2J9HA

Crystal structure of human glutathione-s-transferase p1-1 cys-free mutant in complex with s-hexylglutathione at 2.4 a resolution
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
209
structure length
209
Chain Sequence
PPYTVVYFPVRGRSAALRMLLADQGQSWKEEVVTVETWQEGSLKASALYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRAKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGSLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTATHIONE S-TRANSFERASE P
publication title Modulating Catalytic Activity by Unnatural Amino Acid Residues in a Gsh-Binding Loop of Gst P1-1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 70
structure length 209
sequence length 209
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2006-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 2j9hA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2j9hA01
4K0NA 3IDVA 3PINA 1KBNA 1V2AA 3ZREA 3DKSA 3KH7A 2GGTA 4I2UA 3TGZA 3TJFA 1BX9A 3IC4A 5L71A 1PKZA 2DC5A 2R2JA 1FVKA 3Q6OA 3O3TA 1XW9A 2B5EA 1TRWA 1TRSA 5ABRA 4O5RA 3GSSA 1X9WB 4HOJA 3P2AA 2FNOA 4DSRA 22GSA 2BTOT 5D93A 1PL2A 4KSOA 2R37A 1X5DA 3IE3A 4WKWA 3NZNA 2H0IA 1YJ6A 4POBA 5CYYA 1A0RP 4MMMA 4KCAA 2YWNA 2CZ2A 1SD9A 5IOWA 1IYIA 4BPYA 1TXXA 1V9WA 1XCCA 1ACVA 3GMFA 2GTUA 1PA3A 1MD3A 2OE0A 4PUFC 2YWIA 3APQA 4OFTA 4J56E 4PXOA 1A8LA 2B5XA 2CX3A 3UOMA 2YZUA 4JRRA 2GQLA 2MMOA 4KB3A 4AJ6A 2REMA 3VWUA 4MZBA 1ZOFA 3IAM2 2IWTA 1GWCA 2H75A 1N2AA 4TR3A 1PGTA 2C0EA 2DJ3A 3EMPA 2HQTA 1FVJA 3LSZA 5AN1A 3F6DA 2CX4A 4NMUA 1Z5YE 10GSA 3HJMA 2EIOA 3A5WA 2XBQA 3C7MA 1SL2B 5FWGA 2B1KA 4MJAA 1A24A 5ECHB 2WJUA 5GSSA 2YZHA 2VUPA 1TDIA 1A2JA 2E2GA 3DIEA 3HVSA 5ECQB 5CRDA 1EV9A 2H71A 2IN3A 5IPHA 3KH9A 2C0FA 3GKMA 2FUG2 4K7NA 2D2ZA 5ID2A 2NBSA 4XRAA 2L4QA 5HQPA 1TU7A 1QQ2A 5LNKe 3SBCA 5G5EA 4ZXGA 3U5RE 4MJEA 3F63A 5HR1A 1NHOA 1GUMA 5KN2A 4EVMA 3CBUA 2GSSA 3QMXA 1YKCA 1U3AA 2RM6A 4ML6A 3CYNA 4XS1A 1XWGA 3Q74A 3KIJA 4F9ZA 1TK8B 4GLTA 2IIYA 1MTCA 2HZEB 2N5AA 4PTSA 2IJYA 4BVXB 3M9KA 1TKDB 3LFLA 1S3AA 5D9XA 2GVPA 5H5RA 1FHEA 2HRNA 4NV2A 3GN3A 4ILFA 1EEMA 4I5QA 4OFNA 2HZFA 2HSNB 3WT2A 3CRTA 2V6OA 1VF1A 1Q98A 2XHFA 2R5GA 2H1AA 1OE8A 4RI7A 3UL3A 3HJOA 4KDUA 1HD2A 3TOTA 2GT6A 1FAAA 2V41A 2X8GA 3F9UA 3FHKA 4Q5QA 2BMXA 2L6DA 4F82A 1O6JA 4HUAA 2LUSA 5EVOA 5F07A 4ECJA 1AC1A 1PL1A 4JR6A 3R2QA 5IMDA 4QL9A 2CVBA 1EWXA 1URMA 4P3YB 1M0UA 4KUNA 1ERTA 3BCKA 1A8YA 2CQ9A 1HYUA 1GLQA 5IM9A 1VGLA 2L57A 3ZL5A 3IK9A 4IQAA 1V57A 3CTGA 2BJXA 5ECOB 1KEBA 4LLRA 1M9AA 3F4TA 4ISDA 2M80A 16GSA 3EVIA 5HR3A 2A2RA 1S3DA 3QCPA 4KA0A 1YEXA 3GL3A 3MDKA 4TXOA 3VI7A 1V98A 3VPQA 3ZVJA 1EP7A 3UVHA 5F05A 4K9ZA 3DRNA 3F3QA 2C1YA 3TJKA 3FK8A 2H1BA 5DAKB 2HRFA 2FWFA 1WOUA 3D4MA 4V1Ag 2IL3A 1SK0A 3GTUA 4NHZA 4MP4A 2CT6A 2FHEA 2L5OA 2PVOC 1SKSB 1JZOA 5G2ZA 2HFDA 3JCML 1GSUA 4N11A 5AIVA 1WRYA 4OCEA 1R7HA 3IR4A 1O73A 4MF5A 2YANA 1ZMAA 5F0GA 2UZ8A 4GXZA 4ZILA 5DVBA 1T3BA 4DSSA 1USBA 5IOXA 2R4VA 3EU3A 1M7TA 1QUWA 1K0MA 1F3BA 1XWKA 1IYHA 2V6KA 2KOKA 5D8IA 3LG6A 1EOGA 3H79A 3WYWA 2LKUA 1ZL9A 13GSA 4GWRA 4ECIA 2H74A 1ZZYA 1X0RA 1TTZA 2JU5A 1OAZA 12GSA 3DEXA 1VF2A 2EC4A 2FWHA 5G1LA 1GSEA 5A4VA 2V32A 3UIWA 1R4WA 3ZLPA 1HNCA 3VURA 1FW1A 1PRXA 3Q19A 4WBJA 2O87A 4FYUA 2AB6A 1SL1B 2K9FA 3LORA 3EYTA 4MZCA 2FGXA 3TJJA 4IGJA 17GSA 4IN0A 1SKRB 3APSA 2OBKA 1XPVA 4HDEA 3ZIVA 4RI6A 1CQHA 4KGIA 3ME8A 2DLXA 4KSMA 4OO4A 5DALB 3GH6A 5HFKA 2ES7A 6GSSA 1GH2A 1Q4JA 4PNGA 1OVNA 6GSWA 3QPMA 1X5EA 3EWLA 2F51A 4EC0A 4L0WA 3UBLA 4BA7A 2JSYA 1G7EA 1V58A 4KH7A 1JZDA 1M99A 4V2MA 4MDCA 2OBIA 3RPNA 1SYRA 3VK9A 4WETA 3UARA 18GSA 1DE1A 3PPUA 2N5BA 1X9MB 19GSA 2JZRA 4MK3A 2VO4A 1WPIA 4OD7A 2PWJA 1RQMA 4LMVA 2PU9C 2DMMA 4IKHA 1TK0B 3IAS2 3W8SA 3V1WA 4I97A 2KUCA 1C72A 2WB9A 4TR1A 5CRWA 1XVWA 3FZ5A 1K3YA 4GSSA 2WS2A 5IO0A 4N10A 4BL7B 3KD0A 5ECPB 3L4NA 5HFGA 3CSIA 3TJBA 4N0VA 1SJIA 2GS3A 2JACA 4J2FA 3F6FA 5J9BA 2HYXA 4YH2A 3UMAA 4FQUA 4IBPA 5C04A 1E2YA 2K18A 1GNWA 2OE1A 5DQSA 2GSTA 1GNEA 5D96A 2O8VB 1B4QA 3DMLA 1J0FA 1XXUA 2B3SA 1E6BA 4O7HA 1T7PB 4LL4B 2VM1A 2HSYA 2HSMB 1THXA 4G19A 1B9XC 1XW5A 1WJKA 2C0DA 3GNJA 2B1LA 3EC3A 4LA1A 1YDKA 3QFBC 1THOA 3FZ9A 2WDUA 2DIZA 5F8BA 3M9JA 5H5SA 5ELAA 4YQUA 4DSQA 2X8HA 1J08A 5GAND 4G2EA 2P5QA 5JWQB 3LGCA 4F2IA 4D73A 3GFKA 1LBKA 4MCUA 1M2AA 5EPFA 1OKTA 3KGKA 2V1MA 3A3TA 3ZFBA 2VL2A 5J41A 4CW9A 2ZCTA 1JZWA 1XZOA 2AUVA 2HRKA 3LXZA 1OC9A 3ERGA 4TRXA 4V2NA 2MYGA 2VAFA 3O76A 3BBYA 2AAWA 4E8HA 2DJKA 6GSXA 4ECBA 1TK5B 3HJPA 4MJBA 1AIUA 2WULA 2H19A 4POLA 11GSA 3J7Yk 4POMA 3VWWA 4PQIA 1DUGA 1TW9A 1G6YA 4WR5A 4PX1A 4EUYA 1UA5A 2OACA 2GZZA 5COHA 1HNAA 1U87A 3EE2A 5BMUA 2TRCP 2I1UA 3KM6A 2I81A 5D73A 1DE2A 2OJLA 1NM3A 4Q5RA 4ZBBA 3ZITA 2M46A 1AUCA 3EMXA 1F3AA 2H6ZA 4F03A 1R5AA 2IMIA 4G0IA 1JLWA 2C3QA 1T00A 4WBRD 5KEJA 2QKEA 2VCWA 4MA9A 2YOIA 5AGYA 2A4VA 2E7PA 2JL4A 4PUAA 2H6YA 1K3LA 1GSSA 4MZWA 2YP6A 4TOPA 1U3IA 2MBTA 1I9DA 4G0LA 1Z9HA 3N5OA 2TIRA 3D5JA 3WGDA 2H8LA 4HU9A 3DD3A 1GSQA 5B6MA 3TOUA 2VM2A 1XW6A 2AV4A 2FWEA 3APOA 3WD6A 3HA9A 2RIIA 3F8UA 3RAZA 1K0NA 1T4YA 4DEJA 4E8EA 1YY7A 1TRUA 1Z3EA 2B7JA 2FD3A 4ZB8A 2KP2A 3J7Yb 3TB2A 1GSFA 1OYJA 3L78A 2YV9A 2VL9A 3QAGA 5ELGA 4X43A 3A2VA 4PURA 4K6XA 3TRQA 4KDXA 3LYPA 3VWVA 1T8EB 5LCZA 1OE7A 3SWLA 2ALBA 1SK2A 2LNTA 4EO3A 5F06A 1F6MC 1GTUA 2PMTA 2AHEA 2IFQA 3GURA 3C1RA 1WIKA 2IMDA 4KCEA 3VI5A 3VWXA 3R3EA 3EU4A 4YQVA 1WE0A 1K3OA 4KE3A 1PD21 1AAZA 3RPPA 