2J9AA

Bllap in complex with microginin fr1
Total Genus 175
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
175
sequence length
485
structure length
485
Chain Sequence
TKGLVLGIYSKEKEEDEPQFTSAGENFNKLVSGKLREILNISGPPLKAGKTRTFYGLHEDFPSVVVVGLGKKTAGIDEQENWHEGKENIRAAVAAGCRQIQDLEIPSVEVDPCGDAQAAAEGAVLGLYEYDDLKQKRKVVVSAKLHGSEDQEAWQRGVLFASGQNLARRLMETPANEMTPTKFAEIVEENLKSASIKTDVFIRPKSWIEEQEMGSFLSVAKGSEEPPVFLEIHYKGSPNASEPPLVFVGKGITFDSGGISIKAAANMDLMRADMGGAATICSAIVSAAKLDLPINIVGLAPLCENMPSGKANKPGDVVRARNGKTIQVDNTDAEGRLILADALCYAHTFNPKVIINAATLTGAMDIALGSGATGVFTNSSWLWNKLFEASIETGDRVWRMPLFEHYTRQVIDCQLADVNNIGKYRSAGACTAAAFLKEFVTHPKWAHLDIAGVMTNKDEVPYLRKGMAGRPTRTLIEFLFRFSQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Binding Structure of the Leucine Aminopeptidase Inhibitor Microginin Fr1.
pubmed doi rcsb
molecule tags Hydrolase/inhibitor
molecule keywords CYTOSOL AMINOPEPTIDASE
total genus 175
structure length 485
sequence length 485
ec nomenclature ec 3.4.11.1: Leucyl aminopeptidase.
pdb deposition date 2006-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00883 Peptidase_M17 Cytosol aminopeptidase family, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 2j9aA01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2j9aA02
4EMEA 2WZNA 3B35A 2PJ4A 2EK9A 4NGRA 4B6ZA 3B3VA 2LGRA 3FECA 2ZOFA 4P4FA 4TNUA 8CPAA 4J4ZA 2IJZA 2C6PA 3PB9X 4YWYA 1IGBA 1YLOA 4UF4A 5DS0A 2XEGA 3WC7A 1OBRA 5CB3A 3VARA 3IO1A 1ZLHA 3B7IA 4UMLA 1BPMA 2ZEHA 3EWPA 3H8GA 2AFUA 2JBKA 2EEEA 2ABZA 4MHPA 5F09A 5FSVA 4JYWA 5FSYA 6CPAA 2NSMA 3WT4A 3NH5A 5LRJA 3BI1A 2DX6A 3BHXA 5LRGA 1DE4C 3TX8A 3SIGA 2PCUA 1BPNA 4P4EA 3KASA 2PVVA 2AFSA 1ELMP 4NGSA 3IIDA 3I1UA 3EKEA 4NFRA 3N5FA 4UEZA 1ZG9A 3PFEA 4MCPA 1VHOA 2OR4A 2FG1A 4GVWA 2L8RA 4TU0A 4UEEA 4DYOA 1VHEA 3SJEA 2HC9A 3D7GA 5FSUA 1PYTB 5FSZA 4UEFA 2ZEOA 2RFHA 4PXCA 5FSXA 4JGKA 3GUXA 3SI1A 2PRQA 2AFOA 4X2TA 4MMOA 1EE3P 2ACFA 4MCRA 3FEEA 4IQYA 4MHZA 4OMEA 4RUHA 5K8OA 4P45A 4ABLA 2GREA 4OC2A 1LOKA 3JZTA 3VFQA 1IY7A 5HVFA 4FAIA 4EFDA 2IQ6A 3VATA 4P4IA 2Q51A 3H8FA 5J1QA 3VH9A 4NJRA 3IJ3A 1DTDA 2JBJA 3KR5A 2PJ5A 4PXEA 4P4JA 3FEDA 2NYQA 2QVPA 1ZLIA 4OIDA 3PBBA 1LAMA 4OKOA 4A38A 3EWRA 5LYLA 1TKJA 5AILA 4Q7AA 1CP7A 4O23A 2C6GA 2FVGA 4ZY0A 3NH8A 2AFWA 2G9DA 3SIIA 1LFWA 1VHUA 5E3BA 1ZG8A 2Q4ZA 4OC1A 3NFZA 1F2PA 3Q6ZA 3SI0A 1RTQA 3JRUA 3NA6A 1AYEA 1CPXA 2PJ1A 3ETIA 1TXRA 2RB7A 3D67A 2XD7A 4IAVA 1Y7EA 2I3CA 3PBEA 5D8NA 1M4LA 1HDQA 3KHXA 2VL1A 1CG2A 4GUAA 5HVGA 1BAVA 5HIHA 3GPOA 1LAPA 5IB9A 3D4UA 2C1CA 3CDXA 2BO9A 5HXDA 1Z8LA 5JH9A 7CPAA 1KWMA 3IIBA 2C6CA 3K2KA 4P44A 3HLPA 3PB7X 4MCSA 3KI9A 1CP6A 3PB6X 4KSIA 3TC8A 4R8FA 1HEEA 3NH4A 2ZEEA 4W9YA 1QMUA 4G1PA 5LRKA 4JVVA 2PVWA 4J5RA 4NGPA 3B3WA 1YMEA 2JEWA 2PJ0A 3QNVA 3ISZA 2VRIA 2PJ7A 4A39A 4J5QA 4FUUA 4ZX8A 4ZY2A 2EWBA 2CTBA 3GPGA 3PB8X 1YW6A 3B3TA 3GQEA 4OP4A 3WC5A 2WYRA 2ZEPA 4UIAA 3BI0A 4R76A 5JM6A 1NJRA 1LANA 4X3RA 2PJ6A 3SIJA 3CPAA 4H2KA 4NGMA 4IK2A 3B3CA 4P10A 2POKA 2ANPA 1XBUA 2PJ9A 2V8DA 5D29A 1R43A 4BD9A 3KHZA 3IIFA 1ARMA 1VGYA 3IC1A 3FVLA 3GPQA 4NGTA 4K0CA 3D7HA 4MRIA 2AFXA 4WWVA 2HB6A 3Q71A 5CB5A 1YW4A 3PFOA 3K9TA 4CPAA 4PQAA 5I4MA 1GYTA 4ABKA 2PJ2A 2V77A 4K3NA 2QJ8A 3EWOA 3L2NA 1NSAA 4OC3A 1LCPA 1BLLE 4EWTA 3EWQA 4MCQA 4PPZA 1TY8A 3DLJA 1XFOA 5LYFA 3WC6A 2ZELA 3S9MA 1TKFA 4OC4A 3DGVA 2ZEDA 3IEHA 4MXUA 2PJ8A 1XMBA 3B3SA 4OC0A 1XRYA 3BXMA 1QQ9A 3LMSA 1AMPA 2ZEMA 4ESSA 1UWYA 4WJBA 1HJZA 5HOLA 4AXVA 3FH4A 5THWA 4ONWA 2PJBA 1VIXA 1FNOA 3KQZA 4R7MA 2EK8A 4F9UA 4OIWA 4KYBA 4OC5A 1XJOA 3HUVA 1ZG7A 2O4HA 3D66A 1F57A 2FXKA 2BOAA 3KQXA 1ARLA 2DEAA 4PXBA 4A37A 3V38A 3MN8A 2GLJA 2ZEGA 3LWUA 2PIYA 5LYIA 3S9NA 2BFRA 4YU9A 2PE3A 2V8VA 5HVHA 4FWUA 2AFZA 2CIJA 3KR4A 3D7FA 4NGNA 4J5SA 5ELYA 2GU2A 2FAVA 2AFMA 3FMCA 4NJQA 4ETJA 4LQGA 3EJGA 1Z5RA 4R6TA 3MRUA 4F9VA 2V8GA 3H8EA 5CBMA 2F8HA 3GB0A 3KL9A 4MHNA 2PJ3A 4MHYA 3V45A 3FJUA 4Z65A 3RZAA 1H8LA 3FX6A 3FF3A 4JLLA 5DUSA 3KZWA 5CPAA 3V2BA 2ZENA 4X8IA 2J9AA 3IWWA 3RBUA 4IHMA 3D68A 3GLJA 1SPVA 4P6YA 2ZOGA 1TF9A 3WABA 4P4DA 2GLFA 2XEJA 5LYDA 4PXDA 4TWEA 2XEFA 1CX8A 3IFEA 1TKHA 1R3NA 2PIZA 5K8MA 1ZR3A 4GVVA 3SIHA 3S9LA 3ISXA 3CT9A 3RAMA 4JZ0A 3EW5A 3PB4X 1Y0RA 1TF8A 2ZEFA 2X47A 3EJFA 2BFQA 2Q43A 1CBXA 1JQGA 3SJGA 4NGQA 4A94A 2AFCA 4ZY1A 1TXZA 3T8WA 3CPXA 2XEIA 5JGFA 2OOTA 4ZI6A 3B2YA 2CF4A 3SJXA 2CTCA 3GQOA 4DJLA 5CMSA 4UIBA 4F8ZA 4JCAA 4ZX9A 1PCAA 3SI2A 2V8HA 2O53A 1HDUA 4ZYQA 4GM5A 2F7VA 1ZR5A 4ETKA 1CPSA 1YSJA 2PJAA 2PJCA 2QYVA 1Z2LA 5K8NA 4P4BA 3KGQA 3V7ZA 3PEIA 3SJFA 4FBEA 3D7DA 1Q7LA 4D86A 1YD9A 1FT7A 1F2OA 2BCOA 2IMOA 4DUKA 1ELLP 1Y0YA 5K8PA 3PRTA
