2J9AA

Bllap in complex with microginin fr1
Total Genus 175
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
175
sequence length
485
structure length
485
Chain Sequence
TKGLVLGIYSKEKEEDEPQFTSAGENFNKLVSGKLREILNISGPPLKAGKTRTFYGLHEDFPSVVVVGLGKKTAGIDEQENWHEGKENIRAAVAAGCRQIQDLEIPSVEVDPCGDAQAAAEGAVLGLYEYDDLKQKRKVVVSAKLHGSEDQEAWQRGVLFASGQNLARRLMETPANEMTPTKFAEIVEENLKSASIKTDVFIRPKSWIEEQEMGSFLSVAKGSEEPPVFLEIHYKGSPNASEPPLVFVGKGITFDSGGISIKAAANMDLMRADMGGAATICSAIVSAAKLDLPINIVGLAPLCENMPSGKANKPGDVVRARNGKTIQVDNTDAEGRLILADALCYAHTFNPKVIINAATLTGAMDIALGSGATGVFTNSSWLWNKLFEASIETGDRVWRMPLFEHYTRQVIDCQLADVNNIGKYRSAGACTAAAFLKEFVTHPKWAHLDIAGVMTNKDEVPYLRKGMAGRPTRTLIEFLFRFSQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Binding Structure of the Leucine Aminopeptidase Inhibitor Microginin Fr1.
pubmed doi rcsb
molecule tags Hydrolase/inhibitor
molecule keywords CYTOSOL AMINOPEPTIDASE
total genus 175
structure length 485
sequence length 485
ec nomenclature ec 3.4.11.1: Leucyl aminopeptidase.
pdb deposition date 2006-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00883 Peptidase_M17 Cytosol aminopeptidase family, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 2j9aA01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2j9aA02
5THWA 4ESSA 1ZLHA 2OOTA 1LCPA 3SJFA 3PB8X 1CX8A 3QNVA 2VL1A 2PJ0A 4J5SA 2X47A 5HVGA 2ZELA 2ACFA 5CB3A 4R7MA 1XBUA 4PQAA 3T8WA 2VRIA 2ZEMA 3EWOA 3H8FA 4GM5A 2ZOFA 4OMEA 3PRTA 3SIIA 3V7ZA 2ZOGA 1ZLIA 3FVLA 2V77A 2GREA 4D86A 3WC6A 1HDUA 5DUSA 4UEZA 2PJ9A 4MCPA 3B3CA 2AFUA 1YW6A 3NH4A 1IY7A 1VHUA 3WC5A 3ETIA 5J1QA 4OC4A 1VIXA 1BPNA 3KI9A 2AFMA 1VHEA 1LAMA 4MHZA 3FH4A 1TF8A 4IHMA 4ONWA 7CPAA 4YU9A 4FAIA 3VARA 1SPVA 3SJGA 1DE4C 5DS0A 3GB0A 3V2BA 5LYIA 3IIBA 3D4UA 3MRUA 1LAPA 4G1PA 4OC1A 2Q51A 2ZEEA 1LANA 1HDQA 5CB5A 2L8RA 2FG1A 2IMOA 3EKEA 4OP4A 4BD9A 2C6CA 4RUHA 3BHXA 3KL9A 3FJUA 2ZEHA 3JRUA 1F2OA 2Q43A 4NGTA 4NGPA 4IAVA 3K9TA 3EWPA 3KASA 1GYTA 5E3BA 4ZI6A 2ZEOA 4F9VA 3V45A 3B3SA 3CPAA 3FX6A 2PIYA 4W9YA 4ETKA 2ZENA 2IQ6A 2LGRA 2FXKA 3IIFA 1XMBA 2AFCA 3BI1A 2DEAA 2EK8A 3HUVA 4X3RA 1QMUA 2CTBA 3SIGA 1TKHA 4P4BA 3SIHA 3IWWA 3SI0A 2IJZA 1NSAA 1AYEA 3SJEA 2PJ5A 2QVPA 3VATA 6CPAA 1KWMA 2AFZA 3SJXA 5K8PA 2RFHA 3KZWA 2CF4A 3KR5A 3IO1A 3S9NA 4ZX8A 4Q7AA 4OC3A 1YD9A 3BXMA 1ARLA 2PJCA 2PVVA 1PYTB 3PB9X 3KQXA 4ZX9A 5HIHA 5HOLA 5HVHA 1FT7A 3KR4A 5ELYA 4K3NA 1TY8A 4UIBA 5K8NA 5D8NA 3B3WA 2F8HA 2JEWA 3SIJA 1ELLP 4MHPA 3KGQA 4MCRA 4NJQA 1OBRA 4ZYQA 1CPXA 4F8ZA 3B3VA 5JH9A 4EMEA 3PB6X 2V8VA 2J9AA 3LWUA 3NA6A 1BLLE 1H8LA 3FMCA 1TKJA 4UEFA 4YWYA 3PB7X 3B2YA 2BFRA 1F2PA 3D7DA 4O23A 4UF4A 4K0CA 4JVVA 2BFQA 4A38A 1VGYA 2GLJA 4R76A 4DYOA 1TXZA 3IC1A 4DUKA 8CPAA 3K2KA 4LQGA 4ZY0A 1YW4A 2NYQA 1Y0RA 4DJLA 2XEJA 5LYFA 2XEGA 4Z65A 3PB4X 1EE3P 2C6GA 4PXBA 1HJZA 4R6TA 4IK2A 3PFOA 2XEFA 2V8GA 2BCOA 3EWRA 3EW5A 2CIJA 4OIWA 3H8EA 1XRYA 3JZTA 5FSZA 3D7HA 1TKFA 3FECA 4EWTA 1JQGA 3D7GA 5LRKA 2PJ4A 1Z2LA 5AILA 4P4IA 2G9DA 1CBXA 2XEIA 3PEIA 4X2TA 5CMSA 4UMLA 1Y7EA 1LOKA 4A94A 5JM6A 2PJ8A 3FEDA 4KSIA 3GQEA 4ABLA 2F7VA 1ZR3A 4P4FA 4ABKA 4P10A 4NFRA 3GQOA 5LYDA 3GPGA 4NGNA 2AFXA 3IEHA 4NGQA 3D67A 2XD7A 5CBMA 3CPXA 3B35A 4PPZA 1AMPA 1FNOA 1M4LA 3WABA 2PJ2A 4P4EA 4EFDA 5FSVA 4ZY2A 1ZG7A 4A39A 3PBBA 1TXRA 1VHOA 3WC7A 4MRIA 4FUUA 2AFSA 1ELMP 2BOAA 4P45A 5F09A 1LFWA 2WZNA 1YLOA 3IIDA 2ZEDA 5CPAA 4P44A 5LRJA 3SI2A 4MHYA 2PJAA 4NGRA 2V8HA 4TNUA 3V38A 1BAVA 2PJ7A 1XFOA 1UWYA 2PIZA 3IJ3A 4JCAA 3NH8A 2AFOA 3KHZA 3Q71A 3N5FA 3GPQA 1QQ9A 4FWUA 4JZ0A 3I1UA 2ZEFA 1Z8LA 2JBKA 2PJBA 4UIAA 4OKOA 1HEEA 1ZG8A 4UEEA 1CG2A 3TX8A 4OC0A 3B7IA 5I4MA 4A37A 3H8GA 3MN8A 4CPAA 4PXCA 2HC9A 1Y0YA 3D66A 4GVWA 2JBJA 4MMOA 4R8FA 4P4DA 3PFEA 2CTCA 4MCQA 5FSUA 3S9MA 1R3NA 3B3TA 1Q7LA 2PCUA 2ABZA 1R43A 3EJFA 2PJ1A 2PE3A 1CP6A 1YMEA 2V8DA 3FF3A 3LMSA 1CPSA 1RTQA 5K8MA 3EJGA 4J5RA 5D29A 5K8OA 4FBEA 4J5QA 3D7FA 3ISZA 3L2NA 3ISXA 3DGVA 3Q6ZA 2PRQA 4GVVA 3NFZA 5IB9A 1ZR5A 2EK9A 2NSMA 3D68A 2Q4ZA 4WJBA 1CP7A 1DTDA 4OC5A 5LRGA 2GU2A 3GLJA 4JYWA 2ZEGA 2AFWA 3PBEA 1XJOA 4NGMA 3BI0A 3HLPA 2GLFA 2OR4A 2EEEA 3GUXA 4F9UA 3S9LA 1NJRA 4OC2A 2C1CA 2ZEPA 1F57A 1TF9A 4MCSA 4JLLA 4NJRA 4MHNA 4B6ZA 4ZY1A 3KQZA 4P6YA 4J4ZA 2I3CA 1PCAA 2O4HA 2PJ6A 5HVFA 4KYBA 3VH9A 5LYLA 2FAVA 4TU0A 1BPMA 4TWEA 3EWQA 3FEEA 3WT4A 4IQYA 5FSYA 4MXUA 1IGBA 2PVWA 3CDXA 1ZG9A 4OIDA 2FVGA 2QJ8A 3IFEA 4WWVA 2QYVA 5FSXA 2RB7A 3CT9A 2PJ3A 2WYRA 2DX6A 2HB6A 4PXEA 1Z5RA 4AXVA 5JGFA 3RAMA 4NGSA 4PXDA 3GPOA 1YSJA 4X8IA 3TC8A 3SI1A 2POKA 2O53A 3RBUA 4JGKA 3VFQA 2C6PA 3DLJA 3KHXA 4P4JA 3RZAA 3NH5A 4GUAA 5HXDA 1ARMA 4H2KA 2ANPA 2EWBA 2BO9A 4ETJA
