2J9AA

Bllap in complex with microginin fr1
Total Genus 175
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
175
sequence length
485
structure length
485
Chain Sequence
TKGLVLGIYSKEKEEDEPQFTSAGENFNKLVSGKLREILNISGPPLKAGKTRTFYGLHEDFPSVVVVGLGKKTAGIDEQENWHEGKENIRAAVAAGCRQIQDLEIPSVEVDPCGDAQAAAEGAVLGLYEYDDLKQKRKVVVSAKLHGSEDQEAWQRGVLFASGQNLARRLMETPANEMTPTKFAEIVEENLKSASIKTDVFIRPKSWIEEQEMGSFLSVAKGSEEPPVFLEIHYKGSPNASEPPLVFVGKGITFDSGGISIKAAANMDLMRADMGGAATICSAIVSAAKLDLPINIVGLAPLCENMPSGKANKPGDVVRARNGKTIQVDNTDAEGRLILADALCYAHTFNPKVIINAATLTGAMDIALGSGATGVFTNSSWLWNKLFEASIETGDRVWRMPLFEHYTRQVIDCQLADVNNIGKYRSAGACTAAAFLKEFVTHPKWAHLDIAGVMTNKDEVPYLRKGMAGRPTRTLIEFLFRFSQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CYTOSOL AMINOPEPTIDASE
publication title Binding Structure of the Leucine Aminopeptidase Inhibitor Microginin Fr1.
pubmed doi rcsb
molecule tags Hydrolase/inhibitor
total genus 175
structure length 485
sequence length 485
ec nomenclature ec 3.4.11.1: Leucyl aminopeptidase.
pdb deposition date 2006-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00883 Peptidase_M17 Cytosol aminopeptidase family, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 2j9aA01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2j9aA02
2V8GA 3VFQA 3B3SA 4EFDA 4DYOA 3BXMA 4BD9A 4ZY0A 1AYEA 1LANA 4D86A 3RAMA 1TKFA 3IEHA 2PJBA 4MCPA 1QQ9A 2XEIA 4A37A 4FBEA 2BFQA 4JVVA 2ANPA 3D7GA 3FF3A 3SJFA 3NA6A 1ZLHA 3D7FA 2EEEA 1LAMA 4ZX9A 3SI1A 4NGNA 3NFZA 4NJRA 2ZEFA 2X47A 5DUSA 5JH9A 4P44A 3WC6A 3N5FA 3PRTA 3V2BA 3KR5A 4R8FA 1IGBA 2QVPA 2C6CA 2ZEMA 3KHZA 2IMOA 3K2KA 1UWYA 2AFWA 2CTCA 5AILA 4MHYA 2G9DA 4TWEA 4ZI6A 2PJ5A 2EWBA 4P4JA 1YMEA 1SPVA 4ZY2A 2ZEHA 3B7IA 3V38A 4PXCA 5CMSA 3SJXA 4H2KA 5HXDA 1BAVA 1DTDA 3KR4A 5K8PA 4R6TA 2PJ4A 2QJ8A 2PJAA 4NGQA 5K8MA 3H8GA 1CP7A 3KASA 4OC4A 2XEJA 3TX8A 3LMSA 5THWA 4F8ZA 3D7DA 3VH9A 1XFOA 1F2OA 3CT9A 4F9UA 5FSZA 3S9LA 4P10A 4OC1A 3K9TA 3FEEA 4RUHA 2V8DA 3SJGA 1HDUA 3FJUA 4IK2A 3GLJA 3H8EA 3WABA 1BPNA 4NGMA 3FX6A 4MCQA 3PB4X 3KI9A 1F57A 1XRYA 3BI1A 1Z5RA 5JGFA 5E3BA 3SJEA 3IIBA 2PE3A 3PBBA 3B35A 2BO9A 3B2YA 3TC8A 4KYBA 3EJGA 2FVGA 2XEFA 4KSIA 1LCPA 3KZWA 4WJBA 2PJ7A 2Q43A 5LYIA 5LRGA 3SI0A 1VHOA 2C6PA 2GLJA 4PPZA 4UMLA 1ARMA 3PEIA 2ZEOA 2JBJA 1R43A 4OIWA 3S9NA 3B3CA 2JEWA 1TXZA 3D66A 1BPMA 4J4ZA 2GLFA 2JBKA 1NSAA 2F7VA 5IB9A 1Y0RA 3GUXA 3FH4A 3KQZA 4K0CA 2C1CA 4MHZA 4P4IA 2C6GA 2IQ6A 2ABZA 4EMEA 3L2NA 2PJCA 4Q7AA 4A94A 4DUKA 5HOLA 5CB3A 3IFEA 4UIAA 1HEEA 1XJOA 4ZX8A 3HLPA 3GPOA 3ISXA 4MCSA 2Q51A 1OBRA 5DS0A 3KHXA 3PB6X 2WZNA 2FAVA 2GREA 2OOTA 1KWMA 3T8WA 1XMBA 3FVLA 3S9MA 5FSXA 4MRIA 4Z65A 5CB5A 1BLLE 1CPSA 5K8NA 4X8IA 1YLOA 3KGQA 4P6YA 1TY8A 4UF4A 5D8NA 2POKA 2BOAA 4JYWA 4OP4A 2ZEDA 2GU2A 2ZEEA 2I3CA 3FMCA 2V77A 6CPAA 4X2TA 4ABLA 3SIGA 3CPAA 3B3WA 4PXBA 2WYRA 4A38A 4JLLA 1Y0YA 1AMPA 2EK9A 2Q4ZA 2VRIA 3GQOA 2CIJA 2LGRA 1LOKA 2ZENA 1TF8A 2NSMA 4UEFA 1RTQA 2ZEGA 1EE3P 2RFHA 1Z8LA 3PB7X 1CPXA 1Y7EA 4OC0A 4MCRA 1PCAA 5LRKA 1Z2LA 4MHPA 1ZR3A 4ABKA 1YSJA 3MN8A 4OKOA 4W9YA 3CDXA 2AFMA 3EWPA 1TKHA 3PB8X 3D7HA 4J5QA 4EWTA 3GQEA 1FNOA 3KQXA 1F2PA 4IHMA 4NJQA 4NGSA 2O53A 1HDQA 2EK8A 3Q6ZA 5LYDA 1ELLP 4UEZA 2DX6A 3IIDA 2PVWA 2DEAA 3RZAA 3ISZA 5FSUA 1JQGA 2ZEPA 4G1PA 4B6ZA 2CTBA 4R7MA 4GUAA 4J5SA 4MHNA 3VARA 3KL9A 3GPGA 1ARLA 3B3TA 2PCUA 5FSVA 4P4FA 4YWYA 3NH8A 4NGPA 2FG1A 1H8LA 2AFCA 1CP6A 1VIXA 4JZ0A 4FAIA 4ETKA 1CX8A 2AFOA 5ELYA 5HIHA 1CBXA 3HUVA 1FT7A 3EWOA 3DLJA 4X3RA 3SIJA 1R3NA 4GM5A 1PYTB 4ZY1A 2IJZA 4FWUA 4PXDA 2FXKA 2V8VA 3NH4A 1IY7A 4P4DA 5LYLA 2ACFA 1ZLIA 2XD7A 4F9VA 7CPAA 3VATA 1ZG9A 1VGYA 4FUUA 4NGTA 2AFZA 3EJFA 3SI2A 4TU0A 2HB6A 3PFEA 2J9AA 1Q7LA 2RB7A 3WT4A 1NJRA 5K8OA 4UEEA 4IQYA 4NFRA 4OC5A 2PJ1A 4O23A 2PIZA 1TF9A 4ONWA 2L8RA 3V7ZA 2PJ8A 3EW5A 4ETJA 3IWWA 4YU9A 4OMEA 4ZYQA 1GYTA 4PQAA 4PXEA 2PIYA 3Q71A 3BI0A 3B3VA 3PB9X 2XEGA 3V45A 3RBUA 1TXRA 3IJ3A 2NYQA 4OC2A 4TNUA 4R76A 2ZOFA 1TKJA 4OC3A 5JM6A 1ZR5A 4GVWA 2AFSA 2PRQA 2PVVA 3I1UA 3EWQA 2V8HA 1ZG8A 8CPAA 2PJ0A 1XBUA 1LFWA 3JRUA 3BHXA 4K3NA 3GB0A 4JGKA 4MXUA 1VHEA 1YW4A 2PJ3A 4UIBA 3JZTA 3PFOA 5D29A 3SIHA 4DJLA 3GPQA 2BCOA 5FSYA 3WC5A 3IC1A 4WWVA 5CBMA 2VL1A 5HVGA 3PBEA 3NH5A 1QMUA 4P4EA 5HVFA 4A39A 3WC7A 2ZELA 3D67A 2CF4A 2PJ6A 3IO1A 5J1QA 3QNVA 3FECA 4NGRA 3LWUA 3ETIA 2F8HA 3MRUA 5CPAA 1HJZA 4CPAA 4LQGA 5LRJA 4OIDA 3D68A 4MMOA 1LAPA 2BFRA 1YW6A 5LYFA 3H8FA 1DE4C 2AFUA 3IIFA 1ZG7A 2HC9A 5I4MA 3EKEA 4P4BA 5HVHA 4GVVA 3DGVA 4IAVA 5F09A 3EWRA 4ESSA 2O4HA 2QYVA 3FEDA 1VHUA 2PJ2A 3D4UA 1ELMP 1CG2A 4P45A 3SIIA 4AXVA 1YD9A 1M4LA 3CPXA 2ZOGA 2AFXA 4J5RA 2OR4A 2PJ9A 4JCAA