chains in the Genus database with same CATH superfamily
4B10A 4EMEA 1M4DA 2WZNA 3B35A 3QAHA 2PJ4A 2EK9A 4HKFA 3FIXA 4NGRA 4B6ZA 3B3VA 2LGRA 3FECA 1RO5A 2ZOFA 2JLMA 5BWAB 4P4FA 1IYLA 2AJ6A 4TNUA 4YRHA 8CPAA 4J4ZA 4MI4A 1M4IA 2IJZA 2C6PA 2REEA 3PB9X 4YWYA 4CGNA 1IGBA 1YLOA 4K30A 3A9LA 2B4DB 1YQEA 2ARHA 4UF4A 2Z0ZA 4MFLA 1WK4A 5DS0A 2XEGA 3WC7A 1OBRA 5CB3A 3VARA 4KUBA 4JWPA 3IO1A 3B8GA 4C2YA 1ZLHA 1S7KA 3QB8A 3B7IA 4UMLA 4QBJA 4II9A 2WPWA 4ONUA 4B5PA 1BPMA 2ZEHA 2GE3A 3EWPA 4B11A 3H8GA 1BOBA 2AFUA 2JBKA 2EEEA 2ABZA 4MHPA 5F09A 1IIDA 2O28A 5FSVA 4JYWA 5FSYA 6CPAA 4GS4A 1GHEA 2NSMA 3WT4A 4HPSA 3NH5A 5LRJA 3BI1A 2DX6A 1YVKA 1ZO0A 4KSFA 4R3KA 3BHXA 1V0CA 5LRGA 1DE4C 3TX8A 3SIGA 2PCUA 1BPNA 1YGHA 4NSQA 4P4EA 4JD6A 3KASA 2PVVA 2AFSA 4HNYB 1ELMP 4NGSA 3IIDA 3I1UA 3EKEA 4NFRA 3N5FA 4CAWA 4UEZA 4ORFA 1ZG9A 3CXSA 3PFEA 4MCPA 1VHOA 2OR4A 2FG1A 4GVWA 4MY3A 3T90A 1Q2DA 2YGWA 2ZXVA 5KTAA 3W6SA 2L8RA 4TU0A 2B3VA 4UEEA 1VHEA 2HUZA 4DYOA 3SJEA 4ZBGA 2HC9A 2HV2A 3D7GA 5FSUA 1PYTB 5FSZA 4UEFA 2ZEOA 2RFHA 4PXCA 5FSXA 4LUAA 4JGKA 3K9UA 2JZFA 4MFZA 3IWEA 4KOTA 4Y49B 2HQYA 3GUXA 3SI1A 5F46A 2PRQA 2J8NA 2ZPAA 2AFOA 1FY7A 5H86A 4EVYA 1IYKA 4RN7A 4X2TA 2PRBA 5C82A 4MMOA 1EE3P 4NXYA 4XNHB 2G3AA 2ACFA 4UFXA 4MCRA 3FEEA 4IQYA 1UFHA 4MHZA 4OMEA 5CNPA 4RUHA 5K8OA 3GYAA 4P45A 4ABLA 2GREA 4OC2A 4UCNA 1LOKA 2A4NA 3JZTA 3VFQA 1IY7A 5HVFA 4CGOA 4UA3A 2Z3MA 4FAIA 4EFDA 2IQ6A 4U9ZA 3LACA 4P4IA 2Q51A 4XPDB 3VATA 4FD7A 4NEXA 4QC6A 1RXTA 5KTCA 1QSRA 1NE9A 3H8FA 2Z3NA 3FBUA 5J1QA 3VH9A 2Q4VA 3JUWA 4NJRA 3IJ3A 1DTDA 2BSWA 2JBJA 1NSLA 3KR5A 4CRYB 2PJ5A 4PXEA 4Q36A 3ZZIA 3DNSA 4P4JA 1I21A 2DF5A 1I12A 2NYQA 3FEDA 2QVPA 4IF5A 1ZLIA 2ATRA 2Q7SA 4OIDA 2G3TA 3PBBA 1LAMA 2WPXA 4OKOA 5AG5A 3DR6A 4A38A 3EWRA 2CXAA 4CYPA 4KLVA 4YFJA 5LYLA 1TKJA 5AILA 4Q7AA 1CP7A 1KUXA 4RI1A 4O23A 4HNWB 2C6GA 2FVGA 4ZY0A 4CYOA 1S5KA 3GKRA 4MFJA 4KORA 3NH8A 2AFWA 2G9DA 2OZGA 3SIIA 4PK3A 1B6BA 1VHUA 1LFWA 5E3BA 1ZG8A 2F5IA 2Q4ZA 4OC1A 3NFZA 4ZGYB 2WCTA 1X10A 4UFVA 3F0AA 2PDOA 1F2PA 1Z8TA 1K4JA 3Q6ZA 1R57A 4QUSA 2OB0A 2OZHA 4MHDA 3SI0A 1RTQA 4X5KA 3F8KA 3GIUA 4KVXA 4MY0A 4CRZB 2Z3LA 4LX9A 4UCPA 3JRUA 3JVNA 3NA6A 2VXKA 4MFKA 2KQVA 1PU9A 1AYEA 1MJ9A 2ZW5A 3SXOA 1CPXA 1Y7RA 2PJ1A 3ETIA 1TXRA 2RB7A 3D67A 1PUAA 2XD7A 4OADA 1SQHA 4IAVA 1Y7EA 2I3CA 1MJBA 5D8NA 1M4LA 1HDQA 3KHXA 3PBEA 4L8AA 2VL1A 1A2ZA 1CG2A 4GUAA 5AGEA 4AG7A 5HVGA 1BAVA 2FE7A 5HIHA 1P4NA 3NE7A 4AXVA 1AUGA 3GPOA 1LAPA 5IB9A 3D4UA 1YX0A 2C1CA 3CDXA 2GIVA 2BO9A 5HXDA 1Z8LA 1Q2CA 1XF8A 3SHPA 5JH9A 7CPAA 3P2HA 2EBJA 4FD4A 1S3ZA 1KWMA 2Z3KA 3IIBA 5IV0A 2C6CA 3K2KA 2JZDA 4P44A 2RNKA 3BJ7A 3BLNA 3HLPA 2ZW7A 3PB7X 2Q44A 5ISVA 4MCSA 3FNCA 1CP6A 3KI9A 3D3SA 4E2AA 3PB6X 4KSIA 1MK4A 4KLWA 3TC8A 4R8FA 1QSNA 1HEEA 3NH4A 2ZEEA 4W9YA 1J4JA 1QMUA 2CNSA 4JVVA 1KZFA 2PVWA 4G1PA 5IB0A 4C2ZA 5LRKA 4J5RA 3FXTA 4NGPA 3B3WA 3RO0A 1YMEA 2JEWA 2PJ0A 2NMTA 4BINA 3QNVA 5GCNA 2PR8A 2WUUA 3ISZA 2G0BA 4A33A 2JDDA 2VRIA 2PJ7A 1Z8XA 4A39A 4J5QA 4FUUA 3S6GA 1VKCA 2ZW6A 4CGPA 2P0WA 4ZX8A 3TOBA 4XPKA 4ZY2A 3TO6A 4C7HA 2EWBA 4KSAA 2CTBA 4R87A 3GPGA 1I1DA 1YW6A 3PB8X 1YREA 3B3TA 3DR8A 3GQEA 2Y0MA 4OP4A 4J3GA 3WC5A 2WYRA 2ZEPA 2QMLA 4UIAA 3BI0A 3PGPA 1XE4A 4XPDC 4R76A 2B5GA 1JWQA 3OWCA 5JM6A 1NJRA 1ON0A 2AE6A 1LANA 2Q04A 4X3RA 2PJ6A 3SIJA 3CPAA 4H2KA 4H6UA 3RYOA 4CGLA 3IU1A 2KCWA 4NGMA 5C88A 2Z3PA 5F49A 3I3GA 1YVOA 3G8WA 4B5OA 2H5MA 2PC1A 4IK2A 3B3CA 4CS0B 4P10A 1XEBA 2POKA 2ANPA 4R3LA 4YGOA 1XBUA 1IU8A 2EUIA 2PJ9A 2V8DA 5D29A 1R43A 1YK3A 4BD9A 1YLEA 3IIFA 1ARMA 1VGYA 3IC1A 3KHZA 4AVCA 3FVLA 2C27A 3GPQA 4UCMA 3QAYA 4NGTA 4K0CA 4NCZA 1IB1E 3D7HA 3D8PA 4MRIA 2AFXA 3TO9A 4WWVA 1Z4EA 1OZPA 5HH1A 4PSWA 4M85A 2D4PA 2HB6A 4Q38A 3NE8A 3Q71A 5CB5A 1YW4A 3PFOA 3K9TA 4CPAA 4PQAA 2DXQA 1GYTA 3TOAA 5I4MA 4ABKA 2PJ2A 3D2PA 3N7ZA 2V77A 4K3NA 3EY5A 3ZJ0A 4NF1A 2FT0A 3EWOA 2QJ8A 3L2NA 4KS9A 2OH1A 3EFAA 3PP9A 1NSAA 4OC3A 1LCPA 2B5GB 1BLLE 4EWTA 3VWDA 3EWQA 4MCQA 3TFYA 2FSRA 4PPZA 4QVTA 4KOVA 1TY8A 1S7NA 2PR1A 4JLYA 3DLJA 1XFOA 5LYFA 4UWIA 1Y9WA 2RC4A 3WC6A 4CAVA 2ZELA 3S9MA 1TKFA 4OC4A 4CAEA 1KUYA 2VI7A 3DGVA 3I9SA 1Z4RA 2ZEDA 3IEHA 2R1IA 4UWJA 4CGMA 4MXUA 2REFA 4RS2A 2PJ8A 1XMBA 3GY9A 3MGDA 4B13A 3B3SA 4OC0A 1Z9UA 1XRYA 4UFWA 3BXMA 1QQ9A 4M6HA 3LMSA 1AMPA 2CNMA 2ZEMA 4ESSA 1UWYA 2YNDA 