chains in the Genus database with same CATH superfamily
5THWA 4ESSA 2R8VA 1ZLHA 2OOTA 1LCPA 2RC4A 3EO4A 3SJFA 1I21A 5AG7A 4PK2A 3PB8X 1CX8A 3QNVA 4CS0B 2VL1A 2PJ0A 2DF5A 4J5SA 2X47A 2KCWA 3BJ8A 5HVGA 2ZELA 4FD7A 4UCMA 2ACFA 5CB3A 4R7MA 1XBUA 4JXQA 3IU2A 4PQAA 1OZPA 5FVJA 3T8WA 2VRIA 2ZEMA 3EWOA 2DPTA 2P6GA 3H8FA 4AVCA 3VWEA 1IICA 4A33A 4GM5A 2ZOFA 4U9ZA 4OMEA 1IYKA 3D2MA 3PRTA 3SIIA 4B11A 2PQ8A 3NE7A 5A28A 1BOBA 2Z3KA 2ZOGA 4NXYA 3V7ZA 4UFXA 1ZLIA 5F48A 3FVLA 2V77A 4A2ZA 4I49A 3S6GA 2GREA 4D86A 1MJBA 3WC6A 3GYAA 4FD5A 2Z3OA 2FIWA 2CY2A 1HDUA 5DUSA 4GXHA 2P6EA 3S6FA 4UEZA 2VI7A 2Z3MA 2PJ9A 5F46A 3D3SA 4MCPA 3B3CA 3V8IA 2AFUA 4M6GA 4Y49B 4HKFA 1YW6A 2CNTA 4MI4A 3NH4A 1IY7A 3TO7A 1VHUA 4YGOA 1YQEA 3WC5A 4AB7A 2YNCC 3ETIA 5J1QA 1X10A 3S6KA 4OC4A 1VIXA 1BPNA 2WUUA 2AFMA 1VHEA 3KI9A 2R98A 2ATRA 1LAMA 3G8WA 2Q4YA 1MJAA 3FH4A 4MHZA 1TF8A 4IHMA 3VWDA 4ONWA 4CRZB 2G3AA 7CPAA 1Y9KA 4YU9A 4FAIA 3VARA 3TO6A 1SPVA 2A4NA 1SQHA 2DXQA 3SJGA 2ZW7A 1DE4C 5DS0A 4EVYA 3GB0A 3V2BA 4R87A 2FIAA 4QUSA 4KUBA 1I1DA 5LYIA 3IIBA 1M4GA 3D4UA 3MRUA 3RYOA 1LAPA 4G1PA 4BINA 4BMHA 4OC1A 4A32A 2Q51A 2YNDA 2ZEEA 1Z8XA 1LANA 4QVTA 1HDQA 4PK3A 5CB5A 4L8AA 2L8RA 2FG1A 2PR8A 4AVBA 1B87A 2IMOA 3JVNA 5J8CA 1R57A 2EVNA 3EKEA 1RXTA 4OP4A 4BD9A 2C6CA 4GS4A 3T9YA 4RUHA 1J4JA 3BHXA 4CYOA 3KL9A 3FJUA 2Q43A 3JRUA 1F2OA 2VZYA 2ZEHA 3I9SA 4NGTA 4NGPA 4MY3A 2B5GA 4IAVA 3K9TA 3EWPA 3KASA 1GYTA 5E3BA 4ZI6A 1AUGA 2VZZA 2ZEOA 5F47A 5KTAA 3LD2A 4IF5A 4F9VA 3V45A 2Q04A 3B3SA 3CPAA 3FX6A 4CYQA 2PIYA 4W9YA 4ETKA 2ZENA 2ARHA 2IQ6A 1NMTA 2LGRA 3R9FA 4DNCA 2FXKA 3IIFA 2GFQA 1XMBA 3I3GA 2YNEA 2AFCA 2G0BA 3BI1A 2DEAA 2EK8A 3CXQA 3HUVA 4MY0A 4X3RA 3TOBA 2AE6A 1QMUA 2QECA 2CTBA 3SIGA 1TKHA 3D8PA 4CAVA 1ZO0A 3IWGA 3TCVA 4P4BA 3SIHA 4PSXA 3SHPA 4KZTA 3IWWA 3SI0A 2I79A 2IJZA 4KVXA 5G1ZA 1NSAA 1KUXA 1AYEA 1XIXA 1Z8WA 2FS5A 2PJ5A 2OZGA 2QVPA 3SJEA 3VATA 6CPAA 5IX3A 1KWMA 2AFZA 3SJXA 5K8PA 4QC6A 2G3TA 2REEA 2RFHA 3KZWA 2CF4A 3KR5A 2PR1A 3IO1A 3S9NA 4ZX8A 2REFA 4Q7AA 4OC3A 1YD9A 4UBRA 4NEXA 2YGWA 5DWMA 4AVAA 3A9LA 3BXMA 5J8FA 1ARLA 2PJCA 3DNSA 3K9UA 2PVVA 1PYTB 3IGRA 3PB9X 3KQXA 4ZX9A 4XPKA 4KOXA 1JWQA 1UFHA 5HIHA 5HOLA 5HVHA 2JZEA 1FT7A 3KR4A 1Y9WA 5ELYA 4K3NA 2Z10A 2CXAA 3IWEA 5EC4A 1TY8A 2BL1A 4UIBA 5K8NA 5D8NA 2D4PA 2HV2A 3B3WA 4B5OA 1YX0A 2F8HA 2JEWA 3SIJA 1ELLP 3JUWA 3T90A 4MHPA 3KGQA 1YGHA 4MCRA 4CGPA 2JDCA 4L89A 3TT2A 4B14A 4Y49C 2R1IA 4NJQA 1U6MA 4ORFA 3NE8A 1OBRA 4ZYQA 5LYLA 1CPXA 4E2AA 4F8ZA 3B3VA 5JH9A 2B4BA 4EMEA 3R9EA 2Q4VA 4M6IA 4R9MA 3KKWA 2J8MA 4MFPA 3PB6X 2V8VA 2J9AA 3LWUA 3NA6A 2BEIA 1KUVA 1BLLE 4UFWA 4OAEA 1Z4RA 5EBVA 5BWAB 5JPHA 1H8LA 3FMCA 1TKJA 2IL4A 4UEFA 4UCNA 3PB7X 4XNHB 4YWYA 3B2YA 2BFRA 1K4JA 2ZW6A 4B10A 1F2PA 2EUIA 1P0HA 3D7DA 4M3SA 4E0AA 4O23A 4UF4A 4M6HA 1WWZA 4K0CA 4JVVA 3RNZA 2BFQA 3TO9A 4A38A 1VGYA 2GLJA 3H5ZA 4R76A 4DYOA 1TXZA 3IC1A 3FIXA 4DUKA 2B5GB 8CPAA 3K2KA 3W91A 4LQGA 4ZY0A 2PC1A 4KOWA 4F6AA 4MFLA 1YW4A 2NYQA 1Y0RA 2F5IA 4H89A 4OADA 3EFAA 2XEJA 4DJLA 4UWJA 3RO0A 2XEGA 2B3VA 5LYFA 4CAEA 5H86A 1QSNA 2H5MA 4Z65A 3PB4X 1EE3P 2C6GA 5AG6A 3R1KA 4QBJA 4C2ZA 4PXBA 1HJZA 2Z11A 4R6TA 2YNCA 2Z3PA 4M85A 4IK2A 1IB1E 5KTCA 3PFOA 2XEFA 4B5PB 4CGLA 2V8GA 2Z0ZA 2BCOA 3EWRA 3EW5A 2CIJA 4OIWA 3H8EA 1XRYA 3JZTA 2WCTA 5FSZA 4X5KA 1LRZA 1TKFA 3D7HA 3FECA 4Q38A 4YFJA 4EWTA 4B5PA 1JQGA 2FE7A 3D7GA 5LRKA 1QSOA 2PJ4A 4F0XA 1Z2LA 1YLEA 2JZDA 5AILA 1Y7RA 4P4IA 2Q7SA 2KQVA 2G9DA 4LUAA 1CBXA 2XEIA 4UCPA 1PU9A 4CAFA 1QSMA 3PEIA 4X2TA 4MFKA 5CMSA 4KVME 5JQ4A 2FSRA 1S7LA 4UMLA 2GE3A 4MBUA 1Y7EA 1LOKA 3DR6A 1WK4A 4A94A 3P2HA 5JM6A 2PJ8A 1S7FA 2Q44A 3FEDA 2OZUA 1GHEA 4KSIA 4KS9A 3GQEA 4ABLA 2B4DA 1V0CA 1ZR3A 2F7VA 2R7HA 4NCZA 4ABKA 4P10A 4P4FA 4NFRA 2FXFA 1MJ9A 3GQOA 5DWNA 1XE4A 4C68A 1YR0A 5LYDA 3CXSA 3R96A 3GPGA 4NGNA 4PSWA 2AFXA 2J8NA 1XOVA 2WSAA 3WR7A 3IEHA 3JTKA 4K30A 4NGQA 3D67A 3DR8A 1TIQA 3FXTA 4C2YA 1M4DA 1S60A 3QB8A 2XD7A 2Z3NA 4KORA 5I0CA 5CBMA 3CPXA 4JJXA 3B35A 1M1DA 4PPZA 3FB3A 1AMPA 2FT0A 1FNOA 1IOFA 1M4LA 3WABA 4CGOA 1P4NA 2PJ2A 2PSWA 3R95A 4P4EA 4EFDA 3EC4A 5FSVA 4ZY2A 1ZG7A 2DPSA 4A39A 3PBBA 4KOUA 1TXRA 1VHOA 3WC7A 4MRIA 2JEVA 4FD6A 4FUUA 2AFSA 1ELMP 1YK3A 2BOAA 2JLMA 4P45A 5F09A 2HUZA 1LFWA 2WZNA 4U9YA 4JLYA 1YLOA 4E8OA 4HNWB 3IIDA 2ZPAA 2ZEDA 2EO8A 3W6XA 5CPAA 