2J9AA

Bllap in complex with microginin fr1
Total Genus 175
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
175
sequence length
485
structure length
485
Chain Sequence
b'TKGLVLGIYSKEKEEDEPQFTSAGENFNKLVSGKLREILNISGPPLKAGKTRTFYGLHEDFPSVVVVGLGKKTAGIDEQENWHEGKENIRAAVAAGCRQIQDLEIPSVEVDPCGDAQAAAEGAVLGLYEYDDLKQKRKVVVSAKLHGSEDQEAWQRGVLFASGQNLARRLMETPANEMTPTKFAEIVEENLKSASIKTDVFIRPKSWIEEQEMGSFLSVAKGSEEPPVFLEIHYKGSPNASEPPLVFVGKGITFDSGGISIKAAANMDLMRADMGGAATICSAIVSAAKLDLPINIVGLAPLCENMPSGKANKPGDVVRARNGKTIQVDNTDAEGRLILADALCYAHTFNPKVIINAATLTGAMDIALGSGATGVFTNSSWLWNKLFEASIETGDRVWRMPLFEHYTRQVIDCQLADVNNIGKYRSAGACTAAAFLKEFVTHPKWAHLDIAGVMTNKDEVPYLRKGMAGRPTRTLIEFLFRFSQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CYTOSOL AMINOPEPTIDASE
publication title Binding Structure of the Leucine Aminopeptidase Inhibitor Microginin Fr1.
pubmed doi rcsb
molecule tags Hydrolase/inhibitor
total genus 175
structure length 485
sequence length 485
ec nomenclature ec 3.4.11.1: Leucyl aminopeptidase.
pdb deposition date 2006-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00883 Peptidase_M17 Cytosol aminopeptidase family, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 2j9aA01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2j9aA02
4X8IA 4ZX8A 1CBXA 4X2TA 1YLOA 2JBJA 2PJ7A 4NGMA 3HLPA 3SI2A 2V8DA 3EJFA 3CDXA 1ELLP 2PRQA 2VL1A 4ZY2A 4OC3A 4PPZA 2JBKA 3GPQA 3D68A 4KSIA 5DS0A 3WABA 2ZEOA 4JZ0A 4K3NA 3EWOA 2PJ9A 5K8MA 2DEAA 3KHXA 2J9AA 4UF4A 3DGVA 3B3WA 1ZLIA 2XEFA 3SJXA 3NFZA 4OC4A 3B3CA 1LAMA 3PFEA 4H2KA 3PB6X 4AXVA 3V45A 1F57A 1FT7A 2XD7A 4FAIA 1Y0YA 1ZG7A 4PXDA 1XJOA 4MXUA 3FJUA 5FSZA 1VHEA 4MCPA 4A38A 3PRTA 2ACFA 2PVWA 5JGFA 2PIYA 2GU2A 4P44A 1F2OA 4IQYA 3SIHA 4GVVA 1XRYA 4ABLA 5CMSA 1AMPA 2X47A 1LFWA 2ZOGA 5HXDA 1CPXA 2PCUA 3V7ZA 4YU9A 5LYDA 4RUHA 4P45A 4OC5A 3VH9A 4OIDA 2O53A 3RZAA 2AFXA 2GLJA 4P4DA 1YW6A 2CIJA 3S9NA 4IK2A 1ARMA 4TWEA 1HEEA 3KR5A 4EMEA 3WC7A 2V8VA 3KR4A 3IIBA 4NJQA 1KWMA 1TY8A 4ONWA 2EK8A 1Q7LA 4OMEA 4G1PA 3BHXA 4IAVA 3NA6A 2WYRA 1LCPA 1ELMP 1ZG9A 2PJ4A 3RAMA 1ZR3A 5HVGA 3IIFA 1NSAA 1TF9A 4K0CA 1BLLE 1VHOA 1DTDA 1BAVA 1IY7A 3KQXA 1LAPA 2AFUA 2PJ6A 3KASA 5I4MA 1YW4A 3GLJA 3FX6A 2XEGA 4A39A 6CPAA 3IC1A 3EWRA 3PFOA 3IIDA 3LWUA 2C1CA 4ETKA 2NSMA 2FXKA 4P4BA 4F9UA 4TU0A 1Z2LA 3D7HA 1DE4C 2FAVA 4OIWA 4J5SA 1GYTA 3KGQA 5ELYA 1TKJA 2ZEGA 4MHZA 5LYLA 1YSJA 4ZYQA 1R3NA 2Q43A 3B2YA 5J1QA 3JZTA 4NGQA 5CB3A 4P4EA 5D29A 3D7DA 2AFZA 2JEWA 1NJRA 2IMOA 3GQOA 5DUSA 5HOLA 1F2PA 3VATA 3B3SA 3I1UA 2OOTA 1TKFA 5CBMA 2XEIA 4R76A 2AFWA 3ISXA 4FBEA 4R8FA 4NGSA 4ZY0A 4ETJA 1JQGA 3EWQA 2PJ3A 4MCQA 2GLFA 3PB7X 3VARA 3S9LA 3BI1A 1EE3P 4W9YA 2LGRA 2BCOA 5LYFA 4BD9A 3D7GA 2PVVA 3JRUA 4ESSA 4JYWA 3EJGA 4J5QA 1Z8LA 4P4IA 3MN8A 2HC9A 3SIJA 3K9TA 4MHPA 4MCSA 3S9MA 2ABZA 2EK9A 1ZR5A 3KI9A 3NH8A 2BFRA 2QJ8A 2RB7A 5K8NA 2PJCA 4A37A 3B7IA 3Q71A 2EEEA 1YMEA 1IGBA 1XFOA 2NYQA 4MHYA 5FSUA 2QVPA 3IJ3A 4IHMA 5F09A 4OC2A 4FWUA 5LRGA 1ZLHA 2V77A 3NH5A 5HVHA 2QYVA 4NGNA 4UEFA 2CTBA 1QQ9A 4OKOA 2G9DA 2ZEPA 2Q51A 4OC1A 4D86A 1UWYA 4PQAA 2C6GA 3L2NA 4JGKA 4EWTA 4R6TA 4ABKA 3SI1A 4ZY1A 3FH4A 2ZEMA 1VHUA 2ZENA 2L8RA 2RFHA 3EWPA 2PJ8A 3B35A 3CT9A 5HIHA 3MRUA 3PBEA 2F7VA 1TKHA 5FSXA 1ZG8A 1VGYA 2ZEFA 2PJ1A 3EW5A 2POKA 4UEEA 3DLJA 3RBUA 4J4ZA 2BFQA 3PB4X 2PJAA 4JCAA 4JVVA 1LOKA 2WZNA 2O4HA 4NJRA 2PIZA 4P10A 2CTCA 4NGTA 3IO1A 3FF3A 4UEZA 4WWVA 4B6ZA 3FEDA 1CPSA 1M4LA 3KHZA 4MCRA 3IEHA 4UMLA 2OR4A 2ZELA 3NH4A 1CP6A 2IJZA 5K8OA 2C6PA 3WC5A 3SJGA 2V8HA 1HDUA 4GM5A 5E3BA 1PCAA 2ANPA 4PXEA 4DYOA 4X3RA 5D8NA 3V2BA 4MMOA 1XMBA 3H8FA 2AFOA 1TF8A 4J5RA 5AILA 2HB6A 3N5FA 3PB9X 2FVGA 2ZEHA 3B3TA 2C6CA 4KYBA 4CPAA 1FNOA 4PXBA 2XEJA 1AYEA 1XBUA 3GQEA 3GUXA 4ZI6A 2AFSA 4EFDA 3D66A 4PXCA 2ZOFA 1LANA 3Q6ZA 4DUKA 2PE3A 4OC0A 2EWBA 3T8WA 4ZX9A 1BPMA 2V8GA 5THWA 4UIAA 5JH9A 5HVFA 3H8GA 3GPOA 5LYIA 4F9VA 2BOAA 2PJ0A 3BI0A 3IWWA 3SJFA 2BO9A 4UIBA 4GUAA 1PYTB 4YWYA 2Q4ZA 3FVLA 3B3VA 3KZWA 5FSVA 3GB0A 3IFEA 3D67A 1YD9A 1QMUA 1VIXA 3BXMA 3FEEA 2ZEEA 3EKEA 1RTQA 3SJEA 5JM6A 2PJ5A 3CPXA 3HUVA 3KL9A 3K2KA 4TNUA 4Z65A 1CP7A 1R43A 7CPAA 2AFCA 3D4UA 3KQZA 4NGPA 1HDQA 4FUUA 3LMSA 2VRIA 4P4FA 1CX8A 3FMCA 4F8ZA 1H8LA 2AFMA 1Z5RA 1TXZA 4O23A 3TC8A 2CF4A 3ISZA 8CPAA 1OBRA 1ARLA 1Y7EA 3D7FA 2GREA 3H8EA 2ZEDA 3PB8X 4LQGA 3WT4A 4P4JA 1CG2A 5LRJA 3SIIA 5LRKA 1SPVA 2FG1A 5CPAA 4JLLA 4MHNA 1BPNA 4P6YA 4R7MA 3PEIA 3CPAA 3FECA 3SI0A 4NFRA 4WJBA 4MRIA 3QNVA 4GVWA 4OP4A 1Y0RA 5K8PA 5IB9A 2I3CA 3TX8A 2DX6A 3SIGA 2PJBA 2PJ2A 1HJZA 4NGRA 3VFQA 3ETIA 5FSYA 3GPGA 3V38A 4A94A 3PBBA 2IQ6A 4Q7AA 1TXRA 2F8HA 5CB5A 4DJLA 3WC6A