4WJBA 1S7FA 1HJZA 5HOLA 2R7HA 1M1DA 3FH4A 2D4OA 2R98A 1Y9KA 5THWA 1XOVA 3VWEA 5JQ4A 4ONWA 4AB7A 1VHSA 2PJBA 2B4DA 1VIXA 1FNOA 5EMIA 5AG4A 3KQZA 4R7MA 2EK8A 4PV6A 4F9UA 2Z11A 4OIWA 4KYBA 2QECA 4OC5A 4U5YA 1B87A 1XJOA 2CY2A 3T9YA 3HUVA 4XNHC 1ZG7A 3V8IA 4DNCA 4JXRA 2O4HA 3D66A 3BJ8A 1F57A 3CXQA 4I49A 2FXKA 2BOAA 3G3SA 4BBHA 4C7IA 4IUSA 3S6KA 3CXPA 3KQXA 1ARLA 3D2MA 2DEAA 2ZW4A 4PXBA 1N71A 2PQ8A 4A37A 1Q2YA 2I00A 1M4GA 2FL4A 3V38A 5E96A 1LRZA 1P0HA 1TIQA 3MN8A 4JJXA 4A30A 2GLJA 2ZEGA 1QSTA 3LWUA 4LQ6A 2PIYA 2YNCC 2W2GA 5LYIA 3S9NA 1XIXA 4R57A 2P6GA 2BFRA 2B58A 4KVME 4B5PB 4F0XA 2Q0YA 4YU9A 2PE3A 5A28A 4CAFA 2V8VA 5HVHA 2VQYA 4FWUA 2AFZA 1BO4A 2CIJA 3KR4A 2PSWA 1U6MA 3D7FA 4NGNA 5FVJA 4J5SA 4PK2A 5ELYA 3R9GA 1CM0A 2GU2A 4XPLA 2FAVA 4F0YA 2AFMA 3FMCA 3FRMA 4NJQA 4UBRA 4ETJA 3H4QA 4LQGA 3TT2A 3EJGA 1Z5RA 4R6TA 3MRUA 4KOWA 4F9VA 2Z10A 2V8GA 3H8EA 5CBMA 2F8HA 2BL1A 2Z3OA 3GB0A 2PJ3A 3KL9A 4H6ZA 4KVOE 4MHNA 4MHYA 3V45A 4MJ8A 3E0KA 2P6EA 3FJUA 2JDCA 3WR7A 4Z65A 3R95A 3RZAA 3S6HA 1H8LA 3CZXA 3FYNA 3FX6A 2B3UA 3FF3A 4U9YA 2BUEA 4JLLA 3LODA 5DUSA 4KUAA 3IWGA 5KTDA 1Z8WA 3KZWA 5CPAA 3V2BA 2ZENA 4X8IA 1WWZA 2Q4YA 2J9AA 1NMTA 2FIWA 4KOXA 4KZTA 3IWWA 3PZJA 4L89A 2K5TA 3RBUA 1YR0A 4IHMA 3D68A 4MBUA 4AVBA 4A2ZA 3GLJA 1SPVA 2JZEA 4F6AA 4P6YA 4KOYA 2ZOGA 4C2XA 1TF9A 2FXFA 3WABA 5I0CA 5JPHA 4P4DA 3R9EA 2GLFA 2XEJA 5LYDA 2Q7BA 4PXDA 3F5BA 4TWEA 2XEFA 1CX8A 2P6FA 2X7BA 3IFEA 1TKHA 1R3NA 2ODFA 5F47A 2PIZA 3UY5A 2DPSA 4OAEA 5K8MA 4B14A 1ZR3A 4GVVA 3SIHA 3S9LA 2GFQA 3ISXA 4JXQA 1IICA 2R8VA 3CT9A 4KOSA 3RAMA 3FB3A 4PSXA 2DPTA 4JZ0A 3EW5A 3P2FA 4M6IA 3DSBA 5F48A 3PB4X 2VZYA 4GXHA 2OU2A 1Y0RA 1TF8A 2ZEFA 1XMTA 2X47A 3KKWA 5G21A 4MFPA 3EJFA 5IX3A 2BFQA 2Q43A 1CBXA 1JQGA 3IGRA 2J8MA 3SJGA 4M6GA 4NGQA 3W6XA 4A94A 3R9FA 3EO4A 2AFCA 4ZY1A 1TXZA 2VBQA 2IL4A 4R9MA 3T8WA 3CPXA 2XEIA 4OLLA 3TE4A 2YNCA 5JGFA 4C68A 4A95A 1L0CA 1X12A 4Y49C 2OOTA 2FS5A 4A32A 4H89A 5J8CA 4ZI6A 1KUVA 3B2YA 2CF4A 3SJXA 2CTCA 2GANA 3GQOA 3SXNA 4HNXB 3R96A 5HMNA 4DJLA 4FD5A 5CMSA 2JEVA 4QB9A 5DWNA 4AG9A 2FCKA 4UIBA 1IOIA 2VZZA 5EC4A 4F8ZA 4JCAA 1MJAA 1QSMA 4ZX9A 1PCAA 5G20A 3TTHA 1CJWA 3SI2A 1IOFA 3IU2A 2V8HA 3EC4A 3H5ZA 2QIRA 2O53A 1S7LA 2OZUA 3C26A 1HDUA 5AG7A 4ZYQA 4GM5A 2F7VA 1ZR5A 1QSOA 2EVNA 2I79A 2VEZA 4M3SA 5G1ZA 4ETKA 3W91A 5DWMA 1CPSA 4E8OA 2EO8A 3LD2A 3JTKA 4CAXA 4CYNA 1YSJA 2PJAA 2PJCA 2WSAA 5AG6A 2QYVA 1Z2LA 1M44A 5K8NA 2CNTA 4P4BA 3KGQA 2B4BA 4KOUA 3RNZA 3PEIA 3SJFA 3V7ZA 4A31A 2J8RA 4FBEA 3D7DA 4FD6A 4MFQA 5A27A 1S60A 5H84A 1Q7LA 4AVAA 5G22A 4D86A 1YD9A 2FIAA 1FT7A 1F2OA 3EXNA 2YNEA 3S6FA 2BEIA 3TCVA 4E0AA 2BCOA 3DDDA 3TO7A 2IMOA 4DUKA 1ELLP 4CYQA 4B12A 5EBVA 4BMHA 3R1KA 1Y0YA 5J8FA 5K8PA 3PRTA
chains in the Genus database with same CATH topology
4EMEA 2WZNA 3B35A 2PJ4A 2EK9A 4NGRA 4B6ZA 3B3VA 2LGRA 3FECA 2ZOFA 4P4FA 4TNUA 8CPAA 4J4ZA 2IJZA 2C6PA 3PB9X 4YWYA 1IGBA 1YLOA 4UF4A 5DS0A 2XEGA 3WC7A 1OBRA 5CB3A 3VARA 3IO1A 1ZLHA 3B7IA 4UMLA 1BPMA 2ZEHA 3EWPA 3H8GA 2AFUA 2JBKA 2EEEA 2ABZA 4MHPA 5F09A 5FSVA 4JYWA 5FSYA 6CPAA 2NSMA 3WT4A 3NH5A 5LRJA 3BI1A 2DX6A 3BHXA 5LRGA 1DE4C 3TX8A 3SIGA 2PCUA 1BPNA 4P4EA 3KASA 2PVVA 2AFSA 1ELMP 4NGSA 3IIDA 3I1UA 3EKEA 4NFRA 3N5FA 4UEZA 1ZG9A 3PFEA 4MCPA 1VHOA 2OR4A 2FG1A 4GVWA 2L8RA 4TU0A 4UEEA 4DYOA 1VHEA 3SJEA 2HC9A 3D7GA 5FSUA 1PYTB 5FSZA 4UEFA 2ZEOA 2RFHA 4PXCA 5FSXA 4JGKA 3GUXA 3SI1A 2PRQA 2AFOA 4X2TA 4MMOA 1EE3P 2ACFA 4MCRA 3FEEA 4IQYA 4MHZA 4OMEA 4RUHA 5K8OA 4P45A 4ABLA 2GREA 4OC2A 1LOKA 3JZTA 3VFQA 1IY7A 5HVFA 4FAIA 4EFDA 2IQ6A 3VATA 4P4IA 2Q51A 3H8FA 5J1QA 3VH9A 4NJRA 3IJ3A 1DTDA 2JBJA 3KR5A 2PJ5A 4PXEA 4P4JA 3FEDA 2NYQA 2QVPA 1ZLIA 4OIDA 3PBBA 1LAMA 4OKOA 4A38A 3EWRA 5LYLA 1TKJA 5AILA 4Q7AA 1CP7A 4O23A 2C6GA 2FVGA 4ZY0A 3NH8A 2AFWA 2G9DA 3SIIA 1LFWA 1VHUA 5E3BA 1ZG8A 2Q4ZA 4OC1A 3NFZA 1F2PA 3Q6ZA 3SI0A 1RTQA 3JRUA 3NA6A 1AYEA 1CPXA 2PJ1A 3ETIA 1TXRA 2RB7A 3D67A 2XD7A 4IAVA 1Y7EA 2I3CA 3PBEA 5D8NA 1M4LA 1HDQA 3KHXA 2VL1A 1CG2A 4GUAA 5HVGA 1BAVA 5HIHA 3GPOA 1LAPA 5IB9A 3D4UA 2C1CA 3CDXA 2BO9A 5HXDA 1Z8LA 5JH9A 7CPAA 1KWMA 3IIBA 2C6CA 3K2KA 4P44A 3HLPA 3PB7X 4MCSA 3KI9A 1CP6A 3PB6X 4KSIA 3TC8A 4R8FA 1HEEA 3NH4A 2ZEEA 4W9YA 1QMUA 4G1PA 5LRKA 4JVVA 2PVWA 4J5RA 4NGPA 3B3WA 1YMEA 2JEWA 2PJ0A 3QNVA 3ISZA 2VRIA 2PJ7A 4A39A 4J5QA 4FUUA 4ZX8A 4ZY2A 2EWBA 2CTBA 3GPGA 3PB8X 1YW6A 3B3TA 3GQEA 4OP4A 3WC5A 2WYRA 2ZEPA 4UIAA 3BI0A 4R76A 5JM6A 1NJRA 1LANA 4X3RA 2PJ6A 3SIJA 3CPAA 4H2KA 4NGMA 