chains in the Genus database with same CATH superfamily
3PGPA 2V8GA 3VFQA 3B3SA 4EFDA 4DYOA 3BXMA 1I21A 3G3SA 5AG6A 3R9FA 4AG7A 4BD9A 4F6AA 2VI7A 4ZY0A 4RS2A 3RYOA 1AYEA 1Z8WA 1LANA 2B5GB 2FIWA 3D8PA 3GYAA 4D86A 1SQHA 1S7KA 4XPKA 3P2HA 1TKFA 3RAMA 4A30A 4MBUA 2Z3OA 3IEHA 4AB7A 2PJBA 1M44A 4MCPA 1QQ9A 2XEIA 4A37A 4FBEA 4OLLA 2PSWA 2BFQA 4JVVA 2ANPA 3D7GA 1Y9KA 2J8NA 1Z4RA 3CXSA 1Q2DA 3FF3A 4JWPA 4NF1A 3SJFA 3IU2A 2J8MA 3ZJ0A 4PK3A 3NA6A 5FVJA 1ZLHA 4NSQA 3RNZA 3D7FA 4Q38A 2EEEA 4OAEA 3D2PA 2FL4A 2GANA 1LAMA 4ZX9A 1B6BA 3SI1A 2WPXA 4NGNA 4CS0B 4F0XA 3NFZA 4C7HA 4NJRA 2PC1A 2J8RA 5JQ4A 2ZEFA 2X47A 1KZFA 5DUSA 5JH9A 2JZEA 4P44A 3WC6A 3E0KA 3UY5A 1XIXA 3N5FA 3PRTA 3V2BA 2QMLA 2ZXVA 2F5IA 4Y49C 3KR5A 4NXYA 4R8FA 3TO7A 1YK3A 4NEXA 4EVYA 1YVKA 1IGBA 2ODFA 4C2XA 2YNCA 2QVPA 2C6CA 2ZEMA 2Q0YA 3KHZA 2IMOA 3K2KA 4LUAA 1UWYA 2AFWA 1ON0A 2CTCA 3IWEA 4E2AA 2VZYA 5AILA 3D3SA 4KLVA 2G9DA 4MHYA 4ZI6A 2PJ5A 4MJ8A 4TWEA 2EWBA 4P4JA 1YMEA 1SPVA 2G0BA 4B10A 4KOUA 5F49A 4ZY2A 5H86A 4L89A 2ZEHA 1JWQA 3B7IA 2JZDA 4PXCA 5CMSA 3SJXA 4H2KA 3V38A 5HXDA 4MY3A 1BAVA 1DTDA 3KR4A 1OZPA 3DNSA 4CGOA 2Q4YA 1VHSA 4C7IA 1N71A 3I9SA 1S7LA 2PR8A 5K8PA 4R6TA 2D4PA 2PJ4A 2O28A 2QJ8A 1IICA 1YVOA 2PJAA 4UFXA 2VQYA 4NGQA 1NE9A 5K8MA 3B8GA 3H8GA 1CP7A 4A2ZA 3KASA 4BINA 4OC4A 1XF8A 2EBJA 2EUIA 2XEJA 4XPDB 3TX8A 3JTKA 4C68A 3LMSA 1YLEA 3PFEA 5G22A 5THWA 2K5TA 4F8ZA 3D7DA 3VH9A 1XFOA 1F2OA 4MY0A 2REFA 2W2GA 3CT9A 4C2ZA 4F9UA 5C82A 2G3TA 2Q7SA 2DPSA 3RO0A 5FSZA 1GHEA 1Z8XA 3S9LA 4P10A 4OC1A 5AG4A 1RXTA 5EMIA 3K9TA 3FEEA 4RUHA 2V8DA 3SJGA 1HDUA 2OZUA 4R3LA 3TOBA 3FJUA 5KTDA 3EO4A 4IK2A 3GLJA 3H8EA 4UCNA 3WABA 1BPNA 1RO5A 4XNHB 3TO9A 4KOSA 4UFWA 4HNWB 2ZW4A 2DPTA 2Q4VA 4NGMA 2OU2A 4ONUA 2P6EA 3FX6A 4MCQA 2YNEA 3PB4X 3KI9A 3JVNA 2WPWA 1F57A 1XRYA 3BI1A 1Z5RA 5JGFA 1XOVA 5E3BA 1KUVA 4ZBGA 3SJEA 2AE6A 3JUWA 2HV2A 2AJ6A 3IIBA 5HMNA 2PE3A 1X12A 3PBBA 4CAEA 3B35A 5DWNA 3DR6A 1AUGA 1YX0A 2BO9A 3B2YA 3SXOA 4KLWA 3TC8A 4HKFA 3BLNA 4KYBA 3EJGA 2NMTA 2FVGA 2VBQA 1QSMA 2QIRA 2XEFA 4KSIA 1LCPA 2RNKA 3KZWA 2CXAA 3BJ8A 2PJ7A 2Q43A 1P4NA 2Z3NA 4WJBA 5LYIA 3R9GA 5LRGA 3CXPA 3SI0A 4CYQA 4RN7A 1VHOA 2C6PA 2PR1A 2GLJA 3CZXA 4PPZA 4UMLA 2ZW6A 3I3GA 3EFAA 5I0CA 2Q04A 1ARMA 3PEIA 1K4JA 2ZEOA 2JBJA 1B87A 1R43A 4OIWA 3S9NA 1IIDA 3B3CA 2JEWA 3K9UA 2BSWA 1TXZA 3D66A 2REEA 4JXQA 4KORA 4FD5A 4DNCA 1BPMA 4J4ZA 2GLFA 2PQ8A 3DSBA 1YQEA 2JBKA 2P0WA 1NSAA 4A33A 2F7VA 2GFQA 1Y0RA 3GUXA 5HVHA 2B4DA 5IB9A 3FH4A 3KQZA 4K0CA 2C1CA 4MHZA 4P4IA 3TTHA 2C6GA 4XPDC 3TE4A 2IQ6A 4AVCA 2ABZA 3WR7A 4EMEA 4KOTA 2EVNA 3L2NA 2PJCA 4Q7AA 3QAHA 4A94A 4DUKA 5HOLA 5CB3A 4GXHA 3IFEA 4UIAA 4AVAA 1HEEA 1XJOA 4UFVA 4ZX8A 5F46A 1NMTA 2Z11A 3HLPA 4GS4A 3GPOA 3ISXA 4MCSA 4MFLA 4CGLA 2Q51A 2Z3PA 3S6FA 1OBRA 5DS0A 3D2MA 3KKWA 2JDDA 4KVME 4FD6A 3KHXA 3PB6X 2WZNA 2FAVA 2G3AA 3FBUA 2GREA 2OOTA 5J8FA 1MJBA 1KWMA 3T8WA 3W6XA 1XMBA 3FVLA 3S9MA 5FSXA 1LRZA 2IL4A 2OZGA 4MRIA 5CB5A 3TCVA 4M6IA 4XNHC 4CGNA 4Z65A 3DDDA 1BLLE 4KUAA 4HPSA 3LODA 5E96A 1CPSA 5K8NA 4X8IA 1YLOA 2B5GA 3KGQA 4P6YA 2B3VA 5IV0A 3P2FA 1TY8A 4UF4A 5D8NA 2POKA 5J8CA 2BOAA 2H5MA 4JYWA 4B5PB 4MHDA 4OP4A 2ZEDA 1I12A 2DXQA 2GU2A 2ZEEA 2I3CA 5G20A 3FMCA 2WSAA 3A9LA 2V77A 4ORFA 2JLMA 3G8WA 2CNSA 3GY9A 2HQYA 4KS9A 6CPAA 3GKRA 4X2TA 4ABLA 3SIGA 1YR0A 4LX9A 3CPAA 3B3WA 4PXBA 2WYRA 4A38A 2YGWA 4RI1A 4QUSA 5AGEA 5HH1A 4R3KA 2R98A 1V0CA 4JLLA 1Y0YA 1VKCA 1AMPA 2EK9A 2Q4ZA 4R87A 2VRIA 3GQOA 2CIJA 1L0CA 2LGRA 1WK4A 3SHPA 2FE7A 2FSRA 3NE7A 4UBRA 1LOKA 2ZENA 1TF8A 2NSMA 4KZTA 4UEFA 4R9MA 1RTQA 2ZEGA 4YRHA 1EE3P 2RFHA 3F5BA 5G1ZA 1Z8LA 3PB7X 1CPXA 3H4QA 4L8AA 3TO6A 1Y7EA 3LD2A 4OC0A 4MCRA 1PCAA 2WCTA 2B3UA 5LRKA 1Z2LA 4MHPA 3PZJA 1ZR3A 4ABKA 1YSJA 5F47A 5AG5A 4CYOA 5IB0A 3MN8A 2YNDA 2CNMA 3FXTA 2CNTA 4OKOA 2HUZA 2JEVA 3EY5A 4W9YA 4B13A 3CDXA 3IWGA 4U9YA 3F8KA 2AFMA 3EWPA 1TKHA 3R1KA 3PB8X 3D7HA 4UCMA 5H84A 4J5QA 2C27A 3GQEA 4KUBA 4EWTA 1FNOA 3KQXA 1F2PA 1R57A 2I79A 4MI4A 4IHMA 4NJQA 4QBJA 2Z3LA 4NGSA 3R9EA 3SXNA 4BBHA 2O53A 1IYLA 4B12A 1HDQA 5JPHA 4KVXA 1TIQA 2EK8A 4K30A 5GCNA 3Q6ZA 5LYDA 1Y7RA 1ELLP 4UEZA 4AVBA 4CRZB 1QSNA 2DX6A 3IIDA 4X5KA 1BOBA 4F0YA 2PVWA 2DEAA 3RZAA 1PUAA 3ISZA 5FSUA 1M4DA 4II9A 1JQGA 1S7NA 2ZEPA 4G1PA 2CTBA 4R7MA 4B6ZA 4ZGYB 4GUAA 4J5SA 5KTCA 4MHNA 3VARA 3KL9A 