chains in the Genus database with same CATH superfamily
2OZGA 4R3KA 4X8IA 4ZX8A 1CBXA 4KLVA 4X2TA 1YLOA 2JBJA 2PJ7A 2YNCA 4NGMA 2R7HA 3HLPA 3SI2A 2V8DA 4M6IA 3EJFA 3CDXA 1ELLP 2PRQA 3IWEA 4CAWA 2VL1A 4PV6A 4ZY2A 2YGWA 4OC3A 3NE8A 4PPZA 2JBKA 3GPQA 3D68A 3EY5A 4KSIA 5DS0A 3WABA 2ZEOA 4JZ0A 4CYQA 4QB9A 1Q2CA 4K3NA 3EWOA 2PJ9A 4NXYA 3T90A 5K8MA 4A2ZA 1X10A 1P0HA 2DEAA 3KHXA 4Q36A 4C7HA 1KUYA 1I1DA 1YGHA 2J9AA 3H5ZA 4UF4A 1IOFA 3CXPA 3DGVA 3B3WA 1ZLIA 2XEFA 2PR8A 1X12A 3NFZA 3SJXA 4OC4A 4HKFA 3B3CA 3P2FA 1LAMA 3JVNA 3PFEA 4H2KA 4U5YA 4B5OA 1Z8XA 3PB6X 3CZXA 5AGEA 4AXVA 1VHSA 3V45A 2JDDA 4YGOA 1F57A 1S3ZA 1FT7A 4F6AA 4A32A 4BMHA 2XD7A 4FAIA 2D4OA 3GIUA 4UCNA 4Y49B 1Y0YA 1ZG7A 4PXDA 5J8CA 1XJOA 1YREA 2Q04A 4MXUA 3FJUA 3ZJ0A 4U9YA 2CNSA 1B6BA 2K5TA 4GS4A 5FSZA 1VHEA 4MCPA 4A38A 3PRTA 4E8OA 2ACFA 5BWAB 2PVWA 2YNCC 5JGFA 2PIYA 2GU2A 4MJ8A 4P44A 1S60A 4JXQA 1F2OA 4UWJA 3RYOA 4IQYA 3SIHA 2ZW4A 4GVVA 1XRYA 4ABLA 5CMSA 1AMPA 2Q4YA 2QMLA 3FB3A 2X47A 1LFWA 2ZOGA 2CNMA 2R1IA 1CPXA 5HXDA 3TT2A 2HV2A 2PCUA 2WSAA 1XIXA 3V7ZA 4KOVA 4YU9A 1YVOA 2VZZA 5LYDA 1MJ9A 2VEZA 4OC5A 4P45A 4X5KA 3R96A 3VH9A 1IIDA 4OIDA 2O53A 4Q38A 3RZAA 1RXTA 2KCWA 2AFXA 2GLJA 3F8KA 4P4DA 1YW6A 4CYOA 5IX3A 2CIJA 3S9NA 1IICA 4CGOA 1XOVA 5IB0A 4IK2A 4AVBA 3LODA 2C27A 2FT0A 1ARMA 4MFQA 1HEEA 4TWEA 3TO6A 4KUBA 3KR5A 1NSLA 4EMEA 4UCPA 2W2GA 2V8VA 3KR4A 2Z0ZA 3IIBA 4PSWA 3WC7A 2J8MA 1KWMA 1IYLA 1TY8A 3G3SA 2PRBA 4NJQA 4ONWA 1M1DA 2EK8A 3FRMA 2H5MA 1Q7LA 2G0BA 4OMEA 4OAEA 4UFXA 2Z3KA 3I9SA 2FXFA 4R57A 5FVJA 2VZYA 2FL4A 4G1PA 4R87A 4E0AA 3TO9A 1SQHA 3BHXA 1Z8TA 1XE4A 4IAVA 5DWNA 4KOTA 2REEA 2X7BA 3NA6A 4PK2A 2WYRA 1LCPA 1ELMP 1ZG9A 2YNDA 1M4IA 1MJAA 3D2PA 4OADA 4QC6A 2PJ4A 3RAMA 1ZR3A 5HVGA 3IIFA 1NSAA 4B11A 1TF9A 3GKRA 2FIWA 1L0CA 4K0CA 3T9YA 1BLLE 1VHOA 2GANA 4OLLA 2JZFA 2RNKA 1DTDA 2B5GA 4BBHA 3RNZA 2WPXA 4ORFA 4CAEA 1BAVA 1IY7A 3KQXA 1LAPA 2DPTA 4UCMA 2AFUA 3PZJA 2QIRA 2PJ6A 3KASA 2PC1A 4C2ZA 5I4MA 3TOAA 5KTCA 4C68A 1YW4A 5G1ZA 2Z3OA 3GLJA 3FX6A 2XEGA 4A39A 4MY3A 1Q2DA 2WUUA 6CPAA 3IC1A 4MFPA 4XNHB 3EWRA 4M85A 4QBJA 3PFOA 3IIDA 1V0CA 4NCZA 4B12A 3LWUA 4MY0A 2C1CA 4ETKA 4UWIA 2FIAA 2FXKA 2NSMA 4P4BA 4F9UA 4TU0A 2RC4A 1M4DA 4J3GA 1Z2LA 3D7HA 4KOSA 3PP9A 4EVYA 1DE4C 2FAVA 4JWPA 4Y49C 3RO0A 4OIWA 4J5SA 4UA3A 1GYTA 3KGQA 5ELYA 1TKJA 2ZEGA 4MHZA 5LYLA 1YSJA 4ZYQA 1R3NA 2VQYA 2Q43A 3B2YA 4ONUA 3D3SA 3CXQA 5J1QA 3JZTA 2B58A 4NGQA 2HQYA 5CB3A 4P4EA 2GFQA 4FD6A 5D29A 2PQ8A 3D7DA 1WWZA 2AFZA 3BJ8A 4QVTA 2CXAA 2JEWA 3V8IA 1PUAA 1NJRA 4KS9A 5HH1A 5J8FA 2IMOA 3GQOA 2A4NA 5DUSA 5HOLA 1F2PA 1FY7A 3VATA 3B3SA 4HNYB 3I1UA 2OOTA 1TKFA 5CBMA 2XEIA 1QSOA 4B5PB 2ZW6A 4R76A 2AFWA 3ISXA 4IF5A 4FBEA 1P4NA 4R8FA 4CGMA 4NGSA 4ZY0A 5F49A 5A27A 4ETJA 4HNXB 1JQGA 4JXRA 3EWQA 2PJ3A 4MCQA 2GLFA 4CYPA 3PB7X 1MJBA 5G22A 3TCVA 3VARA 3BI1A 3S9LA 4LUAA 1EE3P 4W9YA 2LGRA 1ON0A 1Z9UA 3JTKA 2BCOA 4H89A 5HMNA 4BD9A 5LYFA 3D7GA 3FBUA 1Y7RA 2FCKA 2PVVA 3FXTA 1KZFA 3JRUA 4H6ZA 3H4QA 4H6UA 4ESSA 4RN7A 3S6KA 4JYWA 2DF5A 3EJGA 4J5QA 4YRHA 4CAVA 5ISVA 1Z8LA 2PSWA 4P4IA 5CNPA 3MN8A 4AVCA 2HC9A 4A31A 3SIJA 3K9TA 1NMTA 4MHPA 4MCSA 4KOUA 3S9MA 2ABZA 2DPSA 2EK9A 1ZR5A 3KI9A 4R3LA 3D8PA 3NE7A 3NH8A 2BFRA 2OU2A 2QJ8A 2RB7A 1BO4A 5K8NA 2EO8A 4CGLA 4UBRA 4AVAA 2ZW5A 4CAXA 2PJCA 5AG6A 4A37A 3B7IA 3Q71A 3EXNA 4DNCA 5AG4A 4B5PA 4C7IA 3W6XA 2EEEA 1YMEA 1IGBA 1XFOA 2NYQA 3KKWA 4JD6A 4MHYA 5F48A 2ZW7A 5FSUA 2QVPA 3IJ3A 1JWQA 4IHMA 5F09A 3BJ7A 4OC2A 2PR1A 4IUSA 4FWUA 5LRGA 1ZLHA 3OWCA 2V77A 4YFJA 1YVKA 2CY2A 3NH5A 5HVHA 2QYVA 4NGNA 4LQ6A 4MBUA 3D2MA 4UEFA 2CTBA 1QQ9A 4K30A 4XNHC 5IV0A 1A2ZA 4OKOA 2Z3LA 2G9DA 4RI1A 3R95A 1S7NA 2Q51A 2ZEPA 3LD2A 1XEBA 4QUSA 4OC1A 4D86A 1UWYA 3IU2A 4M6HA 2JZEA 4PQAA 2C6GA 2HUZA 3EO4A 3L2NA 4JGKA 3P2HA 4R6TA 2NMTA 2B4BA 3VWDA 4EWTA 4ABKA 3SI1A 4ZY1A 1CM0A 3FH4A 2ZEMA 1VHUA 2ZENA 1BOBA 3DDDA 2L8RA 2RFHA 3EWPA 2PJ8A 3FIXA 2QECA 3B35A 1NE9A 2O28A 3CT9A 3EFAA 4UFWA 5G21A 3R9FA 2Q0YA 5HIHA 3MRUA 3PBEA 4NEXA 1YLEA 2F7VA 4F0XA 1YQEA 2P6EA 2JZDA 4KVOE 4FD5A 1TKHA 5FSXA 2WPWA 4KSAA 3BLNA 2DXQA 2GIVA 1U6MA 5H84A 4FD4A 4RUHA 1ZG8A 4MFJA 2VBQA 1Y9WA 4B13A 1VGYA 2ZEFA 5G20A 4CAFA 1XF8A 2PJ1A 3EW5A 2POKA 1Z4EA 4UEEA 3DLJA 3RBUA 3S6FA 2FE7A 1J4JA 3QAHA 4J4ZA 2BEIA 5EBVA 2BFQA 4B10A 3PB4X 2PJAA 4JJXA 4CRZB 