4IK2A 3B3CA 4P10A 2POKA 2ANPA 1XBUA 2PJ9A 2V8DA 5D29A 1R43A 4BD9A 3KHZA 3IIFA 1ARMA 1VGYA 3IC1A 3FVLA 3GPQA 4NGTA 4K0CA 3D7HA 4MRIA 2AFXA 4WWVA 2HB6A 3Q71A 5CB5A 1YW4A 3PFOA 3K9TA 4CPAA 4PQAA 5I4MA 1GYTA 4ABKA 2PJ2A 2V77A 4K3NA 2QJ8A 3EWOA 3L2NA 1NSAA 4OC3A 1LCPA 1BLLE 4EWTA 3EWQA 4MCQA 4PPZA 1TY8A 3DLJA 1XFOA 5LYFA 3WC6A 2ZELA 3S9MA 1TKFA 4OC4A 3DGVA 2ZEDA 3IEHA 4MXUA 2PJ8A 1XMBA 3B3SA 4OC0A 1XRYA 3BXMA 1QQ9A 3LMSA 1AMPA 2ZEMA 4ESSA 1UWYA 4WJBA 1HJZA 5HOLA 4AXVA 3FH4A 5THWA 4ONWA 2PJBA 1VIXA 1FNOA 3KQZA 4R7MA 2EK8A 4F9UA 4OIWA 4KYBA 4OC5A 1XJOA 3HUVA 1ZG7A 2O4HA 3D66A 1F57A 2FXKA 2BOAA 3KQXA 1ARLA 2DEAA 4PXBA 4A37A 3V38A 3MN8A 2GLJA 2ZEGA 3LWUA 2PIYA 5LYIA 3S9NA 2BFRA 4YU9A 2PE3A 2V8VA 5HVHA 4FWUA 2AFZA 2CIJA 3KR4A 3D7FA 4NGNA 4J5SA 5ELYA 2GU2A 2FAVA 2AFMA 3FMCA 4NJQA 4ETJA 4LQGA 3EJGA 1Z5RA 4R6TA 3MRUA 4F9VA 2V8GA 3H8EA 5CBMA 2F8HA 3GB0A 3KL9A 4MHNA 2PJ3A 4MHYA 3V45A 3FJUA 4Z65A 3RZAA 1H8LA 3FX6A 3FF3A 4JLLA 5DUSA 3KZWA 5CPAA 3V2BA 2ZENA 4X8IA 2J9AA 3IWWA 3RBUA 4IHMA 3D68A 3GLJA 1SPVA 4P6YA 2ZOGA 1TF9A 3WABA 4P4DA 2GLFA 2XEJA 5LYDA 4PXDA 4TWEA 2XEFA 1CX8A 3IFEA 1TKHA 1R3NA 2PIZA 5K8MA 1ZR3A 4GVVA 3SIHA 3S9LA 3ISXA 3CT9A 3RAMA 4JZ0A 3EW5A 3PB4X 1Y0RA 1TF8A 2ZEFA 2X47A 3EJFA 2BFQA 2Q43A 1CBXA 1JQGA 3SJGA 4NGQA 4A94A 2AFCA 4ZY1A 1TXZA 3T8WA 3CPXA 2XEIA 5JGFA 2OOTA 4ZI6A 3B2YA 2CF4A 3SJXA 2CTCA 3GQOA 4DJLA 5CMSA 4UIBA 4F8ZA 4JCAA 4ZX9A 1PCAA 3SI2A 2V8HA 2O53A 1HDUA 4ZYQA 4GM5A 2F7VA 1ZR5A 4ETKA 1CPSA 1YSJA 2PJAA 2PJCA 2QYVA 1Z2LA 5K8NA 4P4BA 3KGQA 3V7ZA 3PEIA 3SJFA 4FBEA 3D7DA 1Q7LA 4D86A 1YD9A 1FT7A 1F2OA 2BCOA 2IMOA 4DUKA 1ELLP 1Y0YA 5K8PA 3PRTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EME A;  2WZN A;  3B35 A;  2PJ4 A;  2EK9 A;  4NGR A;  4B6Z A;  3B3V A;  2LGR A;  3FEC A;  2ZOF A;  4P4F A;  4TNU A;  8CPA A;  4J4Z A;  2IJZ A;  2C6P A;  3PB9 X;  4YWY A;  1IGB A;  1YLO A;  4UF4 A;  5DS0 A;  2XEG A;  3WC7 A;  1OBR A;  5CB3 A;  3VAR A;  3IO1 A;  1ZLH A;  3B7I A;  4UML A;  1BPM A;  2ZEH A;  3EWP A;  3H8G A;  2AFU A;  2JBK A;  2EEE A;  2ABZ A;  4MHP A;  5F09 A;  5FSV A;  4JYW A;  5FSY A;  6CPA A;  2NSM A;  3WT4 A;  3NH5 A;  5LRJ A;  3BI1 A;  2DX6 A;  3BHX A;  5LRG A;  1DE4 C;  3TX8 A;  3SIG A;  2PCU A;  1BPN A;  4P4E A;  3KAS A;  2PVV A;  2AFS A;  1ELM P;  4NGS A;  3IID A;  3I1U A;  3EKE A;  4NFR A;  3N5F A;  4UEZ A;  1ZG9 A;  3PFE A;  4MCP A;  1VHO A;  2OR4 A;  2FG1 A;  4GVW A;  2L8R A;  4TU0 A;  4UEE A;  4DYO A;  1VHE A;  3SJE A;  2HC9 A;  3D7G A;  5FSU A;  1PYT B;  5FSZ A;  4UEF A;  2ZEO A;  2RFH A;  4PXC A;  5FSX A;  4JGK A;  3GUX A;  3SI1 A;  2PRQ A;  2AFO A;  4X2T A;  4MMO A;  1EE3 P;  2ACF A;  4MCR A;  3FEE A;  4IQY A;  4MHZ A;  4OME A;  4RUH A;  5K8O A;  4P45 A;  4ABL A;  2GRE A;  4OC2 A;  1LOK A;  3JZT A;  3VFQ A;  1IY7 A;  5HVF A;  4FAI A;  4EFD A;  2IQ6 A;  3VAT A;  4P4I A;  2Q51 A;  3H8F A;  5J1Q A;  3VH9 A;  4NJR A;  3IJ3 A;  1DTD A;  2JBJ A;  3KR5 A;  2PJ5 A;  4PXE A;  4P4J A;  3FED A;  2NYQ A;  2QVP A;  1ZLI A;  4OID A;  3PBB A;  1LAM A;  4OKO A;  4A38 A;  3EWR A;  5LYL A;  1TKJ A;  5AIL A;  4Q7A A;  1CP7 A;  4O23 A;  2C6G A;  2FVG A;  4ZY0 A;  3NH8 A;  2AFW A;  2G9D A;  3SII A;  1LFW A;  1VHU A;  5E3B A;  1ZG8 A;  2Q4Z A;  4OC1 A;  3NFZ A;  1F2P A;  3Q6Z A;  3SI0 A;  1RTQ A;  3JRU A;  3NA6 A;  1AYE A;  1CPX A;  2PJ1 A;  3ETI A;  1TXR A;  2RB7 A;  3D67 A;  2XD7 A;  4IAV A;  1Y7E A;  2I3C A;  3PBE A;  5D8N A;  1M4L A;  1HDQ A;  3KHX A;  2VL1 A;  1CG2 A;  4GUA A;  5HVG A;  1BAV A;  5HIH A;  3GPO A;  1LAP A;  5IB9 A;  3D4U A;  2C1C A;  3CDX A;  2BO9 A;  5HXD A;  1Z8L A;  5JH9 A;  7CPA A;  1KWM A;  3IIB A;  2C6C A;  3K2K A;  4P44 A;  3HLP A;  3PB7 X;  4MCS A;  3KI9 A;  1CP6 A;  3PB6 X;  4KSI A;  3TC8 A;  4R8F A;  1HEE A;  3NH4 A;  2ZEE A;  4W9Y A;  1QMU A;  4G1P A;  5LRK A;  4JVV A;  2PVW A;  4J5R A;  4NGP A;  3B3W A;  1YME A;  2JEW A;  2PJ0 A;  3QNV A;  3ISZ A;  2VRI A;  2PJ7 A;  4A39 A;  4J5Q A;  4FUU A;  4ZX8 A;  4ZY2 A;  2EWB A;  2CTB A;  3GPG A;  3PB8 X;  1YW6 A;  3B3T A;  3GQE A;  4OP4 A;  3WC5 A;  2WYR A;  2ZEP A;  4UIA A;  3BI0 A;  4R76 A;  5JM6 A;  1NJR A;  1LAN A;  4X3R A;  2PJ6 A;  3SIJ A;  3CPA A;  4H2K A;  4NGM A;  4IK2 A;  3B3C A;  4P10 A;  2POK A;  2ANP A;  1XBU A;  2PJ9 A;  2V8D A;  5D29 A;  1R43 A;  4BD9 A;  3KHZ A;  3IIF A;  1ARM A;  1VGY A;  3IC1 A;  3FVL A;  3GPQ A;  4NGT A;  4K0C A;  3D7H A;  4MRI A;  2AFX A;  4WWV A;  2HB6 A;  3Q71 