3GPGA 2Y0MA 3QAYA 2FT0A 1ARLA 2FCKA 3B3TA 2PCUA 5FSVA 2WUUA 4P4FA 3V8IA 4YWYA 1FY7A 3NH8A 4NGPA 4U5YA 2FG1A 1H8LA 2AFCA 1CP6A 1VIXA 1S7FA 2VZZA 4JZ0A 4QC6A 4FAIA 4ETKA 1CX8A 2R7HA 2AFOA 5ELYA 1NSLA 5HIHA 4UWIA 5IX3A 1CBXA 2Q7BA 3HUVA 5A28A 1XMTA 1FT7A 1IU8A 3EWOA 3DLJA 4X3RA 3SIJA 1M4IA 1R3NA 1PYTB 1Y9WA 4ZY1A 2ZW5A 1QSRA 4GM5A 2IJZA 4FWUA 5EBVA 4PXDA 1M1DA 2FXKA 2V8VA 1IYKA 4M6GA 3NH4A 2Z3MA 4KOWA 1IY7A 4P4DA 1CJWA 4KSFA 3T9YA 2ACFA 1ZLIA 4MFQA 5LYLA 1UFHA 2XD7A 3GIUA 4CAWA 4J3GA 4H6ZA 5EC4A 2JDCA 2X7BA 2ZW7A 3EC4A 3QB8A 3W91A 4UWJA 4F9VA 4JXRA 5C88A 7CPAA 3MGDA 2FXFA 3VATA 5ISVA 1ZG9A 4B5OA 1VGYA 2Q44A 2Z10A 4FUUA 4NGTA 4BMHA 2AFZA 1YREA 2I00A 3EJFA 4UCPA 3R95A 3SI2A 4E0AA 5BWAB 4PSWA 4TU0A 1IOFA 1S60A 2HB6A 2J9AA 1Q7LA 2FS5A 1MJAA 2OB0A 2RB7A 1IB1E 2BEIA 1NJRA 3EXNA 3FNCA 4JD6A 4UEEA 3WT4A 3N7ZA 4B14A 5K8OA 4IQYA 1ZO0A 4NFRA 4OC5A 2PJ1A 4UA3A 2OZHA 4FD7A 2GE3A 1MK4A 4O23A 1A2ZA 1TF9A 2OH1A 2PIZA 4ONWA 4YFJA 3TFYA 2L8RA 2D4OA 1M4GA 4B11A 1CM0A 4A95A 3V7ZA 2FIAA 2PJ8A 5G21A 1X10A 4CAXA 3EW5A 4ETJA 3IWWA 4I49A 3BJ7A 4M3SA 4YU9A 4OMEA 5KTAA 3S6KA 1Q2YA 3T90A 4CGPA 4ZYQA 2VEZA 3S6GA 1GYTA 4MFKA 3PP9A 4PQAA 4PXEA 2PIYA 4KSAA 4XPLA 4IF5A 1KUXA 3Q71A 3BI0A 4JJXA 3B3VA 3PB9X 2XEGA 3V45A 3RBUA 1QSOA 1TXRA 3IJ3A 2NYQA 4OC2A 4TNUA 4NCZA 1XEBA 3TT2A 4R76A 2ZOFA 1TKJA 4OC3A 4PSXA 3IU1A 5JM6A 5F48A 1ZR5A 4GVWA 2AFSA 2PRQA 2PVVA 4YGOA 5DWMA 3I1UA 3S6HA 3EWQA 2PRBA 4H6UA 2V8HA 4R57A 4E8OA 1ZG8A 8CPAA 2PJ0A 1XBUA 2KQVA 3JRUA 1LFWA 3BHXA 1KUYA 4M85A 4CRYB 4KOXA 4K3NA 3GB0A 1Z9UA 4KOYA 4JGKA 3C26A 4MXUA 2DF5A 2ZPAA 1VHEA 1YW4A 2PJ3A 4UIBA 3JZTA 3PFOA 5D29A 3SIHA 1YGHA 3GPQA 4AG9A 4CAVA 4DJLA 4HNXB 3R96A 2BCOA 4CAFA 2A4NA 5FSYA 4CYNA 3WC5A 2BUEA 3IC1A 5CBMA 2VL1A 4OADA 4WWVA 3ZZIA 5HVGA 3PBEA 1J4JA 3NH5A 1QMUA 4P4EA 3FIXA 3W6SA 5HVFA 4A39A 4B5PA 2BL1A 3WC7A 2ZELA 3FB3A 1I1DA 4FD4A 3D67A 3FRMA 2CF4A 2Z3KA 2PJ6A 4CYPA 4C2YA 3IO1A 5J1QA 2CY2A 3QNVA 3FECA 3IGRA 4QB9A 4NGRA 3H5ZA 1MJ9A 1Z4EA 2VXKA 2YNCC 1XE4A 4KOVA 3LACA 3LWUA 3ETIA 1Z8TA 3VWDA 4PV6A 2F8HA 3DR8A 3MRUA 1HJZA 1S3ZA 4Q36A 5CPAA 4A31A 4CPAA 2GIVA 4MFJA 4MFPA 4LQGA 5A27A 2B58A 3CXQA 5LRJA 2R1IA 3VWEA 1U6MA 2PDOA 2ATRA 2P6GA 4MFZA 1WWZA 3NE8A 3D68A 4OIDA 4MMOA 4Y49B 1LAPA 2BFRA 1YW6A 5AG7A 3H8FA 5LYFA 1DE4C 4PK2A 4CGMA 2EO8A 2AFUA 4U9ZA 3IIFA 1ZG7A 2HC9A 4M6HA 4A32A 5I4MA 2Z0ZA 3EKEA 4P4BA 2RC4A 3OWCA 4GVVA 1P0HA 2B4DB 4IUSA 3DGVA 4IAVA 4JLYA 5F09A 2B4BA 3EWRA 4ESSA 4KVOE 2O4HA 2QYVA 3FEDA 1VHUA 1Q2CA 2PJ2A 3D4UA 3TOAA 2P6FA 1ELMP 1CG2A 4P45A 2QECA 2JZFA 1IOIA 3SIIA 4AXVA 1YD9A 1M4LA 3CPXA 1S5KA 4HNYB 1PU9A 2ARHA 2ZOGA 2AFXA 3F0AA 4H89A 4LQ6A 2KCWA 4J5RA 2OR4A 1QSTA 3FYNA 1BO4A 2PJ9A 5CNPA 2R8VA 4QVTA 4JCAA
chains in the Genus database with same CATH topology
2V8GA 3VFQA 3B3SA 4EFDA 4DYOA 3BXMA 4BD9A 4ZY0A 1AYEA 1LANA 4D86A 3RAMA 1TKFA 3IEHA 2PJBA 4MCPA 1QQ9A 2XEIA 4A37A 4FBEA 2BFQA 4JVVA 2ANPA 3D7GA 3FF3A 3SJFA 3NA6A 1ZLHA 3D7FA 2EEEA 1LAMA 4ZX9A 3SI1A 4NGNA 3NFZA 4NJRA 2ZEFA 2X47A 5DUSA 5JH9A 4P44A 3WC6A 3N5FA 3PRTA 3V2BA 3KR5A 4R8FA 1IGBA 2QVPA 2C6CA 2ZEMA 3KHZA 2IMOA 3K2KA 1UWYA 2AFWA 2CTCA 5AILA 4MHYA 2G9DA 4TWEA 4ZI6A 2PJ5A 2EWBA 4P4JA 1YMEA 1SPVA 4ZY2A 2ZEHA 3B7IA 3V38A 4PXCA 5CMSA 3SJXA 4H2KA 5HXDA 1BAVA 1DTDA 3KR4A 5K8PA 4R6TA 2PJ4A 2QJ8A 2PJAA 4NGQA 5K8MA 3H8GA 1CP7A 3KASA 4OC4A 2XEJA 3TX8A 3LMSA 5THWA 4F8ZA 3D7DA 3VH9A 1XFOA 1F2OA 3CT9A 4F9UA 5FSZA 3S9LA 4P10A 4OC1A 3K9TA 3FEEA 4RUHA 2V8DA 3SJGA 1HDUA 3FJUA 4IK2A 3GLJA 3H8EA 3WABA 1BPNA 4NGMA 3FX6A 4MCQA 3PB4X 3KI9A 1F57A 1XRYA 3BI1A 1Z5RA 5JGFA 5E3BA 3SJEA 3IIBA 2PE3A 3PBBA 3B35A 2BO9A 3B2YA 3TC8A 4KYBA 3EJGA 2FVGA 2XEFA 4KSIA 1LCPA 3KZWA 4WJBA 2PJ7A 2Q43A 5LYIA 5LRGA 3SI0A 1VHOA 2C6PA 2GLJA 4PPZA 4UMLA 1ARMA 3PEIA 2ZEOA 2JBJA 1R43A 4OIWA 3S9NA 3B3CA 2JEWA 1TXZA 3D66A 1BPMA 4J4ZA 2GLFA 2JBKA 1NSAA 2F7VA 5IB9A 1Y0RA 3GUXA 3FH4A 3KQZA 4K0CA 2C1CA 4MHZA 4P4IA 2C6GA 2IQ6A 2ABZA 4EMEA 3L2NA 2PJCA 4Q7AA 4A94A 4DUKA 5HOLA 5CB3A 3IFEA 4UIAA 1HEEA 1XJOA 4ZX8A 3HLPA 3GPOA 3ISXA 4MCSA 2Q51A 1OBRA 5DS0A 3KHXA 3PB6X 2WZNA 2FAVA 2GREA 2OOTA 1KWMA 3T8WA 1XMBA 3FVLA 3S9MA 5FSXA 4MRIA 4Z65A 5CB5A 1BLLE 1CPSA 5K8NA 4X8IA 1YLOA 3KGQA 4P6YA 1TY8A 4UF4A 5D8NA 2POKA 2BOAA 4JYWA 4OP4A 2ZEDA 2GU2A 2ZEEA 2I3CA 3FMCA 2V77A 6CPAA 4X2TA 4ABLA 3SIGA 3CPAA 3B3WA 4PXBA 2WYRA 4A38A 4JLLA 1Y0YA 1AMPA 2EK9A 2Q4ZA 2VRIA 3GQOA 2CIJA 2LGRA 1LOKA 2ZENA 1TF8A 2NSMA 4UEFA 1RTQA 2ZEGA 1EE3P 2RFHA 1Z8LA 