2JDCA 3MGDA 3TFYA 4JCAA 4JVVA 3GYAA 1KUXA 1LOKA 2WZNA 2O4HA 3DSBA 4KOWA 2PIZA 4NJRA 4AG7A 4CGNA 5C82A 1QSMA 4P10A 2CTCA 4NGTA 4HNWB 2Q44A 3IO1A 4KLWA 3FF3A 3GY9A 2F5IA 4UEZA 2KQVA 4WWVA 2BL1A 4B6ZA 1MK4A 3FEDA 1CPSA 3QB8A 1M4LA 1YK3A 3KHZA 4MCRA 3IEHA 3JUWA 4M6GA 3SHPA 4II9A 4UMLA 2OR4A 2OZUA 2Z3NA 1CP6A 2IJZA 2Q4VA 2C6PA 2ZELA 3G8WA 3NH4A 3WC5A 5K8OA 1VKCA 5KTAA 3SJGA 2V8HA 1HDUA 2IL4A 4GM5A 1UFHA 2BUEA 5EC4A 3WR7A 3DNSA 1CJWA 2Q7BA 5AG5A 5E3BA 1PCAA 2ANPA 4PXEA 5KTDA 4DYOA 2ZXVA 4X3RA 5D8NA 3V2BA 1QSNA 4MMOA 1S5KA 3FYNA 1XMBA 4GXHA 4C2YA 2Z3MA 3H8FA 2B4DB 3QAYA 3SXOA 1IB1E 2AFOA 1TF8A 4A33A 2ODFA 4J5RA 5AILA 1S7LA 2HB6A 1GHEA 3TOBA 2EUIA 2G3AA 3N5FA 3PB9X 2FVGA 2EVNA 1I21A 4XPDB 3W6SA 2ZEHA 3TO7A 3B3TA 3R9EA 2C6CA 4KYBA 3I3GA 4PK3A 4CPAA 3K9UA 2VI7A 1IU8A 5JPHA 1FNOA 4AG9A 4KVXA 4PXBA 4M3SA 2OB0A 1AYEA 2XEJA 2CNTA 1XBUA 3IWGA 4C2XA 3GQEA 3GUXA 4ZI6A 2AFSA 4EFDA 4ZGYB 4LX9A 3D66A 2I00A 4PXCA 3S6HA 2ZOFA 4MFLA 1LANA 3Q6ZA 4DUKA 3N7ZA 4ZBGA 4KORA 2PE3A 2VXKA 4OC0A 3CXSA 4XPLA 2EWBA 3T8WA 4CGPA 5JQ4A 4KSFA 1M4GA 4ZX9A 1BPMA 2V8GA 5THWA 2B3VA 4MFZA 4UIAA 5JH9A 5HVFA 2WCTA 2G3TA 3H8GA 1KUVA 4I49A 3GPOA 5LYIA 1Z8WA 4F9VA 4KUAA 2BSWA 2BOAA 1QSRA 2PJ0A 2Y0MA 3BI0A 4NSQA 3IWWA 3SJFA 2BO9A 4KOYA 1B87A 4UIBA 4GUAA 1PYTB 4YWYA 3UY5A 3ZZIA 2Q4ZA 2AJ6A 2B4DA 2P0WA 3B3VA 3FVLA 4L8AA 3KZWA 5A28A 5FSVA 3GB0A 3IFEA 3D67A 5GCNA 1YD9A 1QMUA 2GE3A 1VIXA 1ZO0A 2Z3PA 4B14A 3BXMA 3EC4A 4E2AA 3FEEA 2ZEEA 3EKEA 1RTQA 5E96A 4U9ZA 3SJEA 3VWEA 1QSTA 5JM6A 1K4JA 1Q2YA 2PJ5A 3CPXA 2OZHA 3HUVA 3KL9A 1R57A 2ARHA 4NF1A 1IYKA 3K2KA 4TNUA 4Z65A 1M44A 4KZTA 5AG7A 1CP7A 1R43A 2D4PA 2EBJA 4AB7A 7CPAA 3E0KA 2AFCA 1WK4A 5DWMA 3TE4A 3D4UA 3KQZA 2I79A 4JLYA 4NGPA 1HDQA 4FUUA 3LMSA 2VRIA 1Y9KA 2B5GB 1CX8A 4P4FA 4R9MA 3FMCA 2Z11A 2AE6A 3B8GA 5EMIA 4CS0B 4F8ZA 2Q7SA 1H8LA 2AFMA 4PSXA 1Z5RA 1TXZA 4O23A 2B3UA 3TC8A 4CRYB 1AUGA 2CF4A 1LRZA 3ISZA 8CPAA 4KOXA 1OBRA 1ARLA 1Y7EA 3D7FA 5I0CA 2GREA 4MFKA 3H8EA 4FD7A 1N71A 2ZEDA 3PB8X 4LQGA 2Z10A 3WT4A 4P4JA 1XMTA 1CG2A 5LRJA 3SIIA 2YNEA 2ZPAA 5C88A 5LRKA 4L89A 2JLMA 5H86A 3FNCA 1I12A 1SPVA 2OH1A 2FG1A 1PU9A 5CPAA 4JLLA 4XPKA 4F0YA 4XPDC 4MHNA 1BPNA 4P6YA 4R7MA 3PEIA 3CPAA 3SXNA 3LACA 3FECA 1YX0A 2PDOA 4A95A 3SI0A 4NFRA 2FSRA 4WJBA 4MRIA 1S7FA 3F0AA 3QNVA 4GVWA 4MHDA 1TIQA 2P6GA 2REFA 2JEVA 4OP4A 3W91A 1Y0RA 1IOIA 5K8PA 5IB9A 5F46A 2I3CA 3TX8A 3IU1A 2DX6A 2ATRA 2R98A 1Z4RA 4KVME 3SIGA 2PJBA 2PJ2A 4BINA 4UFVA 3A9LA 1OZPA 2J8RA 1HJZA 2FS5A 3R9GA 3R1KA 4NGRA 4A30A 3VFQA 3ETIA 5F47A 2R8VA 4MI4A 3F5BA 5FSYA 3PGPA 3TTHA 3GPGA 3V38A 1S7KA 4CYNA 4A94A 3PBBA 1YR0A 2IQ6A 4Q7AA 1TXRA 4HPSA 2F8HA 2P6FA 3DR6A 4RS2A 3S6GA 1RO5A 3IGRA 5CB5A 4DJLA 2J8NA 3WC6A 3C26A 3DR8A
chains in the Genus database with same CATH topology
4X8IA 4ZX8A 1CBXA 4X2TA 1YLOA 2JBJA 2PJ7A 4NGMA 3HLPA 3SI2A 2V8DA 3EJFA 3CDXA 1ELLP 2PRQA 2VL1A 4ZY2A 4OC3A 4PPZA 2JBKA 3GPQA 3D68A 4KSIA 5DS0A 3WABA 2ZEOA 4JZ0A 4K3NA 3EWOA 2PJ9A 5K8MA 2DEAA 3KHXA 2J9AA 4UF4A 3DGVA 3B3WA 1ZLIA 2XEFA 3SJXA 3NFZA 4OC4A 3B3CA 1LAMA 3PFEA 4H2KA 3PB6X 4AXVA 3V45A 1F57A 1FT7A 2XD7A 4FAIA 1Y0YA 1ZG7A 4PXDA 1XJOA 4MXUA 3FJUA 5FSZA 1VHEA 4MCPA 4A38A 3PRTA 2ACFA 2PVWA 5JGFA 2PIYA 2GU2A 4P44A 1F2OA 4IQYA 3SIHA 4GVVA 1XRYA 4ABLA 5CMSA 1AMPA 2X47A 1LFWA 2ZOGA 5HXDA 1CPXA 2PCUA 3V7ZA 4YU9A 5LYDA 4RUHA 4P45A 4OC5A 3VH9A 4OIDA 2O53A 3RZAA 2AFXA 2GLJA 4P4DA 1YW6A 2CIJA 3S9NA 4IK2A 1ARMA 4TWEA 1HEEA 3KR5A 4EMEA 3WC7A 2V8VA 3KR4A 3IIBA 4NJQA 1KWMA 1TY8A 4ONWA 2EK8A 1Q7LA 4OMEA 4G1PA 3BHXA 4IAVA 3NA6A 2WYRA 1LCPA 1ELMP 1ZG9A 2PJ4A 3RAMA 1ZR3A 5HVGA 3IIFA 1NSAA 1TF9A 4K0CA 1BLLE 1VHOA 1DTDA 1BAVA 1IY7A 3KQXA 1LAPA 2AFUA 2PJ6A 3KASA 5I4MA 1YW4A 3GLJA 3FX6A 2XEGA 4A39A 6CPAA 3IC1A 3EWRA 3PFOA 3IIDA 3LWUA 2C1CA 4ETKA 2NSMA 2FXKA 4P4BA 4F9UA 4TU0A 1Z2LA 3D7HA 1DE4C 2FAVA 4OIWA 4J5SA 1GYTA 3KGQA 5ELYA 1TKJA 2ZEGA 4MHZA 5LYLA 1YSJA 4ZYQA 1R3NA 2Q43A 3B2YA 5J1QA 3JZTA 4NGQA 5CB3A 4P4EA 5D29A 3D7DA 2AFZA 2JEWA 1NJRA 2IMOA 3GQOA 5DUSA 5HOLA 1F2PA 3VATA 3B3SA 3I1UA 2OOTA 1TKFA 5CBMA 2XEIA 4R76A 2AFWA 3ISXA 4FBEA 4R8FA 4NGSA 4ZY0A 4ETJA 1JQGA 3EWQA 2PJ3A 4MCQA 2GLFA 3PB7X 3VARA 3S9LA 3BI1A 1EE3P 4W9YA 2LGRA 2BCOA 5LYFA 4BD9A 3D7GA 2PVVA 3JRUA 4ESSA 4JYWA 3EJGA 4J5QA 1Z8LA 4P4IA 3MN8A 2HC9A 3SIJA 3K9TA 4MHPA 4MCSA 3S9MA 2ABZA 2EK9A 1ZR5A 3KI9A 3NH8A 2BFRA 2QJ8A 2RB7A 5K8NA 2PJCA 4A37A 3B7IA 3Q71A 2EEEA 1YMEA 1IGBA 1XFOA 2NYQA 4MHYA 5FSUA 2QVPA 3IJ3A 4IHMA 5F09A 4OC2A 