3CA 2GV6A 3AASA 5K7RA 1P8VC 1YPGH 2ZHDA 4HTCH 2CGAA 3Q00A 4J2YB 3RC4A 3GCHB 1C5PA 1EAXA 5GCHF 2W6JD 2ZFRH 1CBWB 1HGTH 1ZSKA 1AN1E 2G5VA 4WXVA 4XRNA 3LC5A 1EB2A 4K5ZA 2SGPE 2VVVA 1O36A 2WV5A 4QT8C 3SZNA 1W7XH 1XUGA 7GCHG 4Y8XA 1KSNA 5CHAB 4CRDA 4NZLA 1E37B 2HGTH 2P3FH 2ZI2H 2G8TA 1JIRA 3QX5H 2IPHA 1FMGA 2LNCA 5DPAA 1C5OH 2WPJS 1F2SE 3RXMA 4X2WA 1GDUA 3EQ0H 5FPYA 1QJ7B 2BDBA 2DE8A 4ASHA 1K2I1 3H5CB 3MWIU 1GG6B 1NRRH 1GMHF 2B0FA 1LHDH 2JH0D 3URCA 2VB0A 2FPZA 5LH8A 1FXYA 1ZSLA 3LGYA 1SL3A 1THRH 3KN2A 4TWYA 2ZU1A 1SGIB 2HOBA 3A8BA 4Y10E 1AVGH 2ZU5A 5BPEA 1ZYOA 4WF8A 1LDTT 1NU7B 3MH7A 1NRQH 3A7VA 3RDZA 3Q3YA 1UTMA 2JETB 2ZC9H 4ISHH 4IW4E 2ZU3A 1G3EA 1BTPA 1UVSH 1C2IA 3Q77A 1FUJA 1FPHH 3F0PA 5F03A 5FPSA 2GDDA 3PRBA 1FY4A 3UPEA 1X7AC 2F9OA 2F9PA 1HJAB 1P2KA 2YMSC 5C20A 2BD7A 2SFAA 1TABE 1AE5A 2VNTA 3EAJA 4UFFH 2R0LA 2Y6TA 1MZDA 1SQTA 2Z3DA 2A4RA 3RLWH 3RC5A 1FN6A 3S9CA 1ELEE 4UDWH 3U69H 1IQJA 1XMNB 3TNTA 1HV7A 5IDKA 1Z8IB 2KAIA 4KTCA 4XBCA 3A83A 3A87A 3ZZ4A 1BTWA 1E0FD 2VH0A 1AVXA 2KCYA 3K9XB 4O3TA 3BG4C 1MABB 1O33A 2PV9B 1T8LA 1O3KA 3E90B 1N8OC 3GCTG 1U6QA 1Y5AT 4Y0ZE 1IQMA 1O5FH 4ZH8A 1GI0A 4ZHLU 1AWFH 1EAWA 2OXSA 1O2XA 3RUOA 1FIZA 3SO3A 4GVUA 3RM0H 3TK9A 1OKXA 4FU8A 2FLRH 5EXLA 1GI6A 1O32A 1ZGIA 1A3EH 2ZDLA 1MTWA 3SV9A 1QTFA 5C1YA 4JYVH 1GHVH 2BD2A 4FUIA 1DT2A 1OHHD 1ANEA 3SI3H 4HI3A 1K1JA 4B6EA 2THFB 4BAMB 3ATLA 4MPVA 1DS2E 4HGCA 4E7RG 4K1EA 3S9BA 1IAUA 2F43B 2P16A 5CDFE 3QK1A 2VVCA 3M36A 3I29A 1NFXA 5C2ZA 1KLTA 4NIWA 2IJOB 2WPHS 1EZXC 4AGJA 2QAAA 1XXFA 3ZVDA 3T26A 1P0SH 1GGDC 1HCGA 2XCFA 3N7EA 2J98A 1RTKA 2ZGBH 1THSH 1GI1A 2XWAA 2I6QA 4X1RU 4X1QU 1EP6A 1AHTH 4B2AA 2BVRH 2R3YA 1GMCF 5EXMA 2G81E 2QXGA 5AVDA 1EP5A 1QRZA 2QGRA 3T27A 1QQUA 4BAKB 3RXIA 1V2TT 2FOAA 5DSFA 4GHTA 2QF4A 3QO6A 1YY3A 4FUFA 4RT1A 4A6LA 2A7CA 4X6PA 3H7TA 3LC3A 3OSYA 1IQIA 2SGQE 2C90B 1A0HB 2AGGX 5BRRE 1SHYA 2ODYB 1DDJA 5F8TA 3Q3XA 4H6SB 1ANDA 1A46H 3LJJA 1P11E 3RXGA 2P95A 2XBYA 3SNDA 1BMNH 3V13A 3SI4H 3EGKH 1YWUA 1FZZA 1RTFB 3R0FA 1GPZA 4THNH 2FZZA 2PSYA 4CRGA 2TGAA 4HG6A 1CO7E 1GCDA 2WPMS 1PYTC 1P9UA 4I8LA 1V6DA 1EQ9A 1Z7KA 2H9HA 4B2BA 5A09A 1SGFG 2A1DB 2PUXB 1G3DA 3TJVA 2A32A 2ZDMA 3HPTB 5JBTA 1TLDA 3NCLA 2M5TA 3TH2H 2D1JA 1QA7A 2GZ9A 3UNQA 1UJ1A 3N99A 4X6NA 1H1BA 1TIOA 2BQWB 3SJ8A 1F92A 5FBEA 1N6YA 1OWDA 3DT0H 3NUMA 3SOSA 1V2PT 1O3OA 1A0LA 1BHXF 5DKMA 1EFRD 1QL7A 3CS0A 1K1IA 1HPGA 3PROA 1SGPE 1V3XA 1D3DB 1GVZA 4IGDA 1DOJA 1J8AA 2XOKD 3M37A 3ZZ8A 2VIOA 1W13U 3SUGA 4DVAU 4ZKOU 2WV4A 1MU6B 1K1NA 5C0TA 1C5XB 3ZVEA 1AUJA 1TPSA 2Z7FE 2PTCE 4X1SU 4RKJB 1FONA 2UWOA 3CENA 3QUMP 3VXEH 2C8ZB 1KXBA 1RFNA 1C4Y2 4CREA 2UUKB 2HRVA 1ELFA 1MBMA 4KTUA 4B1TA 3ENSB 1RS0A 1GBBA 1RIWC 1UW7A 4K2YA 5G4BA 1WDIA 1DLEA 1BBRH 1DWEH 4WXIA 1AB9B 2SGAA 2GCTC 4BAQB 3FP6E 4WMEA 3T29A 3KIDU 3DHKH 2AIQA 3LKWA 1DWDH 2FI5E 1C5TA 5EQQA 2BLWA 1O37A 2ULLA 1FIWA 3DCLA 3W1EA 1CT4E 3Q3KA 2C8WB 3E6PH 2F4LA 1GJAB 3OY6U 4UFGH 2FOMB 8LPRA 3P8NA 4KKDA 1GJ7B 3LOXA 1O2ZA 2FWWA 1Y3WA 2Q6GA 1HIAB 1VZQH 4IN1A 1O5CB 2F9NA 3PWCA 5E0HA 3RXHA 1TA6A 1C5ZB 3PO1C 3WW7A 3MU0A 3T28A 5TCCA 1HUTH 1TNKA 1QHRB 1O3IA 5T6FA 2FOGA 5B6OA 1H4WA 4AZ2B 2O8UA 4FUDA 1IHSH 1HBTH 2XYAA 4OS7A 1UVOA 3EA8A 1WYKA 1RXPA 2VWNA 5EXNA 4Z6AH 4UD9H 2B5TB 2H1UA 1TNLA 1A5GH 1MD7A 2JJ1D 1S85A 1G32B 1BHXB 2FOBA 3ZVGA 4FVDA 1HAVA 1O3FA 4NSVA 2R0KA 3D65E 1IQEA 2WYJA 1KLIH 4DCDA 1KLJH 1SOTA 4ABDA 3N7OA 4YT6H 2ZG0H 1O2PA 2ZQ1A 3UB0A 3SV6A 4DIHH 4ISLA 4MNYA 3SU5A 1AGJA 3MNXA 1SGFA 1BMFD 1UHBA 1AE8H 1O3BA 1UTPA 2ILNA 2NU0E 3EDXB 4FUEA 3VFEA 3MO6A 2LELA 1L4DA 1IQHA 2O8TA 4CR5A 4TYDA 1BTYA 1S5SA 3UWIA 5FPTA 5DN6D 5DK1A 2IPQX 4ZXYH 2JIZD 1KDQA 1O0DH 1SQRA 4NIYA 1UTOA 1FJSA 1V2OT 2R2WU 1E34B 2PLXA 1W2KH 1PPGE 2QCYA 1ZPZA 2Z9GA 2ZGCA 3BN9A 4NWLA 5ETXA 3ZZ7A 1V2QT 4AC9A 1PPEE 2XXLA 3F2GA 3UQVA 1QRXA 4WMFA 1DM4B 5KEDA 4JK5A 1F0RA 3F1SB 2AIPA 1C5VA 4INKA 6GCHF 5T6GA 2PP6A 2J38A 1TWXB 3D49H 4OGYA 1AZ8A 2QY0B 2STAE 1FV9A 1GJBB 1O3PB 2UWLA 2GT8A 2J4IA 1HB0B 1DWBH 2JDID 5B6LA 4MNVA 2TPIZ 3SV2H 1UVTH 2ZGXH 1IQKA 1TRYA 4B71A 3C27B 1H9HE 1DWCH 1J16A 4NSYA 1O2OA 3FKSD 1DITH 1TQ7B 3EYDA 1JBUH 4YESB 1W7GH 5LPRA 5JBAS 3P70B 1K1OA 5JPMH 1AFQB 6ESTA 3E0NB 1GWAA 2PW8H 4FUGA 3AK5A 4IBLH 4CRAA 5EJ1A 3D62A 4CH2B 1LKBA 2FESH 3GISB 1H8DH 1T7CA 4TPYA 2WV9A 1OWIA 1GBCA 2IJD1 2YNAA 2Z9JA 1GBKA 1KXAA 4J1YA 3GY8A 4KELA 1O5DH 1KXCA 4I86A 5CE1A 1IQLA 1Y8TA 1AWHB 3BSQA 3GDVA 2P3UB 4AYYB 3UIRA 3MYWA 3HK3B 1MMJN 2HNTF 3PB1E 3GDSA 1F5RA 1QQ4A 3TK5A 1GGDB 1VKYA 1F0SA 3OTPA 4ZUHA 2ANKH 1PPFE 4R8TB 5C1UA 4MDSA 2ZEBA 