2M72A 2PERA 4Q5NA 2K8SA 5D9WA 3H4KA 1ERUA 1Y25A 4MF7A 3ZFLA 1EOHA 5B7CA 1Z6NA 2RM5A 2A2SA 1QGVA 4IVFA 2X8CA 4HZ2A 3KCMA 2LJRA 3KMOA 3IA1A 3K8NA 1BYEA 5JWOB 1FO5A 1XWBA 2VCTA 2O7KA 3I6AA 5DJMA 4MPGA 4XS6A 5ID2B 5ECKB 2CVDA 4KDYA 2CV4A 3TKRA 2YJ7A 4BVYA 1PMTA 1GLPA 1KTEA 4IQ1A 3EINA 3C71A 3FEUA 4XTSA 3TKSE 3S9FA 3Q18A 4L8EA 4RUVA 4MLYA 3UVTA 2RUEA 2JSZA 3MSZA 5DBQA 2WZ9A 4IW9A 3RBTA 1ZGNA 2R6KA 4JR4A 2F8AA 3DVXA 2WRTA 4HQZA 1VF3A 3QDNA 3IOSA 2H70A 2DSAA 2LEGA 2H66A 3FKFA 2LRTA 2H1DA 2L6CA 1F37A 4HU7A 3TKQA 2VCXA 2H73A 3CTFA 3ZIJA 1PX7A 4EDYA 3BJ5A 3G7IA 1ZCPA 4F0CA 5HR0A 1X5CA 5CREA 3TUEA 4CDOA 1XOBA 2HE3A 3RHBA 3ZRDA 5DCHA 1WWJA 1EEJA 4HI7A 1GULA 3MNGA 3GHAA 2WFCA 2LV3A 2QSIA 1BQ7A 5JCGA 3UAPA 2HSHA 3LQ7A 5D9TA 2YN1A 1GUKA 1SK1A 1GUHA 3CRUA 2FA8A 2VL3A 4I6XA 3NOFA 1EP8A 2FY6A 3IV4A 3IBHA 3F0IA 3C8EA 3FZAA 1MEKA 4PGTA 4BWSA 3ISOA 4FYCA 3C73A 6GSUA 3KJYA 3GKKA 2O85A 3IK7A 1TP9A 3HCZA 2LRNA 5C00A 4XS4A 4MPFA 3MWHA 4MH3A 2CVKA 3VLNA 4ZBAA 4KF9A 4IHUA 2I3YA 1UVZA 2J23A 3QFAC 3PH9A 2VOCA 3RDWA 4X0XA 5J5NA 5HR2A 3IHQA 4EXJA 2RUFA 2J9HA 4TXOB 4V1Ap 4IJIA 1HQOA 4RQRA 2GDRA 5KN0A 1G0TA 2VCQA 2DIYA 3L0HA 3DVWA 1VF4A 3G7YA 2X64A 1YKAA 2KLXA 1MD4A 3TRPA 2ZUPA 3CSJA 3M8NA 2YNXA 2TRXA 4OO5A 3GTUB 2DJ1A 3N9JA 5INYA 2Z9SA 3HDCA 4O92A 1GSDA 1OC3A 2LRCA 1PX6A 2P5RA 1M2DA 2PGTA 2E2MA 2LJKA 3US3A 5ECMB 4GSNA 2NPBA 2RLIA 4DSSB 2HLSA 3P8WA 3NIVA 2PUKC 1AQWA 3TKSC 1V40A 3A2WA 4J57E 3KP9A 3E9JB 4JBBA 5IO2A 5A5KA 4NWYA 4N30A 3H8QA 1PKWA 4GQCA 1G7OA 1NSWA 1O81A 4K1FA 1GRXA 2GT5A 2H72A 2FA4A 5B6NA 3D4TA 3UEMA 5E59A 1A2MA 1CQGA 4MF6A 4ML1A 1N8JA 2FWGA 1B48A 3FR3A 5ECSA 3ZYWA 2LNSA 2DBCA 4XHMA 2JADA 5ENUA 1XIYA 4K7IA 2YWMA 1G6WA 1O8XA 4O32A 5B8BA 2QC7A 1DSBA 1OKDA 1XVQA 2X99A 2L4CA 2NDOA 1ABAA 5ECNB 3GX0A 1ST9A 5IMFA 1Z7PA 4IP6A 2NTOA 4AJ8A 4JZQA 2LQQA 4Z7XA 2MZCA 4ACSA 3KMNA 3HD5A 1TRVA 5IIZA 4AF2A 1M9BA 3GKXA 2VD1A 1K0DA 5ECRB 1W89A 3A2XA 1AQXA 1A0FA 2VLTA 3WGEA 5KN1A 3DYRA 3GA4A 1TOFA 1XWAA 3TCOA 3D21A 20GSA 1O85A 1ML6A 2ZNMA 1DBYA 1UC7A 2JZTA 3GH9A 5IQYA 4TKYA 3HY2A 4ECCA 2ON5A 3KTBA 2HNLA 3IPZA 1ZYEA 1AW9A 2HZEA 1K0AA 4BVXA 4TR4A 3M0FA 1ERWA 3GYKA 3G9BA 2KHPA 3TKSA 2OKAA 5AISA 1LJRA 2H76A 1O7UA 2VIMA 2H0HA 1GP1A 2C4JA 4G9HA 3AY8A 2VCZA 4TR1B 2WGRA 1R5PA 1SU9A 1MDKA 3GL5A 2JZSA 5IMZA 3MAKA 4YAPA 5B8AA 1ZYQB 2C8UA 3IRAA 3ERFA 4XCSA 1S3CA 1NW2A 2H01A 1PQNA 4EF0A 1XWCA 3G7JA 4NAXA 1MDJA 1AXDA 1XFLA 5D9VA 1SD8A 3QOUA 3ME7A 3ZTLA 3HVXA 5DJLA 5CNWA 6GSVA 4X1UA 1SENA 4AGSA 2O89A 1EV4A 3HHVA 2I4AA 3DWVA 4FO5A 2IPAA 4IELA 3BD2A 3ZMLA 4OCFA 5GSTA 4WF4A 2CZ3A 4AJ7A 4N0ZA 5DQYA 3HVVA 6GSTA 8GSSA 2GZPA 2GSQA 2L59A 4TW5A 1GTBA 2DJ0A 3P7XA 3D6IA 4PQ1A 3PGTA 3IC8A 4WF5A 2IMEA 5J9CA 4D73B 1K0BA 4ZBDA 4QQ7A 5DDLA 3L9SA 1JHBA 4NPBA 4G10A 1GTIA 1QK8A 3I9V2 4L0UA 2DJ2A 1ON4A 5CRGA 2HRKB 2XBIA 1OC9B 4TXVA 3C1SA 1TI3A 5DAKA 3WT1A 3CMIA 1EGRA 4GQFA 3H93A 2GZYA 4Q5FA 3HZ4A 1RK4A 4HS1A 3H1NA 4HQSA 2ON7A 2YJHA 2C80A 3F4SA 2C3NA 4TN8A 1FG4A 3W6GA 2H30A 2B5YA 2VLUA 2VCVA 3WGXA 5FHIA 3GX8A 4HZ4A 4H86A 2LQOA 2KP1A 1R26A 2F9SA 4V2LA 3LXTA 5G5FA 5A4WA 3KZQA 5GAPD 5IMVA 4OMVA 4MABA 3GSTA 5FT3A 1YQ1A 3ZVJD 2LTKA 4XRDA 4ULXA 3FY7A 2OA7A 3LEFA 2B6MA 4LL1B 4K2DA 4HJ2A 3GUSA 1BAYA 3F4RA 4JU5A 4KNDA 3W8JA 3QD9A 4IP1A 1AQVA 1UN2A 2CAQA 3KP8A 2R3XA 5ECLB 2P0GA 3QAVA 1TJDA 2C0GA 1ERVA 2G2QA 1K0OA 4ZIJA 2YV7A 5J4UA 1EZKA 1A23A 1VRSD 4GTUA 5G31A 2DJJA 5G30A 4YQMA 5E4WA 4I8BA 2HRAA 1F2EA 1W4VA 3TKPA 5J3RA 1U88A 1B4PA 1YF1A 4KW6A 4GRFA 4ZB6A 3IXRA 3HYPA 3UBKA 1EGOA 4TVEA 4OWYA 1KNGA 1TU8A 3QR6A 2XPDA 3D0ZA 2PPTA 2HXKA 4GSTA 3GRXA 5H5QA 4USSA 1A2LA 14GSA 2MMZA 3BCIA 4I2TA 2LS5A 3E0UA 5DALA 1FB6A 4G0KA 4L5OA 3EURA 3GIXA 2OE3A 4ZL9A 1SYXA 2F3MA 2GLRA 3FR9A 2IMFA 2L5LA 2EIQA 4ZL8A 1NHYA 2HI7A 1BG5A 4WR4A 4MH2A 3TDGA 4EKZA 1JZRA 4K8MA 2GSRA 5HFIA 4KX4A 1BJXA 5EY6A 4K7OA 2LJAA 2CA8A 1O8WA 1FB0A 4MJCA 4TR0A 1I5GA 3DGQA 5CP1A 4EE0A 3O6TA 3BOAA 2LSTA 3LWAA 4NHWA 3FRCA 2IFQB 3TRXA 1J9BA 2MBSA 2XC2A 3L9VA 5CRHA 5ECIB 2V2GA 2FCHA 1K0CA 1HNBA 5IMCA 2XPEA 4PQHA 4NV5A 4BWQA 2C3TA 2P31A 1Z6MA 5JCWA 5AIXA 4PNFA 3UJ1A 3FZ4A 4ID0A 1WMJA 4HJMA 1M2BA 4EL1A 1QMVA 4BL7A 3F3RA 5KN3A 3HZ8A 4WXTA 2H0GA 2AJQB 5IPGA 4GF0A 4JE1A 3KXOA 4CHSA 2YCDA 3FR6A 3D22A 3ZZXA 5IMAA 1YZXA 5LD0A 2WCIA 3P90A 1H75A 1SJ6A 1YF0A 4BVYB 4F0BA 1B8XA 4WEYA 1ILOA 3E3EA 3ED3A 2HSMA 3HKRA 4L5LA 3KEBA 5CO3A 3GV1A 2PN8A 4NXIA 2MMAA 5JCUA 3ERWA 2DMLA 5G1KA 5EL8A 4HEA2 2GQMA 1GTAA 3L9UA 3M1GA 1X9SB 2GQKA 4GCIA 2F8FA 3CSHA 3HXSA 3M3MA 1OC8A 1GSYA 4IJ3A 1TI1A 1SJZA 3VPTA 1YEPA 5CAXA 1JFUA 1F9MA 1T1VA 5GZZB 1T4ZA 1Y6EA 5DCGA 2OADA 2MMNA 2VL2C 3DXBA 4LMWA 3LJRA 2H1GA 2K6VA 4JEDA 1RW1A 3RHCA 9GSSA 3I69A 3I43A 2CAIA 2G0FA 4FYBA 1PSQA 3PR8A 2B7KA 3U6VA 1LU4A 4KAEA 1PN9A 4QL7A 2NVLA 3ZMKA 7GSSA 2EIRA 4IS0A 1B9YC 1U6TA 1XOAA 2N5FA 4POKA 1JLVA 1BEDA 3OR5A 2AYTA 3FW2A 4OFMA 2IMKA 1Z7RA 4FH8A 4ZB9A 1H4OA 2I9HA 2PBJA 1QFNA 1XBSA 4EDZA 2VD0A 2FLSA 2K8VA 2QGVA 1WP0A 1SL0B 4XS4B 1FOVA 2YPMA 5A4UA 2E0QA 4XIHA 3VFIA 2PVQA 2VLVA 4RQXA 3QAWA 2YWOA 1SKWB 3TJGA 2HT9A 4YAVA 3KTLA 4FIWA 1GL8A 3GKNA 3LYKA 4K0GA 3FYGA 5JWRB 4DVCA 6GSYA 2H6XA 4ZL7A 1QXHA 3CXGA 1MDIA
chains in the Genus database with same CATH superfamily