4FWUA 5LRGA 1ZLHA 2V77A 3NH5A 5HVHA 2QYVA 4NGNA 4UEFA 2CTBA 1QQ9A 4OKOA 2G9DA 2ZEPA 2Q51A 4OC1A 4D86A 1UWYA 4PQAA 2C6GA 3L2NA 4JGKA 4EWTA 4R6TA 4ABKA 3SI1A 4ZY1A 3FH4A 2ZEMA 1VHUA 2ZENA 2L8RA 2RFHA 3EWPA 2PJ8A 3B35A 3CT9A 5HIHA 3MRUA 3PBEA 2F7VA 1TKHA 5FSXA 1ZG8A 1VGYA 2ZEFA 2PJ1A 3EW5A 2POKA 4UEEA 3DLJA 3RBUA 4J4ZA 2BFQA 3PB4X 2PJAA 4JCAA 4JVVA 1LOKA 2WZNA 2O4HA 4NJRA 2PIZA 4P10A 2CTCA 4NGTA 3IO1A 3FF3A 4UEZA 4WWVA 4B6ZA 3FEDA 1CPSA 1M4LA 3KHZA 4MCRA 3IEHA 4UMLA 2OR4A 2ZELA 3NH4A 1CP6A 2IJZA 5K8OA 2C6PA 3WC5A 3SJGA 2V8HA 1HDUA 4GM5A 5E3BA 1PCAA 2ANPA 4PXEA 4DYOA 4X3RA 5D8NA 3V2BA 4MMOA 1XMBA 3H8FA 2AFOA 1TF8A 4J5RA 5AILA 2HB6A 3N5FA 3PB9X 2FVGA 2ZEHA 3B3TA 2C6CA 4KYBA 4CPAA 1FNOA 4PXBA 2XEJA 1AYEA 1XBUA 3GQEA 3GUXA 4ZI6A 2AFSA 4EFDA 3D66A 4PXCA 2ZOFA 1LANA 3Q6ZA 4DUKA 2PE3A 4OC0A 2EWBA 3T8WA 4ZX9A 1BPMA 2V8GA 5THWA 4UIAA 5JH9A 5HVFA 3H8GA 3GPOA 5LYIA 4F9VA 2BOAA 2PJ0A 3BI0A 3IWWA 3SJFA 2BO9A 4UIBA 4GUAA 1PYTB 4YWYA 2Q4ZA 3FVLA 3B3VA 3KZWA 5FSVA 3GB0A 3IFEA 3D67A 1YD9A 1QMUA 1VIXA 3BXMA 3FEEA 2ZEEA 3EKEA 1RTQA 3SJEA 5JM6A 2PJ5A 3CPXA 3HUVA 3KL9A 3K2KA 4TNUA 4Z65A 1CP7A 1R43A 7CPAA 2AFCA 3D4UA 3KQZA 4NGPA 1HDQA 4FUUA 3LMSA 2VRIA 4P4FA 1CX8A 3FMCA 4F8ZA 1H8LA 2AFMA 1Z5RA 1TXZA 4O23A 3TC8A 2CF4A 3ISZA 8CPAA 1OBRA 1ARLA 1Y7EA 3D7FA 2GREA 3H8EA 2ZEDA 3PB8X 4LQGA 3WT4A 4P4JA 1CG2A 5LRJA 3SIIA 5LRKA 1SPVA 2FG1A 5CPAA 4JLLA 4MHNA 1BPNA 4P6YA 4R7MA 3PEIA 3CPAA 3FECA 3SI0A 4NFRA 4WJBA 4MRIA 3QNVA 4GVWA 4OP4A 1Y0RA 5K8PA 5IB9A 2I3CA 3TX8A 2DX6A 3SIGA 2PJBA 2PJ2A 1HJZA 4NGRA 3VFQA 3ETIA 5FSYA 3GPGA 3V38A 4A94A 3PBBA 2IQ6A 4Q7AA 1TXRA 2F8HA 5CB5A 4DJLA 3WC6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X8I A;  4ZX8 A;  1CBX A;  4X2T A;  1YLO A;  2JBJ A;  2PJ7 A;  4NGM A;  3HLP A;  3SI2 A;  2V8D A;  3EJF A;  3CDX A;  1ELL P;  2PRQ A;  2VL1 A;  4ZY2 A;  4OC3 A;  4PPZ A;  2JBK A;  3GPQ A;  3D68 A;  4KSI A;  5DS0 A;  3WAB A;  2ZEO A;  4JZ0 A;  4K3N A;  3EWO A;  2PJ9 A;  5K8M A;  2DEA A;  3KHX A;  2J9A A;  4UF4 A;  3DGV A;  3B3W A;  1ZLI A;  2XEF A;  3SJX A;  3NFZ A;  4OC4 A;  3B3C A;  1LAM A;  3PFE A;  4H2K A;  3PB6 X;  4AXV A;  3V45 A;  1F57 A;  1FT7 A;  2XD7 A;  4FAI A;  1Y0Y A;  1ZG7 A;  4PXD A;  1XJO A;  4MXU A;  3FJU A;  5FSZ A;  1VHE A;  4MCP A;  4A38 A;  3PRT A;  2ACF A;  2PVW A;  5JGF A;  2PIY A;  2GU2 A;  4P44 A;  1F2O A;  4IQY A;  3SIH A;  4GVV A;  1XRY A;  4ABL A;  5CMS A;  1AMP A;  2X47 A;  1LFW A;  2ZOG A;  5HXD A;  1CPX A;  2PCU A;  3V7Z A;  4YU9 A;  5LYD A;  4RUH A;  4P45 A;  4OC5 A;  3VH9 A;  4OID A;  2O53 A;  3RZA A;  2AFX A;  2GLJ A;  4P4D A;  1YW6 A;  2CIJ A;  3S9N A;  4IK2 A;  1ARM A;  4TWE A;  1HEE A;  3KR5 A;  4EME A;  3WC7 A;  2V8V A;  3KR4 A;  3IIB A;  4NJQ A;  1KWM A;  1TY8 A;  4ONW A;  2EK8 A;  1Q7L A;  4OME A;  4G1P A;  3BHX A;  4IAV A;  3NA6 A;  2WYR A;  1LCP A;  1ELM P;  1ZG9 A;  2PJ4 A;  3RAM A;  1ZR3 A;  5HVG A;  3IIF A;  1NSA A;  1TF9 A;  4K0C A;  1BLL E;  1VHO A;  1DTD A;  1BAV A;  1IY7 A;  3KQX A;  1LAP A;  2AFU A;  2PJ6 A;  3KAS A;  5I4M A;  1YW4 A;  3GLJ A;  3FX6 A;  2XEG A;  4A39 A;  6CPA A;  3IC1 A;  3EWR A;  3PFO A;  3IID A;  3LWU A;  2C1C A;  4ETK A;  2NSM A;  2FXK A;  4P4B A;  4F9U A;  4TU0 A;  1Z2L A;  3D7H A;  1DE4 C;  2FAV A;  4OIW A;  4J5S A;  1GYT A;  3KGQ A;  5ELY A;  1TKJ A;  2ZEG A;  4MHZ A;  5LYL A;  1YSJ A;  4ZYQ A;  1R3N A;  2Q43 A;  3B2Y A;  5J1Q A;  3JZT A;  4NGQ A;  5CB3 A;  4P4E A;  5D29 A;  3D7D A;  2AFZ A;  2JEW A;  1NJR A;  2IMO A;  3GQO A;  5DUS A;  5HOL A;  1F2P A;  3VAT A;  3B3S A;  3I1U A;  2OOT A;  1TKF A;  5CBM A;  2XEI A;  4R76 A;  2AFW A;  3ISX A;  4FBE A;  4R8F A;  4NGS A;  4ZY0 A;  4ETJ A;  1JQG A;  3EWQ A;  2PJ3 A;  4MCQ A;  2GLF A;  3PB7 X;  3VAR A;  3S9L A;  3BI1 A;  1EE3 P;  4W9Y A;  2LGR A;  2BCO A;  5LYF A;  4BD9 A;  3D7G A;  2PVV A;  3JRU A;  4ESS A;  4JYW A;  3EJG A;  4J5Q A;  1Z8L A;  4P4I A;  3MN8 A;  2HC9 A;  3SIJ A;  3K9T A;  4MHP A;  4MCS A;  3S9M A;  2ABZ A;  2EK9 A;  1ZR5 A;  3KI9 A;  3NH8 A;  2BFR A;  2QJ8 A;  2RB7 A;  5K8N A;  2PJC A;  4A37 A;  3B7I A;  3Q71 A;  2EEE A;  1YME A;  1IGB A;  1XFO A;  2NYQ A;  4MHY A;  5FSU A;  2QVP A;  3IJ3 A;  4IHM A;  5F09 A;  4OC2 A;  4FWU A;  5LRG A;  1ZLH A;  2V77 A;  3NH5 A;  5HVH A;  2QYV A;  4NGN A;  4UEF A;  2CTB A;  1QQ9 A;  4OKO A;  2G9D A;  2ZEP A;  2Q51 A;  4OC1 A;  4D86 A;  1UWY A;  4PQA A;  2C6G A;  3L2N A;  4JGK A;  4EWT A;  4R6T A;  4ABK A;  3SI1 