2ZHEH 1O30A 1GHAG 1RGQA 2BX4A 3MU5A 1K9OE 4RI0A 2V35A 1EJNA 3F0OA 2OC0A 2PKAA 1C5MD 1FPCH 2GMTC 3VGCC 2PUQH 2WYGA 2HLDD 1PQ7A 4X6OA 1V2ST 2WHXA 1W12U 1CT2E 1E79D 5GCHG 1HDTH 2G52A 1SSXA 2AYWA 3SGAE 3SU0A 3SU3A 3BTQE 2WUCA 2KCPA 1BRUP 1O2HA 2TGTA 3UOUA 1A5HA 1HRTH 2O9QA 2UUFB 4BXSA 4CHAB 4ZXXH 1SMFE 3U8RH 2ZDVH 2R3UA 4NGAH 3G01A 2DE9A 1TMTH 1ETSH 2FODA 1OYQA 2QV1A 2BLQA 2YOLA 1DXWA 1GBJA 3A81A 3RXDA 1EPTA 4AFSA 3OEHD 3MH6A 1QBVH 1KXFA 3PV4A 1FDPA 1DANH 1UTNA 1Q31A 3LGIA 1S0QA 5DP3A 4CRBA 4Q7YA 2ANYA 1VITF 2C4FH 3BIVH 2J34A 4NA8A 3SBKA 3WWBA 4O3UA 2Y7ZA 1MAXA 3BTFE 3RU4E 3KNXA 3SJKA 4NA7A 2O8MA 2VIPA 1AI8H 3M5LA 3KQEA 2CF9H 1M9UA 2SGEE 3UOPA 4K1TA 1ARBA 2W5EA 2ZWLH 3GS9A 5TCAA 1ELAA 4XSKU 3BIUH 3RU4T 1WU1A 1GBTA 3PYHA 4OS4A 4JZDH 1TGSZ 1ELBA 2ZPSA 1OX1A 1GVKB 1WQVH 2UWPA 1C1WH 1SQAA 2VGCB 1S6HA 3BF6H 1ZMLA 3FVFB 1HAYB 2H6MA 4AORA 1UCYK 1IQNA 1WOFA 2OTVA 3SW2B 3UAIC 1SR5C 2A4OA 1INCA 1ESBA 3FZDA 1ETRH 4YZUA 1NT1A 1HAIH 5HM9A 2OQUA 5LPFA 4AFQA 2OC1A 1QFKH 4AFZA 1P10A 5F53A 4AGKA 3CP7A 3OE7D 2PKSC 4MPWA 3UNSA 4E7NA 2Q6FA 1RIWB 1O34A 5GIBA 2PGQB 5KECA 2CJIA 3TJNA 4AX9H 1SBWA 1MQ5A 1GBHA 5JBCS 1J17T 3A8DA 1BRBE 3SGQE 1YYY1 2VIDA 4ZHMU 1YPHC 3SV7A 5CMXH 4MVNA 2Y5HA 3VPKA 4B75A 1TB6H 4CBNA 3GICB 3TGJE 1HJ9A 5A0BA 1F7ZA 1O3NA 4A1XA 2AHME 2W26A 5HIZA 2ODPA 1NS3A 1FX0B 1Z8RA 3VB6A 3R3GB 1HAZB 1AUTC 3LJOA 3SUEA 1CGHA 1GBMA 2Z94A 2GZ8A 5IYTA 1H8ED 2BD5A 4BAHB 2RA3A 1LO6A 2A4QA 2KM0A 3HKJB 4U32A 1UTLM 2ASUB 3KQ5A 7GCHF 2Y5GA 5FL7D 1NFUA 5E2PA 2K8IA 5EPYA 3RP2A 1V2JT 2AS9A 2FM2A 4P02A 2J9NA 1K1MA 3L3TA 1KY9A 3PTNA 1P09A 2AMDA 5DP4A 2QF0A 1W0YH 3FOAA 1UCYH 2WPLS 1O2IA 1GI9B 4YM9A 1T8OA 3I78A 3URDA 1GVLA 5T1VA 1ACBE 1NRSH 1YCPK 1ZJKA 2FDAA 3CNRA 4X8SH 1VR1H 3RC6A 3FP8E 1DE7H 1W0KD 1E36B 2BY8X 4FUHA 4I7YH 4NWKA 2J92A 2OUAA 1WQSA 2A7HA 3ZVBA 1MTVA 1S84A 2LP6A 1GMCG 4NG9H 1T8MA 2D8WA 4MLFB 1OYTH 4YTAA 2ZFFH 3ESTA 1OS8A 3PMBB 4K69A 4B2CA 2XRCA 2XWBI 2AERH 1QBNA 1ELCA 4LK4A 1K28D 3QWCH 2FI4E 1GHWH 4UE7H 3SUFA 4ISNA 4B74A 4Q4LA 5A8ZA 1NO9H 1OPHB 3JZ1B 1XVMA 4OS1A 2P8OB 3IITA 3S7HB 3SNAA 2FX6A 3K6YA 4GCHF 3RXTA 3K2UA 3UWJH 1F0UA 1UVUH 1Z6JH 3M5NA 4Y6DA 1EZQA 1MUEB 5E8EH 4IMQA 4O9VA 1BA8B 2ODQA 4Q7ZA 1NFWA 3KF2A 2R2MB 3H7OA 2VWLA 3SNEA 4XOJA 1WCZA 3JZ2B 2C3SA 1BUIA 1GCTC 3RXPA 1MTNC 8GCHF 1SG8B 4TY7A 4OS2A 2Y82A 2J5UA 3A7TA 3MO3A 1CGIE 1O2RA 2ZA5A 1C1MA 4OS5A 1EXFA 1CSOE 4ZCNA 2BD3A 3RXBA 4KTSA 1K0HA 4U2WA 2ZNKH 1ZTKA 2RDLA 3OX7U 1EUFA 1YPMH 3MMGA 3RMLH 4ABFA 2BX3A 1N6XA 1C2FA 1ZMNA 2P93A 3D23A 5JB9S 1XUHA 1MBQA 4Y71A 2K1QA 2ZF0H 1BCUH 2ANWA 4A5TS 1C5NH 1GJ5H 2V0BA 2BVXH 1PPCE 3MNCA 3UR6A 1B5GH 1YCPH 5HMAA 3VG8A 2J98B 1WBGB 1XUJA 3A85A 1CA0C 1Z8GA 2ZIQH 4ZKSU 2H5CA 1L1NA 1E35B 1TGTA 2GP9B 1D6WA 2EI6A 4IC6A 3BTTE 3SHAH 2EA3A 1BBRK 1O2UA 3H09A 2ZGHA 4ZAEA 5GNDA 3FZZA 1O3JA 3MH5A 1RRKA 2OQ5A 5I25A 1C1PA 1PFXC 1YF4A 6CHAB 3U9AH 5L6NH 1LHCH 4IS5A 5HKKD 2HWLB 2OP9A 4LXBH 4D8NA 4F4OC 5JYIA 3V12A 3LPRA 2GX4A 2G55A 3BV9B 5DP9A 1O2NA 4LZ1H 1JRTA 1AY6H 1B0EA 4VGCC 2BDCA 2IOTA 1JXPA 4YLUA 4ZHAA 1XX9A 3FP7E 5DP5A 2F9BH 1ARCA 4CRFA 1Q2WA 4NFEA 5A0CA 4YOGA 2J2UA 1THPB 3GY6A 3TK6A 1SLXB 2K0QA 1C5QA 1C1NA 1ZHRA 7LPRA 5J4QA 4NZQA 1Z71A 1Y5BT 4JMYA 3T5FH 4GHQA 4WY3A 1TAWA 1FN8A 4F49A 1O3GA 3BTKE 1C9TA 2GGVB 1LHGH 1TFXA 1D3PB 4ZROA 3MNBA 2GMTB 2PHBA 3GCHC 1QJ6B 3ZVFA 1NU9A 1HNEE 5HGGA 1SGNE 1FY1A 3ODFA 1GBAA 1ZPBA 2Q6DA 1XXDA 1FI8A 1QJ1B 1P2NA 1K1LA 3EE0B 3HATH 1EB1H 1NROH 1DUAA 3RXAA 2P94A 1UMAH 1ZLRA 4I8HA 1WV7H 4Q2KA 1E38B 2SNVA 5EW1H 4X2YA 2FS9A 5CHAC 2FOHA 3RXVA 1GI8B 2ZU2A 3NPSA 5EPNA 2VINA 1J14A 2L74A 3KEEA 4ASUD 2FI3E 3QLPH 3ZZAA 2DUCA 1P2MA 3RMNH 1PQ5A 1EJMA 1UTJA 1XUIA 1C2EA 2XCNA 1OWKA 1JMOH 2ZU4A 3SYJA 4UONA 5DO4H 1MCTA 4RT0A 1AU8A 1C1SA 5EQRA 4BANB 3STJA 1L1JA 4I33A 3SORA 1GG6C 1OSSA 2ZKSA 1UCYE 3FFGA 3AAVA 1O3LA 1HIAA 4JZFH 3IG6B 1OWHA 2G00A 2WSSD 3F9HA 5FBIA 4BOHA 2C93B 4Y11E 1EX3A 1XUKA 3MFJA 3IWMA 1O3DA 3NXPA 3TLOA 1LKAA 4X2VA 3ZZ3A 4NIVA 2NU1E 2JETC 2HLCA 3GOVB 1QL9A 1EKBB 4GLYA 1EZSC 1S6FA 1AFEH 2V6NA 1C2LA 3KCGH 1GBDA 2B9LA 1C5UA 1TPAE 3ATIA 4TT3D 3HGPA 3P8OA 4ISIH 1A5IA 3E8LA 2BY5X 5EIYA 4A1TA 2W6ID 2A5AA 5EW2H 1C2DA 3LGTA 3DSPA 5A0AE 4MPXA 3TJOA 1L0ZA 3E0PB 3B23B 1DICA 3MNSA 6GCHG 1T31A 5L2YH 3M5OA 3RXSA 1Y3UA 3VB5A 4I31A 3UY9A 1ZTLA 3OY5U 1YM0A 5GWZA 3F9GA 2W7UA 4RKOB 1SGEE 4E05H 2BD8A 2WPDD 1HLTH 2BOHB 4XFQA 1T4UH 2PGBB 2XBXA 1ZRBA 3SNCA 2BDYA 2OLGA 4LZ4B 2BDAA 3WY8A 4KGAA 3PMHB 3TGIE 5L30H 1P57B 3BTHE 3BTDE 1TRMA 3ZVCA 4BNRA 3OTJE 1COWD 3GY3A 1NC6A 4OGXA 1H8IH 1DUEA 4X8VH 