4P44A 5LRJA 3SI2A 4MHYA 1QSRA 2PJAA 4RN7A 3TFYA 3QAYA 4H6UA 4UWIA 5KTDA 4NGRA 2V8HA 4TNUA 3V38A 1BAVA 2PDOA 3PGPA 4IUSA 2PJ7A 4MFQA 1XFOA 4BBHA 1UWYA 4QB9A 3FYNA 4CAWA 1IIDA 2O28A 2PIZA 3IJ3A 4JCAA 3IU1A 3NH8A 5EMIA 3TTHA 2AFOA 3GKRA 3KHZA 4KOVA 2B58A 3Q71A 3N5FA 5A27A 3GPQA 1QQ9A 4H6ZA 5CNPA 1N71A 4C2XA 4FWUA 4JZ0A 4JWPA 3I1UA 2ZEFA 1KZFA 4A30A 4RI1A 1Z8LA 4RS2A 2B3UA 2JBKA 2PJBA 2VEZA 4ZBGA 4UIAA 5G22A 4OKOA 1HEEA 1ZG8A 2WPWA 1CG2A 3EY5A 4UEEA 3TX8A 4OC0A 4CYPA 3B7IA 5I4MA 1L0CA 4R3LA 4AG7A 1YVOA 2ZW5A 3MGDA 4KOYA 3H8GA 4MJ8A 4XPDB 5F49A 3MN8A 4A37A 4B13A 4CPAA 3CXPA 3R9GA 4PXCA 2B4DB 2HC9A 1Y0YA 4C7HA 3D66A 4GVWA 2JBJA 4KSFA 1VHSA 3LODA 4MMOA 4R8FA 4P4DA 1BO4A 3PFEA 2ZW4A 3CZXA 2CTCA 2P0WA 4MCQA 5FSUA 1IOIA 2D4OA 2RNKA 3S9MA 1FY7A 1R3NA 3B3TA 1Q7LA 2C27A 2PCUA 2ABZA 1R43A 3EJFA 1RO5A 2ZXVA 2WPXA 2PJ1A 2PE3A 3H4QA 1CP6A 1YMEA 3ZJ0A 5AG4A 2V8DA 3FF3A 2PRBA 3LMSA 1VKCA 3TOAA 1CPSA 1S7KA 2EBJA 1RTQA 5K8MA 1IYLA 3EJGA 4J5RA 4XNHC 5D29A 4CYNA 4FBEA 5K8OA 2QMLA 4J5QA 2P6FA 4UFVA 4A31A 1X12A 3D7FA 4II9A 3ISZA 5HH1A 4CGNA 3L2NA 3ISXA 4C7IA 4Q36A 3SXOA 3BJ7A 3DSBA 3QAHA 3F5BA 4ONUA 3DGVA 3W6SA 1XF8A 3Q6ZA 2PRQA 5HMNA 4HNXB 4GVVA 3NFZA 2OB0A 2GIVA 5IB9A 1ZR5A 2EK9A 3C26A 2OH1A 2NSMA 4KSAA 2JDDA 3D68A 4U5YA 2QIRA 4MFJA 2Q4ZA 4R3KA 3S6HA 1S7NA 1CP7A 4LQ6A 1DTDA 4NF1A 4WJBA 4OC5A 5LRGA 2GU2A 3GLJA 1IU8A 4JYWA 2VBQA 2ZEGA 3LACA 2HQYA 2AFWA 2BSWA 4MHDA 3PBEA 3TE4A 1XJOA 4NGMA 3BI0A 3HLPA 4HNYB 2GLFA 2OR4A 2EEEA 2Z3LA 4KUAA 1XEBA 2CNSA 3GUXA 3P2FA 3SXNA 4B12A 4F9UA 1A2ZA 1CM0A 4AG9A 3S9LA 3FNCA 1NJRA 2OZHA 5E96A 2Q7BA 4OC2A 4LX9A 2C1CA 2ZEPA 4UA3A 3ZZIA 5IV0A 1Z8TA 5G20A 1F57A 2X7BA 1TF9A 4MCSA 1B6BA 1Q2CA 4JLLA 5C88A 3FRMA 3D2PA 4NJRA 4MHNA 4XPDC 4KOSA 1ON0A 4ZY1A 4B6ZA 3KQZA 3BLNA 1PUAA 3GY9A 4P6YA 2JZFA 3E0KA 2I00A 5AGEA 3FBUA 1NE9A 2W2GA 1QSTA 4J4ZA 2I3CA 2FCKA 3F0AA 4CGMA 5IB0A 1PCAA 3OWCA 2Q0YA 1M4IA 4KOTA 1I12A 2O4HA 2PJ6A 2VXKA 4KYBA 4XPLA 5HVFA 3VH9A 1CJWA 2FL4A 2FAVA 2CNMA 4TU0A 1YREA 1Z9UA 5AG5A 1Q2DA 4NSQA 5GCNA 1BPMA 1Q2YA 1NSLA 1MK4A 1YVKA 4TWEA 4J3GA 3EWQA 3FEEA 4OLLA 3WT4A 4IQYA 5FSYA 4MXUA 1IGBA 1KUYA 4PV6A 2PVWA 2ODFA 3CDXA 3UY5A 5C82A 1XMTA 4MFZA 1ZG9A 4OIDA 2FVGA 2QJ8A 2BUEA 3IFEA 4WWVA 4CAXA 2QYVA 4ZGYB 5FSXA 5G21A 2RB7A 4HPSA 3CT9A 4YRHA 2PJ3A 2VQYA 2GANA 2WYRA 4FD4A 4F0YA 2DX6A 2HB6A 3GIUA 4PXEA 1Z5RA 4AXVA 5JGFA 4A95A 2K5TA 3RAMA 1Z4EA 2OU2A 4NGSA 4PXDA 3GPOA 1YSJA 4X8IA 3TC8A 5H84A 4JD6A 3SI1A 4KVOE 3B8GA 3EXNA 2POKA 2O53A 3PZJA 1S3ZA 4JGKA 1S5KA 3N7ZA 4R57A 3RBUA 2J8RA 3F8KA 1M44A 3DDDA 3VFQA 4JXRA 2C6PA 3DLJA 3G3SA 3KHXA 3PP9A 4KLVA 4P4JA 3RZAA 2Y0MA 3NH5A 4KLWA 4GUAA 2AJ6A 2NMTA 1ARMA 4CRYB 4H2KA 5HXDA 2ANPA 2EWBA 5ISVA 2BO9A 4ETJA
chains in the Genus database with same CATH topology
5THWA 4ESSA 1ZLHA 2OOTA 1LCPA 3SJFA 3PB8X 1CX8A 3QNVA 2VL1A 2PJ0A 4J5SA 2X47A 5HVGA 2ZELA 2ACFA 5CB3A 4R7MA 1XBUA 4PQAA 3T8WA 2VRIA 2ZEMA 3EWOA 3H8FA 4GM5A 2ZOFA 4OMEA 3PRTA 3SIIA 3V7ZA 2ZOGA 1ZLIA 3FVLA 2V77A 2GREA 4D86A 3WC6A 1HDUA 5DUSA 4UEZA 2PJ9A 4MCPA 3B3CA 2AFUA 1YW6A 3NH4A 1IY7A 1VHUA 3WC5A 3ETIA 5J1QA 4OC4A 1VIXA 1BPNA 3KI9A 2AFMA 1VHEA 1LAMA 4MHZA 3FH4A 1TF8A 4IHMA 4ONWA 7CPAA 4YU9A 4FAIA 3VARA 1SPVA 3SJGA 1DE4C 5DS0A 3GB0A 3V2BA 5LYIA 3IIBA 3D4UA 3MRUA 1LAPA 4G1PA 4OC1A 2Q51A 2ZEEA 1LANA 1HDQA 5CB5A 2L8RA 2FG1A 2IMOA 3EKEA 4OP4A 4BD9A 2C6CA 4RUHA 3BHXA 3KL9A 3FJUA 2ZEHA 3JRUA 1F2OA 2Q43A 4NGTA 4NGPA 4IAVA 3K9TA 3EWPA 3KASA 1GYTA 5E3BA 4ZI6A 2ZEOA 4F9VA 3V45A 3B3SA 3CPAA 3FX6A 2PIYA 4W9YA 4ETKA 2ZENA 2IQ6A 2LGRA 2FXKA 3IIFA 1XMBA 2AFCA 3BI1A 2DEAA 2EK8A 3HUVA 4X3RA 1QMUA 2CTBA 3SIGA 1TKHA 4P4BA 3SIHA 3IWWA 3SI0A 2IJZA 1NSAA 1AYEA 3SJEA 2PJ5A 2QVPA 3VATA 6CPAA 1KWMA 2AFZA 3SJXA 5K8PA 2RFHA 3KZWA 2CF4A 3KR5A 3IO1A 3S9NA 4ZX8A 4Q7AA 4OC3A 1YD9A 3BXMA 1ARLA 2PJCA 2PVVA 1PYTB 3PB9X 3KQXA 4ZX9A 5HIHA 5HOLA 5HVHA 1FT7A 3KR4A 5ELYA 4K3NA 1TY8A 4UIBA 5K8NA 5D8NA 3B3WA 2F8HA 2JEWA 3SIJA 1ELLP 4MHPA 3KGQA 4MCRA 4NJQA 1OBRA 4ZYQA 1CPXA 4F8ZA 3B3VA 5JH9A 4EMEA 3PB6X 2V8VA 2J9AA 3LWUA 3NA6A 1BLLE 1H8LA 3FMCA 1TKJA 4UEFA 4YWYA 3PB7X 3B2YA 2BFRA 1F2PA 3D7DA 4O23A 4UF4A 4K0CA 4JVVA 2BFQA 4A38A 1VGYA 2GLJA 4R76A 4DYOA 1TXZA 3IC1A 4DUKA 8CPAA 3K2KA 4LQGA 4ZY0A 1YW4A 2NYQA 1Y0RA 4DJLA 2XEJA 5LYFA 2XEGA 4Z65A 3PB4X 1EE3P 2C6GA 4PXBA 1HJZA 4R6TA 4IK2A 3PFOA 2XEFA 2V8GA 2BCOA 3EWRA 3EW5A 2CIJA 4OIWA 3H8EA 1XRYA 3JZTA 5FSZA 3D7HA 1TKFA 3FECA 4EWTA 1JQGA 3D7GA 5LRKA 2PJ4A 1Z2LA 5AILA 