A;  4ZY1 A;  3FH4 A;  2ZEM A;  1VHU A;  2ZEN A;  2L8R A;  2RFH A;  3EWP A;  2PJ8 A;  3B35 A;  3CT9 A;  5HIH A;  3MRU A;  3PBE A;  2F7V A;  1TKH A;  5FSX A;  1ZG8 A;  1VGY A;  2ZEF A;  2PJ1 A;  3EW5 A;  2POK A;  4UEE A;  3DLJ A;  3RBU A;  4J4Z A;  2BFQ A;  3PB4 X;  2PJA A;  4JCA A;  4JVV A;  1LOK A;  2WZN A;  2O4H A;  4NJR A;  2PIZ A;  4P10 A;  2CTC A;  4NGT A;  3IO1 A;  3FF3 A;  4UEZ A;  4WWV A;  4B6Z A;  3FED A;  1CPS A;  1M4L A;  3KHZ A;  4MCR A;  3IEH A;  4UML A;  2OR4 A;  2ZEL A;  3NH4 A;  1CP6 A;  2IJZ A;  5K8O A;  2C6P A;  3WC5 A;  3SJG A;  2V8H A;  1HDU A;  4GM5 A;  5E3B A;  1PCA A;  2ANP A;  4PXE A;  4DYO A;  4X3R A;  5D8N A;  3V2B A;  4MMO A;  1XMB A;  3H8F A;  2AFO A;  1TF8 A;  4J5R A;  5AIL A;  2HB6 A;  3N5F A;  3PB9 X;  2FVG A;  2ZEH A;  3B3T A;  2C6C A;  4KYB A;  4CPA A;  1FNO A;  4PXB A;  2XEJ A;  1AYE A;  1XBU A;  3GQE A;  3GUX A;  4ZI6 A;  2AFS A;  4EFD A;  3D66 A;  4PXC A;  2ZOF A;  1LAN A;  3Q6Z A;  4DUK A;  2PE3 A;  4OC0 A;  2EWB A;  3T8W A;  4ZX9 A;  1BPM A;  2V8G A;  5THW A;  4UIA A;  5JH9 A;  5HVF A;  3H8G A;  3GPO A;  5LYI A;  4F9V A;  2BOA A;  2PJ0 A;  3BI0 A;  3IWW A;  3SJF A;  2BO9 A;  4UIB A;  4GUA A;  1PYT B;  4YWY A;  2Q4Z A;  3FVL A;  3B3V A;  3KZW A;  5FSV A;  3GB0 A;  3IFE A;  3D67 A;  1YD9 A;  1QMU A;  1VIX A;  3BXM A;  3FEE A;  2ZEE A;  3EKE A;  1RTQ A;  3SJE A;  5JM6 A;  2PJ5 A;  3CPX A;  3HUV A;  3KL9 A;  3K2K A;  4TNU A;  4Z65 A;  1CP7 A;  1R43 A;  7CPA A;  2AFC A;  3D4U A;  3KQZ A;  4NGP A;  1HDQ A;  4FUU A;  3LMS A;  2VRI A;  4P4F A;  1CX8 A;  3FMC A;  4F8Z A;  1H8L A;  2AFM A;  1Z5R A;  1TXZ A;  4O23 A;  3TC8 A;  2CF4 A;  3ISZ A;  8CPA A;  1OBR A;  1ARL A;  1Y7E A;  3D7F A;  2GRE A;  3H8E A;  2ZED A;  3PB8 X;  4LQG A;  3WT4 A;  4P4J A;  1CG2 A;  5LRJ A;  3SII A;  5LRK A;  1SPV A;  2FG1 A;  5CPA A;  4JLL A;  4MHN A;  1BPN A;  4P6Y A;  4R7M A;  3PEI A;  3CPA A;  3FEC A;  3SI0 A;  4NFR A;  4WJB A;  4MRI A;  3QNV A;  4GVW A;  4OP4 A;  1Y0R A;  5K8P A;  5IB9 A;  2I3C A;  3TX8 A;  2DX6 A;  3SIG A;  2PJB A;  2PJ2 A;  1HJZ A;  4NGR A;  3VFQ A;  3ETI A;  5FSY A;  3GPG A;  3V38 A;  4A94 A;  3PBB A;  2IQ6 A;  4Q7A A;  1TXR A;  2F8H A;  5CB5 A;  4DJL A;  3WC6 A; 
#chains in the Genus database with same CATH topology
 2OZG A;  4R3K A;  4X8I A;  4ZX8 A;  1CBX A;  4KLV A;  4X2T A;  1YLO A;  2JBJ A;  2PJ7 A;  2YNC A;  4NGM A;  2R7H A;  3HLP A;  3SI2 A;  2V8D A;  4M6I A;  3EJF A;  3CDX A;  1ELL P;  2PRQ A;  3IWE A;  4CAW A;  2VL1 A;  4PV6 A;  4ZY2 A;  2YGW A;  4OC3 A;  3NE8 A;  4PPZ A;  2JBK A;  3GPQ A;  3D68 A;  3EY5 A;  4KSI A;  5DS0 A;  3WAB A;  2ZEO A;  4JZ0 A;  4CYQ A;  4QB9 A;  1Q2C A;  4K3N A;  3EWO A;  2PJ9 A;  4NXY A;  3T90 A;  5K8M A;  4A2Z A;  1X10 A;  1P0H A;  2DEA A;  3KHX A;  4Q36 A;  4C7H A;  1KUY A;  1I1D A;  1YGH A;  2J9A A;  3H5Z A;  4UF4 A;  1IOF A;  3CXP A;  3DGV A;  3B3W A;  1ZLI A;  2XEF A;  2PR8 A;  1X12 A;  3NFZ A;  3SJX A;  4OC4 A;  4HKF A;  3B3C A;  3P2F A;  1LAM A;  3JVN A;  3PFE A;  4H2K A;  4U5Y A;  4B5O A;  1Z8X A;  3PB6 X;  3CZX A;  5AGE A;  4AXV A;  1VHS A;  3V45 A;  2JDD A;  4YGO A;  1F57 A;  1S3Z A;  1FT7 A;  4F6A A;  4A32 A;  4BMH A;  2XD7 A;  4FAI A;  2D4O A;  3GIU A;  4UCN A;  4Y49 B;  1Y0Y A;  1ZG7 A;  4PXD A;  5J8C A;  1XJO A;  1YRE A;  2Q04 A;  4MXU A;  3FJU A;  3ZJ0 A;  4U9Y A;  2CNS A;  1B6B A;  2K5T A;  4GS4 A;  5FSZ A;  1VHE A;  4MCP A;  4A38 A;  3PRT A;  4E8O A;  2ACF A;  5BWA B;  2PVW A;  2YNC C;  5JGF A;  2PIY A;  2GU2 A;  4MJ8 A;  4P44 A;  1S60 A;  4JXQ A;  1F2O A;  4UWJ A;  3RYO A;  4IQY A;  3SIH A;  2ZW4 A;  4GVV A;  1XRY A;  4ABL A;  5CMS A;  1AMP A;  2Q4Y A;  2QML A;  3FB3 A;  2X47 A;  1LFW A;  2ZOG A;  2CNM A;  2R1I A;  1CPX A;  5HXD A;  3TT2 A;  2HV2 A;  2PCU A;  2WSA A;  1XIX A;  3V7Z A;  4KOV A;  4YU9 A;  1YVO A;  2VZZ A;  5LYD A;  1MJ9 A;  2VEZ A;  4OC5 A;  4P45 A;  4X5K A;  3R96 A;  3VH9 A;  1IID A;  4OID A;  2O53 A;  4Q38 A;  3RZA A;  1RXT A;  2KCW A;  2AFX A;  2GLJ A;  3F8K A;  4P4D A;  1YW6 A;  4CYO A;  5IX3 A;  2CIJ A;  3S9N A;  1IIC A;  4CGO A;  1XOV A;  5IB0 A;  4IK2 A;  4AVB A;  3LOD A;  2C27 A;  2FT0 A;  1ARM A;  4MFQ A;  1HEE A;  4TWE A;  3TO6 A;  4KUB A;  3KR5 A;  1NSL A;  4EME A;  4UCP A;  2W2G A;  2V8V A;  3KR4 A;  2Z0Z A;  3IIB A;  4PSW A;  3WC7 A;  2J8M A;  1KWM A;  1IYL A;  1TY8 A;  3G3S A;  2PRB A;  4NJQ A;  4ONW A;  1M1D A;  2EK8 A;  3FRM A;  2H5M A;  1Q7L A;  2G0B A;  