2V3MA 3RXJA 1BT7A 1WTGH 3M61U 4JZIA 5DG6A 4TWWA 2PR3A 1O5EH 2YMSB 1K22H 1E1RD 4X8TH 1C1RA 1D6RA 3PTBA 5FX6A 2W7SA 4JCNA 4X0WU 1DSUA 4Y76A 2F91A 2FYQA 1LQEA 4MPUA 3RXOA 4Q80A 1MQ6A 5DP8A 1O2SA 1O31A 1A4WH 2VIQA 3N7DA 2Z9LA 1D3QB 1KDQB 1TONA 1ANBA 1C2MA 1LVYA 1QRWA 4YOIA 1ZPCA 1TNIA 1L4ZA 4ESTE 1UK3A 3MQKC 1V2UT 3HK6B 2BYAX 4U01A 2B7DH 4DURA 2GZ7A 1O3HA 1GJDB 2FIRH 1O3EA 1C5LH 2AMPA 1VJAU 4NFFA 4P00A 5C17A 2BVSH 3BG4B 4Y8ZA 5DJ7A 1NM6A 5HIYA 4NCYA 3SQHE 3TPIZ 1HXEH 4AB8A 4XD7D 1N8OB 2QIQA 1BJVA 1LPZB 2XC0A 1O2GH 1LVBA 5E0JA 1T8NA 1DPOA 4IN2A 3GDUA 1AKSB 1SFIA 5ESBA 3ZV9A 5IK2D 5EQSA 3OU0A 4AG2A 1BMMH 1MKXK 1P03A 1V2KT 1BTUA 4ISOA 2A2QH 3SJOA 5AF9H 1EOLA 3VEQB 3SQEE 1CT0E 4WH6A 2P59A 1O39A 1NESE 3LH3A 1GJ6A 5T3HA 1K1PA 1NBMD 2EI7A 3QTVH 2QE7D 5L2ZH 4JZEH 1NZQH 1YP9A 1GBEA 2A31A 2GCHF 2TRMA 2A5KA 1QBOA 1B7XB 1CVWH 4OM9A 1G37A 3U1JB 1SHHB 2VWMA 4ACBA 2M2AA 1BTXA 3SU6A 1WUNH 1Z8JB 2A45B 4XBDA 3M3VA 1NRNH 1CHOF 5CHBA 2ZPQA 1LVMA 2CHAC 3A8CA 2BQ7B 4B73A 3PLPA 3QGNB 1F5KU 1IHTH 4X2XA 1BBRE 1GCTB 2GVFA 1HJ8A 1SQOA 3MU8A 4UEHH 2EEKA 1VITG 1BB0B 1L1GA 3BEFB 4Z0KA 1TBZH 3ODDA 1CE5A 1DFPA 1OP0A 3BTME 1SGQE 1SLVB 3KYFA 5FCRA 4E06H 1C5YB 2EY4C 4Y8YA 3TVJB 3UREA 1GDNA 3F3BA 3TIUA 2F83A 4DJZB 4A1VA 3M3TA 2L6OA 4GPGA 2O8LA 2A2XH 1BITA 4I32A 4BXWA 2BY6X 5JDUB 3LIWA 2AFQB 3E16B 1MH0A 1BRAA 1SKYE 1N1LA 1CA0B 3DFJA 3M5MA 1MKXH 3E91A 2FOEA 1JIMA 5LGOA 1SGRE 1EAUA 3EA9A 3OAAD 2VWOA 4FVBA 4MNXA 3HGNA 3TH3H 1IOEA 1MTUA 4ABGA 2STBE 2BY7X 1ZZZA 1LHEH 1J15A 4FUBA 4FUJA 3UUZA 4IMZA 2ALPA 2UUJB 5A8YA 3A84A 3NWUA 1O3AA 1O2KA 2XC4A 4VGCB 3KQBA 1GMHG 1NFYA 1V2LT 5ESTE 2FOFA 2G51A 1TA2A 5KGOA 3TNSA 3TJUA 1G3BA 4D7GA 1GL1A 1AB9C 3MH4A 3ZZCA 2A4GA 4X6MA 4DOQA 2YNBA 2AGIX 3PV5A 3E3TA 1FAXA 1W11U 2BLVA 2IN2A 2XW9A 1QY6A 2YMSD 1YKTA 2GJGA 4ABJA 3MHWU 2AH4X 1EASA 1ELTA 3L33A 4AB9A 4ZMAH 1ID5H 3QZRA 1NY22 3SGBE 2VIWA 2ZCKP 1B0FA 5DP6A 1HXFH 5JBBS 3SJ9A 3P8FA
chains in the Genus database with same CATH topology
2J98B 2J97A 1QZ8A 5HIYA 5HIZA 5C94A 1UW7A 2J98A 3EE7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J98 B;  2J97 A;  1QZ8 A;  5HIY A;  5HIZ A;  5C94 A;  1UW7 A;  2J98 A;  3EE7 A; 
#chains in the Genus database with same CATH topology
 1T32 A;  3U8T H;  1DST A;  3A7Z A;  1GHB F;  2ZEC A;  1GI3 A;  5C5O A;  2WZQ A;  2ZDK A;  3F2F A;  3PV2 A;  1S83 A;  4DG4 A;  1TX6 A;  2ZO3 H;  2ZTZ A;  2P3T B;  3OFN D;  2SGD E;  4H42 U;  1ELD E;  1AMH A;  1FY5 A;  1G36 A;  2CXV A;  4TSF D;  2Y5F A;  4WVP E;  4D76 A;  4K60 A;  1VGC C;  3F9F A;  3RXU A;  5A8X A;  2LPR A;  3DUX H;  1ABI H;  2OC8 A;  1GI2 A;  9LPR A;  1VIT H;  4JYT A;  2GCT B;  1TGC A;  1YLN A;  4HFP B;  2QF5 A;  2FS8 A;  3RLY H;  1DVA H;  5GJ4 B;  1YPE H;  2VVU A;  2QC2 A;  3PM3 A;  1BIO A;  1O2Q A;  3M3S A;  3SHC H;  1GMD F;  1SGY E;  2XC5 A;  3S9A A;  1IQG A;  2KZ4 A;  1E1Q D;  3PMJ A;  1LPG B;  1Y3X A;  4ABI A;  1C9P A;  3A8A A;  1SLW B;  3SV8 A;  3RXC A;  1ZR0 A;  2A5I A;  4ABH A;  2F9U A;  2CMY A;  2ALV A;  4BTU B;  2ZHF H;  3RM2 H;  1QUR H;  2OCV B;  5GPI B;  1O2V A;  3PO1 B;  3MTY A;  1FLE E;  1KXE A;  2BD4 A;  3SJI A;  3V0X A;  3KQC A;  2FTL E;  5HXF A;  5TJX A;  4ABB A;  2BOK A;  1A0J A;  3PLK A;  5EGM A;  3T2N A;  1S6L A;  2JJ2 D;  2O8W A;  2Y7X A;  3AVZ A;  4GCH G;  3M35 A;  1W10 U;  3PRD A;  1ZGV A;  3LON A;  1NPM A;  3S0N A;  1ZMJ A;  5ABW A;  1ANC A;  1CGJ E;  4H4F A;  3V7T A;  4R0I A;  3LGW A;  1V2N T;  3DA9 B;  1WAY B;  2ZCL P;  2HVX A;  3A86 A;  4GSO A;  2PSX A;  2OBQ A;  2Z6B D;  4MTB A;  8KME 2;  1EAI A;  1SLU B;  1BQY A;  4H6T A;  4K8B A;  4I8J A;  4X1P U;  1Z6E A;  1EJA A;  2B8O H;  2BXT H;  8GCH G;  1JOU B;  4IC5 A;  1TGB A;  2GT7 A;  1MCV A;  2TGP Z;  4A92 A;  1QB6 A;  4F55 A;  3LDX H;  3UFA A;  2RDE A;  3Q76 A;  4Q63 A;  2ZDA H;  1K21 H;  2KCA A;  3GY7 A;  3O8D A;  4DW2 U;  1O5G H;  1Z1I A;  2HAL A;  1P2I A;  4RSP A;  2BQ6 B;  2KAI B;  2FYR A;  1CQQ A;  5F6M A;  1YPL H;  4A7I B;  1PPH E;  4YLQ H;  4K1S A;  1DLK B;  1F0T A;  1ZTJ A;  1JRS A;  4Q7X A;  4FUC A;  1CHG A;  1P2O A;  3ZZD A;  4D9Q A;  1VCW A;  2GV7 A;  1DXP A;  1AFQ C;  1OOK B;  3CS7 A;  2J95 A;  3UQO A;  3GYL B;  1O2Y A;  1P3C A;  1Z1J A;  2KFW A;  1UTK A;  2BZ6 H;  3B8J A;  3NK8 A;  3L6P A;  1QZ8 A;  1LPK B;  4D9R A;  1PYT D;  2V3O H;  2AGE X;  2ZHW H;  2WUB A;  2PWX A;  1AQ7 A;  3I77 A;  2KR7 A;  1TAL A;  4UFE H;  3LGV A;  2Z3E A;  3SZE A;  4B76 A;  3MOC A;  3ATW A;  2PTN A;  3ZYD A;  1P01 A;  1AVW A;  1TQ0 B;  1LVO A;  2JKH A;  3F68 H;  4YOJ A;  2QN5 