4P4IA 2G9DA 1CBXA 2XEIA 3PEIA 4X2TA 5CMSA 4UMLA 1Y7EA 1LOKA 4A94A 5JM6A 2PJ8A 3FEDA 4KSIA 3GQEA 4ABLA 2F7VA 1ZR3A 4P4FA 4ABKA 4P10A 4NFRA 3GQOA 5LYDA 3GPGA 4NGNA 2AFXA 3IEHA 4NGQA 3D67A 2XD7A 5CBMA 3CPXA 3B35A 4PPZA 1AMPA 1FNOA 1M4LA 3WABA 2PJ2A 4P4EA 4EFDA 5FSVA 4ZY2A 1ZG7A 4A39A 3PBBA 1TXRA 1VHOA 3WC7A 4MRIA 4FUUA 2AFSA 1ELMP 2BOAA 4P45A 5F09A 1LFWA 2WZNA 1YLOA 3IIDA 2ZEDA 5CPAA 4P44A 5LRJA 3SI2A 4MHYA 2PJAA 4NGRA 2V8HA 4TNUA 3V38A 1BAVA 2PJ7A 1XFOA 1UWYA 2PIZA 3IJ3A 4JCAA 3NH8A 2AFOA 3KHZA 3Q71A 3N5FA 3GPQA 1QQ9A 4FWUA 4JZ0A 3I1UA 2ZEFA 1Z8LA 2JBKA 2PJBA 4UIAA 4OKOA 1HEEA 1ZG8A 4UEEA 1CG2A 3TX8A 4OC0A 3B7IA 5I4MA 4A37A 3H8GA 3MN8A 4CPAA 4PXCA 2HC9A 1Y0YA 3D66A 4GVWA 2JBJA 4MMOA 4R8FA 4P4DA 3PFEA 2CTCA 4MCQA 5FSUA 3S9MA 1R3NA 3B3TA 1Q7LA 2PCUA 2ABZA 1R43A 3EJFA 2PJ1A 2PE3A 1CP6A 1YMEA 2V8DA 3FF3A 3LMSA 1CPSA 1RTQA 5K8MA 3EJGA 4J5RA 5D29A 5K8OA 4FBEA 4J5QA 3D7FA 3ISZA 3L2NA 3ISXA 3DGVA 3Q6ZA 2PRQA 4GVVA 3NFZA 5IB9A 1ZR5A 2EK9A 2NSMA 3D68A 2Q4ZA 4WJBA 1CP7A 1DTDA 4OC5A 5LRGA 2GU2A 3GLJA 4JYWA 2ZEGA 2AFWA 3PBEA 1XJOA 4NGMA 3BI0A 3HLPA 2GLFA 2OR4A 2EEEA 3GUXA 4F9UA 3S9LA 1NJRA 4OC2A 2C1CA 2ZEPA 1F57A 1TF9A 4MCSA 4JLLA 4NJRA 4MHNA 4B6ZA 4ZY1A 3KQZA 4P6YA 4J4ZA 2I3CA 1PCAA 2O4HA 2PJ6A 5HVFA 4KYBA 3VH9A 5LYLA 2FAVA 4TU0A 1BPMA 4TWEA 3EWQA 3FEEA 3WT4A 4IQYA 5FSYA 4MXUA 1IGBA 2PVWA 3CDXA 1ZG9A 4OIDA 2FVGA 2QJ8A 3IFEA 4WWVA 2QYVA 5FSXA 2RB7A 3CT9A 2PJ3A 2WYRA 2DX6A 2HB6A 4PXEA 1Z5RA 4AXVA 5JGFA 3RAMA 4NGSA 4PXDA 3GPOA 1YSJA 4X8IA 3TC8A 3SI1A 2POKA 2O53A 3RBUA 4JGKA 3VFQA 2C6PA 3DLJA 3KHXA 4P4JA 3RZAA 3NH5A 4GUAA 5HXDA 1ARMA 4H2KA 2ANPA 2EWBA 2BO9A 4ETJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5THW A;  4ESS A;  1ZLH A;  2OOT A;  1LCP A;  3SJF A;  3PB8 X;  1CX8 A;  3QNV A;  2VL1 A;  2PJ0 A;  4J5S A;  2X47 A;  5HVG A;  2ZEL A;  2ACF A;  5CB3 A;  4R7M A;  1XBU A;  4PQA A;  3T8W A;  2VRI A;  2ZEM A;  3EWO A;  3H8F A;  4GM5 A;  2ZOF A;  4OME A;  3PRT A;  3SII A;  3V7Z A;  2ZOG A;  1ZLI A;  3FVL A;  2V77 A;  2GRE A;  4D86 A;  3WC6 A;  1HDU A;  5DUS A;  4UEZ A;  2PJ9 A;  4MCP A;  3B3C A;  2AFU A;  1YW6 A;  3NH4 A;  1IY7 A;  1VHU A;  3WC5 A;  3ETI A;  5J1Q A;  4OC4 A;  1VIX A;  1BPN A;  3KI9 A;  2AFM A;  1VHE A;  1LAM A;  4MHZ A;  3FH4 A;  1TF8 A;  4IHM A;  4ONW A;  7CPA A;  4YU9 A;  4FAI A;  3VAR A;  1SPV A;  3SJG A;  1DE4 C;  5DS0 A;  3GB0 A;  3V2B A;  5LYI A;  3IIB A;  3D4U A;  3MRU A;  1LAP A;  4G1P A;  4OC1 A;  2Q51 A;  2ZEE A;  1LAN A;  1HDQ A;  5CB5 A;  2L8R A;  2FG1 A;  2IMO A;  3EKE A;  4OP4 A;  4BD9 A;  2C6C A;  4RUH A;  3BHX A;  3KL9 A;  3FJU A;  2ZEH A;  3JRU A;  1F2O A;  2Q43 A;  4NGT A;  4NGP A;  4IAV A;  3K9T A;  3EWP A;  3KAS A;  1GYT A;  5E3B A;  4ZI6 A;  2ZEO A;  4F9V A;  3V45 A;  3B3S A;  3CPA A;  3FX6 A;  2PIY A;  4W9Y A;  4ETK A;  2ZEN A;  2IQ6 A;  2LGR A;  2FXK A;  3IIF A;  1XMB A;  2AFC A;  3BI1 A;  2DEA A;  2EK8 A;  3HUV A;  4X3R A;  1QMU A;  2CTB A;  3SIG A;  1TKH A;  4P4B A;  3SIH A;  3IWW A;  3SI0 A;  2IJZ A;  1NSA A;  1AYE A;  3SJE A;  2PJ5 A;  2QVP A;  3VAT A;  6CPA A;  1KWM A;  2AFZ A;  3SJX A;  5K8P A;  2RFH A;  3KZW A;  2CF4 A;  3KR5 A;  3IO1 A;  3S9N A;  4ZX8 A;  4Q7A A;  4OC3 A;  1YD9 A;  3BXM A;  1ARL A;  2PJC A;  2PVV A;  1PYT B;  3PB9 X;  3KQX A;  4ZX9 A;  5HIH A;  5HOL A;  5HVH A;  1FT7 A;  3KR4 A;  5ELY A;  4K3N A;  1TY8 A;  4UIB A;  5K8N A;  5D8N A;  3B3W A;  2F8H A;  2JEW A;  3SIJ A;  1ELL P;  4MHP A;  3KGQ A;  4MCR A;  4NJQ A;  1OBR A;  4ZYQ A;  1CPX A;  4F8Z A;  3B3V A;  5JH9 A;  4EME A;  3PB6 X;  2V8V A;  2J9A A;  3LWU A;  3NA6 A;  1BLL E;  1H8L A;  3FMC A;  1TKJ A;  4UEF A;  4YWY A;  3PB7 X;  3B2Y A;  2BFR A;  1F2P A;  3D7D A;  4O23 A;  4UF4 A;  4K0C A;  4JVV A;  2BFQ A;  4A38 A;  1VGY A;  2GLJ A;  4R76 A;  4DYO A;  1TXZ A;  3IC1 A;  4DUK A;  8CPA A;  3K2K A;  4LQG A;  4ZY0 A;  1YW4 A;  2NYQ A;  1Y0R A;  4DJL A;  2XEJ A;  5LYF A;  2XEG A;  4Z65 A;  3PB4 X;  1EE3 P;  2C6G A;  4PXB A;  1HJZ A;  4R6T A;  4IK2 A;  3PFO A;  2XEF A;  2V8G A;  2BCO A;  3EWR A;  3EW5 A;  2CIJ A;  4OIW A;  3H8E A;  1XRY A;  3JZT A;  5FSZ A;  3D7H A;  1TKF A;  3FEC A;  4EWT A;  1JQG A;  3D7G A;  5LRK A;  2PJ4 A;  1Z2L A;  5AIL A;  4P4I A;  2G9D A;  1CBX A;  2XEI A;  3PEI A;  4X2T A;  5CMS A;  4UML A;  1Y7E A;  1LOK A;  4A94 A;  5JM6 A;  2PJ8 A;  3FED A;  4KSI A;  3GQE A;  4ABL A;  2F7V A;  1ZR3 A;  4P4F A;  4ABK A;  4P10 A;  4NFR A;  3GQO A;  5LYD A;  3GPG