3PB7X 1CPXA 1Y7EA 4OC0A 4MCRA 1PCAA 5LRKA 1Z2LA 4MHPA 1ZR3A 4ABKA 1YSJA 3MN8A 4OKOA 4W9YA 3CDXA 2AFMA 3EWPA 1TKHA 3PB8X 3D7HA 4J5QA 4EWTA 3GQEA 1FNOA 3KQXA 1F2PA 4IHMA 4NJQA 4NGSA 2O53A 1HDQA 2EK8A 3Q6ZA 5LYDA 1ELLP 4UEZA 2DX6A 3IIDA 2PVWA 2DEAA 3RZAA 3ISZA 5FSUA 1JQGA 2ZEPA 4G1PA 4B6ZA 2CTBA 4R7MA 4GUAA 4J5SA 4MHNA 3VARA 3KL9A 3GPGA 1ARLA 3B3TA 2PCUA 5FSVA 4P4FA 4YWYA 3NH8A 4NGPA 2FG1A 1H8LA 2AFCA 1CP6A 1VIXA 4JZ0A 4FAIA 4ETKA 1CX8A 2AFOA 5ELYA 5HIHA 1CBXA 3HUVA 1FT7A 3EWOA 3DLJA 4X3RA 3SIJA 1R3NA 4GM5A 1PYTB 4ZY1A 2IJZA 4FWUA 4PXDA 2FXKA 2V8VA 3NH4A 1IY7A 4P4DA 5LYLA 2ACFA 1ZLIA 2XD7A 4F9VA 7CPAA 3VATA 1ZG9A 1VGYA 4FUUA 4NGTA 2AFZA 3EJFA 3SI2A 4TU0A 2HB6A 3PFEA 2J9AA 1Q7LA 2RB7A 3WT4A 1NJRA 5K8OA 4UEEA 4IQYA 4NFRA 4OC5A 2PJ1A 4O23A 2PIZA 1TF9A 4ONWA 2L8RA 3V7ZA 2PJ8A 3EW5A 4ETJA 3IWWA 4YU9A 4OMEA 4ZYQA 1GYTA 4PQAA 4PXEA 2PIYA 3Q71A 3BI0A 3B3VA 3PB9X 2XEGA 3V45A 3RBUA 1TXRA 3IJ3A 2NYQA 4OC2A 4TNUA 4R76A 2ZOFA 1TKJA 4OC3A 5JM6A 1ZR5A 4GVWA 2AFSA 2PRQA 2PVVA 3I1UA 3EWQA 2V8HA 1ZG8A 8CPAA 2PJ0A 1XBUA 1LFWA 3JRUA 3BHXA 4K3NA 3GB0A 4JGKA 4MXUA 1VHEA 1YW4A 2PJ3A 4UIBA 3JZTA 3PFOA 5D29A 3SIHA 4DJLA 3GPQA 2BCOA 5FSYA 3WC5A 3IC1A 4WWVA 5CBMA 2VL1A 5HVGA 3PBEA 3NH5A 1QMUA 4P4EA 5HVFA 4A39A 3WC7A 2ZELA 3D67A 2CF4A 2PJ6A 3IO1A 5J1QA 3QNVA 3FECA 4NGRA 3LWUA 3ETIA 2F8HA 3MRUA 5CPAA 1HJZA 4CPAA 4LQGA 5LRJA 4OIDA 3D68A 4MMOA 1LAPA 2BFRA 1YW6A 5LYFA 3H8FA 1DE4C 2AFUA 3IIFA 1ZG7A 2HC9A 5I4MA 3EKEA 4P4BA 5HVHA 4GVVA 3DGVA 4IAVA 5F09A 3EWRA 4ESSA 2O4HA 2QYVA 3FEDA 1VHUA 2PJ2A 3D4UA 1ELMP 1CG2A 4P45A 3SIIA 4AXVA 1YD9A 1M4LA 3CPXA 2ZOGA 2AFXA 4J5RA 2OR4A 2PJ9A 4JCAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V8G A;  3VFQ A;  3B3S A;  4EFD A;  4DYO A;  3BXM A;  4BD9 A;  4ZY0 A;  1AYE A;  1LAN A;  4D86 A;  3RAM A;  1TKF A;  3IEH A;  2PJB A;  4MCP A;  1QQ9 A;  2XEI A;  4A37 A;  4FBE A;  2BFQ A;  4JVV A;  2ANP A;  3D7G A;  3FF3 A;  3SJF A;  3NA6 A;  1ZLH A;  3D7F A;  2EEE A;  1LAM A;  4ZX9 A;  3SI1 A;  4NGN A;  3NFZ A;  4NJR A;  2ZEF A;  2X47 A;  5DUS A;  5JH9 A;  4P44 A;  3WC6 A;  3N5F A;  3PRT A;  3V2B A;  3KR5 A;  4R8F A;  1IGB A;  2QVP A;  2C6C A;  2ZEM A;  3KHZ A;  2IMO A;  3K2K A;  1UWY A;  2AFW A;  2CTC A;  5AIL A;  4MHY A;  2G9D A;  4TWE A;  4ZI6 A;  2PJ5 A;  2EWB A;  4P4J A;  1YME A;  1SPV A;  4ZY2 A;  2ZEH A;  3B7I A;  3V38 A;  4PXC A;  5CMS A;  3SJX A;  4H2K A;  5HXD A;  1BAV A;  1DTD A;  3KR4 A;  5K8P A;  4R6T A;  2PJ4 A;  2QJ8 A;  2PJA A;  4NGQ A;  5K8M A;  3H8G A;  1CP7 A;  3KAS A;  4OC4 A;  2XEJ A;  3TX8 A;  3LMS A;  5THW A;  4F8Z A;  3D7D A;  3VH9 A;  1XFO A;  1F2O A;  3CT9 A;  4F9U A;  5FSZ A;  3S9L A;  4P10 A;  4OC1 A;  3K9T A;  3FEE A;  4RUH A;  2V8D A;  3SJG A;  1HDU A;  3FJU A;  4IK2 A;  3GLJ A;  3H8E A;  3WAB A;  1BPN A;  4NGM A;  3FX6 A;  4MCQ A;  3PB4 X;  3KI9 A;  1F57 A;  1XRY A;  3BI1 A;  1Z5R A;  5JGF A;  5E3B A;  3SJE A;  3IIB A;  2PE3 A;  3PBB A;  3B35 A;  2BO9 A;  3B2Y A;  3TC8 A;  4KYB A;  3EJG A;  2FVG A;  2XEF A;  4KSI A;  1LCP A;  3KZW A;  4WJB A;  2PJ7 A;  2Q43 A;  5LYI A;  5LRG A;  3SI0 A;  1VHO A;  2C6P A;  2GLJ A;  4PPZ A;  4UML A;  1ARM A;  3PEI A;  2ZEO A;  2JBJ A;  1R43 A;  4OIW A;  3S9N A;  3B3C A;  2JEW A;  1TXZ A;  3D66 A;  1BPM A;  4J4Z A;  2GLF A;  2JBK A;  1NSA A;  2F7V A;  5IB9 A;  1Y0R A;  3GUX A;  3FH4 A;  3KQZ A;  4K0C A;  2C1C A;  4MHZ A;  4P4I A;  2C6G A;  2IQ6 A;  2ABZ A;  4EME A;  3L2N A;  2PJC A;  4Q7A A;  4A94 A;  4DUK A;  5HOL A;  5CB3 A;  3IFE A;  4UIA A;  1HEE A;  1XJO A;  4ZX8 A;  3HLP A;  3GPO A;  3ISX A;  4MCS A;  2Q51 A;  1OBR A;  5DS0 A;  3KHX A;  3PB6 X;  2WZN A;  2FAV A;  2GRE A;  2OOT A;  1KWM A;  3T8W A;  1XMB A;  3FVL A;  3S9M A;  5FSX A;  4MRI A;  4Z65 A;  5CB5 A;  1BLL E;  1CPS A;  5K8N A;  4X8I A;  1YLO A;  3KGQ A;  4P6Y A;  1TY8 A;  4UF4 A;  5D8N A;  2POK A;  2BOA A;  4JYW A;  4OP4 A;  2ZED A;  2GU2 A;  2ZEE A;  2I3C A;  3FMC A;  2V77 A;  6CPA A;  4X2T A;  4ABL A;  3SIG A;  3CPA A;  3B3W A;  4PXB A;  2WYR A;  4A38 A;  4JLL A;  1Y0Y A;  1AMP A;  2EK9 A;  2Q4Z A;  2VRI A;  3GQO A;  2CIJ A;  2LGR A;  1LOK A;  2ZEN A;  1TF8 A;  2NSM A;  4UEF A;  1RTQ A;  2ZEG A;  1EE3 P;  2RFH A;  1Z8L A;  3PB7 X;  1CPX A;  1Y7E A;  4OC0 A;  4MCR A;  1PCA A;  5LRK A;  1Z2L A;  4MHP A;  1ZR3 A;  4ABK A;  1YSJ A;  3MN8 A;  4OKO A;  4W9Y A;  3CDX A;  2AFM A;  3EWP A;  1TKH A;  3PB8 X;  3D7H A;  4J5Q A;  4EWT A;  3GQE A;  1FNO A;  3KQX