T;  3P92 A;  3M7T A;  2XBV A;  3QN7 A;  1ELG A;  1C2J A;  1S82 A;  1NTP A;  4X8U H;  2HNT E;  4AN7 A;  4XE4 A;  2I6S A;  1SGC A;  1SB1 H;  1SOZ A;  1P9S A;  2AEI H;  3GY4 A;  4UFD H;  7EST E;  1Q3X A;  4DGJ A;  1EST A;  3LGU A;  1TE0 A;  1QA0 A;  2F9V A;  1SGT A;  2ZP0 H;  3GCT F;  1W3C A;  1YPK H;  4MNW A;  1TNH A;  4Z1M D;  6LPR A;  1QB1 A;  4DII H;  1SVP A;  1GHZ A;  2F3C E;  3FO8 D;  3RXL A;  1VJ9 U;  7KME H;  1O5B B;  3V3M A;  1XM1 A;  1TPP A;  4ABE A;  3C1K A;  4FU9 A;  2KX4 A;  1TNJ A;  5C1X A;  4BAO B;  1RTL A;  2ZQ2 A;  4YT7 H;  3FAN A;  1G30 B;  1YPJ H;  2UUY A;  2TIO A;  4HZH A;  2FMJ A;  1AO5 A;  1W8B H;  1LTO A;  2WPK S;  1MU8 B;  4FOU C;  5GXP A;  2WPI S;  3BEI B;  2VJ1 A;  2Y81 A;  4WMD A;  4CHA C;  2RFK C;  3W94 A;  2WIN I;  4NIX A;  1O5A B;  1PQA A;  1S81 A;  4TY6 A;  1C4U 2;  3K65 B;  4GUX A;  1BOQ A;  1QR3 E;  3LU9 B;  3RXF A;  1H8H D;  3ELA H;  4YXW D;  1GHY H;  2FTM A;  1S0R A;  4BTT B;  1TBQ H;  1QNJ A;  2R9P A;  1TGN A;  2CHA B;  2ZFQ H;  2PFE A;  3GY5 A;  3TH4 H;  1KMH B;  3TU7 H;  3NZI A;  1EPT C;  1MTS A;  1GJ8 B;  3PLB A;  3ZZ5 A;  5K0H A;  3TGK E;  4CH8 B;  1QCP A;  4BTI B;  3MU1 A;  1XKA C;  1OWJ A;  3F6U H;  1A7S A;  1PPB H;  1RD3 B;  2FXR A;  2NU4 E;  1HAP H;  2BM2 A;  1KIG H;  3VGC B;  2SGF E;  3HKI B;  5F8Z A;  4GAW A;  1C2G A;  1C5R A;  4TPI Z;  1C2H A;  3ITI A;  3MI4 A;  1CBW C;  1XVO A;  2C8Y B;  1BMA A;  5HM2 A;  5FHT A;  3BG8 A;  1O2M A;  1AIX H;  2BY9 X;  1A2C H;  2HNT C;  3O8C A;  5C67 A;  4RN6 A;  2ZZU H;  2ANM H;  3MO9 A;  3U28 C;  3DD2 H;  1YGC H;  1IQF A;  2G5N A;  3GCO A;  3P95 A;  3SN8 A;  2ZDN A;  1ZJD A;  1G2L A;  3U8O H;  3M7U A;  1ABJ H;  2XNI A;  3ZZB A;  2VGC C;  1GL0 E;  1GJ4 H;  5HYO A;  1Y59 T;  3KYG A;  1VCP A;  2BXU H;  2ZTY A;  3DFL A;  3OEE D;  1OP2 A;  1LQD B;  1UK2 A;  4D7F A;  4KP0 A;  3PMA B;  3VB7 A;  2NU3 E;  1WSS H;  3MU4 A;  1GBF A;  5FX5 A;  3UNR A;  1KTS B;  3WWF A;  1HYL A;  1L2E A;  1C1U H;  1P3E A;  3P17 H;  5H4I B;  2GKV E;  3ZVA A;  4ACA A;  2JH5 D;  1D4P B;  1H9L B;  2AMQ A;  4ZKN U;  3DSO A;  3VXF H;  1DY9 A;  3NKK A;  2BTC E;  1XKB C;  3BEU A;  1CA8 B;  3OYP A;  9EST A;  2VIV A;  1Y5U T;  1LCY A;  4AFU A;  4JK6 A;  1WXR A;  1CU1 A;  2J97 A;  4YO9 A;  2HVY B;  2HPQ H;  1C1T A;  1ZSJ A;  1V2W T;  1A3B H;  1O2J A;  2QXJ A;  3QGJ A;  4JZ1 A;  1GBI A;  1TOM H;  4AYV B;  1QB9 A;  4Y7A A;  1TMU H;  4AG1 A;  3FN8 A;  4WWY A;  1MKW K;  1SPJ A;  1RJX B;  3A88 A;  2BHG A;  3KL6 A;  1G2M A;  1OWE A;  3ATK A;  1BTZ A;  1TYN A;  1P04 A;  1SFQ B;  3A7W A;  3BTE E;  1HAX B;  4SGA E;  2EC9 H;  2RCE A;  1HAG E;  1TMB H;  2G4T A;  1HJA C;  3S69 A;  3ZV8 A;  3EA7 A;  1HFD A;  3SNB A;  2TBS A;  2QA9 E;  5F8X A;  2ZGJ A;  1DX5 M;  4LOY H;  5EJL A;  2ZFP H;  3U1I B;  4M7G A;  5A2M H;  3AW1 A;  1A1R A;  2V3H H;  3B9F H;  3F2H A;  3RMM H;  3W95 A;  1VGC B;  1UVP A;  1NRP H;  3A80 A;  4Y79 A;  2A7J A;  5C5N A;  2PKS B;  1ZOM A;  2CK3 D;  2RA0 A;  3RXR A;  1JWT A;  3SUD A;  1D3T B;  1MZA A;  1O3M A;  1G3C A;  5E0G A;  1UTQ A;  1D9I A;  2OIN A;  3STI A;  1UK4 A;  3LH1 A;  5SGA E;  2EI8 A;  3FAO A;  3O8R A;  2HPP H;  2OD3 B;  1SI5 H;  1YC0 A;  5AFY H;  2GTB A;  3KHV A;  2ZFS A;  1KTT B;  4ABA A;  2GDE H;  2RG3 A;  5EOD A;  5I46 H;  1HAV B;  1ZHM A;  3BTW E;  5AFZ H;  3TIT A;  1TX7 A;  4Y7B A;  4U30 A;  2D2D A;  1QIX B;  2ZCH P;  1QGF A;  1WTH D;  1FAK H;  3SU1 A;  4WJG 2;  3GY2 A;  1ORF A;  3ZZ9 A;  1C1Q A;  5FCK A;  4K3J A;  1F5L A;  1UHB B;  4DT4 A;  1UO6 A;  3GYM A;  1Y3Y A;  5C0U A;  2OC7 A;  1C5W B;  2BDI A;  1ZHP A;  1TOC B;  3AAU A;  1O35 A;  3P6Z B;  4DY7 B;  3T25 A;  4XBB A;  5AHG H;  1EAT A;  2P8O C;  1C1O A;  2J94 A;  1AZZ A;  2CF8 H;  3AW0 A;  1MKW H;  4X1N U;  1BDA A;  1BRC E;  1QL8 A;  2GCH G;  2FO9 A;  2H9E H;  5T6D A;  1MD8 A;  2GD4 B;  1V2V T;  5EG4 A;  2G4U A;  4FU7 A;  3DSG A;  1NN6 A;  5EJZ A;  2XND D;  2JH6 D;  1KYN A;  1T4V H;  2NWN A;  1CHO G;  5EOK A;  1PJP A;  4MQA A;  1AKS A;  1OP8 A;  4INL A;  2FOC A;  1TBR H;  4SGB E;  3ZYE A;  1HAO H;  2OK5 A;  1AD8 H;  2ZFT A;  3PWB A;  2FEQ H;  1PQ8 A;  2BB4 A;  2QXI A;  1J9C H;  1W0Z U;  2QF3 A;  1LMW B;  5LPE A;  2KCO A;  3VB3 A;  5C94 A;  2VBC A;  3A82 A;  3VB4 A;  1OXG A;  1W14 U;  2Y80 A;  4PRO A;  2V7Q D;  3EE7 A;  5GDS H;  1P05 A;  5E2O A;  3ATM A;  1O3C A;  1TNG A;  3A7Y A;  1ESA A;  1NBM E;  3RXQ A;  1GBL A;  5EU8 A;  3SU2 A;  1Y3V A;  1P2J A;  2BDH A;  1FY8 E;  4K8Y A;  1ZRK A;  1KXD A;  4FXG H;  1ELV A;  1YLC A;  2Z9K A;  4XDE