A;  4NGN A;  2AFX A;  3IEH A;  4NGQ A;  3D67 A;  2XD7 A;  5CBM A;  3CPX A;  3B35 A;  4PPZ A;  1AMP A;  1FNO A;  1M4L A;  3WAB A;  2PJ2 A;  4P4E A;  4EFD A;  5FSV A;  4ZY2 A;  1ZG7 A;  4A39 A;  3PBB A;  1TXR A;  1VHO A;  3WC7 A;  4MRI A;  4FUU A;  2AFS A;  1ELM P;  2BOA A;  4P45 A;  5F09 A;  1LFW A;  2WZN A;  1YLO A;  3IID A;  2ZED A;  5CPA A;  4P44 A;  5LRJ A;  3SI2 A;  4MHY A;  2PJA A;  4NGR A;  2V8H A;  4TNU A;  3V38 A;  1BAV A;  2PJ7 A;  1XFO A;  1UWY A;  2PIZ A;  3IJ3 A;  4JCA A;  3NH8 A;  2AFO A;  3KHZ A;  3Q71 A;  3N5F A;  3GPQ A;  1QQ9 A;  4FWU A;  4JZ0 A;  3I1U A;  2ZEF A;  1Z8L A;  2JBK A;  2PJB A;  4UIA A;  4OKO A;  1HEE A;  1ZG8 A;  4UEE A;  1CG2 A;  3TX8 A;  4OC0 A;  3B7I A;  5I4M A;  4A37 A;  3H8G A;  3MN8 A;  4CPA A;  4PXC A;  2HC9 A;  1Y0Y A;  3D66 A;  4GVW A;  2JBJ A;  4MMO A;  4R8F A;  4P4D A;  3PFE A;  2CTC A;  4MCQ A;  5FSU A;  3S9M A;  1R3N A;  3B3T A;  1Q7L A;  2PCU A;  2ABZ A;  1R43 A;  3EJF A;  2PJ1 A;  2PE3 A;  1CP6 A;  1YME A;  2V8D A;  3FF3 A;  3LMS A;  1CPS A;  1RTQ A;  5K8M A;  3EJG A;  4J5R A;  5D29 A;  5K8O A;  4FBE A;  4J5Q A;  3D7F A;  3ISZ A;  3L2N A;  3ISX A;  3DGV A;  3Q6Z A;  2PRQ A;  4GVV A;  3NFZ A;  5IB9 A;  1ZR5 A;  2EK9 A;  2NSM A;  3D68 A;  2Q4Z A;  4WJB A;  1CP7 A;  1DTD A;  4OC5 A;  5LRG A;  2GU2 A;  3GLJ A;  4JYW A;  2ZEG A;  2AFW A;  3PBE A;  1XJO A;  4NGM A;  3BI0 A;  3HLP A;  2GLF A;  2OR4 A;  2EEE A;  3GUX A;  4F9U A;  3S9L A;  1NJR A;  4OC2 A;  2C1C A;  2ZEP A;  1F57 A;  1TF9 A;  4MCS A;  4JLL A;  4NJR A;  4MHN A;  4B6Z A;  4ZY1 A;  3KQZ A;  4P6Y A;  4J4Z A;  2I3C A;  1PCA A;  2O4H A;  2PJ6 A;  5HVF A;  4KYB A;  3VH9 A;  5LYL A;  2FAV A;  4TU0 A;  1BPM A;  4TWE A;  3EWQ A;  3FEE A;  3WT4 A;  4IQY A;  5FSY A;  4MXU A;  1IGB A;  2PVW A;  3CDX A;  1ZG9 A;  4OID A;  2FVG A;  2QJ8 A;  3IFE A;  4WWV A;  2QYV A;  5FSX A;  2RB7 A;  3CT9 A;  2PJ3 A;  2WYR A;  2DX6 A;  2HB6 A;  4PXE A;  1Z5R A;  4AXV A;  5JGF A;  3RAM A;  4NGS A;  4PXD A;  3GPO A;  1YSJ A;  4X8I A;  3TC8 A;  3SI1 A;  2POK A;  2O53 A;  3RBU A;  4JGK A;  3VFQ A;  2C6P A;  3DLJ A;  3KHX A;  4P4J A;  3RZA A;  3NH5 A;  4GUA A;  5HXD A;  1ARM A;  4H2K A;  2ANP A;  2EWB A;  2BO9 A;  4ETJ A; 
#chains in the Genus database with same CATH topology
 5THW A;  4ESS A;  2R8V A;  1ZLH A;  2OOT A;  1LCP A;  2RC4 A;  3EO4 A;  3SJF A;  1I21 A;  5AG7 A;  4PK2 A;  3PB8 X;  1CX8 A;  3QNV A;  4CS0 B;  2VL1 A;  2PJ0 A;  2DF5 A;  4J5S A;  2X47 A;  2KCW A;  3BJ8 A;  5HVG A;  2ZEL A;  4FD7 A;  4UCM A;  2ACF A;  5CB3 A;  4R7M A;  1XBU A;  4JXQ A;  3IU2 A;  4PQA A;  1OZP A;  5FVJ A;  3T8W A;  2VRI A;  2ZEM A;  3EWO A;  2DPT A;  2P6G A;  3H8F A;  4AVC A;  3VWE A;  1IIC A;  4A33 A;  4GM5 A;  2ZOF A;  4U9Z A;  4OME A;  1IYK A;  3D2M A;  3PRT A;  3SII A;  4B11 A;  2PQ8 A;  3NE7 A;  5A28 A;  1BOB A;  2Z3K A;  2ZOG A;  4NXY A;  3V7Z A;  4UFX A;  1ZLI A;  5F48 A;  3FVL A;  2V77 A;  4A2Z A;  4I49 A;  3S6G A;  2GRE A;  4D86 A;  1MJB A;  3WC6 A;  3GYA A;  4FD5 A;  2Z3O A;  2FIW A;  2CY2 A;  1HDU A;  5DUS A;  4GXH A;  2P6E A;  3S6F A;  4UEZ A;  2VI7 A;  2Z3M A;  2PJ9 A;  5F46 A;  3D3S A;  4MCP A;  3B3C A;  3V8I A;  2AFU A;  4M6G A;  4Y49 B;  4HKF A;  1YW6 A;  2CNT A;  4MI4 A;  3NH4 A;  1IY7 A;  3TO7 A;  1VHU A;  4YGO A;  1YQE A;  3WC5 A;  4AB7 A;  2YNC C;  3ETI A;  5J1Q A;  1X10 A;  3S6K A;  4OC4 A;  1VIX A;  1BPN A;  2WUU A;  2AFM A;  1VHE A;  3KI9 A;  2R98 A;  2ATR A;  1LAM A;  3G8W A;  2Q4Y A;  1MJA A;  3FH4 A;  4MHZ A;  1TF8 A;  4IHM A;  3VWD A;  4ONW A;  4CRZ B;  2G3A A;  7CPA A;  1Y9K A;  4YU9 A;  4FAI A;  3VAR A;  3TO6 A;  1SPV A;  2A4N A;  1SQH A;  2DXQ A;  3SJG A;  2ZW7 A;  1DE4 C;  5DS0 A;  4EVY A;  3GB0 A;  3V2B A;  4R87 A;  2FIA A;  4QUS A;  4KUB A;  1I1D A;  5LYI A;  3IIB A;  1M4G A;  3D4U A;  3MRU A;  3RYO A;  1LAP A;  4G1P A;  4BIN A;  4BMH A;  4OC1 A;  4A32 A;  2Q51 A;  2YND A;  2ZEE A;  1Z8X A;  1LAN A;  4QVT A;  1HDQ A;  4PK3 A;  5CB5 A;  4L8A A;  2L8R A;  2FG1 A;  2PR8 A;  4AVB A;  1B87 A;  2IMO A;  3JVN A;  5J8C A;  1R57 A;  2EVN A;  3EKE A;  1RXT A;  4OP4 A;  4BD9 A;  2C6C A;  4GS4 A;  3T9Y A;  4RUH A;  1J4J A;  3BHX A;  4CYO A;  3KL9 A;  3FJU A;  2Q43 A;  3JRU A;  1F2O A;  2VZY A;  2ZEH A;  3I9S A;  4NGT A;  4NGP A;  4MY3 A;  2B5G A;  4IAV A;  3K9T A;  3EWP A;  3KAS A;  1GYT A;  5E3B A;  4ZI6 A;  1AUG A;  2VZZ A;  2ZEO A;  5F47 A;  5KTA A;  3LD2 A;  4IF5 A;  4F9V A;  3V45 A;  