A;  1F2P A;  4IHM A;  4NJQ A;  4NGS A;  2O53 A;  1HDQ A;  2EK8 A;  3Q6Z A;  5LYD A;  1ELL P;  4UEZ A;  2DX6 A;  3IID A;  2PVW A;  2DEA A;  3RZA A;  3ISZ A;  5FSU A;  1JQG A;  2ZEP A;  4G1P A;  4B6Z A;  2CTB A;  4R7M A;  4GUA A;  4J5S A;  4MHN A;  3VAR A;  3KL9 A;  3GPG A;  1ARL A;  3B3T A;  2PCU A;  5FSV A;  4P4F A;  4YWY A;  3NH8 A;  4NGP A;  2FG1 A;  1H8L A;  2AFC A;  1CP6 A;  1VIX A;  4JZ0 A;  4FAI A;  4ETK A;  1CX8 A;  2AFO A;  5ELY A;  5HIH A;  1CBX A;  3HUV A;  1FT7 A;  3EWO A;  3DLJ A;  4X3R A;  3SIJ A;  1R3N A;  4GM5 A;  1PYT B;  4ZY1 A;  2IJZ A;  4FWU A;  4PXD A;  2FXK A;  2V8V A;  3NH4 A;  1IY7 A;  4P4D A;  5LYL A;  2ACF A;  1ZLI A;  2XD7 A;  4F9V A;  7CPA A;  3VAT A;  1ZG9 A;  1VGY A;  4FUU A;  4NGT A;  2AFZ A;  3EJF A;  3SI2 A;  4TU0 A;  2HB6 A;  3PFE A;  2J9A A;  1Q7L A;  2RB7 A;  3WT4 A;  1NJR A;  5K8O A;  4UEE A;  4IQY A;  4NFR A;  4OC5 A;  2PJ1 A;  4O23 A;  2PIZ A;  1TF9 A;  4ONW A;  2L8R A;  3V7Z A;  2PJ8 A;  3EW5 A;  4ETJ A;  3IWW A;  4YU9 A;  4OME A;  4ZYQ A;  1GYT A;  4PQA A;  4PXE A;  2PIY A;  3Q71 A;  3BI0 A;  3B3V A;  3PB9 X;  2XEG A;  3V45 A;  3RBU A;  1TXR A;  3IJ3 A;  2NYQ A;  4OC2 A;  4TNU A;  4R76 A;  2ZOF A;  1TKJ A;  4OC3 A;  5JM6 A;  1ZR5 A;  4GVW A;  2AFS A;  2PRQ A;  2PVV A;  3I1U A;  3EWQ A;  2V8H A;  1ZG8 A;  8CPA A;  2PJ0 A;  1XBU A;  1LFW A;  3JRU A;  3BHX A;  4K3N A;  3GB0 A;  4JGK A;  4MXU A;  1VHE A;  1YW4 A;  2PJ3 A;  4UIB A;  3JZT A;  3PFO A;  5D29 A;  3SIH A;  4DJL A;  3GPQ A;  2BCO A;  5FSY A;  3WC5 A;  3IC1 A;  4WWV A;  5CBM A;  2VL1 A;  5HVG A;  3PBE A;  3NH5 A;  1QMU A;  4P4E A;  5HVF A;  4A39 A;  3WC7 A;  2ZEL A;  3D67 A;  2CF4 A;  2PJ6 A;  3IO1 A;  5J1Q A;  3QNV A;  3FEC A;  4NGR A;  3LWU A;  3ETI A;  2F8H A;  3MRU A;  5CPA A;  1HJZ A;  4CPA A;  4LQG A;  5LRJ A;  4OID A;  3D68 A;  4MMO A;  1LAP A;  2BFR A;  1YW6 A;  5LYF A;  3H8F A;  1DE4 C;  2AFU A;  3IIF A;  1ZG7 A;  2HC9 A;  5I4M A;  3EKE A;  4P4B A;  5HVH A;  4GVV A;  3DGV A;  4IAV A;  5F09 A;  3EWR A;  4ESS A;  2O4H A;  2QYV A;  3FED A;  1VHU A;  2PJ2 A;  3D4U A;  1ELM P;  1CG2 A;  4P45 A;  3SII A;  4AXV A;  1YD9 A;  1M4L A;  3CPX A;  2ZOG A;  2AFX A;  4J5R A;  2OR4 A;  2PJ9 A;  4JCA A; 
#chains in the Genus database with same CATH topology
 3PGP A;  2V8G A;  3VFQ A;  3B3S A;  4EFD A;  4DYO A;  3BXM A;  1I21 A;  3G3S A;  5AG6 A;  3R9F A;  4AG7 A;  4BD9 A;  4F6A A;  2VI7 A;  4ZY0 A;  4RS2 A;  3RYO A;  1AYE A;  1Z8W A;  1LAN A;  2B5G B;  2FIW A;  3D8P A;  3GYA A;  4D86 A;  1SQH A;  1S7K A;  4XPK A;  3P2H A;  1TKF A;  3RAM A;  4A30 A;  4MBU A;  2Z3O A;  3IEH A;  4AB7 A;  2PJB A;  1M44 A;  4MCP A;  1QQ9 A;  2XEI A;  4A37 A;  4FBE A;  4OLL A;  2PSW A;  2BFQ A;  4JVV A;  2ANP A;  3D7G A;  1Y9K A;  2J8N A;  1Z4R A;  3CXS A;  1Q2D A;  3FF3 A;  4JWP A;  4NF1 A;  3SJF A;  3IU2 A;  2J8M A;  3ZJ0 A;  4PK3 A;  3NA6 A;  5FVJ A;  1ZLH A;  4NSQ A;  3RNZ A;  3D7F A;  4Q38 A;  2EEE A;  4OAE A;  3D2P A;  2FL4 A;  2GAN A;  1LAM A;  4ZX9 A;  1B6B A;  3SI1 A;  2WPX A;  4NGN A;  4CS0 B;  4F0X A;  3NFZ A;  4C7H A;  4NJR A;  2PC1 A;  2J8R A;  5JQ4 A;  2ZEF A;  2X47 A;  1KZF A;  5DUS A;  5JH9 A;  2JZE A;  4P44 A;  3WC6 A;  3E0K A;  3UY5 A;  1XIX A;  3N5F A;  3PRT A;  3V2B A;  2QML A;  2ZXV A;  2F5I A;  4Y49 C;  3KR5 A;  4NXY A;  4R8F A;  3TO7 A;  1YK3 A;  4NEX A;  4EVY A;  1YVK A;  1IGB A;  2ODF A;  4C2X A;  2YNC A;  2QVP A;  2C6C A;  2ZEM A;  2Q0Y A;  3KHZ A;  2IMO A;  3K2K A;  4LUA A;  1UWY A;  2AFW A;  1ON0 A;  2CTC A;  3IWE A;  4E2A A;  2VZY A;  5AIL A;  3D3S A;  4KLV A;  2G9D A;  4MHY A;  4ZI6 A;  2PJ5 A;  4MJ8 A;  4TWE A;  2EWB A;  4P4J A;  1YME A;  1SPV A;  2G0B A;  4B10 A;  4KOU A;  5F49 A;  4ZY2 A;  5H86 A;  4L89 A;  2ZEH A;  1JWQ A;  3B7I A;  2JZD A;  4PXC A;  5CMS A;  3SJX A;  4H2K A;  3V38 A;  5HXD A;  4MY3 A;  1BAV A;  1DTD A;  3KR4 A;  1OZP A;  3DNS A;  4CGO A;  2Q4Y A;  1VHS A;  4C7I A;  1N71 A;  3I9S A;  1S7L A;  2PR8 A;  5K8P A;  4R6T A;  2D4P A;  2PJ4 A;  2O28 A;  2QJ8 A;  1IIC A;  1YVO A;  2PJA A;  4UFX A;  2VQY A;  4NGQ A;  1NE9 A;  5K8M A;  3B8G A;  3H8G A;  1CP7 A;  4A2Z A;  3KAS A;  4BIN A;  4OC4 A;  1XF8 A;  2EBJ A;  2EUI A;  2XEJ A;  4XPD B;  3TX8 A;  3JTK A;  4C68 A;  3LMS A;  1YLE A;  3PFE A;  5G22 A;  5THW A;  2K5T A;  4F8Z A;  3D7D A;  3VH9 A;  1XFO A;  1F2O A;  4MY0 A;  2REF A;  2W2G A;  3CT9 A;  4C2Z A;  4F9U A;  5C82 A;  2G3T A;  2Q7S A;  2DPS A;  3RO0 A;  