A;  4AOQ A;  4CRC A;  3O8B A;  1LHF H;  2A0Q B;  2BZA A;  2BDG A;  3F9E A;  1P06 A;  6CHA C;  1PPZ A;  1W0J D;  4CR9 A;  1TX8 A;  1P12 E;  2NU2 E;  1GDQ A;  1GJ9 B;  1GJC B;  4MG3 A;  1P02 A;  4WH8 A;  3U98 H;  1MTN B;  1O2L A;  1BML A;  1XUF A;  3ZZ6 A;  2SNW A;  1EOJ A;  3UR9 A;  1FQ3 A;  4CBO A;  2XTT B;  2ZPR A;  2FX4 A;  3RXE A;  3KGP A;  1BTH H;  1FY3 A;  2QXH A;  3P8G A;  1C5S A;  1C1V H;  3A7X A;  1O38 A;  1O2W A;  1ETT H;  2W3K A;  2H9T H;  3QZQ A;  3KQD A;  1MAY A;  5FXL A;  4O97 A;  3LT3 A;  3RMO H;  1TPO A;  2EQN A;  1GI4 A;  2W3I A;  2BD9 A;  3M7Q A;  5FAH A;  1SGD E;  3S7K B;  4I8K A;  1YLD A;  1TRN A;  1FNI A;  2H2Z A;  4M9F A;  1VCQ A;  1GHB G;  1GHX H;  1V2M T;  1GI7 B;  1SC8 U;  2Z9I A;  4B6F A;  3K6Z A;  1EZU C;  2FLB H;  2PKA B;  1BZX E;  1A61 H;  5DP7 A;  2CN0 H;  2C8X B;  3E1X B;  1C4V 2;  3QDZ B;  1DY8 A;  1V2R T;  3ZIA D;  2ZTX A;  1GI5 A;  3RXK A;  3QTO H;  1HAH H;  3T62 A;  2D26 C;  5J4S A;  2Q1J A;  2H5D A;  2BLO A;  4O03 A;  1YPH E;  4OS6 A;  4F48 B;  2ZHQ H;  2TGD A;  3A89 A;  4FET A;  5DGJ A;  5PTP A;  2XBW A;  2CV3 A;  2FP7 B;  3GCN A;  1H9I E;  2OBO A;  8EST E;  4NA9 H;  4INH A;  3SU4 A;  2QYI A;  4ZKR U;  4Y0Y E;  5JB8 S;  4JYU H;  1YBW A;  1EPT B;  1YCP M;  2EST E;  1GMD G;  1C2K A;  4DT7 B;  1G9I E;  2BMG B;  1P2Q A;  1O2T A;  3BTG E;  2VU8 E;  3RU4 D;  5C3N A;  3NRL A;  4I8G A;  1BJU A;  1GHA F;  2VH6 A;  3UTU H;  2Z3C A;  2GV6 A;  3AAS A;  5K7R A;  1P8V C;  1YPG H;  2ZHD A;  4HTC H;  2CGA A;  3Q00 A;  4J2Y B;  3RC4 A;  3GCH B;  1C5P A;  1EAX A;  5GCH F;  2W6J D;  2ZFR H;  1CBW B;  1HGT H;  1ZSK A;  1AN1 E;  2G5V A;  4WXV A;  4XRN A;  3LC5 A;  1EB2 A;  4K5Z A;  2SGP E;  2VVV A;  1O36 A;  2WV5 A;  4QT8 C;  3SZN A;  1W7X H;  1XUG A;  7GCH G;  4Y8X A;  1KSN A;  5CHA B;  4CRD A;  4NZL A;  1E37 B;  2HGT H;  2P3F H;  2ZI2 H;  2G8T A;  1JIR A;  3QX5 H;  2IPH A;  1FMG A;  2LNC A;  5DPA A;  1C5O H;  2WPJ S;  1F2S E;  3RXM A;  4X2W A;  1GDU A;  3EQ0 H;  5FPY A;  1QJ7 B;  2BDB A;  2DE8 A;  4ASH A;  1K2I 1;  3H5C B;  3MWI U;  1GG6 B;  1NRR H;  1GMH F;  2B0F A;  1LHD H;  2JH0 D;  3URC A;  2VB0 A;  2FPZ A;  5LH8 A;  1FXY A;  1ZSL A;  3LGY A;  1SL3 A;  1THR H;  3KN2 A;  4TWY A;  2ZU1 A;  1SGI B;  2HOB A;  3A8B A;  4Y10 E;  1AVG H;  2ZU5 A;  5BPE A;  1ZYO A;  4WF8 A;  1LDT T;  1NU7 B;  3MH7 A;  1NRQ H;  3A7V A;  3RDZ A;  3Q3Y A;  1UTM A;  2JET B;  2ZC9 H;  4ISH H;  4IW4 E;  2ZU3 A;  1G3E A;  1BTP A;  1UVS H;  1C2I A;  3Q77 A;  1FUJ A;  1FPH H;  3F0P A;  5F03 A;  5FPS A;  2GDD A;  3PRB A;  1FY4 A;  3UPE A;  1X7A C;  2F9O A;  2F9P A;  1HJA B;  1P2K A;  2YMS C;  5C20 A;  2BD7 A;  2SFA A;  1TAB E;  1AE5 A;  2VNT A;  3EAJ A;  4UFF H;  2R0L A;  2Y6T A;  1MZD A;  1SQT A;  2Z3D A;  2A4R A;  3RLW H;  3RC5 A;  1FN6 A;  3S9C A;  1ELE E;  4UDW H;  3U69 H;  1IQJ A;  1XMN B;  3TNT A;  1HV7 A;  5IDK A;  1Z8I B;  2KAI A;  4KTC A;  4XBC A;  3A83 A;  3A87 A;  3ZZ4 A;  1BTW A;  1E0F D;  2VH0 A;  1AVX A;  2KCY A;  3K9X B;  4O3T A;  3BG4 C;  1MAB B;  1O33 A;  2PV9 B;  1T8L A;  1O3K A;  3E90 B;  1N8O C;  3GCT G;  1U6Q A;  1Y5A T;  4Y0Z E;  1IQM A;  1O5F H;  4ZH8 A;  1GI0 A;  4ZHL U;  1AWF H;  1EAW A;  2OXS A;  1O2X A;  3RUO A;  1FIZ A;  3SO3 A;  4GVU A;  3RM0 H;  3TK9 A;  1OKX A;  4FU8 A;  2FLR H;  5EXL A;  1GI6 A;  1O32 A;  1ZGI A;  1A3E H;  2ZDL A;  1MTW A;  3SV9 A;  1QTF A;  5C1Y A;  4JYV H;  1GHV H;  2BD2 A;  4FUI A;  1DT2 A;  1OHH D;  1ANE A;  3SI3 H;  4HI3 A;  1K1J A;  4B6E A;  2THF B;  4BAM B;  3ATL A;  4MPV A;  1DS2 E;  4HGC A;  4E7R G;  4K1E A;  3S9B A;  1IAU A;  2F43 B;  2P16 A;  5CDF E;  3QK1 A;  2VVC A;  3M36 A;  3I29 A;  1NFX A;  5C2Z A;  1KLT A;  4NIW A;  2IJO B;  2WPH S;  1EZX C;  4AGJ A;  2QAA A;  1XXF A;  3ZVD A;  3T26 A;  1P0S H;  1GGD C;  1HCG A;  2XCF A;  3N7E A;  2J98 A;  1RTK A;  2ZGB H;  1THS H;  1GI1 A;  2XWA A;  2I6Q A;  4X1R U;  4X1Q U;  1EP6 A;  1AHT H;  4B2A A;  2BVR H;  2R3Y A;  1GMC F;  5EXM A;  2G81 E;  2QXG A;  5AVD A;  1EP5 A;  1QRZ A;  2QGR A;  3T27 A;  1QQU A;  4BAK B;  3RXI A;  1V2T T;  2FOA A;  5DSF A;  4GHT A;  2QF4 A;  3QO6 A;  1YY3 A;  4FUF A;  4RT1 A;  4A6L A;  2A7C A;  4X6P A;  3H7T A;  3LC3 A;  3OSY A;  1IQI A;  2SGQ E;  2C90 B;  1A0H B;  2AGG X;  5BRR E;  1SHY A;  2ODY B;  1DDJ A;  5F8T A;  3Q3X A;  4H6S B;  1AND A;  1A46 H;  3LJJ A;  1P11 E;  3RXG A;  2P95 A;  2XBY A;  3SND A;  1BMN H;  3V13 A;  3SI4 H;  3EGK H;  1YWU A;  1FZZ A;  1RTF B;  3R0F A;  1GPZ A;  4THN H;  2FZZ A;  2PSY A;  4CRG A;  2TGA A;  4HG6 A;  