2Q04 A;  3B3S A;  3CPA A;  3FX6 A;  4CYQ A;  2PIY A;  4W9Y A;  4ETK A;  2ZEN A;  2ARH A;  2IQ6 A;  1NMT A;  2LGR A;  3R9F A;  4DNC A;  2FXK A;  3IIF A;  2GFQ A;  1XMB A;  3I3G A;  2YNE A;  2AFC A;  2G0B A;  3BI1 A;  2DEA A;  2EK8 A;  3CXQ A;  3HUV A;  4MY0 A;  4X3R A;  3TOB A;  2AE6 A;  1QMU A;  2QEC A;  2CTB A;  3SIG A;  1TKH A;  3D8P A;  4CAV A;  1ZO0 A;  3IWG A;  3TCV A;  4P4B A;  3SIH A;  4PSX A;  3SHP A;  4KZT A;  3IWW A;  3SI0 A;  2I79 A;  2IJZ A;  4KVX A;  5G1Z A;  1NSA A;  1KUX A;  1AYE A;  1XIX A;  1Z8W A;  2FS5 A;  2PJ5 A;  2OZG A;  2QVP A;  3SJE A;  3VAT A;  6CPA A;  5IX3 A;  1KWM A;  2AFZ A;  3SJX A;  5K8P A;  4QC6 A;  2G3T A;  2REE A;  2RFH A;  3KZW A;  2CF4 A;  3KR5 A;  2PR1 A;  3IO1 A;  3S9N A;  4ZX8 A;  2REF A;  4Q7A A;  4OC3 A;  1YD9 A;  4UBR A;  4NEX A;  2YGW A;  5DWM A;  4AVA A;  3A9L A;  3BXM A;  5J8F A;  1ARL A;  2PJC A;  3DNS A;  3K9U A;  2PVV A;  1PYT B;  3IGR A;  3PB9 X;  3KQX A;  4ZX9 A;  4XPK A;  4KOX A;  1JWQ A;  1UFH A;  5HIH A;  5HOL A;  5HVH A;  2JZE A;  1FT7 A;  3KR4 A;  1Y9W A;  5ELY A;  4K3N A;  2Z10 A;  2CXA A;  3IWE A;  5EC4 A;  1TY8 A;  2BL1 A;  4UIB A;  5K8N A;  5D8N A;  2D4P A;  2HV2 A;  3B3W A;  4B5O A;  1YX0 A;  2F8H A;  2JEW A;  3SIJ A;  1ELL P;  3JUW A;  3T90 A;  4MHP A;  3KGQ A;  1YGH A;  4MCR A;  4CGP A;  2JDC A;  4L89 A;  3TT2 A;  4B14 A;  4Y49 C;  2R1I A;  4NJQ A;  1U6M A;  4ORF A;  3NE8 A;  1OBR A;  4ZYQ A;  5LYL A;  1CPX A;  4E2A A;  4F8Z A;  3B3V A;  5JH9 A;  2B4B A;  4EME A;  3R9E A;  2Q4V A;  4M6I A;  4R9M A;  3KKW A;  2J8M A;  4MFP A;  3PB6 X;  2V8V A;  2J9A A;  3LWU A;  3NA6 A;  2BEI A;  1KUV A;  1BLL E;  4UFW A;  4OAE A;  1Z4R A;  5EBV A;  5BWA B;  5JPH A;  1H8L A;  3FMC A;  1TKJ A;  2IL4 A;  4UEF A;  4UCN A;  3PB7 X;  4XNH B;  4YWY A;  3B2Y A;  2BFR A;  1K4J A;  2ZW6 A;  4B10 A;  1F2P A;  2EUI A;  1P0H A;  3D7D A;  4M3S A;  4E0A A;  4O23 A;  4UF4 A;  4M6H A;  1WWZ A;  4K0C A;  4JVV A;  3RNZ A;  2BFQ A;  3TO9 A;  4A38 A;  1VGY A;  2GLJ A;  3H5Z A;  4R76 A;  4DYO A;  1TXZ A;  3IC1 A;  3FIX A;  4DUK A;  2B5G B;  8CPA A;  3K2K A;  3W91 A;  4LQG A;  4ZY0 A;  2PC1 A;  4KOW A;  4F6A A;  4MFL A;  1YW4 A;  2NYQ A;  1Y0R A;  2F5I A;  4H89 A;  4OAD A;  3EFA A;  2XEJ A;  4DJL A;  4UWJ A;  3RO0 A;  2XEG A;  2B3V A;  5LYF A;  4CAE A;  5H86 A;  1QSN A;  2H5M A;  4Z65 A;  3PB4 X;  1EE3 P;  2C6G A;  5AG6 A;  3R1K A;  4QBJ A;  4C2Z A;  4PXB A;  1HJZ A;  2Z11 A;  4R6T A;  2YNC A;  2Z3P A;  4M85 A;  4IK2 A;  1IB1 E;  5KTC A;  3PFO A;  2XEF A;  4B5P B;  4CGL A;  2V8G A;  2Z0Z A;  2BCO A;  3EWR A;  3EW5 A;  2CIJ A;  4OIW A;  3H8E A;  1XRY A;  3JZT A;  2WCT A;  5FSZ A;  4X5K A;  1LRZ A;  1TKF A;  3D7H A;  3FEC A;  4Q38 A;  4YFJ A;  4EWT A;  4B5P A;  1JQG A;  2FE7 A;  3D7G A;  5LRK A;  1QSO A;  2PJ4 A;  4F0X A;  1Z2L A;  1YLE A;  2JZD A;  5AIL A;  1Y7R A;  4P4I A;  2Q7S A;  2KQV A;  2G9D A;  4LUA A;  1CBX A;  2XEI A;  4UCP A;  1PU9 A;  4CAF A;  1QSM A;  3PEI A;  4X2T A;  4MFK A;  5CMS A;  4KVM E;  5JQ4 A;  2FSR A;  1S7L A;  4UML A;  2GE3 A;  4MBU A;  1Y7E A;  1LOK A;  3DR6 A;  1WK4 A;  4A94 A;  3P2H A;  5JM6 A;  2PJ8 A;  1S7F A;  2Q44 A;  3FED A;  2OZU A;  1GHE A;  4KSI A;  4KS9 A;  3GQE A;  4ABL A;  2B4D A;  1V0C A;  1ZR3 A;  2F7V A;  2R7H A;  4NCZ A;  4ABK A;  4P10 A;  4P4F A;  4NFR A;  2FXF A;  1MJ9 A;  3GQO A;  5DWN A;  1XE4 A;  4C68 A;  1YR0 A;  5LYD A;  3CXS A;  3R96 A;  3GPG A;  4NGN A;  4PSW A;  2AFX A;  2J8N A;  1XOV A;  2WSA A;  3WR7 A;  3IEH A;  3JTK A;  4K30 A;  4NGQ A;  3D67 A;  3DR8 A;  1TIQ A;  3FXT A;  4C2Y A;  1M4D A;  1S60 A;  3QB8 A;  2XD7 A;  2Z3N A;  4KOR A;  5I0C A;  5CBM A;  3CPX A;  4JJX A;  3B35 A;  1M1D A;  4PPZ A;  3FB3 A;  1AMP A;  2FT0 A;  1FNO A;  1IOF A;  1M4L A;  3WAB A;  4CGO A;  1P4N A;  2PJ2 A;  2PSW A;  3R95 A;  4P4E A;  4EFD A;  3EC4 A;  5FSV A;  4ZY2 A;  1ZG7 A;  2DPS A;  4A39 A;  3PBB A;  4KOU A;  1TXR A;  1VHO A;  3WC7 A;  4MRI A;  2JEV A;  4FD6 A;  4FUU A;  2AFS A;  1ELM P;  1YK3 A;  2BOA A;  2JLM A;  4P45 A;  5F09 A;  2HUZ A;  1LFW A;  2WZN A;  4U9Y A;  4JLY A;  1YLO A;  4E8O A;  4HNW B;  3IID A;  2ZPA A;  2ZED A;  2EO8 A;  3W6X A;  5CPA A;  4P44 A;  5LRJ A;  3SI2 A;  4MHY A;  1QSR A;  2PJA A;  4RN7 A;  3TFY A;  3QAY A;  4H6U A;  4UWI A;  5KTD A;  4NGR A;  2V8H A;  4TNU A;  3V38 A;  1BAV A;  2PDO A;  3PGP A;  4IUS A;  2PJ7 A;  4MFQ A;  1XFO A;  4BBH A;  1UWY A;  4QB9 A;  3FYN A;  4CAW A;  1IID