A;  5CB5 A;  1YW4 A;  3PFO A;  3K9T A;  4CPA A;  4PQA A;  5I4M A;  1GYT A;  4ABK A;  2PJ2 A;  2V77 A;  4K3N A;  2QJ8 A;  3EWO A;  3L2N A;  1NSA A;  4OC3 A;  1LCP A;  1BLL E;  4EWT A;  3EWQ A;  4MCQ A;  4PPZ A;  1TY8 A;  3DLJ A;  1XFO A;  5LYF A;  3WC6 A;  2ZEL A;  3S9M A;  1TKF A;  4OC4 A;  3DGV A;  2ZED A;  3IEH A;  4MXU A;  2PJ8 A;  1XMB A;  3B3S A;  4OC0 A;  1XRY A;  3BXM A;  1QQ9 A;  3LMS A;  1AMP A;  2ZEM A;  4ESS A;  1UWY A;  4WJB A;  1HJZ A;  5HOL A;  4AXV A;  3FH4 A;  5THW A;  4ONW A;  2PJB A;  1VIX A;  1FNO A;  3KQZ A;  4R7M A;  2EK8 A;  4F9U A;  4OIW A;  4KYB A;  4OC5 A;  1XJO A;  3HUV A;  1ZG7 A;  2O4H A;  3D66 A;  1F57 A;  2FXK A;  2BOA A;  3KQX A;  1ARL A;  2DEA A;  4PXB A;  4A37 A;  3V38 A;  3MN8 A;  2GLJ A;  2ZEG A;  3LWU A;  2PIY A;  5LYI A;  3S9N A;  2BFR A;  4YU9 A;  2PE3 A;  2V8V A;  5HVH A;  4FWU A;  2AFZ A;  2CIJ A;  3KR4 A;  3D7F A;  4NGN A;  4J5S A;  5ELY A;  2GU2 A;  2FAV A;  2AFM A;  3FMC A;  4NJQ A;  4ETJ A;  4LQG A;  3EJG A;  1Z5R A;  4R6T A;  3MRU A;  4F9V A;  2V8G A;  3H8E A;  5CBM A;  2F8H A;  3GB0 A;  3KL9 A;  4MHN A;  2PJ3 A;  4MHY A;  3V45 A;  3FJU A;  4Z65 A;  3RZA A;  1H8L A;  3FX6 A;  3FF3 A;  4JLL A;  5DUS A;  3KZW A;  5CPA A;  3V2B A;  2ZEN A;  4X8I A;  2J9A A;  3IWW A;  3RBU A;  4IHM A;  3D68 A;  3GLJ A;  1SPV A;  4P6Y A;  2ZOG A;  1TF9 A;  3WAB A;  4P4D A;  2GLF A;  2XEJ A;  5LYD A;  4PXD A;  4TWE A;  2XEF A;  1CX8 A;  3IFE A;  1TKH A;  1R3N A;  2PIZ A;  5K8M A;  1ZR3 A;  4GVV A;  3SIH A;  3S9L A;  3ISX A;  3CT9 A;  3RAM A;  4JZ0 A;  3EW5 A;  3PB4 X;  1Y0R A;  1TF8 A;  2ZEF A;  2X47 A;  3EJF A;  2BFQ A;  2Q43 A;  1CBX A;  1JQG A;  3SJG A;  4NGQ A;  4A94 A;  2AFC A;  4ZY1 A;  1TXZ A;  3T8W A;  3CPX A;  2XEI A;  5JGF A;  2OOT A;  4ZI6 A;  3B2Y A;  2CF4 A;  3SJX A;  2CTC A;  3GQO A;  4DJL A;  5CMS A;  4UIB A;  4F8Z A;  4JCA A;  4ZX9 A;  1PCA A;  3SI2 A;  2V8H A;  2O53 A;  1HDU A;  4ZYQ A;  4GM5 A;  2F7V A;  1ZR5 A;  4ETK A;  1CPS A;  1YSJ A;  2PJA A;  2PJC A;  2QYV A;  1Z2L A;  5K8N A;  4P4B A;  3KGQ A;  3V7Z A;  3PEI A;  3SJF A;  4FBE A;  3D7D A;  1Q7L A;  4D86 A;  1YD9 A;  1FT7 A;  1F2O A;  2BCO A;  2IMO A;  4DUK A;  1ELL P;  1Y0Y A;  5K8P A;  3PRT A; 
#chains in the Genus database with same CATH topology
 4B10 A;  4EME A;  1M4D A;  2WZN A;  3B35 A;  3QAH A;  2PJ4 A;  2EK9 A;  4HKF A;  3FIX A;  4NGR A;  4B6Z A;  3B3V A;  2LGR A;  3FEC A;  1RO5 A;  2ZOF A;  2JLM A;  5BWA B;  4P4F A;  1IYL A;  2AJ6 A;  4TNU A;  4YRH A;  8CPA A;  4J4Z A;  4MI4 A;  1M4I A;  2IJZ A;  2C6P A;  2REE A;  3PB9 X;  4YWY A;  4CGN A;  1IGB A;  1YLO A;  4K30 A;  3A9L A;  2B4D B;  1YQE A;  2ARH A;  4UF4 A;  2Z0Z A;  4MFL A;  1WK4 A;  5DS0 A;  2XEG A;  3WC7 A;  1OBR A;  5CB3 A;  3VAR A;  4KUB A;  4JWP A;  3IO1 A;  3B8G A;  4C2Y A;  1ZLH A;  1S7K A;  3QB8 A;  3B7I A;  4UML A;  4QBJ A;  4II9 A;  2WPW A;  4ONU A;  4B5P A;  1BPM A;  2ZEH A;  2GE3 A;  3EWP A;  4B11 A;  3H8G A;  1BOB A;  2AFU A;  2JBK A;  2EEE A;  2ABZ A;  4MHP A;  5F09 A;  1IID A;  2O28 A;  5FSV A;  4JYW A;  5FSY A;  6CPA A;  4GS4 A;  1GHE A;  2NSM A;  3WT4 A;  4HPS A;  3NH5 A;  5LRJ A;  3BI1 A;  2DX6 A;  1YVK A;  1ZO0 A;  4KSF A;  4R3K A;  3BHX A;  1V0C A;  5LRG A;  1DE4 C;  3TX8 A;  3SIG A;  2PCU A;  1BPN A;  1YGH A;  4NSQ A;  4P4E A;  4JD6 A;  3KAS A;  2PVV A;  2AFS A;  4HNY B;  1ELM P;  4NGS A;  3IID A;  3I1U A;  3EKE A;  4NFR A;  3N5F A;  4CAW A;  4UEZ A;  4ORF A;  1ZG9 A;  3CXS A;  3PFE A;  4MCP A;  1VHO A;  2OR4 A;  2FG1 A;  4GVW A;  4MY3 A;  3T90 A;  1Q2D A;  2YGW A;  2ZXV A;  5KTA A;  3W6S A;  2L8R A;  4TU0 A;  2B3V A;  4UEE A;  1VHE A;  2HUZ A;  4DYO A;  3SJE A;  4ZBG A;  2HC9 A;  2HV2 A;  3D7G A;  5FSU A;  1PYT B;  5FSZ A;  4UEF A;  2ZEO A;  2RFH A;  4PXC A;  5FSX A;  4LUA A;  4JGK A;  3K9U A;  2JZF A;  4MFZ A;  3IWE A;  4KOT A;  4Y49 B;  2HQY A;  3GUX A;  3SI1 A;  5F46 A;  2PRQ A;  2J8N A;  2ZPA A;  2AFO A;  1FY7 A;  5H86 A;  4EVY A;  1IYK A;  4RN7 A;  4X2T A;  2PRB A;  5C82 A;  4MMO A;  1EE3 P;  4NXY A;  4XNH B;  2G3A A;  2ACF A;  4UFX A;  4MCR A;  3FEE A;  4IQY A;  1UFH A;  4MHZ A;  4OME A;  5CNP A;  4RUH A;  5K8O A;  3GYA A;  4P45 A;  4ABL A;  2GRE A;  4OC2 A;  4UCN A;  1LOK A;  2A4N A;  3JZT A;  3VFQ A;  1IY7 A;  5HVF A;  4CGO A;  4UA3 A;  2Z3M A;  4FAI A;  4EFD A;  2IQ6 A;  4U9Z A;  3LAC A;  4P4I A;  2Q51 A;  4XPD B;  3VAT A;  4FD7 A;  4NEX A;  4QC6 A;  1RXT A;  5KTC A;  1QSR A;  