4K0NA 3IDVA 3PINA 1KBNA 1M3JA 1V2AA 3ZREA 3DKSA 3KH7A 2GGTA 4I2UA 3TGZA 3TJFA 1BX9A 3IC4A 5L71A 1PKZA 2DC5A 2WW0A 2R2JA 1FVKA 3Q6OA 3O3TA 1XW9A 2B5EA 1TRWA 1TRSA 5ABRA 4O5RA 4Z2TA 3GSSA 1X9WB 4HOJA 3P2AA 2FNOA 4DSRA 22GSA 2BTOT 5D93A 1PL2A 4KSOA 2R37A 1X5DA 3IE3A 4WKWA 3NZNA 2H0IA 1S4BP 1YJ6A 4POBA 5CYYA 1A0RP 4MMMA 4KCAA 2YWNA 2CZ2A 1SD9A 5IOWA 1IYIA 4BPYA 1TXXA 1V9WA 1XCCA 1ACVA 3GMFA 2GTUA 1PA3A 1MD3A 2OE0A 4PUFC 2YWIA 2WVXB 3APQA 4OFTA 4J56E 4PXOA 1A8LA 2B5XA 2CX3A 3UOMA 2YZUA 4JRRA 2GQLA 3CQFA 2MMOA 4KB3A 4AJ6A 2REMA 3VWUA 4MZBA 1ZOFA 3IAM2 2EFCA 4PHZC 2IWTA 1GWCA 2H75A 1N2AA 4TR3A 1BG1A 1PGTA 2C0EA 2DJ3A 3EMPA 2HQTA 1FVJA 3LSZA 5AN1A 3F6DA 2CX4A 4NMUA 1Z5YE 10GSA 3HJMA 2A2PA 2EIOA 3A5WA 2XBQA 3C7MA 1SL2B 5FWGA 2B1KA 4MJAA 1A24A 5ECHB 2WJUA 5GSSA 2YZHA 2VUPA 1TDIA 1A2JA 2E2GA 3DIEA 3HVSA 5ECQB 5CRDA 1EV9A 2H71A 2IN3A 5IPHA 3KH9A 2C0FA 3GKMA 2FUG2 4K7NA 2D2ZA 5ID2A 2NBSA 2WW2A 4XRAA 2L4QA 2R0PA 5HQPA 1TU7A 1QQ2A 5LNKe 3SBCA 5G5EA 4ZXGA 3U5RE 4MJEA 3F63A 5HR1A 1NHOA 1GUMA 5KN2A 4EVMA 3CBUA 2GSSA 3QMXA 1YKCA 1U3AA 2RM6A 4ML6A 3CYNA 4XS1A 2O3EA 1XWGA 3Q74A 3KIJA 4F9ZA 1TK8B 4GLTA 2IIYA 1MTCA 2HZEB 2N5AA 4PTSA 2IJYA 4BVXB 3M9KA 1TKDB 3LFLA 1S3AA 5D9XA 2GVPA 5H5RA 1FHEA 2HRNA 4NV2A 3GN3A 1EEMA 4ILFA 4I5QA 4OFNA 2HZFA 2HSNB 3WT2A 3CRTA 2V6OA 1VF1A 1Q98A 2XHFA 2R5GA 2H1AA 1OE8A 4RI7A 3UL3A 3HJOA 4KDUA 1HD2A 3TOTA 2GT6A 1FAAA 2V41A 2X8GA 3F9UA 3FHKA 4Q5QA 2BMXA 2L6DA 4F82A 1O6JA 4HUAA 2LUSA 5EVOA 5F07A 4ECJA 1AC1A 1PL1A 4JR6A 3R2QA 5IMDA 4QL9A 2CVBA 1EWXA 1URMA 4P3YB 1M0UA 4KUNA 1ERTA 3BCKA 4PI0C 1A8YA 2CQ9A 1HYUA 1GLQA 5IM9A 1VGLA 5BRTA 2L57A 3ZL5A 3IK9A 4IQAA 1V57A 5J40A 3CTGA 2BJXA 5ECOB 1KEBA 4LLRA 1M9AA 3F4TA 4ISDA 2M80A 16GSA 3EVIA 5HR3A 2A2RA 1S3DA 3QCPA 4KA0A 1YEXA 3GL3A 3MDKA 4TXOA 3VI7A 1V98A 3VPQA 3ZVJA 1EP7A 3UVHA 5F05A 4K9ZA 3DRNA 3F3QA 2C1YA 3TJKA 3FK8A 2H1BA 4A5PA 5DAKB 2HRFA 2FWFA 1WOUA 3D4MA 4V1Ag 2IL3A 1SK0A 3GTUA 4NHZA 4MP4A 2CT6A 2FHEA 2L5OA 2PVOC 1SKSB 1JZOA 5G2ZA 2HFDA 3JCML 1GSUA 4N11A 5AIVA 1WRYA 3RFRC 1R7HA 4OCEA 3IR4A 1O73A 4MF5A 2YANA 1ZMAA 5F0GA 2UZ8A 4GXZA 4ZILA 5DVBA 1T3BA 4DSSA 4HSCX 1USBA 2X49A 5IOXA 2R4VA 4CY8A 3EU3A 1M7TA 1QUWA 1K0MA 1F3BA 1XWKA 1IYHA 2V6KA 2KOKA 5D8IA 3LG6A 1EOGA 5A5HB 3H79A 3WYWA 2DKHA 1ZL9A 2LKUA 13GSA 4GWRA 4ECIA 2H74A 1ZZYA 1X0RA 1TTZA 2JU5A 1OAZA 12GSA 4YKFA 3DEXA 1VF2A 3A5IA 2EC4A 2FWHA 5A1NB 5G1LA 1GSEA 5A4VA 2V32A 3UIWA 1R4WA 3ZLPA 1HNCA 3VURA 1FW1A 4YKGA 1Y1UA 1PRXA 3Q19A 4WBJA 2O87A 4FYUA 2AB6A 4ZB7A 1SL1B 2K9FA 3LORA 3EYTA 1I1IP 4MZCA 2FGXA 3TJJA 4IGJA 17GSA 1YVLA 4IN0A 1SKRB 3APSA 2OBKA 1XPVA 4HDEA 3ZIVA 4RI6A 1CQHA 4KGIA 3ME8A 2DLXA 4KSMA 4OO4A 5DALB 3GH6A 5HFKA 2ES7A 6GSSA 1GH2A 1Q4JA 4PNGA 1OVNA 6GSWA 2EFDA 3QPMA 1X5EA 3EWLA 2F51A 4EC0A 4L0WA 3UBLA 4BA7A 2JSYA 1G7EA 1V58A 4KH7A 1JZDA 1M99A 4V2MA 4MDCA 2OBIA 3RPNA 1SYRA 3VK9A 4WETA 3UARA 18GSA 1DE1A 3PPUA 2N5BA 1X9MB 19GSA 2JZRA 4MK3A 2VO4A 1WPIA 4OD7A 2PWJA 1RQMA 4K2XA 4LMVA 2PU9C 2DMMA 4IKHA 1TK0B 3IAS2 3W8SA 3LW9A 3V1WA 4I97A 2KUCA 1C72A 2WB9A 4TR1A 5CRWA 1XVWA 3FZ5A 1K3YA 4GSSA 2WS2A 5IO0A 4N10A 4BL7B 3KD0A 5ECPB 3L4NA 5HFGA 3CSIA 3TJBA 4N0VA 5A34A 1SJIA 2GS3A 2JACA 4J2FA 3F6FA 5J9BA 2HYXA 4YH2A 3UMAA 4FQUA 4IBPA 5C04A 1E2YA 3MIXA 2K18A 1GNWA 2OE1A 5DQSA 2GSTA 1GNEA 2DKIA 5D96A 2O8VB 1B4QA 3DMLA 1J0FA 1XXUA 2B3SA 1E6BA 4O7HA 1T7PB 4LL4B 2VM1A 2HSYA 2HSMB 1THXA 4G19A 4AI6A 1B9XC 1XW5A 1WJKA 2C0DA 3GNJA 2B1LA 3EC3A 4LA1A 1YDKA 3QFBC 1THOA 3FZ9A 2WDUA 2DIZA 5F8BA 3M9JA 5H5SA 5ELAA 4YQUA 4DSQA 2X8HA 1J08A 5GAND 4G2EA 2P5QA 4QMKA 5JWQB 5J47A 3LGCA 4F2IA 4D73A 3GFKA 1LBKA 4MCUA 1M2AA 5EPFA 1OKTA 3KGKA 2V1MA 3A3TA 3ZFBA 2VL2A 5J41A 4CW9A 2ZCTA 1JZWA 1XZOA 2AUVA 2HRKA 3LXZA 1OC9A 3ERGA 4TRXA 4V2NA 2MYGA 2VAFA 3O76A 3BBYA 2AAWA 4E8HA 2DJKA 6GSXA 4ECBA 1TK5B 3HJPA 4MJBA 1AIUA 2WULA 2H19A 4POLA 11GSA 3J7Yk 4POMA 3CWGA 3VWWA 4PQIA 1DUGA 1TW9A 3FMWA 2WW3A 1G6YA 4WR5A 4PX1A 4EUYA 1UA5A 2OACA 2GZZA 5COHA 1HNAA 1U87A 3EE2A 2R0CA 5BMUA 2TRCP 2I1UA 3KM6A 2I81A 5D73A 1DE2A 2OJLA 1NM3A 4Q5RA 4ZBBA 3ZITA 2M46A 4G01A 1AUCA 3EMXA 1F3AA 2H6ZA 4F03A 1R5AA 2IMIA 4G0IA 1JLWA 2C3QA 1T00A 4WBRD 5KEJA 2QKEA 2VCWA 4MA9A 2YOIA 5AGYA 2A4VA 2E7PA 2JL4A 4PUAA 2H6YA 1K3LA 1GSSA 4MZWA 2YP6A 4TOPA 1U3IA 2MBTA 1I9DA 4G0LA 1Z9HA 3N5OA 2TIRA 3D5JA 3WGDA 2H8LA 4HU9A 3DD3A 1GSQA 5B6MA 3TOUA 2VM2A 1XW6A 2AV4A 2FWEA 3APOA 3WD6A 3HA9A 2RIIA 3F8UA 3RAZA 1K0NA 1T4YA 2X4AA 4DEJA 4E8EA 1YY7A 1TRUA 1Z3EA 2B7JA 2FD3A 2WVYA 4ZB8A 2KP2A 3J7Yb 3TB2A 1GSFA 1OYJA 3L78A 2YV9A 2VL9A 5J4VA 3QAGA 5ELGA 4X43A 3A2VA 4PURA 4K6XA 3TRQA 4KDXA 3LYPA 3VWVA 1T8EB 5LCZA 1OE7A 3SWLA 2ALBA 4AKHA 5J4YA 1SK2A 2LNTA 4EO3A 5F06A 1F6MC 1GTUA 2PMTA 2AHEA 2IFQA 3GURA 3C1RA 1WIKA 2IMDA 4KCEA 3VI5A 3VWXA 3R3EA 3EU4A 4EIQA 4YQVA 1WE0A 1K3OA 4KE3A 1PD21 1AAZA 3RPPA 2M72A 2PERA 4Q5NA 2K8SA 5D9WA 3H4KA 1ERUA 1Y25A 4MF7A 4AKIA 3ZFLA 1EOHA 5B7CA 1Z6NA 2RM5A 2A2SA 1QGVA 2R0GA 4IVFA 2X8CA 4N3ZA 4HZ2A 3KCMA 2LJRA 3KMOA 3IA1A 1BF5A 3K8NA 1BYEA 5JWOB 1FO5A 4Z2UA 1XWBA 2VCTA 2O7KA 3I6AA 5DJMA 4MPGA 4XS6A 5ID2B 5ECKB 2CVDA 2O36A 4KDYA 2EFEA 2CV4A 3TKRA 2YJ7A 4BVYA 1PMTA 1GLPA 1KTEA 4IQ1A 3EINA 2UV8G 3C71A 3FEUA 4XTSA 3TKSE 3S9FA 3Q18A 4L8EA 4RUVA 4MLYA 3UVTA 2RUEA 2JSZA 3MSZA 5DBQA 2WZ9A 4IW9A 3RBTA 1ZGNA 2R6KA 4JR4A 2F8AA 3DVXA 3MYDA 2WRTA 4HQZA 1VF3A 3QDNA 3IOSA 2H70A 2DSAA 2LEGA 2H66A 3FKFA 2LRTA 2H1DA 2L6CA 1F37A 4HU7A 3TKQA 2VCXA 2H73A 3HMJG 1S3RA 3CTFA 3ZIJA 1PX7A 4EDYA 3BJ5A 3G7IA 1ZCPA 4F0CA 5HR0A 1X5CA 5CREA 3TUEA 4CDOA 1XOBA 2HE3A 3RHBA 3ZRDA 5DCHA 1WWJA 2QA2A 1EEJA 4HI7A 1GULA 3MNGA 