A;  2O28 A;  2PIZ A;  3IJ3 A;  4JCA A;  3IU1 A;  3NH8 A;  5EMI A;  3TTH A;  2AFO A;  3GKR A;  3KHZ A;  4KOV A;  2B58 A;  3Q71 A;  3N5F A;  5A27 A;  3GPQ A;  1QQ9 A;  4H6Z A;  5CNP A;  1N71 A;  4C2X A;  4FWU A;  4JZ0 A;  4JWP A;  3I1U A;  2ZEF A;  1KZF A;  4A30 A;  4RI1 A;  1Z8L A;  4RS2 A;  2B3U A;  2JBK A;  2PJB A;  2VEZ A;  4ZBG A;  4UIA A;  5G22 A;  4OKO A;  1HEE A;  1ZG8 A;  2WPW A;  1CG2 A;  3EY5 A;  4UEE A;  3TX8 A;  4OC0 A;  4CYP A;  3B7I A;  5I4M A;  1L0C A;  4R3L A;  4AG7 A;  1YVO A;  2ZW5 A;  3MGD A;  4KOY A;  3H8G A;  4MJ8 A;  4XPD B;  5F49 A;  3MN8 A;  4A37 A;  4B13 A;  4CPA A;  3CXP A;  3R9G A;  4PXC A;  2B4D B;  2HC9 A;  1Y0Y A;  4C7H A;  3D66 A;  4GVW A;  2JBJ A;  4KSF A;  1VHS A;  3LOD A;  4MMO A;  4R8F A;  4P4D A;  1BO4 A;  3PFE A;  2ZW4 A;  3CZX A;  2CTC A;  2P0W A;  4MCQ A;  5FSU A;  1IOI A;  2D4O A;  2RNK A;  3S9M A;  1FY7 A;  1R3N A;  3B3T A;  1Q7L A;  2C27 A;  2PCU A;  2ABZ A;  1R43 A;  3EJF A;  1RO5 A;  2ZXV A;  2WPX A;  2PJ1 A;  2PE3 A;  3H4Q A;  1CP6 A;  1YME A;  3ZJ0 A;  5AG4 A;  2V8D A;  3FF3 A;  2PRB A;  3LMS A;  1VKC A;  3TOA A;  1CPS A;  1S7K A;  2EBJ A;  1RTQ A;  5K8M A;  1IYL A;  3EJG A;  4J5R A;  4XNH C;  5D29 A;  4CYN A;  4FBE A;  5K8O A;  2QML A;  4J5Q A;  2P6F A;  4UFV A;  4A31 A;  1X12 A;  3D7F A;  4II9 A;  3ISZ A;  5HH1 A;  4CGN A;  3L2N A;  3ISX A;  4C7I A;  4Q36 A;  3SXO A;  3BJ7 A;  3DSB A;  3QAH A;  3F5B A;  4ONU A;  3DGV A;  3W6S A;  1XF8 A;  3Q6Z A;  2PRQ A;  5HMN A;  4HNX B;  4GVV A;  3NFZ A;  2OB0 A;  2GIV A;  5IB9 A;  1ZR5 A;  2EK9 A;  3C26 A;  2OH1 A;  2NSM A;  4KSA A;  2JDD A;  3D68 A;  4U5Y A;  2QIR A;  4MFJ A;  2Q4Z A;  4R3K A;  3S6H A;  1S7N A;  1CP7 A;  4LQ6 A;  1DTD A;  4NF1 A;  4WJB A;  4OC5 A;  5LRG A;  2GU2 A;  3GLJ A;  1IU8 A;  4JYW A;  2VBQ A;  2ZEG A;  3LAC A;  2HQY A;  2AFW A;  2BSW A;  4MHD A;  3PBE A;  3TE4 A;  1XJO A;  4NGM A;  3BI0 A;  3HLP A;  4HNY B;  2GLF A;  2OR4 A;  2EEE A;  2Z3L A;  4KUA A;  1XEB A;  2CNS A;  3GUX A;  3P2F A;  3SXN A;  4B12 A;  4F9U A;  1A2Z A;  1CM0 A;  4AG9 A;  3S9L A;  3FNC A;  1NJR A;  2OZH A;  5E96 A;  2Q7B A;  4OC2 A;  4LX9 A;  2C1C A;  2ZEP A;  4UA3 A;  3ZZI A;  5IV0 A;  1Z8T A;  5G20 A;  1F57 A;  2X7B A;  1TF9 A;  4MCS A;  1B6B A;  1Q2C A;  4JLL A;  5C88 A;  3FRM A;  3D2P A;  4NJR A;  4MHN A;  4XPD C;  4KOS A;  1ON0 A;  4ZY1 A;  4B6Z A;  3KQZ A;  3BLN A;  1PUA A;  3GY9 A;  4P6Y A;  2JZF A;  3E0K A;  2I00 A;  5AGE A;  3FBU A;  1NE9 A;  2W2G A;  1QST A;  4J4Z A;  2I3C A;  2FCK A;  3F0A A;  4CGM A;  5IB0 A;  1PCA A;  3OWC A;  2Q0Y A;  1M4I A;  4KOT A;  1I12 A;  2O4H A;  2PJ6 A;  2VXK A;  4KYB A;  4XPL A;  5HVF A;  3VH9 A;  1CJW A;  2FL4 A;  2FAV A;  2CNM A;  4TU0 A;  1YRE A;  1Z9U A;  5AG5 A;  1Q2D A;  4NSQ A;  5GCN A;  1BPM A;  1Q2Y A;  1NSL A;  1MK4 A;  1YVK A;  4TWE A;  4J3G A;  3EWQ A;  3FEE A;  4OLL A;  3WT4 A;  4IQY A;  5FSY A;  4MXU A;  1IGB A;  1KUY A;  4PV6 A;  2PVW A;  2ODF A;  3CDX A;  3UY5 A;  5C82 A;  1XMT A;  4MFZ A;  1ZG9 A;  4OID A;  2FVG A;  2QJ8 A;  2BUE A;  3IFE A;  4WWV A;  4CAX A;  2QYV A;  4ZGY B;  5FSX A;  5G21 A;  2RB7 A;  4HPS A;  3CT9 A;  4YRH A;  2PJ3 A;  2VQY A;  2GAN A;  2WYR A;  4FD4 A;  4F0Y A;  2DX6 A;  2HB6 A;  3GIU A;  4PXE A;  1Z5R A;  4AXV A;  5JGF A;  4A95 A;  2K5T A;  3RAM A;  1Z4E A;  2OU2 A;  4NGS A;  4PXD A;  3GPO A;  1YSJ A;  4X8I A;  3TC8 A;  5H84 A;  4JD6 A;  3SI1 A;  4KVO E;  3B8G A;  3EXN A;  2POK A;  2O53 A;  3PZJ A;  1S3Z A;  4JGK A;  1S5K A;  3N7Z A;  4R57 A;  3RBU A;  2J8R A;  3F8K A;  1M44 A;  3DDD A;  3VFQ A;  4JXR A;  2C6P A;  3DLJ A;  3G3S A;  3KHX A;  3PP9 A;  4KLV A;  4P4J A;  3RZA A;  2Y0M A;  3NH5 A;  4KLW A;  4GUA A;  2AJ6 A;  2NMT A;  1ARM A;  4CRY B;  4H2K A;  5HXD A;  2ANP A;  2EWB A;  5ISV A;  2BO9 A;  4ETJ A; 
#chains in the Genus database with same CATH homology