1NE9 A;  3H8F A;  2Z3N A;  3FBU A;  5J1Q A;  3VH9 A;  2Q4V A;  3JUW A;  4NJR A;  3IJ3 A;  1DTD A;  2BSW A;  2JBJ A;  1NSL A;  3KR5 A;  4CRY B;  2PJ5 A;  4PXE A;  4Q36 A;  3ZZI A;  3DNS A;  4P4J A;  1I21 A;  2DF5 A;  1I12 A;  2NYQ A;  3FED A;  2QVP A;  4IF5 A;  1ZLI A;  2ATR A;  2Q7S A;  4OID A;  2G3T A;  3PBB A;  1LAM A;  2WPX A;  4OKO A;  5AG5 A;  3DR6 A;  4A38 A;  3EWR A;  2CXA A;  4CYP A;  4KLV A;  4YFJ A;  5LYL A;  1TKJ A;  5AIL A;  4Q7A A;  1CP7 A;  1KUX A;  4RI1 A;  4O23 A;  4HNW B;  2C6G A;  2FVG A;  4ZY0 A;  4CYO A;  1S5K A;  3GKR A;  4MFJ A;  4KOR A;  3NH8 A;  2AFW A;  2G9D A;  2OZG A;  3SII A;  4PK3 A;  1B6B A;  1VHU A;  1LFW A;  5E3B A;  1ZG8 A;  2F5I A;  2Q4Z A;  4OC1 A;  3NFZ A;  4ZGY B;  2WCT A;  1X10 A;  4UFV A;  3F0A A;  2PDO A;  1F2P A;  1Z8T A;  1K4J A;  3Q6Z A;  1R57 A;  4QUS A;  2OB0 A;  2OZH A;  4MHD A;  3SI0 A;  1RTQ A;  4X5K A;  3F8K A;  3GIU A;  4KVX A;  4MY0 A;  4CRZ B;  2Z3L A;  4LX9 A;  4UCP A;  3JRU A;  3JVN A;  3NA6 A;  2VXK A;  4MFK A;  2KQV A;  1PU9 A;  1AYE A;  1MJ9 A;  2ZW5 A;  3SXO A;  1CPX A;  1Y7R A;  2PJ1 A;  3ETI A;  1TXR A;  2RB7 A;  3D67 A;  1PUA A;  2XD7 A;  4OAD A;  1SQH A;  4IAV A;  1Y7E A;  2I3C A;  1MJB A;  5D8N A;  1M4L A;  1HDQ A;  3KHX A;  3PBE A;  4L8A A;  2VL1 A;  1A2Z A;  1CG2 A;  4GUA A;  5AGE A;  4AG7 A;  5HVG A;  1BAV A;  2FE7 A;  5HIH A;  1P4N A;  3NE7 A;  4AXV A;  1AUG A;  3GPO A;  1LAP A;  5IB9 A;  3D4U A;  1YX0 A;  2C1C A;  3CDX A;  2GIV A;  2BO9 A;  5HXD A;  1Z8L A;  1Q2C A;  1XF8 A;  3SHP A;  5JH9 A;  7CPA A;  3P2H A;  2EBJ A;  4FD4 A;  1S3Z A;  1KWM A;  2Z3K A;  3IIB A;  5IV0 A;  2C6C A;  3K2K A;  2JZD A;  4P44 A;  2RNK A;  3BJ7 A;  3BLN A;  3HLP A;  2ZW7 A;  3PB7 X;  2Q44 A;  5ISV A;  4MCS A;  3FNC A;  1CP6 A;  3KI9 A;  3D3S A;  4E2A A;  3PB6 X;  4KSI A;  1MK4 A;  4KLW A;  3TC8 A;  4R8F A;  1QSN A;  1HEE A;  3NH4 A;  2ZEE A;  4W9Y A;  1J4J A;  1QMU A;  2CNS A;  4JVV A;  1KZF A;  2PVW A;  4G1P A;  5IB0 A;  4C2Z A;  5LRK A;  4J5R A;  3FXT A;  4NGP A;  3B3W A;  3RO0 A;  1YME A;  2JEW A;  2PJ0 A;  2NMT A;  4BIN A;  3QNV A;  5GCN A;  2PR8 A;  2WUU A;  3ISZ A;  2G0B A;  4A33 A;  2JDD A;  2VRI A;  2PJ7 A;  1Z8X A;  4A39 A;  4J5Q A;  4FUU A;  3S6G A;  1VKC A;  2ZW6 A;  4CGP A;  2P0W A;  4ZX8 A;  3TOB A;  4XPK A;  4ZY2 A;  3TO6 A;  4C7H A;  2EWB A;  4KSA A;  2CTB A;  4R87 A;  3GPG A;  1I1D A;  1YW6 A;  3PB8 X;  1YRE A;  3B3T A;  3DR8 A;  3GQE A;  2Y0M A;  4OP4 A;  4J3G A;  3WC5 A;  2WYR A;  2ZEP A;  2QML A;  4UIA A;  3BI0 A;  3PGP A;  1XE4 A;  4XPD C;  4R76 A;  2B5G A;  1JWQ A;  3OWC A;  5JM6 A;  1NJR A;  1ON0 A;  2AE6 A;  1LAN A;  2Q04 A;  4X3R A;  2PJ6 A;  3SIJ A;  3CPA A;  4H2K A;  4H6U A;  3RYO A;  4CGL A;  3IU1 A;  2KCW A;  4NGM A;  5C88 A;  2Z3P A;  5F49 A;  3I3G A;  1YVO A;  3G8W A;  4B5O A;  2H5M A;  2PC1 A;  4IK2 A;  3B3C A;  4CS0 B;  4P10 A;  1XEB A;  2POK A;  2ANP A;  4R3L A;  4YGO A;  1XBU A;  1IU8 A;  2EUI A;  2PJ9 A;  2V8D A;  5D29 A;  1R43 A;  1YK3 A;  4BD9 A;  1YLE A;  3IIF A;  1ARM A;  1VGY A;  3IC1 A;  3KHZ A;  4AVC A;  3FVL A;  2C27 A;  3GPQ A;  4UCM A;  3QAY A;  4NGT A;  4K0C A;  4NCZ A;  1IB1 E;  3D7H A;  3D8P A;  4MRI A;  2AFX A;  3TO9 A;  4WWV A;  1Z4E A;  1OZP A;  5HH1 A;  4PSW A;  4M85 A;  2D4P A;  2HB6 A;  4Q38 A;  3NE8 A;  3Q71 A;  5CB5 A;  1YW4 A;  3PFO A;  3K9T A;  4CPA A;  4PQA A;  2DXQ A;  1GYT A;  3TOA A;  5I4M A;  4ABK A;  2PJ2 A;  3D2P A;  3N7Z A;  2V77 A;  4K3N A;  3EY5 A;  3ZJ0 A;  4NF1 A;  2FT0 A;  3EWO A;  2QJ8 A;  3L2N A;  4KS9 A;  2OH1 A;  3EFA A;  3PP9 A;  1NSA A;  4OC3 A;  1LCP A;  2B5G B;  1BLL E;  4EWT A;  3VWD A;  3EWQ A;  4MCQ A;  3TFY A;  2FSR A;  4PPZ A;  4QVT A;  4KOV A;  1TY8 A;  1S7N A;  2PR1 A;  4JLY A;  3DLJ A;  1XFO A;  5LYF A;  4UWI A;  1Y9W A;  2RC4 A;  3WC6 A;  4CAV A;  2ZEL A;  3S9M A;  1TKF A;  4OC4 A;  4CAE A;  1KUY A;  2VI7 A;  3DGV A;  3I9S A;  1Z4R A;  2ZED A;  3IEH A;  2R1I A;  4UWJ A;  4CGM A;  4MXU A;  2REF A;  4RS2 A;  2PJ8 A;  1XMB A;  3GY9 A;  3MGD A;  4B13 A;  3B3S A;  4OC0 A;  1Z9U A;  1XRY A;  4UFW A;  3BXM A;  1QQ9 A;  4M6H A;  3LMS A;  1AMP A;  2CNM A;  2ZEM A;  4ESS A;  1UWY A;  2YND A;  4WJB A;  1S7F A;  1HJZ A;  5HOL A;  2R7H A;  1M1D A;  3FH4 A;  2D4O A;  2R98 A;  1Y9K A;  5THW A;  1XOV A;  3VWE A;  5JQ4 A;  4ONW A;  4AB7 A;  1VHS A;  2PJB A;  2B4D A;  1VIX A;  1FNO A;  5EMI A;  5AG4 A;  3KQZ A;  4R7M A;  2EK8 A;  4PV6 A;  4F9U A;  2Z11 