4OME A;  4OAE A;  4UFX A;  2Z3K A;  3I9S A;  2FXF A;  4R57 A;  5FVJ A;  2VZY A;  2FL4 A;  4G1P A;  4R87 A;  4E0A A;  3TO9 A;  1SQH A;  3BHX A;  1Z8T A;  1XE4 A;  4IAV A;  5DWN A;  4KOT A;  2REE A;  2X7B A;  3NA6 A;  4PK2 A;  2WYR A;  1LCP A;  1ELM P;  1ZG9 A;  2YND A;  1M4I A;  1MJA A;  3D2P A;  4OAD A;  4QC6 A;  2PJ4 A;  3RAM A;  1ZR3 A;  5HVG A;  3IIF A;  1NSA A;  4B11 A;  1TF9 A;  3GKR A;  2FIW A;  1L0C A;  4K0C A;  3T9Y A;  1BLL E;  1VHO A;  2GAN A;  4OLL A;  2JZF A;  2RNK A;  1DTD A;  2B5G A;  4BBH A;  3RNZ A;  2WPX A;  4ORF A;  4CAE A;  1BAV A;  1IY7 A;  3KQX A;  1LAP A;  2DPT A;  4UCM A;  2AFU A;  3PZJ A;  2QIR A;  2PJ6 A;  3KAS A;  2PC1 A;  4C2Z A;  5I4M A;  3TOA A;  5KTC A;  4C68 A;  1YW4 A;  5G1Z A;  2Z3O A;  3GLJ A;  3FX6 A;  2XEG A;  4A39 A;  4MY3 A;  1Q2D A;  2WUU A;  6CPA A;  3IC1 A;  4MFP A;  4XNH B;  3EWR A;  4M85 A;  4QBJ A;  3PFO A;  3IID A;  1V0C A;  4NCZ A;  4B12 A;  3LWU A;  4MY0 A;  2C1C A;  4ETK A;  4UWI A;  2FIA A;  2FXK A;  2NSM A;  4P4B A;  4F9U A;  4TU0 A;  2RC4 A;  1M4D A;  4J3G A;  1Z2L A;  3D7H A;  4KOS A;  3PP9 A;  4EVY A;  1DE4 C;  2FAV A;  4JWP A;  4Y49 C;  3RO0 A;  4OIW A;  4J5S A;  4UA3 A;  1GYT A;  3KGQ A;  5ELY A;  1TKJ A;  2ZEG A;  4MHZ A;  5LYL A;  1YSJ A;  4ZYQ A;  1R3N A;  2VQY A;  2Q43 A;  3B2Y A;  4ONU A;  3D3S A;  3CXQ A;  5J1Q A;  3JZT A;  2B58 A;  4NGQ A;  2HQY A;  5CB3 A;  4P4E A;  2GFQ A;  4FD6 A;  5D29 A;  2PQ8 A;  3D7D A;  1WWZ A;  2AFZ A;  3BJ8 A;  4QVT A;  2CXA A;  2JEW A;  3V8I A;  1PUA A;  1NJR A;  4KS9 A;  5HH1 A;  5J8F A;  2IMO A;  3GQO A;  2A4N A;  5DUS A;  5HOL A;  1F2P A;  1FY7 A;  3VAT A;  3B3S A;  4HNY B;  3I1U A;  2OOT A;  1TKF A;  5CBM A;  2XEI A;  1QSO A;  4B5P B;  2ZW6 A;  4R76 A;  2AFW A;  3ISX A;  4IF5 A;  4FBE A;  1P4N A;  4R8F A;  4CGM A;  4NGS A;  4ZY0 A;  5F49 A;  5A27 A;  4ETJ A;  4HNX B;  1JQG A;  4JXR A;  3EWQ A;  2PJ3 A;  4MCQ A;  2GLF A;  4CYP A;  3PB7 X;  1MJB A;  5G22 A;  3TCV A;  3VAR A;  3BI1 A;  3S9L A;  4LUA A;  1EE3 P;  4W9Y A;  2LGR A;  1ON0 A;  1Z9U A;  3JTK A;  2BCO A;  4H89 A;  5HMN A;  4BD9 A;  5LYF A;  3D7G A;  3FBU A;  1Y7R A;  2FCK A;  2PVV A;  3FXT A;  1KZF A;  3JRU A;  4H6Z A;  3H4Q A;  4H6U A;  4ESS A;  4RN7 A;  3S6K A;  4JYW A;  2DF5 A;  3EJG A;  4J5Q A;  4YRH A;  4CAV A;  5ISV A;  1Z8L A;  2PSW A;  4P4I A;  5CNP A;  3MN8 A;  4AVC A;  2HC9 A;  4A31 A;  3SIJ A;  3K9T A;  1NMT A;  4MHP A;  4MCS A;  4KOU A;  3S9M A;  2ABZ A;  2DPS A;  2EK9 A;  1ZR5 A;  3KI9 A;  4R3L A;  3D8P A;  3NE7 A;  3NH8 A;  2BFR A;  2OU2 A;  2QJ8 A;  2RB7 A;  1BO4 A;  5K8N A;  2EO8 A;  4CGL A;  4UBR A;  4AVA A;  2ZW5 A;  4CAX A;  2PJC A;  5AG6 A;  4A37 A;  3B7I A;  3Q71 A;  3EXN A;  4DNC A;  5AG4 A;  4B5P A;  4C7I A;  3W6X A;  2EEE A;  1YME A;  1IGB A;  1XFO A;  2NYQ A;  3KKW A;  4JD6 A;  4MHY A;  5F48 A;  2ZW7 A;  5FSU A;  2QVP A;  3IJ3 A;  1JWQ A;  4IHM A;  5F09 A;  3BJ7 A;  4OC2 A;  2PR1 A;  4IUS A;  4FWU A;  5LRG A;  1ZLH A;  3OWC A;  2V77 A;  4YFJ A;  1YVK A;  2CY2 A;  3NH5 A;  5HVH A;  2QYV A;  4NGN A;  4LQ6 A;  4MBU A;  3D2M A;  4UEF A;  2CTB A;  1QQ9 A;  4K30 A;  4XNH C;  5IV0 A;  1A2Z A;  4OKO A;  2Z3L A;  2G9D A;  4RI1 A;  3R95 A;  1S7N A;  2Q51 A;  2ZEP A;  3LD2 A;  1XEB A;  4QUS A;  4OC1 A;  4D86 A;  1UWY A;  3IU2 A;  4M6H A;  2JZE A;  4PQA A;  2C6G A;  2HUZ A;  3EO4 A;  3L2N A;  4JGK A;  3P2H A;  4R6T A;  2NMT A;  2B4B A;  3VWD A;  4EWT A;  4ABK A;  3SI1 A;  4ZY1 A;  1CM0 A;  3FH4 A;  2ZEM A;  1VHU A;  2ZEN A;  1BOB A;  3DDD A;  2L8R A;  2RFH A;  3EWP A;  2PJ8 A;  3FIX A;  2QEC A;  3B35 A;  1NE9 A;  2O28 A;  3CT9 A;  3EFA A;  4UFW A;  5G21 A;  3R9F A;  2Q0Y A;  5HIH A;  3MRU A;  3PBE A;  4NEX A;  1YLE A;  2F7V A;  4F0X A;  1YQE A;  2P6E A;  2JZD A;  4KVO E;  4FD5 A;  1TKH A;  5FSX A;  2WPW A;  4KSA A;  3BLN A;  2DXQ A;  2GIV A;  1U6M A;  5H84 A;  4FD4 A;  4RUH A;  1ZG8 A;  4MFJ A;  2VBQ A;  1Y9W A;  4B13 A;  1VGY A;  2ZEF A;  5G20 A;  4CAF A;  1XF8 A;  2PJ1 A;  3EW5 A;  2POK A;  1Z4E A;  4UEE A;  3DLJ A;  3RBU A;  3S6F A;  2FE7 A;  1J4J A;  3QAH A;  4J4Z A;  2BEI A;  5EBV A;  2BFQ A;  4B10 A;  3PB4 X;  2PJA A;  4JJX A;  4CRZ B;  2JDC A;  3MGD A;  3TFY A;  4JCA A;  4JVV A;  3GYA A;  1KUX A;  1LOK A;  2WZN A;  2O4H A;  3DSB A;  4KOW A;  2PIZ A;  4NJR A;  4AG7 A;  4CGN A;  5C82 A;  1QSM A;  4P10 A;  2CTC A;  4NGT A;  4HNW B;  2Q44 A;  3IO1 A;  4KLW A;  3FF3 A;  3GY9 A;  2F5I A;  4UEZ A;  2KQV