1CO7 E;  1GCD A;  2WPM S;  1PYT C;  1P9U A;  4I8L A;  1V6D A;  1EQ9 A;  1Z7K A;  2H9H A;  4B2B A;  5A09 A;  1SGF G;  2A1D B;  2PUX B;  1G3D A;  3TJV A;  2A32 A;  2ZDM A;  3HPT B;  5JBT A;  1TLD A;  3NCL A;  2M5T A;  3TH2 H;  2D1J A;  1QA7 A;  2GZ9 A;  3UNQ A;  1UJ1 A;  3N99 A;  4X6N A;  1H1B A;  1TIO A;  2BQW B;  3SJ8 A;  1F92 A;  5FBE A;  1N6Y A;  1OWD A;  3DT0 H;  3NUM A;  3SOS A;  1V2P T;  1O3O A;  1A0L A;  1BHX F;  5DKM A;  1EFR D;  1QL7 A;  3CS0 A;  1K1I A;  1HPG A;  3PRO A;  1SGP E;  1V3X A;  1D3D B;  1GVZ A;  4IGD A;  1DOJ A;  1J8A A;  2XOK D;  3M37 A;  3ZZ8 A;  2VIO A;  1W13 U;  3SUG A;  4DVA U;  4ZKO U;  2WV4 A;  1MU6 B;  1K1N A;  5C0T A;  1C5X B;  3ZVE A;  1AUJ A;  1TPS A;  2Z7F E;  2PTC E;  4X1S U;  4RKJ B;  1FON A;  2UWO A;  3CEN A;  3QUM P;  3VXE H;  2C8Z B;  1KXB A;  1RFN A;  1C4Y 2;  4CRE A;  2UUK B;  2HRV A;  1ELF A;  1MBM A;  4KTU A;  4B1T A;  3ENS B;  1RS0 A;  1GBB A;  1RIW C;  1UW7 A;  4K2Y A;  5G4B A;  1WDI A;  1DLE A;  1BBR H;  1DWE H;  4WXI A;  1AB9 B;  2SGA A;  2GCT C;  4BAQ B;  3FP6 E;  4WME A;  3T29 A;  3KID U;  3DHK H;  2AIQ A;  3LKW A;  1DWD H;  2FI5 E;  1C5T A;  5EQQ A;  2BLW A;  1O37 A;  2ULL A;  1FIW A;  3DCL A;  3W1E A;  1CT4 E;  3Q3K A;  2C8W B;  3E6P H;  2F4L A;  1GJA B;  3OY6 U;  4UFG H;  2FOM B;  8LPR A;  3P8N A;  4KKD A;  1GJ7 B;  3LOX A;  1O2Z A;  2FWW A;  1Y3W A;  2Q6G A;  1HIA B;  1VZQ H;  4IN1 A;  1O5C B;  2F9N A;  3PWC A;  5E0H A;  3RXH A;  1TA6 A;  1C5Z B;  3PO1 C;  3WW7 A;  3MU0 A;  3T28 A;  5TCC A;  1HUT H;  1TNK A;  1QHR B;  1O3I A;  5T6F A;  2FOG A;  5B6O A;  1H4W A;  4AZ2 B;  2O8U A;  4FUD A;  1IHS H;  1HBT H;  2XYA A;  4OS7 A;  1UVO A;  3EA8 A;  1WYK A;  1RXP A;  2VWN A;  5EXN A;  4Z6A H;  4UD9 H;  2B5T B;  2H1U A;  1TNL A;  1A5G H;  1MD7 A;  2JJ1 D;  1S85 A;  1G32 B;  1BHX B;  2FOB A;  3ZVG A;  4FVD A;  1HAV A;  1O3F A;  4NSV A;  2R0K A;  3D65 E;  1IQE A;  2WYJ A;  1KLI H;  4DCD A;  1KLJ H;  1SOT A;  4ABD A;  3N7O A;  4YT6 H;  2ZG0 H;  1O2P A;  2ZQ1 A;  3UB0 A;  3SV6 A;  4DIH H;  4ISL A;  4MNY A;  3SU5 A;  1AGJ A;  3MNX A;  1SGF A;  1BMF D;  1UHB A;  1AE8 H;  1O3B A;  1UTP A;  2ILN A;  2NU0 E;  3EDX B;  4FUE A;  3VFE A;  3MO6 A;  2LEL A;  1L4D A;  1IQH A;  2O8T A;  4CR5 A;  4TYD A;  1BTY A;  1S5S A;  3UWI A;  5FPT A;  5DN6 D;  5DK1 A;  2IPQ X;  4ZXY H;  2JIZ D;  1KDQ A;  1O0D H;  1SQR A;  4NIY A;  1UTO A;  1FJS A;  1V2O T;  2R2W U;  1E34 B;  2PLX A;  1W2K H;  1PPG E;  2QCY A;  1ZPZ A;  2Z9G A;  2ZGC A;  3BN9 A;  4NWL A;  5ETX A;  3ZZ7 A;  1V2Q T;  4AC9 A;  1PPE E;  2XXL A;  3F2G A;  3UQV A;  1QRX A;  4WMF A;  1DM4 B;  5KED A;  4JK5 A;  1F0R A;  3F1S B;  2AIP A;  1C5V A;  4INK A;  6GCH F;  5T6G A;  2PP6 A;  2J38 A;  1TWX B;  3D49 H;  4OGY A;  1AZ8 A;  2QY0 B;  2STA E;  1FV9 A;  1GJB B;  1O3P B;  2UWL A;  2GT8 A;  2J4I A;  1HB0 B;  1DWB H;  2JDI D;  5B6L A;  4MNV A;  2TPI Z;  3SV2 H;  1UVT H;  2ZGX H;  1IQK A;  1TRY A;  4B71 A;  3C27 B;  1H9H E;  1DWC H;  1J16 A;  4NSY A;  1O2O A;  3FKS D;  1DIT H;  1TQ7 B;  3EYD A;  1JBU H;  4YES B;  1W7G H;  5LPR A;  5JBA S;  3P70 B;  1K1O A;  5JPM H;  1AFQ B;  6EST A;  3E0N B;  1GWA A;  2PW8 H;  4FUG A;  3AK5 A;  4IBL H;  4CRA A;  5EJ1 A;  3D62 A;  4CH2 B;  1LKB A;  2FES H;  3GIS B;  1H8D H;  1T7C A;  4TPY A;  2WV9 A;  1OWI A;  1GBC A;  2IJD 1;  2YNA A;  2Z9J A;  1GBK A;  1KXA A;  4J1Y A;  3GY8 A;  4KEL A;  1O5D H;  1KXC A;  4I86 A;  5CE1 A;  1IQL A;  1Y8T A;  1AWH B;  3BSQ A;  3GDV A;  2P3U B;  4AYY B;  3UIR A;  3MYW A;  3HK3 B;  1MMJ N;  2HNT F;  3PB1 E;  3GDS A;  1F5R A;  1QQ4 A;  3TK5 A;  1GGD B;  1VKY A;  1F0S A;  3OTP A;  4ZUH A;  2ANK H;  1PPF E;  4R8T B;  5C1U A;  4MDS A;  2ZEB A;  2ZHE H;  1O30 A;  1GHA G;  1RGQ A;  2BX4 A;  3MU5 A;  1K9O E;  4RI0 A;  2V35 A;  1EJN A;  3F0O A;  2OC0 A;  2PKA A;  1C5M D;  1FPC H;  2GMT C;  3VGC C;  2PUQ H;  2WYG A;  2HLD D;  1PQ7 A;  4X6O A;  1V2S T;  2WHX A;  1W12 U;  1CT2 E;  1E79 D;  5GCH G;  1HDT H;  2G52 A;  1SSX A;  2AYW A;  3SGA E;  3SU0 A;  3SU3 A;  3BTQ E;  2WUC A;  2KCP A;  1BRU P;  1O2H A;  2TGT A;  3UOU A;  1A5H A;  1HRT H;  2O9Q A;  2UUF B;  4BXS A;  4CHA B;  4ZXX H;  1SMF E;  3U8R H;  2ZDV H;  2R3U A;  4NGA H;  3G01 A;  2DE9 A;  1TMT H;  1ETS H;  2FOD A;  1OYQ A;  2QV1 A;  2BLQ A;  2YOL A;  1DXW A;  1GBJ A;  3A81 A;  3RXD A;  1EPT A;  4AFS A;  3OEH D;  3MH6 A;  1QBV H;  1KXF A;  3PV4 A;  1FDP A;  1DAN H;  1UTN A;  1Q31 A;  3LGI A;  1S0Q A;  5DP3 A;  4CRB A;  4Q7Y A;  2ANY A;  1VIT F;  2C4F H;  3BIV H;  2J34 A;  