3GHAA 2WFCA 2LV3A 2QSIA 1BQ7A 5JCGA 3UAPA 2HSHA 3LQ7A 5D9TA 2YN1A 1GUKA 1SK1A 1GUHA 3CRUA 2FA8A 2VL3A 4I6XA 3NOFA 1EP8A 2FY6A 3IV4A 3IBHA 3F0IA 3C8EA 3FZAA 1MEKA 4PGTA 4BWSA 3ISOA 4FYCA 3C73A 6GSUA 3KJYA 3GKKA 2O85A 3IK7A 1TP9A 3HCZA 2LRNA 5C00A 4XS4A 4MPFA 3MWHA 4MH3A 2CVKA 3VLNA 4ZBAA 4KF9A 4IHUA 2I3YA 2A4HA 1UVZA 2J23A 3QFAC 3PH9A 2VOCA 3RDWA 4X0XA 5J5NA 5HR2A 3IHQA 2VKZG 4EXJA 2RUFA 2J9HA 4TXOB 4V1Ap 4IJIA 1HQOA 1TXUA 4RQRA 2GDRA 5KN0A 1G0TA 2VCQA 2DIYA 3L0HA 3DVWA 1VF4A 3G7YA 2X64A 1YKAA 2KLXA 1MD4A 3TRPA 2ZUPA 3CSJA 3M8NA 4MNNA 2YNXA 2TRXA 4OO5A 3GTUB 2DJ1A 3N9JA 5INYA 2Z9SA 3HDCA 4O92A 1GSDA 1OC3A 2LRCA 1PX6A 2P5RA 1M2DA 2PGTA 2E2MA 2LJKA 3US3A 2WVZA 5ECMB 4GSNA 2NPBA 2RLIA 4DSSB 2HLSA 3P8WA 3NIVA 2PUKC 1AQWA 3TKSC 1V40A 3A2WA 4J57E 3KP9A 3E9JB 4JBBA 4K5RA 5IO2A 5A5KA 2WVXA 4NWYA 4N30A 3H8QA 1PKWA 4GQCA 1G7OA 1NSWA 1O81A 4K1FA 1GRXA 2GT5A 3HVNA 2H72A 2FA4A 5B6NA 3D4TA 3UEMA 5E59A 1A2MA 1CQGA 4MF6A 4ML1A 1N8JA 2FWGA 1B48A 3FR3A 5ECSA 3ZYWA 2LNSA 2DBCA 4XHMA 2JADA 5ENUA 1YEWC 1XIYA 4K7IA 2YWMA 1G6WA 4PI2C 1O8XA 4O32A 5B8BA 2QC7A 1DSBA 1OKDA 1XVQA 2X99A 2L4CA 2NDOA 1ABAA 1SVMA 5ECNB 3GX0A 1ST9A 5IMFA 1Z7PA 4IP6A 2NTOA 4AJ8A 4JZQA 2LQQA 4Z7XA 2MZCA 4ACSA 3KMNA 3HD5A 1TRVA 5IIZA 4AF2A 1M9BA 3GKXA 4EIPA 2VD1A 1K0DA 5ECRB 1W89A 3A2XA 1AQXA 1A0FA 2VLTA 3WGEA 5KN1A 3DYRA 4GDFA 3GA4A 1TOFA 1XWAA 3TCOA 3D21A 20GSA 1O85A 1ML6A 2ZNMA 1DBYA 1UC7A 1XG8A 2JZTA 3GH9A 5IQYA 4TKYA 3HY2A 4ECCA 2ON5A 3KTBA 2HNLA 3IPZA 1ZYEA 1AW9A 2HZEA 1K0AA 4BVXA 4TR4A 3M0FA 1ERWA 3GYKA 3G9BA 2KHPA 3TKSA 2OKAA 2WW1A 5AISA 1LJRA 2HSNA 3TU3B 2H76A 1O7UA 2VIMA 2H0HA 1GP1A 2C4JA 4G9HA 3AY8A 2VCZA 4TR1B 2WGRA 1R5PA 1SU9A 1MDKA 3GL5A 2JZSA 5IMZA 3MAKA 4YAPA 5B8AA 4FXYP 1ZYQB 2C8UA 3IRAA 3ERFA 4XCSA 1S3CA 1NW2A 2H01A 1PQNA 4EF0A 5A34B 1XWCA 3G7JA 4NAXA 1MDJA 1AXDA 1XFLA 5D9VA 1SD8A 3QOUA 3ME7A 3ZTLA 3HVXA 5DJLA 5CNWA 6GSVA 4X1UA 1SENA 4AGSA 2O89A 1EV4A 3HHVA 2I4AA 3DWVA 4FO5A 2IPAA 4IELA 4BIKA 3BD2A 3ZMLA 4OCFA 5GSTA 4WF4A 2CZ3A 4AJ7A 4N0ZA 5DQYA 3HVVA 6GSTA 8GSSA 2GZPA 2GSQA 2L59A 4TW5A 1GTBA 2DJ0A 3P7XA 3D6IA 4PQ1A 3PGTA 4AKGA 3IC8A 4WF5A 1SVOA 4O5UA 2IMEA 5J9CA 4D73B 1K0BA 4ZBDA 4QQ7A 5DDLA 3L9SA 1JHBA 4NPBA 4G10A 1GTIA 1QK8A 3I9V2 4L0UA 2DJ2A 1ON4A 5CRGA 2QA1A 2HRKB 2XBIA 1OC9B 4TXVA 3C1SA 1TI3A 5KOXA 5DAKA 3WT1A 3CMIA 1EGRA 4GQFA 3H93A 2GZYA 4Q5FA 3HZ4A 1RK4A 4HS1A 3H1NA 4HQSA 2ON7A 2YJHA 2C80A 3F4SA 2C3NA 4TN8A 1FG4A 3W6GA 2H30A 2B5YA 2VLUA 4ICYA 2VCVA 3WGXA 5FHIA 3GX8A 4HZ4A 4H86A 2LQOA 2KP1A 1R26A 2F9SA 4V2LA 3LXTA 5G5FA 5A4WA 5BMUB 3KZQA 5GAPD 1PFOA 5IMVA 4OMVA 4MABA 3GSTA 5FT3A 1YQ1A 3ZVJD 1ZYNA 2LTKA 4XRDA 4ULXA 3FY7A 2OA7A 3LEFA 2B6MA 4LL1B 4K2DA 4HJ2A 3GUSA 1BAYA 3F4RA 4JU5A 4KNDA 3W8JA 3QD9A 4IP1A 1AQVA 1UN2A 5A5HA 2CAQA 3KP8A 2R3XA 5ECLB 2P0GA 3QAVA 1TJDA 2C0GA 1ERVA 2G2QA 1K0OA 4ZIJA 2YV7A 5J4UA 1EZKA 1A23A 1VRSD 2EFHA 4GTUA 5G31A 2DJJA 5G30A 4YQMA 1PN0A 5E4WA 4I8BA 2HRAA 1F2EA 3RGBC 1W4VA 5A1NA 3TKPA 5J3RA 1U88A 1B4PA 1YF1A 4KW6A 4GRFA 4ZB6A 3IXRA 3HYPA 3EPTA 3UBKA 1EGOA 4TVEA 4OWYA 1KNGA 1TU8A 3QR6A 2XPDA 3D0ZA 2PPTA 2HXKA 4GSTA 3GRXA 5H5QA 4USSA 1A2LA 14GSA 2MMZA 3BCIA 4I2TA 2LS5A 3IHGA 3E0UA 5DALA 1FB6A 4G0KA 4L5OA 3EURA 3GIXA 2OE3A 4ZL9A 1SYXA 2F3MA 2GLRA 3FR9A 2IMFA 2L5LA 2EIQA 4ZL8A 1NHYA 2HI7A 1BG5A 4WR4A 4MH2A 3TDGA 4EKZA 1JZRA 4K8MA 2GSRA 5HFIA 4KX4A 1BJXA 5EY6A 4K7OA 2LJAA 2CA8A 1O8WA 1FB0A 4MJCA 4TR0A 1I5GA 3DGQA 5CP1A 4EE0A 3O6TA 3BOAA 2LSTA 3LWAA 4NHWA 3FRCA 2IFQB 4X4JA 3TRXA 1J9BA 2MBSA 2XC2A 1SVLA 3L9VA 5CRHA 5ECIB 2V2GA 2FCHA 1K0CA 1HNBA 5IMCA 1ZYPA 2XPEA 4PQHA 4NV5A 4BWQA 2C3TA 2P31A 1Z6MA 5JCWA 2O5VA 5AIXA 4PNFA 3UJ1A 3FZ4A 4ID0A 1WMJA 4HJMA 1M2BA 4EL1A 1QMVA 4BL7A 2WZSA 3F3RA 5KN3A 3HZ8A 4WXTA 2H0GA 2AJQB 5IPGA 4GF0A 4JE1A 3KXOA 4CHSA 2YCDA 3FR6A 3D22A 3ZZXA 5IMAA 1YZXA 5LD0A 4E68A 2WCIA 3P90A 1H75A 1SJ6A 1YF0A 4BVYB 4F0BA 1B8XA 4WEYA 1ILOA 3E3EA 3ED3A 2HSMA 3HKRA 4L5LA 3KEBA 5CO3A 3GV1A 2PN8A 4NXIA 2MMAA 5JCUA 3ERWA 2DMLA 5G1KA 5EL8A 4HEA2 2GQMA 1GTAA 3L9UA 3M1GA 1X9SB 2GQKA 4GCIA 2F8FA 3CSHA 3HXSA 3M3MA 1OC8A 1GSYA 4W66A 4IJ3A 1TI1A 3CHXC 1SJZA 3VPTA 1YEPA 5CAXA 1JFUA 1F9MA 1T1VA 5GZZB 4O5QA 1T4ZA 1Y6EA 5DCGA 2OADA 2H1LA 2MMNA 2VL2C 3DXBA 4LMWA 3LJRA 2H1GA 2K6VA 4JEDA 1RW1A 3RHCA 4AKXB 9GSSA 3I69A 3I43A 2CAIA 2G0FA 4FYBA 4CY6A 1PSQA 3PR8A 2B7KA 3U6VA 1LU4A 2OT3A 4KAEA 1PN9A 1M3IA 4QL7A 2NVLA 1FOHA 3ZMKA 7GSSA 2EIRA 4IS0A 1B9YC 1U6TA 1XOAA 2N5FA 4POKA 1JLVA 1BEDA 3OR5A 2AYTA 3FW2A 4OFMA 2IMKA 1Z7RA 4FH8A 4ZB9A 1H4OA 2I9HA 2PBJA 1QFNA 1XBSA 4EDZA 2VD0A 2FLSA 2K8VA 2QGVA 1WP0A 1SL0B 4XS4B 1FOVA 1N25A 2YPMA 5A4UA 2E0QA 4XIHA 5KOWA 3VFIA 2PVQA 2VLVA 4RQXA 3QAWA 2YWOA 4Z2RA 1SKWB 3TJGA 2HT9A 4YAVA 3KTLA 4FIWA 1GL8A 3GKNA 3LYKA 4K0GA 3FYGA 5JWRB 4DVCA 4K5SA 6GSYA 2H6XA 4ZL7A 1QXHA 3CXGA 1MDIA
chains in the Genus database with same CATH topology