5FSZ A;  1GHE A;  1Z8X A;  3S9L A;  4P10 A;  4OC1 A;  5AG4 A;  1RXT A;  5EMI A;  3K9T A;  3FEE A;  4RUH A;  2V8D A;  3SJG A;  1HDU A;  2OZU A;  4R3L A;  3TOB A;  3FJU A;  5KTD A;  3EO4 A;  4IK2 A;  3GLJ A;  3H8E A;  4UCN A;  3WAB A;  1BPN A;  1RO5 A;  4XNH B;  3TO9 A;  4KOS A;  4UFW A;  4HNW B;  2ZW4 A;  2DPT A;  2Q4V A;  4NGM A;  2OU2 A;  4ONU A;  2P6E A;  3FX6 A;  4MCQ A;  2YNE A;  3PB4 X;  3KI9 A;  3JVN A;  2WPW A;  1F57 A;  1XRY A;  3BI1 A;  1Z5R A;  5JGF A;  1XOV A;  5E3B A;  1KUV A;  4ZBG A;  3SJE A;  2AE6 A;  3JUW A;  2HV2 A;  2AJ6 A;  3IIB A;  5HMN A;  2PE3 A;  1X12 A;  3PBB A;  4CAE A;  3B35 A;  5DWN A;  3DR6 A;  1AUG A;  1YX0 A;  2BO9 A;  3B2Y A;  3SXO A;  4KLW A;  3TC8 A;  4HKF A;  3BLN A;  4KYB A;  3EJG A;  2NMT A;  2FVG A;  2VBQ A;  1QSM A;  2QIR A;  2XEF A;  4KSI A;  1LCP A;  2RNK A;  3KZW A;  2CXA A;  3BJ8 A;  2PJ7 A;  2Q43 A;  1P4N A;  2Z3N A;  4WJB A;  5LYI A;  3R9G A;  5LRG A;  3CXP A;  3SI0 A;  4CYQ A;  4RN7 A;  1VHO A;  2C6P A;  2PR1 A;  2GLJ A;  3CZX A;  4PPZ A;  4UML A;  2ZW6 A;  3I3G A;  3EFA A;  5I0C A;  2Q04 A;  1ARM A;  3PEI A;  1K4J A;  2ZEO A;  2JBJ A;  1B87 A;  1R43 A;  4OIW A;  3S9N A;  1IID A;  3B3C A;  2JEW A;  3K9U A;  2BSW A;  1TXZ A;  3D66 A;  2REE A;  4JXQ A;  4KOR A;  4FD5 A;  4DNC A;  1BPM A;  4J4Z A;  2GLF A;  2PQ8 A;  3DSB A;  1YQE A;  2JBK A;  2P0W A;  1NSA A;  4A33 A;  2F7V A;  2GFQ A;  1Y0R A;  3GUX A;  5HVH A;  2B4D A;  5IB9 A;  3FH4 A;  3KQZ A;  4K0C A;  2C1C A;  4MHZ A;  4P4I A;  3TTH A;  2C6G A;  4XPD C;  3TE4 A;  2IQ6 A;  4AVC A;  2ABZ A;  3WR7 A;  4EME A;  4KOT A;  2EVN A;  3L2N A;  2PJC A;  4Q7A A;  3QAH A;  4A94 A;  4DUK A;  5HOL A;  5CB3 A;  4GXH A;  3IFE A;  4UIA A;  4AVA A;  1HEE A;  1XJO A;  4UFV A;  4ZX8 A;  5F46 A;  1NMT A;  2Z11 A;  3HLP A;  4GS4 A;  3GPO A;  3ISX A;  4MCS A;  4MFL A;  4CGL A;  2Q51 A;  2Z3P A;  3S6F A;  1OBR A;  5DS0 A;  3D2M A;  3KKW A;  2JDD A;  4KVM E;  4FD6 A;  3KHX A;  3PB6 X;  2WZN A;  2FAV A;  2G3A A;  3FBU A;  2GRE A;  2OOT A;  5J8F A;  1MJB A;  1KWM A;  3T8W A;  3W6X A;  1XMB A;  3FVL A;  3S9M A;  5FSX A;  1LRZ A;  2IL4 A;  2OZG A;  4MRI A;  5CB5 A;  3TCV A;  4M6I A;  4XNH C;  4CGN A;  4Z65 A;  3DDD A;  1BLL E;  4KUA A;  4HPS A;  3LOD A;  5E96 A;  1CPS A;  5K8N A;  4X8I A;  1YLO A;  2B5G A;  3KGQ A;  4P6Y A;  2B3V A;  5IV0 A;  3P2F A;  1TY8 A;  4UF4 A;  5D8N A;  2POK A;  5J8C A;  2BOA A;  2H5M A;  4JYW A;  4B5P B;  4MHD A;  4OP4 A;  2ZED A;  1I12 A;  2DXQ A;  2GU2 A;  2ZEE A;  2I3C A;  5G20 A;  3FMC A;  2WSA A;  3A9L A;  2V77 A;  4ORF A;  2JLM A;  3G8W A;  2CNS A;  3GY9 A;  2HQY A;  4KS9 A;  6CPA A;  3GKR A;  4X2T A;  4ABL A;  3SIG A;  1YR0 A;  4LX9 A;  3CPA A;  3B3W A;  4PXB A;  2WYR A;  4A38 A;  2YGW A;  4RI1 A;  4QUS A;  5AGE A;  5HH1 A;  4R3K A;  2R98 A;  1V0C A;  4JLL A;  1Y0Y A;  1VKC A;  1AMP A;  2EK9 A;  2Q4Z A;  4R87 A;  2VRI A;  3GQO A;  2CIJ A;  1L0C A;  2LGR A;  1WK4 A;  3SHP A;  2FE7 A;  2FSR A;  3NE7 A;  4UBR A;  1LOK A;  2ZEN A;  1TF8 A;  2NSM A;  4KZT A;  4UEF A;  4R9M A;  1RTQ A;  2ZEG A;  4YRH A;  1EE3 P;  2RFH A;  3F5B A;  5G1Z A;  1Z8L A;  3PB7 X;  1CPX A;  3H4Q A;  4L8A A;  3TO6 A;  1Y7E A;  3LD2 A;  4OC0 A;  4MCR A;  1PCA A;  2WCT A;  2B3U A;  5LRK A;  1Z2L A;  4MHP A;  3PZJ A;  1ZR3 A;  4ABK A;  1YSJ A;  5F47 A;  5AG5 A;  4CYO A;  5IB0 A;  3MN8 A;  2YND A;  2CNM A;  3FXT A;  2CNT A;  4OKO A;  2HUZ A;  2JEV A;  3EY5 A;  4W9Y A;  4B13 A;  3CDX A;  3IWG A;  4U9Y A;  3F8K A;  2AFM A;  3EWP A;  1TKH A;  3R1K A;  3PB8 X;  3D7H A;  4UCM A;  5H84 A;  4J5Q A;  2C27 A;  3GQE A;  4KUB A;  4EWT A;  1FNO A;  3KQX A;  1F2P A;  1R57 A;  2I79 A;  4MI4 A;  4IHM A;  4NJQ A;  4QBJ A;  2Z3L A;  4NGS A;  3R9E A;  3SXN A;  4BBH A;  2O53 A;  1IYL A;  4B12 A;  1HDQ A;  5JPH A;  4KVX A;  1TIQ A;  2EK8 A;  4K30 A;  5GCN A;  3Q6Z A;  5LYD A;  1Y7R A;  1ELL P;  4UEZ A;  4AVB A;  4CRZ B;  1QSN A;  2DX6 A;  3IID A;  4X5K A;  1BOB A;  4F0Y A;  2PVW A;  2DEA A;  3RZA A;  1PUA A;  3ISZ A;  5FSU A;  1M4D A;  4II9 A;  1JQG A;  1S7N A;  2ZEP A;  4G1P A;  2CTB A;  4R7M A;  4B6Z A;  4ZGY B;  4GUA A;  4J5S A;  5KTC A;  4MHN A;  3VAR A;  3KL9 A;  3GPG A;  2Y0M A;  3QAY A;  2FT0 A;  1ARL A;  2FCK A;  3B3T A;  2PCU A;  5FSV A;  2WUU A;  4P4F A;  3V8I A;  4YWY A;  1FY7 A;  3NH8 A;  4NGP A;  4U5Y A;  2FG1 A;  1H8L A;  2AFC A;  1CP6 A;  1VIX A;  1S7F A;  2VZZ A;  4JZ0 A;  4QC6 A;  4FAI A;  4ETK A;  1CX8 