A;  4OIW A;  4KYB A;  2QEC A;  4OC5 A;  4U5Y A;  1B87 A;  1XJO A;  2CY2 A;  3T9Y A;  3HUV A;  4XNH C;  1ZG7 A;  3V8I A;  4DNC A;  4JXR A;  2O4H A;  3D66 A;  3BJ8 A;  1F57 A;  3CXQ A;  4I49 A;  2FXK A;  2BOA A;  3G3S A;  4BBH A;  4C7I A;  4IUS A;  3S6K A;  3CXP A;  3KQX A;  1ARL A;  3D2M A;  2DEA A;  2ZW4 A;  4PXB A;  1N71 A;  2PQ8 A;  4A37 A;  1Q2Y A;  2I00 A;  1M4G A;  2FL4 A;  3V38 A;  5E96 A;  1LRZ A;  1P0H A;  1TIQ A;  3MN8 A;  4JJX A;  4A30 A;  2GLJ A;  2ZEG A;  1QST A;  3LWU A;  4LQ6 A;  2PIY A;  2YNC C;  2W2G A;  5LYI A;  3S9N A;  1XIX A;  4R57 A;  2P6G A;  2BFR A;  2B58 A;  4KVM E;  4B5P B;  4F0X A;  2Q0Y A;  4YU9 A;  2PE3 A;  5A28 A;  4CAF A;  2V8V A;  5HVH A;  2VQY A;  4FWU A;  2AFZ A;  1BO4 A;  2CIJ A;  3KR4 A;  2PSW A;  1U6M A;  3D7F A;  4NGN A;  5FVJ A;  4J5S A;  4PK2 A;  5ELY A;  3R9G A;  1CM0 A;  2GU2 A;  4XPL A;  2FAV A;  4F0Y A;  2AFM A;  3FMC A;  3FRM A;  4NJQ A;  4UBR A;  4ETJ A;  3H4Q A;  4LQG A;  3TT2 A;  3EJG A;  1Z5R A;  4R6T A;  3MRU A;  4KOW A;  4F9V A;  2Z10 A;  2V8G A;  3H8E A;  5CBM A;  2F8H A;  2BL1 A;  2Z3O A;  3GB0 A;  2PJ3 A;  3KL9 A;  4H6Z A;  4KVO E;  4MHN A;  4MHY A;  3V45 A;  4MJ8 A;  3E0K A;  2P6E A;  3FJU A;  2JDC A;  3WR7 A;  4Z65 A;  3R95 A;  3RZA A;  3S6H A;  1H8L A;  3CZX A;  3FYN A;  3FX6 A;  2B3U A;  3FF3 A;  4U9Y A;  2BUE A;  4JLL A;  3LOD A;  5DUS A;  4KUA A;  3IWG A;  5KTD A;  1Z8W A;  3KZW A;  5CPA A;  3V2B A;  2ZEN A;  4X8I A;  1WWZ A;  2Q4Y A;  2J9A A;  1NMT A;  2FIW A;  4KOX A;  4KZT A;  3IWW A;  3PZJ A;  4L89 A;  2K5T A;  3RBU A;  1YR0 A;  4IHM A;  3D68 A;  4MBU A;  4AVB A;  4A2Z A;  3GLJ A;  1SPV A;  2JZE A;  4F6A A;  4P6Y A;  4KOY A;  2ZOG A;  4C2X A;  1TF9 A;  2FXF A;  3WAB A;  5I0C A;  5JPH A;  4P4D A;  3R9E A;  2GLF A;  2XEJ A;  5LYD A;  2Q7B A;  4PXD A;  3F5B A;  4TWE A;  2XEF A;  1CX8 A;  2P6F A;  2X7B A;  3IFE A;  1TKH A;  1R3N A;  2ODF A;  5F47 A;  2PIZ A;  3UY5 A;  2DPS A;  4OAE A;  5K8M A;  4B14 A;  1ZR3 A;  4GVV A;  3SIH A;  3S9L A;  2GFQ A;  3ISX A;  4JXQ A;  1IIC A;  2R8V A;  3CT9 A;  4KOS A;  3RAM A;  3FB3 A;  4PSX A;  2DPT A;  4JZ0 A;  3EW5 A;  3P2F A;  4M6I A;  3DSB A;  5F48 A;  3PB4 X;  2VZY A;  4GXH A;  2OU2 A;  1Y0R A;  1TF8 A;  2ZEF A;  1XMT A;  2X47 A;  3KKW A;  5G21 A;  4MFP A;  3EJF A;  5IX3 A;  2BFQ A;  2Q43 A;  1CBX A;  1JQG A;  3IGR A;  2J8M A;  3SJG A;  4M6G A;  4NGQ A;  3W6X A;  4A94 A;  3R9F A;  3EO4 A;  2AFC A;  4ZY1 A;  1TXZ A;  2VBQ A;  2IL4 A;  4R9M A;  3T8W A;  3CPX A;  2XEI A;  4OLL A;  3TE4 A;  2YNC A;  5JGF A;  4C68 A;  4A95 A;  1L0C A;  1X12 A;  4Y49 C;  2OOT A;  2FS5 A;  4A32 A;  4H89 A;  5J8C A;  4ZI6 A;  1KUV A;  3B2Y A;  2CF4 A;  3SJX A;  2CTC A;  2GAN A;  3GQO A;  3SXN A;  4HNX B;  3R96 A;  5HMN A;  4DJL A;  4FD5 A;  5CMS A;  2JEV A;  4QB9 A;  5DWN A;  4AG9 A;  2FCK A;  4UIB A;  1IOI A;  2VZZ A;  5EC4 A;  4F8Z A;  4JCA A;  1MJA A;  1QSM A;  4ZX9 A;  1PCA A;  5G20 A;  3TTH A;  1CJW A;  3SI2 A;  1IOF A;  3IU2 A;  2V8H A;  3EC4 A;  3H5Z A;  2QIR A;  2O53 A;  1S7L A;  2OZU A;  3C26 A;  1HDU A;  5AG7 A;  4ZYQ A;  4GM5 A;  2F7V A;  1ZR5 A;  1QSO A;  2EVN A;  2I79 A;  2VEZ A;  4M3S A;  5G1Z A;  4ETK A;  3W91 A;  5DWM A;  1CPS A;  4E8O A;  2EO8 A;  3LD2 A;  3JTK A;  4CAX A;  4CYN A;  1YSJ A;  2PJA A;  2PJC A;  2WSA A;  5AG6 A;  2QYV A;  1Z2L A;  1M44 A;  5K8N A;  2CNT A;  4P4B A;  3KGQ A;  2B4B A;  4KOU A;  3RNZ A;  3PEI A;  3SJF A;  3V7Z A;  4A31 A;  2J8R A;  4FBE A;  3D7D A;  4FD6 A;  4MFQ A;  5A27 A;  1S60 A;  5H84 A;  1Q7L A;  4AVA A;  5G22 A;  4D86 A;  1YD9 A;  2FIA A;  1FT7 A;  1F2O A;  3EXN A;  2YNE A;  3S6F A;  2BEI A;  3TCV A;  4E0A A;  2BCO A;  3DDD A;  3TO7 A;  2IMO A;  4DUK A;  1ELL P;  4CYQ A;  4B12 A;  5EBV A;  4BMH A;  3R1K A;  1Y0Y A;  5J8F A;  5K8P A;  3PRT A; 
#chains in the Genus database with same CATH homology