4K0NA 3IDVA 3PINA 1KBNA 1V2AA 3ZREA 3DKSA 3KH7A 2GGTA 4I2UA 3TGZA 3TJFA 1BX9A 3IC4A 5L71A 1PKZA 2DC5A 2R2JA 1FVKA 3Q6OA 3O3TA 1XW9A 2B5EA 1TRWA 1TRSA 5ABRA 4O5RA 4Z2TA 3GSSA 1X9WB 4HOJA 3P2AA 2FNOA 4DSRA 22GSA 2BTOT 5D93A 1PL2A 4KSOA 2R37A 1X5DA 3IE3A 4WKWA 3NZNA 2H0IA 1YJ6A 4POBA 5CYYA 1A0RP 4MMMA 4KCAA 2YWNA 2CZ2A 1SD9A 5IOWA 1IYIA 4BPYA 1TXXA 1V9WA 1XCCA 1ACVA 3GMFA 2GTUA 1PA3A 1MD3A 2OE0A 4PUFC 2YWIA 3APQA 4OFTA 4J56E 4PXOA 1A8LA 2B5XA 2CX3A 3UOMA 2YZUA 4JRRA 2GQLA 2MMOA 4KB3A 4AJ6A 2REMA 3VWUA 4MZBA 1ZOFA 3IAM2 2EFCA 2IWTA 1GWCA 2H75A 1N2AA 4TR3A 1BG1A 1PGTA 2C0EA 2DJ3A 3EMPA 2HQTA 1FVJA 3LSZA 5AN1A 3F6DA 2CX4A 4NMUA 1Z5YE 10GSA 3HJMA 2A2PA 2EIOA 3A5WA 2XBQA 3C7MA 1SL2B 5FWGA 2B1KA 4MJAA 1A24A 5ECHB 2WJUA 5GSSA 2YZHA 2VUPA 1TDIA 1A2JA 2E2GA 3DIEA 3HVSA 5ECQB 5CRDA 1EV9A 2H71A 2IN3A 5IPHA 3KH9A 2C0FA 3GKMA 2FUG2 4K7NA 2D2ZA 5ID2A 2NBSA 4XRAA 2L4QA 2R0PA 5HQPA 1TU7A 1QQ2A 5LNKe 3SBCA 5G5EA 4ZXGA 3U5RE 4MJEA 3F63A 5HR1A 1NHOA 1GUMA 5KN2A 4EVMA 3CBUA 2GSSA 3QMXA 1YKCA 1U3AA 2RM6A 4ML6A 3CYNA 4XS1A 1XWGA 3Q74A 3KIJA 4F9ZA 1TK8B 4GLTA 2IIYA 1MTCA 2HZEB 2N5AA 4PTSA 2IJYA 4BVXB 3M9KA 1TKDB 3LFLA 1S3AA 5D9XA 2GVPA 5H5RA 1FHEA 2HRNA 4NV2A 3GN3A 1EEMA 4ILFA 4I5QA 4OFNA 2HZFA 2HSNB 3WT2A 3CRTA 2V6OA 1VF1A 1Q98A 2XHFA 2R5GA 2H1AA 1OE8A 4RI7A 3UL3A 3HJOA 4KDUA 1HD2A 3TOTA 2GT6A 1FAAA 2V41A 2X8GA 3F9UA 3FHKA 4Q5QA 2BMXA 2L6DA 4F82A 1O6JA 4HUAA 2LUSA 5EVOA 5F07A 4ECJA 1AC1A 1PL1A 4JR6A 3R2QA 5IMDA 4QL9A 2CVBA 1EWXA 1URMA 4P3YB 1M0UA 4KUNA 1ERTA 3BCKA 1A8YA 2CQ9A 1HYUA 1GLQA 5IM9A 1VGLA 5BRTA 2L57A 3ZL5A 3IK9A 4IQAA 1V57A 5J40A 3CTGA 2BJXA 5ECOB 1KEBA 4LLRA 1M9AA 3F4TA 4ISDA 2M80A 16GSA 3EVIA 5HR3A 2A2RA 1S3DA 3QCPA 4KA0A 1YEXA 3GL3A 3MDKA 4TXOA 3VI7A 1V98A 3VPQA 3ZVJA 1EP7A 3UVHA 5F05A 4K9ZA 3DRNA 3F3QA 2C1YA 3TJKA 3FK8A 2H1BA 4A5PA 5DAKB 2HRFA 2FWFA 1WOUA 3D4MA 4V1Ag 2IL3A 1SK0A 3GTUA 4NHZA 4MP4A 2CT6A 2FHEA 2L5OA 2PVOC 1SKSB 1JZOA 5G2ZA 2HFDA 3JCML 1GSUA 4N11A 5AIVA 1WRYA 4OCEA 1R7HA 3IR4A 1O73A 4MF5A 2YANA 1ZMAA 5F0GA 2UZ8A 4GXZA 4ZILA 5DVBA 1T3BA 4DSSA 1USBA 2X49A 5IOXA 2R4VA 4CY8A 3EU3A 1M7TA 1QUWA 1K0MA 1F3BA 1XWKA 1IYHA 2V6KA 2KOKA 5D8IA 3LG6A 1EOGA 5A5HB 3H79A 3WYWA 2DKHA 1ZL9A 2LKUA 13GSA 4GWRA 4ECIA 2H74A 1ZZYA 1X0RA 1TTZA 2JU5A 1OAZA 12GSA 4YKFA 3DEXA 1VF2A 3A5IA 2EC4A 2FWHA 5A1NB 5G1LA 1GSEA 5A4VA 2V32A 3UIWA 1R4WA 3ZLPA 1HNCA 3VURA 1FW1A 4YKGA 1Y1UA 1PRXA 3Q19A 4WBJA 2O87A 4FYUA 2AB6A 4ZB7A 1SL1B 2K9FA 3LORA 3EYTA 4MZCA 2FGXA 3TJJA 4IGJA 17GSA 1YVLA 4IN0A 1SKRB 3APSA 2OBKA 1XPVA 4HDEA 3ZIVA 4RI6A 1CQHA 4KGIA 3ME8A 2DLXA 4KSMA 4OO4A 5DALB 3GH6A 5HFKA 2ES7A 6GSSA 1GH2A 1Q4JA 4PNGA 1OVNA 6GSWA 2EFDA 3QPMA 1X5EA 3EWLA 2F51A 4EC0A 4L0WA 3UBLA 4BA7A 2JSYA 1G7EA 1V58A 4KH7A 1JZDA 1M99A 4V2MA 4MDCA 2OBIA 3RPNA 1SYRA 3VK9A 4WETA 3UARA 18GSA 1DE1A 3PPUA 2N5BA 1X9MB 19GSA 2JZRA 4MK3A 2VO4A 1WPIA 4OD7A 2PWJA 1RQMA 4K2XA 4LMVA 2PU9C 2DMMA 4IKHA 1TK0B 3IAS2 3W8SA 3LW9A 3V1WA 4I97A 2KUCA 1C72A 2WB9A 4TR1A 5CRWA 1XVWA 3FZ5A 1K3YA 4GSSA 2WS2A 5IO0A 4N10A 4BL7B 3KD0A 5ECPB 3L4NA 5HFGA 3CSIA 3TJBA 4N0VA 5A34A 1SJIA 2GS3A 2JACA 4J2FA 3F6FA 5J9BA 2HYXA 4YH2A 3UMAA 4FQUA 4IBPA 5C04A 1E2YA 3MIXA 2K18A 1GNWA 2OE1A 5DQSA 2GSTA 1GNEA 2DKIA 5D96A 2O8VB 1B4QA 3DMLA 1J0FA 1XXUA 2B3SA 1E6BA 4O7HA 1T7PB 4LL4B 2VM1A 2HSYA 2HSMB 1THXA 4G19A 4AI6A 1B9XC 1XW5A 1WJKA 2C0DA 3GNJA 2B1LA 3EC3A 4LA1A 1YDKA 3QFBC 1THOA 3FZ9A 2WDUA 2DIZA 5F8BA 3M9JA 5H5SA 5ELAA 4YQUA 4DSQA 2X8HA 1J08A 5GAND 4G2EA 2P5QA 4QMKA 5JWQB 5J47A 3LGCA 4F2IA 4D73A 3GFKA 1LBKA 4MCUA 1M2AA 5EPFA 1OKTA 3KGKA 2V1MA 3A3TA 3ZFBA 2VL2A 5J41A 4CW9A 2ZCTA 1JZWA 1XZOA 2AUVA 2HRKA 3LXZA 1OC9A 3ERGA 4TRXA 4V2NA 2MYGA 2VAFA 3O76A 3BBYA 2AAWA 4E8HA 2DJKA 6GSXA 4ECBA 1TK5B 3HJPA 4MJBA 1AIUA 2WULA 2H19A 4POLA 11GSA 3J7Yk 4POMA 3CWGA 3VWWA 4PQIA 1DUGA 1TW9A 3FMWA 1G6YA 4WR5A 4PX1A 4EUYA 1UA5A 2OACA 2GZZA 5COHA 1HNAA 1U87A 3EE2A 2R0CA 5BMUA 2TRCP 2I1UA 3KM6A 2I81A 5D73A 1DE2A 2OJLA 1NM3A 4Q5RA 4ZBBA 3ZITA 2M46A 4G01A 1AUCA 3EMXA 1F3AA 2H6ZA 4F03A 1R5AA 2IMIA 4G0IA 1JLWA 2C3QA 1T00A 4WBRD 5KEJA 2QKEA 2VCWA 4MA9A 2YOIA 5AGYA 2A4VA 2E7PA 2JL4A 4PUAA 2H6YA 1K3LA 1GSSA 4MZWA 2YP6A 4TOPA 1U3IA 2MBTA 1I9DA 4G0LA 1Z9HA 3N5OA 2TIRA 3D5JA 3WGDA 2H8LA 4HU9A 3DD3A 1GSQA 5B6MA 3TOUA 2VM2A 1XW6A 2AV4A 2FWEA 3APOA 3WD6A 3HA9A 2RIIA 3F8UA 3RAZA 1K0NA 1T4YA 2X4AA 4DEJA 4E8EA 1YY7A 1TRUA 1Z3EA 2B7JA 2FD3A 4ZB8A 2KP2A 3J7Yb 3TB2A 1GSFA 1OYJA 3L78A 2YV9A 2VL9A 5J4VA 3QAGA 5ELGA 4X43A 3A2VA 4PURA 4K6XA 3TRQA 4KDXA 3LYPA 3VWVA 1T8EB 5LCZA 1OE7A 3SWLA 2ALBA 4AKHA 5J4YA 1SK2A 2LNTA 4EO3A 5F06A 1F6MC 1GTUA 2PMTA 2AHEA 2IFQA 3GURA 3C1RA 1WIKA 2IMDA 4KCEA 3VI5A 3VWXA 3R3EA 3EU4A 4EIQA 4YQVA 1WE0A 1K3OA 4KE3A 1PD21 1AAZA 3RPPA 2M72A 2PERA 4Q5NA 2K8SA 5D9WA 3H4KA 1ERUA 1Y25A 4MF7A 4AKIA 3ZFLA 1EOHA 5B7CA 1Z6NA 2RM5A 2A2SA 1QGVA 2R0GA 4IVFA 2X8CA 4N3ZA 4HZ2A 3KCMA 2LJRA 3KMOA 3IA1A 1BF5A 3K8NA 1BYEA 5JWOB 1FO5A 4Z2UA 1XWBA 2VCTA 2O7KA 3I6AA 5DJMA 4MPGA 4XS6A 5ID2B 5ECKB 2CVDA 4KDYA 2EFEA 2CV4A 3TKRA 2YJ7A 4BVYA 1PMTA 1GLPA 1KTEA 4IQ1A 3EINA 2UV8G 3C71A 3FEUA 4XTSA 3TKSE 3S9FA 3Q18A 4L8EA 4RUVA 4MLYA 3UVTA 2RUEA 2JSZA 3MSZA 5DBQA 2WZ9A 4IW9A 3RBTA 1ZGNA 2R6KA 4JR4A 2F8AA 3DVXA 3MYDA 2WRTA 4HQZA 1VF3A 3QDNA 3IOSA 2H70A 2DSAA 2LEGA 2H66A 3FKFA 2LRTA 2H1DA 2L6CA 1F37A 4HU7A 3TKQA 2VCXA 2H73A 3HMJG 3CTFA 3ZIJA 1PX7A 4EDYA 3BJ5A 3G7IA 1ZCPA 4F0CA 5HR0A 1X5CA 5CREA 3TUEA 4CDOA 1XOBA 2HE3A 3RHBA 3ZRDA 5DCHA 1WWJA 2QA2A 1EEJA 4HI7A 1GULA 3MNGA 3GHAA 2WFCA 2LV3A 2QSIA 1BQ7A 5JCGA 3UAPA 2HSHA 3LQ7A 5D9TA 2YN1A 1GUKA 1SK1A 1GUHA 3CRUA 2FA8A 2VL3A 4I6XA 3NOFA 1EP8A 2FY6A 3IV4A 3IBHA 3F0IA 3C8EA 3FZAA 1MEKA 4PGTA 4BWSA 3ISOA 4FYCA 3C73A 6GSUA 3KJYA 3GKKA 2O85A 3IK7A 1TP9A 3HCZA 2LRNA 5C00A 4XS4A 4MPFA 3MWHA 4MH3A 2CVKA 3VLNA 4ZBAA 4KF9A 4IHUA 2I3YA 2A4HA 1UVZA 2J23A 3QFAC 3PH9A 2VOCA 3RDWA 4X0XA 5J5NA 5HR2A 3IHQA 2VKZG 4EXJA 2RUFA 2J9HA 4TXOB 4V1Ap 4IJIA 1HQOA 1TXUA 4RQRA 