A;  2R7H A;  2AFO A;  5ELY A;  1NSL A;  5HIH A;  4UWI A;  5IX3 A;  1CBX A;  2Q7B A;  3HUV A;  5A28 A;  1XMT A;  1FT7 A;  1IU8 A;  3EWO A;  3DLJ A;  4X3R A;  3SIJ A;  1M4I A;  1R3N A;  1PYT B;  1Y9W A;  4ZY1 A;  2ZW5 A;  1QSR A;  4GM5 A;  2IJZ A;  4FWU A;  5EBV A;  4PXD A;  1M1D A;  2FXK A;  2V8V A;  1IYK A;  4M6G A;  3NH4 A;  2Z3M A;  4KOW A;  1IY7 A;  4P4D A;  1CJW A;  4KSF A;  3T9Y A;  2ACF A;  1ZLI A;  4MFQ A;  5LYL A;  1UFH A;  2XD7 A;  3GIU A;  4CAW A;  4J3G A;  4H6Z A;  5EC4 A;  2JDC A;  2X7B A;  2ZW7 A;  3EC4 A;  3QB8 A;  3W91 A;  4UWJ A;  4F9V A;  4JXR A;  5C88 A;  7CPA A;  3MGD A;  2FXF A;  3VAT A;  5ISV A;  1ZG9 A;  4B5O A;  1VGY A;  2Q44 A;  2Z10 A;  4FUU A;  4NGT A;  4BMH A;  2AFZ A;  1YRE A;  2I00 A;  3EJF A;  4UCP A;  3R95 A;  3SI2 A;  4E0A A;  5BWA B;  4PSW A;  4TU0 A;  1IOF A;  1S60 A;  2HB6 A;  2J9A A;  1Q7L A;  2FS5 A;  1MJA A;  2OB0 A;  2RB7 A;  1IB1 E;  2BEI A;  1NJR A;  3EXN A;  3FNC A;  4JD6 A;  4UEE A;  3WT4 A;  3N7Z A;  4B14 A;  5K8O A;  4IQY A;  1ZO0 A;  4NFR A;  4OC5 A;  2PJ1 A;  4UA3 A;  2OZH A;  4FD7 A;  2GE3 A;  1MK4 A;  4O23 A;  1A2Z A;  1TF9 A;  2OH1 A;  2PIZ A;  4ONW A;  4YFJ A;  3TFY A;  2L8R A;  2D4O A;  1M4G A;  4B11 A;  1CM0 A;  4A95 A;  3V7Z A;  2FIA A;  2PJ8 A;  5G21 A;  1X10 A;  4CAX A;  3EW5 A;  4ETJ A;  3IWW A;  4I49 A;  3BJ7 A;  4M3S A;  4YU9 A;  4OME A;  5KTA A;  3S6K A;  1Q2Y A;  3T90 A;  4CGP A;  4ZYQ A;  2VEZ A;  3S6G A;  1GYT A;  4MFK A;  3PP9 A;  4PQA A;  4PXE A;  2PIY A;  4KSA A;  4XPL A;  4IF5 A;  1KUX A;  3Q71 A;  3BI0 A;  4JJX A;  3B3V A;  3PB9 X;  2XEG A;  3V45 A;  3RBU A;  1QSO A;  1TXR A;  3IJ3 A;  2NYQ A;  4OC2 A;  4TNU A;  4NCZ A;  1XEB A;  3TT2 A;  4R76 A;  2ZOF A;  1TKJ A;  4OC3 A;  4PSX A;  3IU1 A;  5JM6 A;  5F48 A;  1ZR5 A;  4GVW A;  2AFS A;  2PRQ A;  2PVV A;  4YGO A;  5DWM A;  3I1U A;  3S6H A;  3EWQ A;  2PRB A;  4H6U A;  2V8H A;  4R57 A;  4E8O A;  1ZG8 A;  8CPA A;  2PJ0 A;  1XBU A;  2KQV A;  3JRU A;  1LFW A;  3BHX A;  1KUY A;  4M85 A;  4CRY B;  4KOX A;  4K3N A;  3GB0 A;  1Z9U A;  4KOY A;  4JGK A;  3C26 A;  4MXU A;  2DF5 A;  2ZPA A;  1VHE A;  1YW4 A;  2PJ3 A;  4UIB A;  3JZT A;  3PFO A;  5D29 A;  3SIH A;  1YGH A;  3GPQ A;  4AG9 A;  4CAV A;  4DJL A;  4HNX B;  3R96 A;  2BCO A;  4CAF A;  2A4N A;  5FSY A;  4CYN A;  3WC5 A;  2BUE A;  3IC1 A;  5CBM A;  2VL1 A;  4OAD A;  4WWV A;  3ZZI A;  5HVG A;  3PBE A;  1J4J A;  3NH5 A;  1QMU A;  4P4E A;  3FIX A;  3W6S A;  5HVF A;  4A39 A;  4B5P A;  2BL1 A;  3WC7 A;  2ZEL A;  3FB3 A;  1I1D A;  4FD4 A;  3D67 A;  3FRM A;  2CF4 A;  2Z3K A;  2PJ6 A;  4CYP A;  4C2Y A;  3IO1 A;  5J1Q A;  2CY2 A;  3QNV A;  3FEC A;  3IGR A;  4QB9 A;  4NGR A;  3H5Z A;  1MJ9 A;  1Z4E A;  2VXK A;  2YNC C;  1XE4 A;  4KOV A;  3LAC A;  3LWU A;  3ETI A;  1Z8T A;  3VWD A;  4PV6 A;  2F8H A;  3DR8 A;  3MRU A;  1HJZ A;  1S3Z A;  4Q36 A;  5CPA A;  4A31 A;  4CPA A;  2GIV A;  4MFJ A;  4MFP A;  4LQG A;  5A27 A;  2B58 A;  3CXQ A;  5LRJ A;  2R1I A;  3VWE A;  1U6M A;  2PDO A;  2ATR A;  2P6G A;  4MFZ A;  1WWZ A;  3NE8 A;  3D68 A;  4OID A;  4MMO A;  4Y49 B;  1LAP A;  2BFR A;  1YW6 A;  5AG7 A;  3H8F A;  5LYF A;  1DE4 C;  4PK2 A;  4CGM A;  2EO8 A;  2AFU A;  4U9Z A;  3IIF A;  1ZG7 A;  2HC9 A;  4M6H A;  4A32 A;  5I4M A;  2Z0Z A;  3EKE A;  4P4B A;  2RC4 A;  3OWC A;  4GVV A;  1P0H A;  2B4D B;  4IUS A;  3DGV A;  4IAV A;  4JLY A;  5F09 A;  2B4B A;  3EWR A;  4ESS A;  4KVO E;  2O4H A;  2QYV A;  3FED A;  1VHU A;  1Q2C A;  2PJ2 A;  3D4U A;  3TOA A;  2P6F A;  1ELM P;  1CG2 A;  4P45 A;  2QEC A;  2JZF A;  1IOI A;  3SII A;  4AXV A;  1YD9 A;  1M4L A;  3CPX A;  1S5K A;  4HNY B;  1PU9 A;  2ARH A;  2ZOG A;  2AFX A;  3F0A A;  4H89 A;  4LQ6 A;  2KCW A;  4J5R A;  2OR4 A;  1QST A;  3FYN A;  1BO4 A;  2PJ9 A;  5CNP A;  2R8V A;  4QVT A;  4JCA A; 
#chains in the Genus database with same CATH homology