4NA8 A;  3SBK A;  3WWB A;  4O3U A;  2Y7Z A;  1MAX A;  3BTF E;  3RU4 E;  3KNX A;  3SJK A;  4NA7 A;  2O8M A;  2VIP A;  1AI8 H;  3M5L A;  3KQE A;  2CF9 H;  1M9U A;  2SGE E;  3UOP A;  4K1T A;  1ARB A;  2W5E A;  2ZWL H;  3GS9 A;  5TCA A;  1ELA A;  4XSK U;  3BIU H;  3RU4 T;  1WU1 A;  1GBT A;  3PYH A;  4OS4 A;  4JZD H;  1TGS Z;  1ELB A;  2ZPS A;  1OX1 A;  1GVK B;  1WQV H;  2UWP A;  1C1W H;  1SQA A;  2VGC B;  1S6H A;  3BF6 H;  1ZML A;  3FVF B;  1HAY B;  2H6M A;  4AOR A;  1UCY K;  1IQN A;  1WOF A;  2OTV A;  3SW2 B;  3UAI C;  1SR5 C;  2A4O A;  1INC A;  1ESB A;  3FZD A;  1ETR H;  4YZU A;  1NT1 A;  1HAI H;  5HM9 A;  2OQU A;  5LPF A;  4AFQ A;  2OC1 A;  1QFK H;  4AFZ A;  1P10 A;  5F53 A;  4AGK A;  3CP7 A;  3OE7 D;  2PKS C;  4MPW A;  3UNS A;  4E7N A;  2Q6F A;  1RIW B;  1O34 A;  5GIB A;  2PGQ B;  5KEC A;  2CJI A;  3TJN A;  4AX9 H;  1SBW A;  1MQ5 A;  1GBH A;  5JBC S;  1J17 T;  3A8D A;  1BRB E;  3SGQ E;  1YYY 1;  2VID A;  4ZHM U;  1YPH C;  3SV7 A;  5CMX H;  4MVN A;  2Y5H A;  3VPK A;  4B75 A;  1TB6 H;  4CBN A;  3GIC B;  3TGJ E;  1HJ9 A;  5A0B A;  1F7Z A;  1O3N A;  4A1X A;  2AHM E;  2W26 A;  5HIZ A;  2ODP A;  1NS3 A;  1FX0 B;  1Z8R A;  3VB6 A;  3R3G B;  1HAZ B;  1AUT C;  3LJO A;  3SUE A;  1CGH A;  1GBM A;  2Z94 A;  2GZ8 A;  5IYT A;  1H8E D;  2BD5 A;  4BAH B;  2RA3 A;  1LO6 A;  2A4Q A;  2KM0 A;  3HKJ B;  4U32 A;  1UTL M;  2ASU B;  3KQ5 A;  7GCH F;  2Y5G A;  5FL7 D;  1NFU A;  5E2P A;  2K8I A;  5EPY A;  3RP2 A;  1V2J T;  2AS9 A;  2FM2 A;  4P02 A;  2J9N A;  1K1M A;  3L3T A;  1KY9 A;  3PTN A;  1P09 A;  2AMD A;  5DP4 A;  2QF0 A;  1W0Y H;  3FOA A;  1UCY H;  2WPL S;  1O2I A;  1GI9 B;  4YM9 A;  1T8O A;  3I78 A;  3URD A;  1GVL A;  5T1V A;  1ACB E;  1NRS H;  1YCP K;  1ZJK A;  2FDA A;  3CNR A;  4X8S H;  1VR1 H;  3RC6 A;  3FP8 E;  1DE7 H;  1W0K D;  1E36 B;  2BY8 X;  4FUH A;  4I7Y H;  4NWK A;  2J92 A;  2OUA A;  1WQS A;  2A7H A;  3ZVB A;  1MTV A;  1S84 A;  2LP6 A;  1GMC G;  4NG9 H;  1T8M A;  2D8W A;  4MLF B;  1OYT H;  4YTA A;  2ZFF H;  3EST A;  1OS8 A;  3PMB B;  4K69 A;  4B2C A;  2XRC A;  2XWB I;  2AER H;  1QBN A;  1ELC A;  4LK4 A;  1K28 D;  3QWC H;  2FI4 E;  1GHW H;  4UE7 H;  3SUF A;  4ISN A;  4B74 A;  4Q4L A;  5A8Z A;  1NO9 H;  1OPH B;  3JZ1 B;  1XVM A;  4OS1 A;  2P8O B;  3IIT A;  3S7H B;  3SNA A;  2FX6 A;  3K6Y A;  4GCH F;  3RXT A;  3K2U A;  3UWJ H;  1F0U A;  1UVU H;  1Z6J H;  3M5N A;  4Y6D A;  1EZQ A;  1MUE B;  5E8E H;  4IMQ A;  4O9V A;  1BA8 B;  2ODQ A;  4Q7Z A;  1NFW A;  3KF2 A;  2R2M B;  3H7O A;  2VWL A;  3SNE A;  4XOJ A;  1WCZ A;  3JZ2 B;  2C3S A;  1BUI A;  1GCT C;  3RXP A;  1MTN C;  8GCH F;  1SG8 B;  4TY7 A;  4OS2 A;  2Y82 A;  2J5U A;  3A7T A;  3MO3 A;  1CGI E;  1O2R A;  2ZA5 A;  1C1M A;  4OS5 A;  1EXF A;  1CSO E;  4ZCN A;  2BD3 A;  3RXB A;  4KTS A;  1K0H A;  4U2W A;  2ZNK H;  1ZTK A;  2RDL A;  3OX7 U;  1EUF A;  1YPM H;  3MMG A;  3RML H;  4ABF A;  2BX3 A;  1N6X A;  1C2F A;  1ZMN A;  2P93 A;  3D23 A;  5JB9 S;  1XUH A;  1MBQ A;  4Y71 A;  2K1Q A;  2ZF0 H;  1BCU H;  2ANW A;  4A5T S;  1C5N H;  1GJ5 H;  2V0B A;  2BVX H;  1PPC E;  3MNC A;  3UR6 A;  1B5G H;  1YCP H;  5HMA A;  3VG8 A;  2J98 B;  1WBG B;  1XUJ A;  3A85 A;  1CA0 C;  1Z8G A;  2ZIQ H;  4ZKS U;  2H5C A;  1L1N A;  1E35 B;  1TGT A;  2GP9 B;  1D6W A;  2EI6 A;  4IC6 A;  3BTT E;  3SHA H;  2EA3 A;  1BBR K;  1O2U A;  3H09 A;  2ZGH A;  4ZAE A;  5GND A;  3FZZ A;  1O3J A;  3MH5 A;  1RRK A;  2OQ5 A;  5I25 A;  1C1P A;  1PFX C;  1YF4 A;  6CHA B;  3U9A H;  5L6N H;  1LHC H;  4IS5 A;  5HKK D;  2HWL B;  2OP9 A;  4LXB H;  4D8N A;  4F4O C;  5JYI A;  3V12 A;  3LPR A;  2GX4 A;  2G55 A;  3BV9 B;  5DP9 A;  1O2N A;  4LZ1 H;  1JRT A;  1AY6 H;  1B0E A;  4VGC C;  2BDC A;  2IOT A;  1JXP A;  4YLU A;  4ZHA A;  1XX9 A;  3FP7 E;  5DP5 A;  2F9B H;  1ARC A;  4CRF A;  1Q2W A;  4NFE A;  5A0C A;  4YOG A;  2J2U A;  1THP B;  3GY6 A;  3TK6 A;  1SLX B;  2K0Q A;  1C5Q A;  1C1N A;  1ZHR A;  7LPR A;  5J4Q A;  4NZQ A;  1Z71 A;  1Y5B T;  4JMY A;  3T5F H;  4GHQ A;  4WY3 A;  1TAW A;  1FN8 A;  4F49 A;  1O3G A;  3BTK E;  1C9T A;  2GGV B;  1LHG H;  1TFX A;  1D3P B;  4ZRO A;  3MNB A;  2GMT B;  2PHB A;  3GCH C;  1QJ6 B;  3ZVF A;  1NU9 A;  1HNE E;  5HGG A;  1SGN E;  1FY1 A;  3ODF A;  1GBA A;  1ZPB A;  2Q6D A;  1XXD A;  1FI8 A;  1QJ1 B;  1P2N A;  1K1L A;  3EE0 B;  3HAT H;  1EB1 H;  1NRO H;  1DUA A;  3RXA A;  2P94 A;  1UMA H;  1ZLR A;  4I8H A;  1WV7 H;  4Q2K A;  1E38 B;  2SNV A;  5EW1 H;  4X2Y A;  2FS9 A;  5CHA C;  2FOH A;  3RXV A;  1GI8 B;  2ZU2 A;  3NPS A;  5EPN A;  2VIN A;  1J14 