2GDRA 5KN0A 1G0TA 2VCQA 2DIYA 3L0HA 3DVWA 1VF4A 3G7YA 2X64A 1YKAA 2KLXA 1MD4A 3TRPA 2ZUPA 3CSJA 3M8NA 4MNNA 2YNXA 2TRXA 4OO5A 3GTUB 2DJ1A 3N9JA 5INYA 2Z9SA 3HDCA 4O92A 1GSDA 1OC3A 2LRCA 1PX6A 2P5RA 1M2DA 2PGTA 2E2MA 2LJKA 3US3A 5ECMB 4GSNA 2NPBA 2RLIA 4DSSB 2HLSA 3P8WA 3NIVA 2PUKC 1AQWA 3TKSC 1V40A 3A2WA 4J57E 3KP9A 3E9JB 4JBBA 4K5RA 5IO2A 5A5KA 4NWYA 4N30A 3H8QA 1PKWA 4GQCA 1G7OA 1NSWA 1O81A 4K1FA 1GRXA 2GT5A 2H72A 2FA4A 5B6NA 3D4TA 3UEMA 5E59A 1A2MA 1CQGA 4MF6A 4ML1A 1N8JA 2FWGA 1B48A 3FR3A 5ECSA 3ZYWA 2LNSA 2DBCA 4XHMA 2JADA 5ENUA 1XIYA 4K7IA 2YWMA 1G6WA 1O8XA 4O32A 5B8BA 2QC7A 1DSBA 1OKDA 1XVQA 2X99A 2L4CA 2NDOA 1ABAA 1SVMA 5ECNB 3GX0A 1ST9A 5IMFA 1Z7PA 4IP6A 2NTOA 4AJ8A 4JZQA 2LQQA 4Z7XA 2MZCA 4ACSA 3KMNA 3HD5A 1TRVA 5IIZA 4AF2A 1M9BA 3GKXA 4EIPA 2VD1A 1K0DA 5ECRB 1W89A 3A2XA 1AQXA 1A0FA 2VLTA 3WGEA 5KN1A 3DYRA 4GDFA 3GA4A 1TOFA 1XWAA 3TCOA 3D21A 20GSA 1O85A 1ML6A 2ZNMA 1DBYA 1UC7A 2JZTA 3GH9A 5IQYA 4TKYA 3HY2A 4ECCA 2ON5A 3KTBA 2HNLA 3IPZA 1ZYEA 1AW9A 2HZEA 1K0AA 4BVXA 4TR4A 3M0FA 1ERWA 3GYKA 3G9BA 2KHPA 3TKSA 2OKAA 5AISA 1LJRA 2HSNA 3TU3B 2H76A 1O7UA 2VIMA 2H0HA 1GP1A 2C4JA 4G9HA 3AY8A 2VCZA 4TR1B 2WGRA 1R5PA 1SU9A 1MDKA 3GL5A 2JZSA 5IMZA 3MAKA 4YAPA 5B8AA 1ZYQB 2C8UA 3IRAA 3ERFA 4XCSA 1S3CA 1NW2A 2H01A 1PQNA 4EF0A 5A34B 1XWCA 3G7JA 4NAXA 1MDJA 1AXDA 1XFLA 5D9VA 1SD8A 3QOUA 3ME7A 3ZTLA 3HVXA 5DJLA 5CNWA 6GSVA 4X1UA 1SENA 4AGSA 2O89A 1EV4A 3HHVA 2I4AA 3DWVA 4FO5A 2IPAA 4IELA 3BD2A 3ZMLA 4OCFA 5GSTA 4WF4A 2CZ3A 4AJ7A 4N0ZA 5DQYA 3HVVA 6GSTA 8GSSA 2GZPA 2GSQA 2L59A 4TW5A 1GTBA 2DJ0A 3P7XA 3D6IA 4PQ1A 3PGTA 4AKGA 3IC8A 4WF5A 1SVOA 4O5UA 2IMEA 5J9CA 4D73B 1K0BA 4ZBDA 4QQ7A 5DDLA 3L9SA 1JHBA 4NPBA 4G10A 1GTIA 1QK8A 3I9V2 4L0UA 2DJ2A 1ON4A 5CRGA 2QA1A 2HRKB 2XBIA 1OC9B 4TXVA 3C1SA 1TI3A 5KOXA 5DAKA 3WT1A 3CMIA 1EGRA 4GQFA 3H93A 2GZYA 4Q5FA 3HZ4A 1RK4A 4HS1A 3H1NA 4HQSA 2ON7A 2YJHA 2C80A 3F4SA 2C3NA 4TN8A 1FG4A 3W6GA 2H30A 2B5YA 2VLUA 4ICYA 2VCVA 3WGXA 5FHIA 3GX8A 4HZ4A 4H86A 2LQOA 2KP1A 1R26A 2F9SA 4V2LA 3LXTA 5G5FA 5A4WA 5BMUB 3KZQA 5GAPD 5IMVA 4OMVA 4MABA 3GSTA 5FT3A 1YQ1A 3ZVJD 1ZYNA 2LTKA 4XRDA 4ULXA 3FY7A 2OA7A 3LEFA 2B6MA 4LL1B 4K2DA 4HJ2A 3GUSA 1BAYA 3F4RA 4JU5A 4KNDA 3W8JA 3QD9A 4IP1A 1AQVA 1UN2A 5A5HA 2CAQA 3KP8A 2R3XA 5ECLB 2P0GA 3QAVA 1TJDA 2C0GA 1ERVA 2G2QA 1K0OA 4ZIJA 2YV7A 5J4UA 1EZKA 1A23A 1VRSD 2EFHA 4GTUA 5G31A 2DJJA 5G30A 4YQMA 1PN0A 5E4WA 4I8BA 2HRAA 1F2EA 1W4VA 5A1NA 3TKPA 5J3RA 1U88A 1B4PA 1YF1A 4KW6A 4GRFA 4ZB6A 3IXRA 3HYPA 3EPTA 3UBKA 1EGOA 4TVEA 4OWYA 1KNGA 1TU8A 3QR6A 2XPDA 3D0ZA 2PPTA 2HXKA 4GSTA 3GRXA 5H5QA 4USSA 1A2LA 14GSA 2MMZA 3BCIA 4I2TA 2LS5A 3IHGA 3E0UA 5DALA 1FB6A 4G0KA 4L5OA 3EURA 3GIXA 2OE3A 4ZL9A 1SYXA 2F3MA 2GLRA 3FR9A 2IMFA 2L5LA 2EIQA 4ZL8A 1NHYA 2HI7A 1BG5A 4WR4A 4MH2A 3TDGA 4EKZA 1JZRA 4K8MA 2GSRA 5HFIA 4KX4A 1BJXA 5EY6A 4K7OA 2LJAA 2CA8A 1O8WA 1FB0A 4MJCA 4TR0A 1I5GA 3DGQA 5CP1A 4EE0A 3O6TA 3BOAA 2LSTA 3LWAA 4NHWA 3FRCA 2IFQB 4X4JA 3TRXA 1J9BA 2MBSA 2XC2A 1SVLA 3L9VA 5CRHA 5ECIB 2V2GA 2FCHA 1K0CA 1HNBA 5IMCA 1ZYPA 2XPEA 4PQHA 4NV5A 4BWQA 2C3TA 2P31A 1Z6MA 5JCWA 2O5VA 5AIXA 4PNFA 3UJ1A 3FZ4A 4ID0A 1WMJA 4HJMA 1M2BA 4EL1A 1QMVA 4BL7A 3F3RA 5KN3A 3HZ8A 4WXTA 2H0GA 2AJQB 5IPGA 4GF0A 4JE1A 3KXOA 4CHSA 2YCDA 3FR6A 3D22A 3ZZXA 5IMAA 1YZXA 5LD0A 4E68A 2WCIA 3P90A 1H75A 1SJ6A 1YF0A 4BVYB 4F0BA 1B8XA 4WEYA 1ILOA 3E3EA 3ED3A 2HSMA 3HKRA 4L5LA 3KEBA 5CO3A 3GV1A 2PN8A 4NXIA 2MMAA 5JCUA 3ERWA 2DMLA 5G1KA 5EL8A 4HEA2 2GQMA 1GTAA 3L9UA 3M1GA 1X9SB 2GQKA 4GCIA 2F8FA 3CSHA 3HXSA 3M3MA 1OC8A 1GSYA 4W66A 4IJ3A 1TI1A 1SJZA 3VPTA 1YEPA 5CAXA 1JFUA 1F9MA 1T1VA 5GZZB 4O5QA 1T4ZA 1Y6EA 5DCGA 2OADA 2H1LA 2MMNA 2VL2C 3DXBA 4LMWA 3LJRA 2H1GA 2K6VA 4JEDA 1RW1A 3RHCA 4AKXB 9GSSA 3I69A 3I43A 2CAIA 2G0FA 4FYBA 4CY6A 1PSQA 3PR8A 2B7KA 3U6VA 1LU4A 2OT3A 4KAEA 1PN9A 4QL7A 2NVLA 1FOHA 3ZMKA 7GSSA 2EIRA 4IS0A 1B9YC 1U6TA 1XOAA 2N5FA 4POKA 1JLVA 1BEDA 3OR5A 2AYTA 3FW2A 4OFMA 2IMKA 1Z7RA 4FH8A 4ZB9A 1H4OA 2I9HA 2PBJA 1QFNA 1XBSA 4EDZA 2VD0A 2FLSA 2K8VA 2QGVA 1WP0A 1SL0B 4XS4B 1FOVA 1N25A 2YPMA 5A4UA 2E0QA 4XIHA 5KOWA 3VFIA 2PVQA 2VLVA 4RQXA 3QAWA 2YWOA 4Z2RA 1SKWB 3TJGA 2HT9A 4YAVA 3KTLA 4FIWA 1GL8A 3GKNA 3LYKA 4K0GA 3FYGA 5JWRB 4DVCA 4K5SA 6GSYA 2H6XA 4ZL7A 1QXHA 3CXGA 1MDIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K0N A;  3IDV A;  3PIN A;  1KBN A;  1V2A A;  3ZRE A;  3DKS A;  3KH7 A;  2GGT A;  4I2U A;  3TGZ A;  3TJF A;  1BX9 A;  3IC4 A;  5L71 A;  1PKZ A;  2DC5 A;  2R2J A;  1FVK A;  3Q6O A;  3O3T A;  1XW9 A;  2B5E A;  1TRW A;  1TRS A;  5ABR A;  4O5R A;  3GSS A;  1X9W B;  4HOJ A;  3P2A A;  2FNO A;  4DSR A;  22GS A;  2BTO T;  5D93 A;  1PL2 A;  4KSO A;  2R37 A;  1X5D A;  3IE3 A;  4WKW A;  3NZN A;  2H0I A;  1YJ6 A;  4POB A;  5CYY A;  1A0R P;  4MMM A;  4KCA A;  2YWN A;  2CZ2 A;  1SD9 A;  5IOW A;  1IYI A;  4BPY A;  1TXX A;  1V9W A;  1XCC A;  1ACV A;  3GMF A;  2GTU A;  1PA3 A;  1MD3 A;  2OE0 A;  4PUF C;  2YWI A;  3APQ A;  4OFT A;  4J56 E;  4PXO A;  1A8L A;  2B5X A;  2CX3 A;  3UOM A;  2YZU A;  4JRR A;  2GQL A;  2MMO A;  4KB3 A;  4AJ6 A;  2REM A;  3VWU A;  4MZB A;  1ZOF A;  3IAM 2;  2IWT A;  1GWC A;  2H75 A;  1N2A A;  4TR3 A;  1PGT A;  2C0E A;  2DJ3 A;  3EMP A;  2HQT A;  1FVJ A;  3LSZ A;  5AN1 A;  3F6D A;  2CX4 A;  4NMU A;  1Z5Y E;  10GS A;  3HJM A;  2EIO A;  3A5W A;  2XBQ A;  3C7M A;  1SL2 B;  5FWG A;  2B1K A;  4MJA A;  1A24 A;  5ECH B;  