 2V8G A;  3VFQ A;  3B3S A;  4EFD A;  4DYO A;  3BXM A;  4BD9 A;  4ZY0 A;  1AYE A;  1LAN A;  4D86 A;  3RAM A;  1TKF A;  3IEH A;  2PJB A;  4MCP A;  1QQ9 A;  2XEI A;  4A37 A;  4FBE A;  2BFQ A;  4JVV A;  2ANP A;  3D7G A;  3FF3 A;  3SJF A;  3NA6 A;  1ZLH A;  3D7F A;  2EEE A;  1LAM A;  4ZX9 A;  3SI1 A;  4NGN A;  3NFZ A;  4NJR A;  2ZEF A;  2X47 A;  5DUS A;  5JH9 A;  4P44 A;  3WC6 A;  3N5F A;  3PRT A;  3V2B A;  3KR5 A;  4R8F A;  1IGB A;  2QVP A;  2C6C A;  2ZEM A;  3KHZ A;  2IMO A;  3K2K A;  1UWY A;  2AFW A;  2CTC A;  5AIL A;  4MHY A;  2G9D A;  4TWE A;  4ZI6 A;  2PJ5 A;  2EWB A;  4P4J A;  1YME A;  1SPV A;  4ZY2 A;  2ZEH A;  3B7I A;  3V38 A;  4PXC A;  5CMS A;  3SJX A;  4H2K A;  5HXD A;  1BAV A;  1DTD A;  3KR4 A;  5K8P A;  4R6T A;  2PJ4 A;  2QJ8 A;  2PJA A;  4NGQ A;  5K8M A;  3H8G A;  1CP7 A;  3KAS A;  4OC4 A;  2XEJ A;  3TX8 A;  3LMS A;  5THW A;  4F8Z A;  3D7D A;  3VH9 A;  1XFO A;  1F2O A;  3CT9 A;  4F9U A;  5FSZ A;  3S9L A;  4P10 A;  4OC1 A;  3K9T A;  3FEE A;  4RUH A;  2V8D A;  3SJG A;  1HDU A;  3FJU A;  4IK2 A;  3GLJ A;  3H8E A;  3WAB A;  1BPN A;  4NGM A;  3FX6 A;  4MCQ A;  3PB4 X;  3KI9 A;  1F57 A;  1XRY A;  3BI1 A;  1Z5R A;  5JGF A;  5E3B A;  3SJE A;  3IIB A;  2PE3 A;  3PBB A;  3B35 A;  2BO9 A;  3B2Y A;  3TC8 A;  4KYB A;  3EJG A;  2FVG A;  2XEF A;  4KSI A;  1LCP A;  3KZW A;  4WJB A;  2PJ7 A;  2Q43 A;  5LYI A;  5LRG A;  3SI0 A;  1VHO A;  2C6P A;  2GLJ A;  4PPZ A;  4UML A;  1ARM A;  3PEI A;  2ZEO A;  2JBJ A;  1R43 A;  4OIW A;  3S9N A;  3B3C A;  2JEW A;  1TXZ A;  3D66 A;  1BPM A;  4J4Z A;  2GLF A;  2JBK A;  1NSA A;  2F7V A;  5IB9 A;  1Y0R A;  3GUX A;  3FH4 A;  3KQZ A;  4K0C A;  2C1C A;  4MHZ A;  4P4I A;  2C6G A;  2IQ6 A;  2ABZ A;  4EME A;  3L2N A;  2PJC A;  4Q7A A;  4A94 A;  4DUK A;  5HOL A;  5CB3 A;  3IFE A;  4UIA A;  1HEE A;  1XJO A;  4ZX8 A;  3HLP A;  3GPO A;  3ISX A;  4MCS A;  2Q51 A;  1OBR A;  5DS0 A;  3KHX A;  3PB6 X;  2WZN A;  2FAV A;  2GRE A;  2OOT A;  1KWM A;  3T8W A;  1XMB A;  3FVL A;  3S9M A;  5FSX A;  4MRI A;  4Z65 A;  5CB5 A;  1BLL E;  1CPS A;  5K8N A;  4X8I A;  1YLO A;  3KGQ A;  4P6Y A;  1TY8 A;  4UF4 A;  5D8N A;  2POK A;  2BOA A;  4JYW A;  4OP4 A;  2ZED A;  2GU2 A;  2ZEE A;  2I3C A;  3FMC A;  2V77 A;  6CPA A;  4X2T A;  4ABL A;  3SIG A;  3CPA A;  3B3W A;  4PXB A;  2WYR A;  4A38 A;  4JLL A;  1Y0Y A;  1AMP A;  2EK9 A;  2Q4Z A;  2VRI A;  3GQO A;  2CIJ A;  2LGR A;  1LOK A;  2ZEN A;  1TF8 A;  2NSM A;  4UEF A;  1RTQ A;  2ZEG A;  1EE3 P;  2RFH A;  1Z8L A;  3PB7 X;  1CPX A;  1Y7E A;  4OC0 A;  4MCR A;  1PCA A;  5LRK A;  1Z2L A;  4MHP A;  1ZR3 A;  4ABK A;  1YSJ A;  3MN8 A;  4OKO A;  4W9Y A;  3CDX A;  2AFM A;  3EWP A;  1TKH A;  3PB8 X;  3D7H A;  4J5Q A;  4EWT A;  3GQE A;  1FNO A;  3KQX A;  1F2P A;  4IHM A;  4NJQ A;  4NGS A;  2O53 A;  1HDQ A;  2EK8 A;  3Q6Z A;  5LYD A;  1ELL P;  4UEZ A;  2DX6 A;  3IID A;  2PVW A;  2DEA A;  3RZA A;  3ISZ A;  5FSU A;  1JQG A;  2ZEP A;  4G1P A;  4B6Z A;  2CTB A;  4R7M A;  4GUA A;  4J5S A;  4MHN A;  3VAR A;  3KL9 A;  3GPG A;  1ARL A;  3B3T A;  2PCU A;  5FSV A;  4P4F A;  4YWY A;  3NH8 A;  4NGP A;  2FG1 A;  1H8L A;  2AFC A;  1CP6 A;  1VIX A;  4JZ0 A;  4FAI A;  4ETK A;  1CX8 A;  2AFO A;  5ELY A;  5HIH A;  1CBX A;  3HUV A;  1FT7 A;  3EWO A;  3DLJ A;  4X3R A;  3SIJ A;  1R3N A;  4GM5 A;  1PYT B;  4ZY1 A;  2IJZ A;  4FWU A;  4PXD A;  2FXK A;  2V8V A;  3NH4 A;  1IY7 A;  4P4D A;  5LYL A;  2ACF A;  1ZLI A;  2XD7 A;  4F9V A;  7CPA A;  3VAT A;  1ZG9 A;  1VGY A;  4FUU A;  4NGT A;  2AFZ A;  3EJF A;  3SI2 A;  4TU0 A;  2HB6 A;  3PFE A;  2J9A A;  1Q7L A;  2RB7 A;  3WT4 A;  1NJR A;  5K8O A;  4UEE A;  4IQY A;  4NFR A;  4OC5 A;  2PJ1 A;  4O23 A;  2PIZ A;  1TF9 A;  4ONW A;  2L8R A;  3V7Z A;  2PJ8 A;  3EW5 A;  4ETJ A;  3IWW A;  4YU9 A;  4OME A;  4ZYQ A;  1GYT A;  4PQA A;  4PXE A;  2PIY A;  3Q71 A;  3BI0 A;  3B3V A;  3PB9 X;  2XEG A;  3V45 A;  3RBU A;  1TXR A;  3IJ3 A;  2NYQ A;  4OC2 A;  4TNU A;  4R76 A;  2ZOF A;  1TKJ A;  4OC3 A;  5JM6 A;  1ZR5 A;  4GVW A;  2AFS A;  2PRQ A;  2PVV A;  3I1U A;  3EWQ A;  2V8H A;  1ZG8 A;  8CPA A;  2PJ0 A;  1XBU A;  1LFW A;  3JRU A;  3BHX A;  4K3N A;  3GB0 A;  4JGK A;  4MXU A;  1VHE A;  1YW4 A;  2PJ3 A;  4UIB A;  3JZT A;  3PFO A;  5D29 A;  3SIH A;  4DJL A;  3GPQ A;  2BCO A;  5FSY A;  3WC5 A;  3IC1 A;  4WWV A;  5CBM A;  2VL1 A;  5HVG A;  3PBE A;  3NH5 A;  1QMU A;  4P4E A;  5HVF A;  4A39 A;  3WC7 A;  2ZEL A;  3D67 A;  2CF4 A;  2PJ6 A;  3IO1 A;  5J1Q A;  3QNV A;  3FEC A;  4NGR A;  3LWU A;  3ETI A;  2F8H A;  3MRU A;  5CPA A;  1HJZ A;  4CPA A;  4LQG A;  5LRJ A;  4OID A;  3D68 A;  4MMO A;  1LAP A;  2BFR A;  1YW6 A;  5LYF A;  3H8F A;  1DE4 C;  2AFU A;  3IIF A;  1ZG7 A;  2HC9 A;  5I4M A;  3EKE A;  4P4B A;  5HVH A;  4GVV A;  3DGV A;  4IAV A;  5F09 A;  3EWR A;  4ESS A;  2O4H A;  2QYV A;  3FED A;  1VHU A;  2PJ2 A;  3D4U A;  1ELM P;  1CG2 A;  4P45 A;  3SII A;  4AXV A;  1YD9 A;  1M4L A;  3CPX A;  2ZOG A;  2AFX A;  4J5R A;  2OR4 A;  2PJ9 A;  4JCA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...