 4EME A;  2WZN A;  3B35 A;  2PJ4 A;  2EK9 A;  4NGR A;  4B6Z A;  3B3V A;  2LGR A;  3FEC A;  2ZOF A;  4P4F A;  4TNU A;  8CPA A;  4J4Z A;  2IJZ A;  2C6P A;  3PB9 X;  4YWY A;  1IGB A;  1YLO A;  4UF4 A;  5DS0 A;  2XEG A;  3WC7 A;  1OBR A;  5CB3 A;  3VAR A;  3IO1 A;  1ZLH A;  3B7I A;  4UML A;  1BPM A;  2ZEH A;  3EWP A;  3H8G A;  2AFU A;  2JBK A;  2EEE A;  2ABZ A;  4MHP A;  5F09 A;  5FSV A;  4JYW A;  5FSY A;  6CPA A;  2NSM A;  3WT4 A;  3NH5 A;  5LRJ A;  3BI1 A;  2DX6 A;  3BHX A;  5LRG A;  1DE4 C;  3TX8 A;  3SIG A;  2PCU A;  1BPN A;  4P4E A;  3KAS A;  2PVV A;  2AFS A;  1ELM P;  4NGS A;  3IID A;  3I1U A;  3EKE A;  4NFR A;  3N5F A;  4UEZ A;  1ZG9 A;  3PFE A;  4MCP A;  1VHO A;  2OR4 A;  2FG1 A;  4GVW A;  2L8R A;  4TU0 A;  4UEE A;  4DYO A;  1VHE A;  3SJE A;  2HC9 A;  3D7G A;  5FSU A;  1PYT B;  5FSZ A;  4UEF A;  2ZEO A;  2RFH A;  4PXC A;  5FSX A;  4JGK A;  3GUX A;  3SI1 A;  2PRQ A;  2AFO A;  4X2T A;  4MMO A;  1EE3 P;  2ACF A;  4MCR A;  3FEE A;  4IQY A;  4MHZ A;  4OME A;  4RUH A;  5K8O A;  4P45 A;  4ABL A;  2GRE A;  4OC2 A;  1LOK A;  3JZT A;  3VFQ A;  1IY7 A;  5HVF A;  4FAI A;  4EFD A;  2IQ6 A;  3VAT A;  4P4I A;  2Q51 A;  3H8F A;  5J1Q A;  3VH9 A;  4NJR A;  3IJ3 A;  1DTD A;  2JBJ A;  3KR5 A;  2PJ5 A;  4PXE A;  4P4J A;  3FED A;  2NYQ A;  2QVP A;  1ZLI A;  4OID A;  3PBB A;  1LAM A;  4OKO A;  4A38 A;  3EWR A;  5LYL A;  1TKJ A;  5AIL A;  4Q7A A;  1CP7 A;  4O23 A;  2C6G A;  2FVG A;  4ZY0 A;  3NH8 A;  2AFW A;  2G9D A;  3SII A;  1LFW A;  1VHU A;  5E3B A;  1ZG8 A;  2Q4Z A;  4OC1 A;  3NFZ A;  1F2P A;  3Q6Z A;  3SI0 A;  1RTQ A;  3JRU A;  3NA6 A;  1AYE A;  1CPX A;  2PJ1 A;  3ETI A;  1TXR A;  2RB7 A;  3D67 A;  2XD7 A;  4IAV A;  1Y7E A;  2I3C A;  3PBE A;  5D8N A;  1M4L A;  1HDQ A;  3KHX A;  2VL1 A;  1CG2 A;  4GUA A;  5HVG A;  1BAV A;  5HIH A;  3GPO A;  1LAP A;  5IB9 A;  3D4U A;  2C1C A;  3CDX A;  2BO9 A;  5HXD A;  1Z8L A;  5JH9 A;  7CPA A;  1KWM A;  3IIB A;  2C6C A;  3K2K A;  4P44 A;  3HLP A;  3PB7 X;  4MCS A;  3KI9 A;  1CP6 A;  3PB6 X;  4KSI A;  3TC8 A;  4R8F A;  1HEE A;  3NH4 A;  2ZEE A;  4W9Y A;  1QMU A;  4G1P A;  5LRK A;  4JVV A;  2PVW A;  4J5R A;  4NGP A;  3B3W A;  1YME A;  2JEW A;  2PJ0 A;  3QNV A;  3ISZ A;  2VRI A;  2PJ7 A;  4A39 A;  4J5Q A;  4FUU A;  4ZX8 A;  4ZY2 A;  2EWB A;  2CTB A;  3GPG A;  3PB8 X;  1YW6 A;  3B3T A;  3GQE A;  4OP4 A;  3WC5 A;  2WYR A;  2ZEP A;  4UIA A;  3BI0 A;  4R76 A;  5JM6 A;  1NJR A;  1LAN A;  4X3R A;  2PJ6 A;  3SIJ A;  3CPA A;  4H2K A;  4NGM A;  4IK2 A;  3B3C A;  4P10 A;  2POK A;  2ANP A;  1XBU A;  2PJ9 A;  2V8D A;  5D29 A;  1R43 A;  4BD9 A;  3KHZ A;  3IIF A;  1ARM A;  1VGY A;  3IC1 A;  3FVL A;  3GPQ A;  4NGT A;  4K0C A;  3D7H A;  4MRI A;  2AFX A;  4WWV A;  2HB6 A;  3Q71 A;  5CB5 A;  1YW4 A;  3PFO A;  3K9T A;  4CPA A;  4PQA A;  5I4M A;  1GYT A;  4ABK A;  2PJ2 A;  2V77 A;  4K3N A;  2QJ8 A;  3EWO A;  3L2N A;  1NSA A;  4OC3 A;  1LCP A;  1BLL E;  4EWT A;  3EWQ A;  4MCQ A;  4PPZ A;  1TY8 A;  3DLJ A;  1XFO A;  5LYF A;  3WC6 A;  2ZEL A;  3S9M A;  1TKF A;  4OC4 A;  3DGV A;  2ZED A;  3IEH A;  4MXU A;  2PJ8 A;  1XMB A;  3B3S A;  4OC0 A;  1XRY A;  3BXM A;  1QQ9 A;  3LMS A;  1AMP A;  2ZEM A;  4ESS A;  1UWY A;  4WJB A;  1HJZ A;  5HOL A;  4AXV A;  3FH4 A;  5THW A;  4ONW A;  2PJB A;  1VIX A;  1FNO A;  3KQZ A;  4R7M A;  2EK8 A;  4F9U A;  4OIW A;  4KYB A;  4OC5 A;  1XJO A;  3HUV A;  1ZG7 A;  2O4H A;  3D66 A;  1F57 A;  2FXK A;  2BOA A;  3KQX A;  1ARL A;  2DEA A;  4PXB A;  4A37 A;  3V38 A;  3MN8 A;  2GLJ A;  2ZEG A;  3LWU A;  2PIY A;  5LYI A;  3S9N A;  2BFR A;  4YU9 A;  2PE3 A;  2V8V A;  5HVH A;  4FWU A;  2AFZ A;  2CIJ A;  3KR4 A;  3D7F A;  4NGN A;  4J5S A;  5ELY A;  2GU2 A;  2FAV A;  2AFM A;  3FMC A;  4NJQ A;  4ETJ A;  4LQG A;  3EJG A;  1Z5R A;  4R6T A;  3MRU A;  4F9V A;  2V8G A;  3H8E A;  5CBM A;  2F8H A;  3GB0 A;  3KL9 A;  4MHN A;  2PJ3 A;  4MHY A;  3V45 A;  3FJU A;  4Z65 A;  3RZA A;  1H8L A;  3FX6 A;  3FF3 A;  4JLL A;  5DUS A;  3KZW A;  5CPA A;  3V2B A;  2ZEN A;  4X8I A;  2J9A A;  3IWW A;  3RBU A;  4IHM A;  3D68 A;  3GLJ A;  1SPV A;  4P6Y A;  2ZOG A;  1TF9 A;  3WAB A;  4P4D A;  2GLF A;  2XEJ A;  5LYD A;  4PXD A;  4TWE A;  2XEF A;  1CX8 A;  3IFE A;  1TKH A;  1R3N A;  2PIZ A;  5K8M A;  1ZR3 A;  4GVV A;  3SIH A;  3S9L A;  3ISX A;  3CT9 A;  3RAM A;  4JZ0 A;  3EW5 A;  3PB4 X;  1Y0R A;  1TF8 A;  2ZEF A;  2X47 A;  3EJF A;  2BFQ A;  2Q43 A;  1CBX A;  1JQG A;  3SJG A;  4NGQ A;  4A94 A;  2AFC A;  4ZY1 A;  1TXZ A;  3T8W A;  3CPX A;  2XEI A;  5JGF A;  2OOT A;  4ZI6 A;  3B2Y A;  2CF4 A;  3SJX A;  2CTC A;  3GQO A;  4DJL A;  5CMS A;  4UIB A;  4F8Z A;  4JCA A;  4ZX9 A;  1PCA A;  3SI2 A;  2V8H A;  2O53 A;  1HDU A;  4ZYQ A;  4GM5 A;  2F7V A;  1ZR5 A;  4ETK A;  1CPS A;  1YSJ A;  2PJA A;  2PJC A;  2QYV A;  1Z2L A;  5K8N A;  4P4B A;  3KGQ A;  3V7Z A;  3PEI A;  3SJF A;  4FBE A;  3D7D A;  1Q7L A;  4D86 A;  1YD9 A;  1FT7 A;  1F2O A;  2BCO A;  2IMO A;  4DUK A;  1ELL P;  1Y0Y A;  5K8P A;  3PRT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...