2WJU A;  5GSS A;  2YZH A;  2VUP A;  1TDI A;  1A2J A;  2E2G A;  3DIE A;  3HVS A;  5ECQ B;  5CRD A;  1EV9 A;  2H71 A;  2IN3 A;  5IPH A;  3KH9 A;  2C0F A;  3GKM A;  2FUG 2;  4K7N A;  2D2Z A;  5ID2 A;  2NBS A;  4XRA A;  2L4Q A;  5HQP A;  1TU7 A;  1QQ2 A;  5LNK e;  3SBC A;  5G5E A;  4ZXG A;  3U5R E;  4MJE A;  3F63 A;  5HR1 A;  1NHO A;  1GUM A;  5KN2 A;  4EVM A;  3CBU A;  2GSS A;  3QMX A;  1YKC A;  1U3A A;  2RM6 A;  4ML6 A;  3CYN A;  4XS1 A;  1XWG A;  3Q74 A;  3KIJ A;  4F9Z A;  1TK8 B;  4GLT A;  2IIY A;  1MTC A;  2HZE B;  2N5A A;  4PTS A;  2IJY A;  4BVX B;  3M9K A;  1TKD B;  3LFL A;  1S3A A;  5D9X A;  2GVP A;  5H5R A;  1FHE A;  2HRN A;  4NV2 A;  3GN3 A;  4ILF A;  1EEM A;  4I5Q A;  4OFN A;  2HZF A;  2HSN B;  3WT2 A;  3CRT A;  2V6O A;  1VF1 A;  1Q98 A;  2XHF A;  2R5G A;  2H1A A;  1OE8 A;  4RI7 A;  3UL3 A;  3HJO A;  4KDU A;  1HD2 A;  3TOT A;  2GT6 A;  1FAA A;  2V41 A;  2X8G A;  3F9U A;  3FHK A;  4Q5Q A;  2BMX A;  2L6D A;  4F82 A;  1O6J A;  4HUA A;  2LUS A;  5EVO A;  5F07 A;  4ECJ A;  1AC1 A;  1PL1 A;  4JR6 A;  3R2Q A;  5IMD A;  4QL9 A;  2CVB A;  1EWX A;  1URM A;  4P3Y B;  1M0U A;  4KUN A;  1ERT A;  3BCK A;  1A8Y A;  2CQ9 A;  1HYU A;  1GLQ A;  5IM9 A;  1VGL A;  2L57 A;  3ZL5 A;  3IK9 A;  4IQA A;  1V57 A;  3CTG A;  2BJX A;  5ECO B;  1KEB A;  4LLR A;  1M9A A;  3F4T A;  4ISD A;  2M80 A;  16GS A;  3EVI A;  5HR3 A;  2A2R A;  1S3D A;  3QCP A;  4KA0 A;  1YEX A;  3GL3 A;  3MDK A;  4TXO A;  3VI7 A;  1V98 A;  3VPQ A;  3ZVJ A;  1EP7 A;  3UVH A;  5F05 A;  4K9Z A;  3DRN A;  3F3Q A;  2C1Y A;  3TJK A;  3FK8 A;  2H1B A;  5DAK B;  2HRF A;  2FWF A;  1WOU A;  3D4M A;  4V1A g;  2IL3 A;  1SK0 A;  3GTU A;  4NHZ A;  4MP4 A;  2CT6 A;  2FHE A;  2L5O A;  2PVO C;  1SKS B;  1JZO A;  5G2Z A;  2HFD A;  3JCM L;  1GSU A;  4N11 A;  5AIV A;  1WRY A;  4OCE A;  1R7H A;  3IR4 A;  1O73 A;  4MF5 A;  2YAN A;  1ZMA A;  5F0G A;  2UZ8 A;  4GXZ A;  4ZIL A;  5DVB A;  1T3B A;  4DSS A;  1USB A;  5IOX A;  2R4V A;  3EU3 A;  1M7T A;  1QUW A;  1K0M A;  1F3B A;  1XWK A;  1IYH A;  2V6K A;  2KOK A;  5D8I A;  3LG6 A;  1EOG A;  3H79 A;  3WYW A;  2LKU A;  1ZL9 A;  13GS A;  4GWR A;  4ECI A;  2H74 A;  1ZZY A;  1X0R A;  1TTZ A;  2JU5 A;  1OAZ A;  12GS A;  3DEX A;  1VF2 A;  2EC4 A;  2FWH A;  5G1L A;  1GSE A;  5A4V A;  2V32 A;  3UIW A;  1R4W A;  3ZLP A;  1HNC A;  3VUR A;  1FW1 A;  1PRX A;  3Q19 A;  4WBJ A;  2O87 A;  4FYU A;  2AB6 A;  1SL1 B;  2K9F A;  3LOR A;  3EYT A;  4MZC A;  2FGX A;  3TJJ A;  4IGJ A;  17GS A;  4IN0 A;  1SKR B;  3APS A;  2OBK A;  1XPV A;  4HDE A;  3ZIV A;  4RI6 A;  1CQH A;  4KGI A;  3ME8 A;  2DLX A;  4KSM A;  4OO4 A;  5DAL B;  3GH6 A;  5HFK A;  2ES7 A;  6GSS A;  1GH2 A;  1Q4J A;  4PNG A;  1OVN A;  6GSW A;  3QPM A;  1X5E A;  3EWL A;  2F51 A;  4EC0 A;  4L0W A;  3UBL A;  4BA7 A;  2JSY A;  1G7E A;  1V58 A;  4KH7 A;  1JZD A;  1M99 A;  4V2M A;  4MDC A;  2OBI A;  3RPN A;  1SYR A;  3VK9 A;  4WET A;  3UAR A;  18GS A;  1DE1 A;  3PPU A;  2N5B A;  1X9M B;  19GS A;  2JZR A;  4MK3 A;  2VO4 A;  1WPI A;  4OD7 A;  2PWJ A;  1RQM A;  4LMV A;  2PU9 C;  2DMM A;  4IKH A;  1TK0 B;  3IAS 2;  3W8S A;  3V1W A;  4I97 A;  2KUC A;  1C72 A;  2WB9 A;  4TR1 A;  5CRW A;  1XVW A;  3FZ5 A;  1K3Y A;  4GSS A;  2WS2 A;  5IO0 A;  4N10 A;  4BL7 B;  3KD0 A;  5ECP B;  3L4N A;  5HFG A;  3CSI A;  3TJB A;  4N0V A;  1SJI A;  2GS3 A;  2JAC A;  4J2F A;  3F6F A;  5J9B A;  2HYX A;  4YH2 A;  3UMA A;  4FQU A;  4IBP A;  5C04 A;  1E2Y A;  2K18 A;  1GNW A;  2OE1 A;  5DQS A;  2GST A;  1GNE A;  5D96 A;  2O8V B;  1B4Q A;  3DML A;  1J0F A;  1XXU A;  2B3S A;  1E6B A;  4O7H A;  1T7P B;  4LL4 B;  2VM1 A;  2HSY A;  2HSM B;  1THX A;  4G19 A;  1B9X C;  1XW5 A;  1WJK A;  2C0D A;  3GNJ A;  2B1L A;  3EC3 A;  4LA1 A;  1YDK A;  3QFB C;  1THO A;  3FZ9 A;  2WDU A;  2DIZ A;  5F8B A;  3M9J A;  5H5S A;  5ELA A;  4YQU A;  4DSQ A;  2X8H A;  1J08 A;  5GAN D;  4G2E A;  2P5Q A;  5JWQ B;  3LGC A;  4F2I A;  4D73 A;  3GFK A;  1LBK A;  4MCU A;  1M2A A;  5EPF A;  1OKT A;  3KGK A;  2V1M A;  3A3T A;  3ZFB A;  2VL2 A;  5J41 A;  4CW9 A;  2ZCT A;  1JZW A;  1XZO A;  2AUV A;  2HRK A;  3LXZ A;  1OC9 A;  3ERG A;  4TRX A;  4V2N A;  2MYG A;  2VAF A;  3O76 A;  3BBY A;  2AAW A;  4E8H A;  2DJK A;  6GSX A;  4ECB A;  1TK5 B;  3HJP A;  4MJB A;  1AIU A;  2WUL A;  2H19 A;  4POL A;  11GS A;  3J7Y k;  4POM A;  3VWW A;  4PQI A;  1DUG A;  1TW9 A;  1G6Y A;  4WR5 A;  4PX1 A;  4EUY A;  1UA5 A;  2OAC A;  2GZZ A;  5COH A;  1HNA A;  1U87 A;  3EE2 A;  5BMU A;  2TRC P;  2I1U A;  3KM6 A;  2I81 A;  5D73 A;  1DE2 A;  2OJL A;  1NM3 A;  4Q5R A;  4ZBB A;  3ZIT A;  2M46 A;  1AUC A;  3EMX A;  1F3A A;  2H6Z A;  4F03 A;  1R5A A;  2IMI A;  4G0I A;  1JLW A;  2C3Q A;  1T00 A;  4WBR D;  5KEJ A;  2QKE A;  2VCW A;  4MA9 A;  2YOI A;  5AGY A;  2A4V A;  2E7P A;  2JL4 A;  4PUA A;  2H6Y A;  1K3L A;  1GSS A;  4MZW A;  2YP6 A;  4TOP A;  1U3I A;  2MBT A;  1I9D A;  4G0L A;  1Z9H A;  3N5O A;  2TIR A;  3D5J A;  3WGD A;  2H8L A;  4HU9 A;  3DD3 A;  1GSQ A;  5B6M A;  3TOU A;  2VM2 A;  1XW6 A;  2AV4 A;  2FWE A;  3APO A;  3WD6 A;  3HA9 A;  2RII A;  3F8U A;  3RAZ A;  1K0N A;  1T4Y A;  4DEJ A;  4E8E A;  1YY7 A;  1TRU A;  1Z3E A;  2B7J A;  2FD3 A;  4ZB8 A;  2KP2 A;  3J7Y b;  3TB2 A;  1GSF A;  1OYJ A;  3L78 A;  2YV9 A;  2VL9 A;  3QAG A;  5ELG A;  4X43 A;  3A2V A;  4PUR A;  4K6X A;  3TRQ A;  4KDX A;  3LYP A;  3VWV A;  1T8E B;  5LCZ A;  1OE7 