A;  4WWV A;  2BL1 A;  4B6Z A;  1MK4 A;  3FED A;  1CPS A;  3QB8 A;  1M4L A;  1YK3 A;  3KHZ A;  4MCR A;  3IEH A;  3JUW A;  4M6G A;  3SHP A;  4II9 A;  4UML A;  2OR4 A;  2OZU A;  2Z3N A;  1CP6 A;  2IJZ A;  2Q4V A;  2C6P A;  2ZEL A;  3G8W A;  3NH4 A;  3WC5 A;  5K8O A;  1VKC A;  5KTA A;  3SJG A;  2V8H A;  1HDU A;  2IL4 A;  4GM5 A;  1UFH A;  2BUE A;  5EC4 A;  3WR7 A;  3DNS A;  1CJW A;  2Q7B A;  5AG5 A;  5E3B A;  1PCA A;  2ANP A;  4PXE A;  5KTD A;  4DYO A;  2ZXV A;  4X3R A;  5D8N A;  3V2B A;  1QSN A;  4MMO A;  1S5K A;  3FYN A;  1XMB A;  4GXH A;  4C2Y A;  2Z3M A;  3H8F A;  2B4D B;  3QAY A;  3SXO A;  1IB1 E;  2AFO A;  1TF8 A;  4A33 A;  2ODF A;  4J5R A;  5AIL A;  1S7L A;  2HB6 A;  1GHE A;  3TOB A;  2EUI A;  2G3A A;  3N5F A;  3PB9 X;  2FVG A;  2EVN A;  1I21 A;  4XPD B;  3W6S A;  2ZEH A;  3TO7 A;  3B3T A;  3R9E A;  2C6C A;  4KYB A;  3I3G A;  4PK3 A;  4CPA A;  3K9U A;  2VI7 A;  1IU8 A;  5JPH A;  1FNO A;  4AG9 A;  4KVX A;  4PXB A;  4M3S A;  2OB0 A;  1AYE A;  2XEJ A;  2CNT A;  1XBU A;  3IWG A;  4C2X A;  3GQE A;  3GUX A;  4ZI6 A;  2AFS A;  4EFD A;  4ZGY B;  4LX9 A;  3D66 A;  2I00 A;  4PXC A;  3S6H A;  2ZOF A;  4MFL A;  1LAN A;  3Q6Z A;  4DUK A;  3N7Z A;  4ZBG A;  4KOR A;  2PE3 A;  2VXK A;  4OC0 A;  3CXS A;  4XPL A;  2EWB A;  3T8W A;  4CGP A;  5JQ4 A;  4KSF A;  1M4G A;  4ZX9 A;  1BPM A;  2V8G A;  5THW A;  2B3V A;  4MFZ A;  4UIA A;  5JH9 A;  5HVF A;  2WCT A;  2G3T A;  3H8G A;  1KUV A;  4I49 A;  3GPO A;  5LYI A;  1Z8W A;  4F9V A;  4KUA A;  2BSW A;  2BOA A;  1QSR A;  2PJ0 A;  2Y0M A;  3BI0 A;  4NSQ A;  3IWW A;  3SJF A;  2BO9 A;  4KOY A;  1B87 A;  4UIB A;  4GUA A;  1PYT B;  4YWY A;  3UY5 A;  3ZZI A;  2Q4Z A;  2AJ6 A;  2B4D A;  2P0W A;  3B3V A;  3FVL A;  4L8A A;  3KZW A;  5A28 A;  5FSV A;  3GB0 A;  3IFE A;  3D67 A;  5GCN A;  1YD9 A;  1QMU A;  2GE3 A;  1VIX A;  1ZO0 A;  2Z3P A;  4B14 A;  3BXM A;  3EC4 A;  4E2A A;  3FEE A;  2ZEE A;  3EKE A;  1RTQ A;  5E96 A;  4U9Z A;  3SJE A;  3VWE A;  1QST A;  5JM6 A;  1K4J A;  1Q2Y A;  2PJ5 A;  3CPX A;  2OZH A;  3HUV A;  3KL9 A;  1R57 A;  2ARH A;  4NF1 A;  1IYK A;  3K2K A;  4TNU A;  4Z65 A;  1M44 A;  4KZT A;  5AG7 A;  1CP7 A;  1R43 A;  2D4P A;  2EBJ A;  4AB7 A;  7CPA A;  3E0K A;  2AFC A;  1WK4 A;  5DWM A;  3TE4 A;  3D4U A;  3KQZ A;  2I79 A;  4JLY A;  4NGP A;  1HDQ A;  4FUU A;  3LMS A;  2VRI A;  1Y9K A;  2B5G B;  1CX8 A;  4P4F A;  4R9M A;  3FMC A;  2Z11 A;  2AE6 A;  3B8G A;  5EMI A;  4CS0 B;  4F8Z A;  2Q7S A;  1H8L A;  2AFM A;  4PSX A;  1Z5R A;  1TXZ A;  4O23 A;  2B3U A;  3TC8 A;  4CRY B;  1AUG A;  2CF4 A;  1LRZ A;  3ISZ A;  8CPA A;  4KOX A;  1OBR A;  1ARL A;  1Y7E A;  3D7F A;  5I0C A;  2GRE A;  4MFK A;  3H8E A;  4FD7 A;  1N71 A;  2ZED A;  3PB8 X;  4LQG A;  2Z10 A;  3WT4 A;  4P4J A;  1XMT A;  1CG2 A;  5LRJ A;  3SII A;  2YNE A;  2ZPA A;  5C88 A;  5LRK A;  4L89 A;  2JLM A;  5H86 A;  3FNC A;  1I12 A;  1SPV A;  2OH1 A;  2FG1 A;  1PU9 A;  5CPA A;  4JLL A;  4XPK A;  4F0Y A;  4XPD C;  4MHN A;  1BPN A;  4P6Y A;  4R7M A;  3PEI A;  3CPA A;  3SXN A;  3LAC A;  3FEC A;  1YX0 A;  2PDO A;  4A95 A;  3SI0 A;  4NFR A;  2FSR A;  4WJB A;  4MRI A;  1S7F A;  3F0A A;  3QNV A;  4GVW A;  4MHD A;  1TIQ A;  2P6G A;  2REF A;  2JEV A;  4OP4 A;  3W91 A;  1Y0R A;  1IOI A;  5K8P A;  5IB9 A;  5F46 A;  2I3C A;  3TX8 A;  3IU1 A;  2DX6 A;  2ATR A;  2R98 A;  1Z4R A;  4KVM E;  3SIG A;  2PJB A;  2PJ2 A;  4BIN A;  4UFV A;  3A9L A;  1OZP A;  2J8R A;  1HJZ A;  2FS5 A;  3R9G A;  3R1K A;  4NGR A;  4A30 A;  3VFQ A;  3ETI A;  5F47 A;  2R8V A;  4MI4 A;  3F5B A;  5FSY A;  3PGP A;  3TTH A;  3GPG A;  3V38 A;  1S7K A;  4CYN A;  4A94 A;  3PBB A;  1YR0 A;  2IQ6 A;  4Q7A A;  1TXR A;  4HPS A;  2F8H A;  2P6F A;  3DR6 A;  4RS2 A;  3S6G A;  1RO5 A;  3IGR A;  5CB5 A;  4DJL A;  2J8N A;  3WC6 A;  3C26 A;  3DR8 A; 
#chains in the Genus database with same CATH homology