 5THW A;  4ESS A;  1ZLH A;  2OOT A;  1LCP A;  3SJF A;  3PB8 X;  1CX8 A;  3QNV A;  2VL1 A;  2PJ0 A;  4J5S A;  2X47 A;  5HVG A;  2ZEL A;  2ACF A;  5CB3 A;  4R7M A;  1XBU A;  4PQA A;  3T8W A;  2VRI A;  2ZEM A;  3EWO A;  3H8F A;  4GM5 A;  2ZOF A;  4OME A;  3PRT A;  3SII A;  3V7Z A;  2ZOG A;  1ZLI A;  3FVL A;  2V77 A;  2GRE A;  4D86 A;  3WC6 A;  1HDU A;  5DUS A;  4UEZ A;  2PJ9 A;  4MCP A;  3B3C A;  2AFU A;  1YW6 A;  3NH4 A;  1IY7 A;  1VHU A;  3WC5 A;  3ETI A;  5J1Q A;  4OC4 A;  1VIX A;  1BPN A;  3KI9 A;  2AFM A;  1VHE A;  1LAM A;  4MHZ A;  3FH4 A;  1TF8 A;  4IHM A;  4ONW A;  7CPA A;  4YU9 A;  4FAI A;  3VAR A;  1SPV A;  3SJG A;  1DE4 C;  5DS0 A;  3GB0 A;  3V2B A;  5LYI A;  3IIB A;  3D4U A;  3MRU A;  1LAP A;  4G1P A;  4OC1 A;  2Q51 A;  2ZEE A;  1LAN A;  1HDQ A;  5CB5 A;  2L8R A;  2FG1 A;  2IMO A;  3EKE A;  4OP4 A;  4BD9 A;  2C6C A;  4RUH A;  3BHX A;  3KL9 A;  3FJU A;  2ZEH A;  3JRU A;  1F2O A;  2Q43 A;  4NGT A;  4NGP A;  4IAV A;  3K9T A;  3EWP A;  3KAS A;  1GYT A;  5E3B A;  4ZI6 A;  2ZEO A;  4F9V A;  3V45 A;  3B3S A;  3CPA A;  3FX6 A;  2PIY A;  4W9Y A;  4ETK A;  2ZEN A;  2IQ6 A;  2LGR A;  2FXK A;  3IIF A;  1XMB A;  2AFC A;  3BI1 A;  2DEA A;  2EK8 A;  3HUV A;  4X3R A;  1QMU A;  2CTB A;  3SIG A;  1TKH A;  4P4B A;  3SIH A;  3IWW A;  3SI0 A;  2IJZ A;  1NSA A;  1AYE A;  3SJE A;  2PJ5 A;  2QVP A;  3VAT A;  6CPA A;  1KWM A;  2AFZ A;  3SJX A;  5K8P A;  2RFH A;  3KZW A;  2CF4 A;  3KR5 A;  3IO1 A;  3S9N A;  4ZX8 A;  4Q7A A;  4OC3 A;  1YD9 A;  3BXM A;  1ARL A;  2PJC A;  2PVV A;  1PYT B;  3PB9 X;  3KQX A;  4ZX9 A;  5HIH A;  5HOL A;  5HVH A;  1FT7 A;  3KR4 A;  5ELY A;  4K3N A;  1TY8 A;  4UIB A;  5K8N A;  5D8N A;  3B3W A;  2F8H A;  2JEW A;  3SIJ A;  1ELL P;  4MHP A;  3KGQ A;  4MCR A;  4NJQ A;  1OBR A;  4ZYQ A;  1CPX A;  4F8Z A;  3B3V A;  5JH9 A;  4EME A;  3PB6 X;  2V8V A;  2J9A A;  3LWU A;  3NA6 A;  1BLL E;  1H8L A;  3FMC A;  1TKJ A;  4UEF A;  4YWY A;  3PB7 X;  3B2Y A;  2BFR A;  1F2P A;  3D7D A;  4O23 A;  4UF4 A;  4K0C A;  4JVV A;  2BFQ A;  4A38 A;  1VGY A;  2GLJ A;  4R76 A;  4DYO A;  1TXZ A;  3IC1 A;  4DUK A;  8CPA A;  3K2K A;  4LQG A;  4ZY0 A;  1YW4 A;  2NYQ A;  1Y0R A;  4DJL A;  2XEJ A;  5LYF A;  2XEG A;  4Z65 A;  3PB4 X;  1EE3 P;  2C6G A;  4PXB A;  1HJZ A;  4R6T A;  4IK2 A;  3PFO A;  2XEF A;  2V8G A;  2BCO A;  3EWR A;  3EW5 A;  2CIJ A;  4OIW A;  3H8E A;  1XRY A;  3JZT A;  5FSZ A;  3D7H A;  1TKF A;  3FEC A;  4EWT A;  1JQG A;  3D7G A;  5LRK A;  2PJ4 A;  1Z2L A;  5AIL A;  4P4I A;  2G9D A;  1CBX A;  2XEI A;  3PEI A;  4X2T A;  5CMS A;  4UML A;  1Y7E A;  1LOK A;  4A94 A;  5JM6 A;  2PJ8 A;  3FED A;  4KSI A;  3GQE A;  4ABL A;  2F7V A;  1ZR3 A;  4P4F A;  4ABK A;  4P10 A;  4NFR A;  3GQO A;  5LYD A;  3GPG A;  4NGN A;  2AFX A;  3IEH A;  4NGQ A;  3D67 A;  2XD7 A;  5CBM A;  3CPX A;  3B35 A;  4PPZ A;  1AMP A;  1FNO A;  1M4L A;  3WAB A;  2PJ2 A;  4P4E A;  4EFD A;  5FSV A;  4ZY2 A;  1ZG7 A;  4A39 A;  3PBB A;  1TXR A;  1VHO A;  3WC7 A;  4MRI A;  4FUU A;  2AFS A;  1ELM P;  2BOA A;  4P45 A;  5F09 A;  1LFW A;  2WZN A;  1YLO A;  3IID A;  2ZED A;  5CPA A;  4P44 A;  5LRJ A;  3SI2 A;  4MHY A;  2PJA A;  4NGR A;  2V8H A;  4TNU A;  3V38 A;  1BAV A;  2PJ7 A;  1XFO A;  1UWY A;  2PIZ A;  3IJ3 A;  4JCA A;  3NH8 A;  2AFO A;  3KHZ A;  3Q71 A;  3N5F A;  3GPQ A;  1QQ9 A;  4FWU A;  4JZ0 A;  3I1U A;  2ZEF A;  1Z8L A;  2JBK A;  2PJB A;  4UIA A;  4OKO A;  1HEE A;  1ZG8 A;  4UEE A;  1CG2 A;  3TX8 A;  4OC0 A;  3B7I A;  5I4M A;  4A37 A;  3H8G A;  3MN8 A;  4CPA A;  4PXC A;  2HC9 A;  1Y0Y A;  3D66 A;  4GVW A;  2JBJ A;  4MMO A;  4R8F A;  4P4D A;  3PFE A;  2CTC A;  4MCQ A;  5FSU A;  3S9M A;  1R3N A;  3B3T A;  1Q7L A;  2PCU A;  2ABZ A;  1R43 A;  3EJF A;  2PJ1 A;  2PE3 A;  1CP6 A;  1YME A;  2V8D A;  3FF3 A;  3LMS A;  1CPS A;  1RTQ A;  5K8M A;  3EJG A;  4J5R A;  5D29 A;  5K8O A;  4FBE A;  4J5Q A;  3D7F A;  3ISZ A;  3L2N A;  3ISX A;  3DGV A;  3Q6Z A;  2PRQ A;  4GVV A;  3NFZ A;  5IB9 A;  1ZR5 A;  2EK9 A;  2NSM A;  3D68 A;  2Q4Z A;  4WJB A;  1CP7 A;  1DTD A;  4OC5 A;  5LRG A;  2GU2 A;  3GLJ A;  4JYW A;  2ZEG A;  2AFW A;  3PBE A;  1XJO A;  4NGM A;  3BI0 A;  3HLP A;  2GLF A;  2OR4 A;  2EEE A;  3GUX A;  4F9U A;  3S9L A;  1NJR A;  4OC2 A;  2C1C A;  2ZEP A;  1F57 A;  1TF9 A;  4MCS A;  4JLL A;  4NJR A;  4MHN A;  4B6Z A;  4ZY1 A;  3KQZ A;  4P6Y A;  4J4Z A;  2I3C A;  1PCA A;  2O4H A;  2PJ6 A;  5HVF A;  4KYB A;  3VH9 A;  5LYL A;  2FAV A;  4TU0 A;  1BPM A;  4TWE A;  3EWQ A;  3FEE A;  3WT4 A;  4IQY A;  5FSY A;  4MXU A;  1IGB A;  2PVW A;  3CDX A;  1ZG9 A;  4OID A;  2FVG A;  2QJ8 A;  3IFE A;  4WWV A;  2QYV A;  5FSX A;  2RB7 A;  3CT9 A;  2PJ3 A;  2WYR A;  2DX6 A;  2HB6 A;  4PXE A;  1Z5R A;  4AXV A;  5JGF A;  3RAM A;  4NGS A;  4PXD A;  3GPO A;  1YSJ A;  4X8I A;  3TC8 A;  3SI1 A;  2POK A;  2O53 A;  3RBU A;  4JGK A;  3VFQ A;  2C6P A;  3DLJ A;  3KHX A;  4P4J A;  3RZA A;  3NH5 A;  4GUA A;  5HXD A;  1ARM A;  4H2K A;  2ANP A;  2EWB A;  2BO9 A;  4ETJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...