A;  2L74 A;  3KEE A;  4ASU D;  2FI3 E;  3QLP H;  3ZZA A;  2DUC A;  1P2M A;  3RMN H;  1PQ5 A;  1EJM A;  1UTJ A;  1XUI A;  1C2E A;  2XCN A;  1OWK A;  1JMO H;  2ZU4 A;  3SYJ A;  4UON A;  5DO4 H;  1MCT A;  4RT0 A;  1AU8 A;  1C1S A;  5EQR A;  4BAN B;  3STJ A;  1L1J A;  4I33 A;  3SOR A;  1GG6 C;  1OSS A;  2ZKS A;  1UCY E;  3FFG A;  3AAV A;  1O3L A;  1HIA A;  4JZF H;  3IG6 B;  1OWH A;  2G00 A;  2WSS D;  3F9H A;  5FBI A;  4BOH A;  2C93 B;  4Y11 E;  1EX3 A;  1XUK A;  3MFJ A;  3IWM A;  1O3D A;  3NXP A;  3TLO A;  1LKA A;  4X2V A;  3ZZ3 A;  4NIV A;  2NU1 E;  2JET C;  2HLC A;  3GOV B;  1QL9 A;  1EKB B;  4GLY A;  1EZS C;  1S6F A;  1AFE H;  2V6N A;  1C2L A;  3KCG H;  1GBD A;  2B9L A;  1C5U A;  1TPA E;  3ATI A;  4TT3 D;  3HGP A;  3P8O A;  4ISI H;  1A5I A;  3E8L A;  2BY5 X;  5EIY A;  4A1T A;  2W6I D;  2A5A A;  5EW2 H;  1C2D A;  3LGT A;  3DSP A;  5A0A E;  4MPX A;  3TJO A;  1L0Z A;  3E0P B;  3B23 B;  1DIC A;  3MNS A;  6GCH G;  1T31 A;  5L2Y H;  3M5O A;  3RXS A;  1Y3U A;  3VB5 A;  4I31 A;  3UY9 A;  1ZTL A;  3OY5 U;  1YM0 A;  5GWZ A;  3F9G A;  2W7U A;  4RKO B;  1SGE E;  4E05 H;  2BD8 A;  2WPD D;  1HLT H;  2BOH B;  4XFQ A;  1T4U H;  2PGB B;  2XBX A;  1ZRB A;  3SNC A;  2BDY A;  2OLG A;  4LZ4 B;  2BDA A;  3WY8 A;  4KGA A;  3PMH B;  3TGI E;  5L30 H;  1P57 B;  3BTH E;  3BTD E;  1TRM A;  3ZVC A;  4BNR A;  3OTJ E;  1COW D;  3GY3 A;  1NC6 A;  4OGX A;  1H8I H;  1DUE A;  4X8V H;  2V3M A;  3RXJ A;  1BT7 A;  1WTG H;  3M61 U;  4JZI A;  5DG6 A;  4TWW A;  2PR3 A;  1O5E H;  2YMS B;  1K22 H;  1E1R D;  4X8T H;  1C1R A;  1D6R A;  3PTB A;  5FX6 A;  2W7S A;  4JCN A;  4X0W U;  1DSU A;  4Y76 A;  2F91 A;  2FYQ A;  1LQE A;  4MPU A;  3RXO A;  4Q80 A;  1MQ6 A;  5DP8 A;  1O2S A;  1O31 A;  1A4W H;  2VIQ A;  3N7D A;  2Z9L A;  1D3Q B;  1KDQ B;  1TON A;  1ANB A;  1C2M A;  1LVY A;  1QRW A;  4YOI A;  1ZPC A;  1TNI A;  1L4Z A;  4EST E;  1UK3 A;  3MQK C;  1V2U T;  3HK6 B;  2BYA X;  4U01 A;  2B7D H;  4DUR A;  2GZ7 A;  1O3H A;  1GJD B;  2FIR H;  1O3E A;  1C5L H;  2AMP A;  1VJA U;  4NFF A;  4P00 A;  5C17 A;  2BVS H;  3BG4 B;  4Y8Z A;  5DJ7 A;  1NM6 A;  5HIY A;  4NCY A;  3SQH E;  3TPI Z;  1HXE H;  4AB8 A;  4XD7 D;  1N8O B;  2QIQ A;  1BJV A;  1LPZ B;  2XC0 A;  1O2G H;  1LVB A;  5E0J A;  1T8N A;  1DPO A;  4IN2 A;  3GDU A;  1AKS B;  1SFI A;  5ESB A;  3ZV9 A;  5IK2 D;  5EQS A;  3OU0 A;  4AG2 A;  1BMM H;  1MKX K;  1P03 A;  1V2K T;  1BTU A;  4ISO A;  2A2Q H;  3SJO A;  5AF9 H;  1EOL A;  3VEQ B;  3SQE E;  1CT0 E;  4WH6 A;  2P59 A;  1O39 A;  1NES E;  3LH3 A;  1GJ6 A;  5T3H A;  1K1P A;  1NBM D;  2EI7 A;  3QTV H;  2QE7 D;  5L2Z H;  4JZE H;  1NZQ H;  1YP9 A;  1GBE A;  2A31 A;  2GCH F;  2TRM A;  2A5K A;  1QBO A;  1B7X B;  1CVW H;  4OM9 A;  1G37 A;  3U1J B;  1SHH B;  2VWM A;  4ACB A;  2M2A A;  1BTX A;  3SU6 A;  1WUN H;  1Z8J B;  2A45 B;  4XBD A;  3M3V A;  1NRN H;  1CHO F;  5CHB A;  2ZPQ A;  1LVM A;  2CHA C;  3A8C A;  2BQ7 B;  4B73 A;  3PLP A;  3QGN B;  1F5K U;  1IHT H;  4X2X A;  1BBR E;  1GCT B;  2GVF A;  1HJ8 A;  1SQO A;  3MU8 A;  4UEH H;  2EEK A;  1VIT G;  1BB0 B;  1L1G A;  3BEF B;  4Z0K A;  1TBZ H;  3ODD A;  1CE5 A;  1DFP A;  1OP0 A;  3BTM E;  1SGQ E;  1SLV B;  3KYF A;  5FCR A;  4E06 H;  1C5Y B;  2EY4 C;  4Y8Y A;  3TVJ B;  3URE A;  1GDN A;  3F3B A;  3TIU A;  2F83 A;  4DJZ B;  4A1V A;  3M3T A;  2L6O A;  4GPG A;  2O8L A;  2A2X H;  1BIT A;  4I32 A;  4BXW A;  2BY6 X;  5JDU B;  3LIW A;  2AFQ B;  3E16 B;  1MH0 A;  1BRA A;  1SKY E;  1N1L A;  1CA0 B;  3DFJ A;  3M5M A;  1MKX H;  3E91 A;  2FOE A;  1JIM A;  5LGO A;  1SGR E;  1EAU A;  3EA9 A;  3OAA D;  2VWO A;  4FVB A;  4MNX A;  3HGN A;  3TH3 H;  1IOE A;  1MTU A;  4ABG A;  2STB E;  2BY7 X;  1ZZZ A;  1LHE H;  1J15 A;  4FUB A;  4FUJ A;  3UUZ A;  4IMZ A;  2ALP A;  2UUJ B;  5A8Y A;  3A84 A;  3NWU A;  1O3A A;  1O2K A;  2XC4 A;  4VGC B;  3KQB A;  1GMH G;  1NFY A;  1V2L T;  5EST E;  2FOF A;  2G51 A;  1TA2 A;  5KGO A;  3TNS A;  3TJU A;  1G3B A;  4D7G A;  1GL1 A;  1AB9 C;  3MH4 A;  3ZZC A;  2A4G A;  4X6M A;  4DOQ A;  2YNB A;  2AGI X;  3PV5 A;  3E3T A;  1FAX A;  1W11 U;  2BLV A;  2IN2 A;  2XW9 A;  1QY6 A;  2YMS D;  1YKT A;  2GJG A;  4ABJ A;  3MHW U;  2AH4 X;  1EAS A;  1ELT A;  3L33 A;  4AB9 A;  4ZMA H;  1ID5 H;  3QZR A;  1NY2 2;  3SGB E;  2VIW A;  2ZCK P;  1B0F A;  5DP6 A;  1HXF H;  5JBB S;  3SJ9 A;  3P8F A; 
#chains in the Genus database with same CATH homology
 2J98 B;  2J97 A;  1QZ8 A;  5HIY A;  5HIZ A;  5C94 A;  1UW7 A;  2J98 A;  3EE7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...