 4X8I A;  4ZX8 A;  1CBX A;  4X2T A;  1YLO A;  2JBJ A;  2PJ7 A;  4NGM A;  3HLP A;  3SI2 A;  2V8D A;  3EJF A;  3CDX A;  1ELL P;  2PRQ A;  2VL1 A;  4ZY2 A;  4OC3 A;  4PPZ A;  2JBK A;  3GPQ A;  3D68 A;  4KSI A;  5DS0 A;  3WAB A;  2ZEO A;  4JZ0 A;  4K3N A;  3EWO A;  2PJ9 A;  5K8M A;  2DEA A;  3KHX A;  2J9A A;  4UF4 A;  3DGV A;  3B3W A;  1ZLI A;  2XEF A;  3SJX A;  3NFZ A;  4OC4 A;  3B3C A;  1LAM A;  3PFE A;  4H2K A;  3PB6 X;  4AXV A;  3V45 A;  1F57 A;  1FT7 A;  2XD7 A;  4FAI A;  1Y0Y A;  1ZG7 A;  4PXD A;  1XJO A;  4MXU A;  3FJU A;  5FSZ A;  1VHE A;  4MCP A;  4A38 A;  3PRT A;  2ACF A;  2PVW A;  5JGF A;  2PIY A;  2GU2 A;  4P44 A;  1F2O A;  4IQY A;  3SIH A;  4GVV A;  1XRY A;  4ABL A;  5CMS A;  1AMP A;  2X47 A;  1LFW A;  2ZOG A;  5HXD A;  1CPX A;  2PCU A;  3V7Z A;  4YU9 A;  5LYD A;  4RUH A;  4P45 A;  4OC5 A;  3VH9 A;  4OID A;  2O53 A;  3RZA A;  2AFX A;  2GLJ A;  4P4D A;  1YW6 A;  2CIJ A;  3S9N A;  4IK2 A;  1ARM A;  4TWE A;  1HEE A;  3KR5 A;  4EME A;  3WC7 A;  2V8V A;  3KR4 A;  3IIB A;  4NJQ A;  1KWM A;  1TY8 A;  4ONW A;  2EK8 A;  1Q7L A;  4OME A;  4G1P A;  3BHX A;  4IAV A;  3NA6 A;  2WYR A;  1LCP A;  1ELM P;  1ZG9 A;  2PJ4 A;  3RAM A;  1ZR3 A;  5HVG A;  3IIF A;  1NSA A;  1TF9 A;  4K0C A;  1BLL E;  1VHO A;  1DTD A;  1BAV A;  1IY7 A;  3KQX A;  1LAP A;  2AFU A;  2PJ6 A;  3KAS A;  5I4M A;  1YW4 A;  3GLJ A;  3FX6 A;  2XEG A;  4A39 A;  6CPA A;  3IC1 A;  3EWR A;  3PFO A;  3IID A;  3LWU A;  2C1C A;  4ETK A;  2NSM A;  2FXK A;  4P4B A;  4F9U A;  4TU0 A;  1Z2L A;  3D7H A;  1DE4 C;  2FAV A;  4OIW A;  4J5S A;  1GYT A;  3KGQ A;  5ELY A;  1TKJ A;  2ZEG A;  4MHZ A;  5LYL A;  1YSJ A;  4ZYQ A;  1R3N A;  2Q43 A;  3B2Y A;  5J1Q A;  3JZT A;  4NGQ A;  5CB3 A;  4P4E A;  5D29 A;  3D7D A;  2AFZ A;  2JEW A;  1NJR A;  2IMO A;  3GQO A;  5DUS A;  5HOL A;  1F2P A;  3VAT A;  3B3S A;  3I1U A;  2OOT A;  1TKF A;  5CBM A;  2XEI A;  4R76 A;  2AFW A;  3ISX A;  4FBE A;  4R8F A;  4NGS A;  4ZY0 A;  4ETJ A;  1JQG A;  3EWQ A;  2PJ3 A;  4MCQ A;  2GLF A;  3PB7 X;  3VAR A;  3S9L A;  3BI1 A;  1EE3 P;  4W9Y A;  2LGR A;  2BCO A;  5LYF A;  4BD9 A;  3D7G A;  2PVV A;  3JRU A;  4ESS A;  4JYW A;  3EJG A;  4J5Q A;  1Z8L A;  4P4I A;  3MN8 A;  2HC9 A;  3SIJ A;  3K9T A;  4MHP A;  4MCS A;  3S9M A;  2ABZ A;  2EK9 A;  1ZR5 A;  3KI9 A;  3NH8 A;  2BFR A;  2QJ8 A;  2RB7 A;  5K8N A;  2PJC A;  4A37 A;  3B7I A;  3Q71 A;  2EEE A;  1YME A;  1IGB A;  1XFO A;  2NYQ A;  4MHY A;  5FSU A;  2QVP A;  3IJ3 A;  4IHM A;  5F09 A;  4OC2 A;  4FWU A;  5LRG A;  1ZLH A;  2V77 A;  3NH5 A;  5HVH A;  2QYV A;  4NGN A;  4UEF A;  2CTB A;  1QQ9 A;  4OKO A;  2G9D A;  2ZEP A;  2Q51 A;  4OC1 A;  4D86 A;  1UWY A;  4PQA A;  2C6G A;  3L2N A;  4JGK A;  4EWT A;  4R6T A;  4ABK A;  3SI1 A;  4ZY1 A;  3FH4 A;  2ZEM A;  1VHU A;  2ZEN A;  2L8R A;  2RFH A;  3EWP A;  2PJ8 A;  3B35 A;  3CT9 A;  5HIH A;  3MRU A;  3PBE A;  2F7V A;  1TKH A;  5FSX A;  1ZG8 A;  1VGY A;  2ZEF A;  2PJ1 A;  3EW5 A;  2POK A;  4UEE A;  3DLJ A;  3RBU A;  4J4Z A;  2BFQ A;  3PB4 X;  2PJA A;  4JCA A;  4JVV A;  1LOK A;  2WZN A;  2O4H A;  4NJR A;  2PIZ A;  4P10 A;  2CTC A;  4NGT A;  3IO1 A;  3FF3 A;  4UEZ A;  4WWV A;  4B6Z A;  3FED A;  1CPS A;  1M4L A;  3KHZ A;  4MCR A;  3IEH A;  4UML A;  2OR4 A;  2ZEL A;  3NH4 A;  1CP6 A;  2IJZ A;  5K8O A;  2C6P A;  3WC5 A;  3SJG A;  2V8H A;  1HDU A;  4GM5 A;  5E3B A;  1PCA A;  2ANP A;  4PXE A;  4DYO A;  4X3R A;  5D8N A;  3V2B A;  4MMO A;  1XMB A;  3H8F A;  2AFO A;  1TF8 A;  4J5R A;  5AIL A;  2HB6 A;  3N5F A;  3PB9 X;  2FVG A;  2ZEH A;  3B3T A;  2C6C A;  4KYB A;  4CPA A;  1FNO A;  4PXB A;  2XEJ A;  1AYE A;  1XBU A;  3GQE A;  3GUX A;  4ZI6 A;  2AFS A;  4EFD A;  3D66 A;  4PXC A;  2ZOF A;  1LAN A;  3Q6Z A;  4DUK A;  2PE3 A;  4OC0 A;  2EWB A;  3T8W A;  4ZX9 A;  1BPM A;  2V8G A;  5THW A;  4UIA A;  5JH9 A;  5HVF A;  3H8G A;  3GPO A;  5LYI A;  4F9V A;  2BOA A;  2PJ0 A;  3BI0 A;  3IWW A;  3SJF A;  2BO9 A;  4UIB A;  4GUA A;  1PYT B;  4YWY A;  2Q4Z A;  3FVL A;  3B3V A;  3KZW A;  5FSV A;  3GB0 A;  3IFE A;  3D67 A;  1YD9 A;  1QMU A;  1VIX A;  3BXM A;  3FEE A;  2ZEE A;  3EKE A;  1RTQ A;  3SJE A;  5JM6 A;  2PJ5 A;  3CPX A;  3HUV A;  3KL9 A;  3K2K A;  4TNU A;  4Z65 A;  1CP7 A;  1R43 A;  7CPA A;  2AFC A;  3D4U A;  3KQZ A;  4NGP A;  1HDQ A;  4FUU A;  3LMS A;  2VRI A;  4P4F A;  1CX8 A;  3FMC A;  4F8Z A;  1H8L A;  2AFM A;  1Z5R A;  1TXZ A;  4O23 A;  3TC8 A;  2CF4 A;  3ISZ A;  8CPA A;  1OBR A;  1ARL A;  1Y7E A;  3D7F A;  2GRE A;  3H8E A;  2ZED A;  3PB8 X;  4LQG A;  3WT4 A;  4P4J A;  1CG2 A;  5LRJ A;  3SII A;  5LRK A;  1SPV A;  2FG1 A;  5CPA A;  4JLL A;  4MHN A;  1BPN A;  4P6Y A;  4R7M A;  3PEI A;  3CPA A;  3FEC A;  3SI0 A;  4NFR A;  4WJB A;  4MRI A;  3QNV A;  4GVW A;  4OP4 A;  1Y0R A;  5K8P A;  5IB9 A;  2I3C A;  3TX8 A;  2DX6 A;  3SIG A;  2PJB A;  2PJ2 A;  1HJZ A;  4NGR A;  3VFQ A;  3ETI A;  5FSY A;  3GPG A;  3V38 A;  4A94 A;  3PBB A;  2IQ6 A;  4Q7A A;  1TXR A;  2F8H A;  5CB5 A;  4DJL A;  3WC6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...