A;  3SWL A;  2ALB A;  1SK2 A;  2LNT A;  4EO3 A;  5F06 A;  1F6M C;  1GTU A;  2PMT A;  2AHE A;  2IFQ A;  3GUR A;  3C1R A;  1WIK A;  2IMD A;  4KCE A;  3VI5 A;  3VWX A;  3R3E A;  3EU4 A;  4YQV A;  1WE0 A;  1K3O A;  4KE3 A;  1PD2 1;  1AAZ A;  3RPP A;  2M72 A;  2PER A;  4Q5N A;  2K8S A;  5D9W A;  3H4K A;  1ERU A;  1Y25 A;  4MF7 A;  3ZFL A;  1EOH A;  5B7C A;  1Z6N A;  2RM5 A;  2A2S A;  1QGV A;  4IVF A;  2X8C A;  4HZ2 A;  3KCM A;  2LJR A;  3KMO A;  3IA1 A;  3K8N A;  1BYE A;  5JWO B;  1FO5 A;  1XWB A;  2VCT A;  2O7K A;  3I6A A;  5DJM A;  4MPG A;  4XS6 A;  5ID2 B;  5ECK B;  2CVD A;  4KDY A;  2CV4 A;  3TKR A;  2YJ7 A;  4BVY A;  1PMT A;  1GLP A;  1KTE A;  4IQ1 A;  3EIN A;  3C71 A;  3FEU A;  4XTS A;  3TKS E;  3S9F A;  3Q18 A;  4L8E A;  4RUV A;  4MLY A;  3UVT A;  2RUE A;  2JSZ A;  3MSZ A;  5DBQ A;  2WZ9 A;  4IW9 A;  3RBT A;  1ZGN A;  2R6K A;  4JR4 A;  2F8A A;  3DVX A;  2WRT A;  4HQZ A;  1VF3 A;  3QDN A;  3IOS A;  2H70 A;  2DSA A;  2LEG A;  2H66 A;  3FKF A;  2LRT A;  2H1D A;  2L6C A;  1F37 A;  4HU7 A;  3TKQ A;  2VCX A;  2H73 A;  3CTF A;  3ZIJ A;  1PX7 A;  4EDY A;  3BJ5 A;  3G7I A;  1ZCP A;  4F0C A;  5HR0 A;  1X5C A;  5CRE A;  3TUE A;  4CDO A;  1XOB A;  2HE3 A;  3RHB A;  3ZRD A;  5DCH A;  1WWJ A;  1EEJ A;  4HI7 A;  1GUL A;  3MNG A;  3GHA A;  2WFC A;  2LV3 A;  2QSI A;  1BQ7 A;  5JCG A;  3UAP A;  2HSH A;  3LQ7 A;  5D9T A;  2YN1 A;  1GUK A;  1SK1 A;  1GUH A;  3CRU A;  2FA8 A;  2VL3 A;  4I6X A;  3NOF A;  1EP8 A;  2FY6 A;  3IV4 A;  3IBH A;  3F0I A;  3C8E A;  3FZA A;  1MEK A;  4PGT A;  4BWS A;  3ISO A;  4FYC A;  3C73 A;  6GSU A;  3KJY A;  3GKK A;  2O85 A;  3IK7 A;  1TP9 A;  3HCZ A;  2LRN A;  5C00 A;  4XS4 A;  4MPF A;  3MWH A;  4MH3 A;  2CVK A;  3VLN A;  4ZBA A;  4KF9 A;  4IHU A;  2I3Y A;  1UVZ A;  2J23 A;  3QFA C;  3PH9 A;  2VOC A;  3RDW A;  4X0X A;  5J5N A;  5HR2 A;  3IHQ A;  4EXJ A;  2RUF A;  2J9H A;  4TXO B;  4V1A p;  4IJI A;  1HQO A;  4RQR A;  2GDR A;  5KN0 A;  1G0T A;  2VCQ A;  2DIY A;  3L0H A;  3DVW A;  1VF4 A;  3G7Y A;  2X64 A;  1YKA A;  2KLX A;  1MD4 A;  3TRP A;  2ZUP A;  3CSJ A;  3M8N A;  2YNX A;  2TRX A;  4OO5 A;  3GTU B;  2DJ1 A;  3N9J A;  5INY A;  2Z9S A;  3HDC A;  4O92 A;  1GSD A;  1OC3 A;  2LRC A;  1PX6 A;  2P5R A;  1M2D A;  2PGT A;  2E2M A;  2LJK A;  3US3 A;  5ECM B;  4GSN A;  2NPB A;  2RLI A;  4DSS B;  2HLS A;  3P8W A;  3NIV A;  2PUK C;  1AQW A;  3TKS C;  1V40 A;  3A2W A;  4J57 E;  3KP9 A;  3E9J B;  4JBB A;  5IO2 A;  5A5K A;  4NWY A;  4N30 A;  3H8Q A;  1PKW A;  4GQC A;  1G7O A;  1NSW A;  1O81 A;  4K1F A;  1GRX A;  2GT5 A;  2H72 A;  2FA4 A;  5B6N A;  3D4T A;  3UEM A;  5E59 A;  1A2M A;  1CQG A;  4MF6 A;  4ML1 A;  1N8J A;  2FWG A;  1B48 A;  3FR3 A;  5ECS A;  3ZYW A;  2LNS A;  2DBC A;  4XHM A;  2JAD A;  5ENU A;  1XIY A;  4K7I A;  2YWM A;  1G6W A;  1O8X A;  4O32 A;  5B8B A;  2QC7 A;  1DSB A;  1OKD A;  1XVQ A;  2X99 A;  2L4C A;  2NDO A;  1ABA A;  5ECN B;  3GX0 A;  1ST9 A;  5IMF A;  1Z7P A;  4IP6 A;  2NTO A;  4AJ8 A;  4JZQ A;  2LQQ A;  4Z7X A;  2MZC A;  4ACS A;  3KMN A;  3HD5 A;  1TRV A;  5IIZ A;  4AF2 A;  1M9B A;  3GKX A;  2VD1 A;  1K0D A;  5ECR B;  1W89 A;  3A2X A;  1AQX A;  1A0F A;  2VLT A;  3WGE A;  5KN1 A;  3DYR A;  3GA4 A;  1TOF A;  1XWA A;  3TCO A;  3D21 A;  20GS A;  1O85 A;  1ML6 A;  2ZNM A;  1DBY A;  1UC7 A;  2JZT A;  3GH9 A;  5IQY A;  4TKY A;  3HY2 A;  4ECC A;  2ON5 A;  3KTB A;  2HNL A;  3IPZ A;  1ZYE A;  1AW9 A;  2HZE A;  1K0A A;  4BVX A;  4TR4 A;  3M0F A;  1ERW A;  3GYK A;  3G9B A;  2KHP A;  3TKS A;  2OKA A;  5AIS A;  1LJR A;  2H76 A;  1O7U A;  2VIM A;  2H0H A;  1GP1 A;  2C4J A;  4G9H A;  3AY8 A;  2VCZ A;  4TR1 B;  2WGR A;  1R5P A;  1SU9 A;  1MDK A;  3GL5 A;  2JZS A;  5IMZ A;  3MAK A;  4YAP A;  5B8A A;  1ZYQ B;  2C8U A;  3IRA A;  3ERF A;  4XCS A;  1S3C A;  1NW2 A;  2H01 A;  1PQN A;  4EF0 A;  1XWC A;  3G7J A;  4NAX A;  1MDJ A;  1AXD A;  1XFL A;  5D9V A;  1SD8 A;  3QOU A;  3ME7 A;  3ZTL A;  3HVX A;  5DJL A;  5CNW A;  6GSV A;  4X1U A;  1SEN A;  4AGS A;  2O89 A;  1EV4 A;  3HHV A;  2I4A A;  3DWV A;  4FO5 A;  2IPA A;  4IEL A;  3BD2 A;  3ZML A;  4OCF A;  5GST A;  4WF4 A;  2CZ3 A;  4AJ7 A;  4N0Z A;  5DQY A;  3HVV A;  6GST A;  8GSS A;  2GZP A;  2GSQ A;  2L59 A;  4TW5 A;  1GTB A;  2DJ0 A;  3P7X A;  3D6I A;  4PQ1 A;  3PGT A;  3IC8 A;  4WF5 A;  2IME A;  5J9C A;  4D73 B;  1K0B A;  4ZBD A;  4QQ7 A;  5DDL A;  3L9S A;  1JHB A;  4NPB A;  4G10 A;  1GTI A;  1QK8 A;  3I9V 2;  4L0U A;  2DJ2 A;  1ON4 A;  5CRG A;  2HRK B;  2XBI A;  1OC9 B;  4TXV A;  3C1S A;  1TI3 A;  5DAK A;  3WT1 A;  3CMI A;  1EGR A;  4GQF A;  3H93 A;  2GZY A;  4Q5F A;  3HZ4 A;  1RK4 A;  4HS1 A;  3H1N A;  4HQS A;  2ON7 A;  2YJH A;  2C80 A;  3F4S A;  2C3N A;  4TN8 A;  1FG4 A;  3W6G A;  2H30 A;  2B5Y A;  2VLU A;  2VCV A;  3WGX A;  5FHI A;  3GX8 A;  4HZ4 A;  4H86 A;  2LQO A;  2KP1 A;  1R26 A;  2F9S A;  4V2L A;  3LXT A;  5G5F A;  5A4W A;  3KZQ A;  5GAP D;  5IMV A;  4OMV A;  4MAB A;  3GST A;  5FT3 A;  1YQ1 A;  3ZVJ D;  2LTK A;  4XRD A;  4ULX A;  3FY7 A;  2OA7 A;  3LEF A;  2B6M A;  4LL1 B;  4K2D A;  4HJ2 A;  3GUS A;  1BAY A;  3F4R A;  4JU5 A;  4KND A;  3W8J A;  3QD9 A;  4IP1 A;  1AQV A;  1UN2 A;  2CAQ A;  3KP8 A;  2R3X A;  5ECL B;  2P0G A;  3QAV A;  1TJD A;  2C0G A;  1ERV A;  2G2Q A;  1K0O A;  4ZIJ A;  2YV7 A;  5J4U A;  1EZK A;  1A23 A;  1VRS D;  4GTU A;  5G31 A;  2DJJ A;  5G30 A;  4YQM A;  5E4W A;  4I8B A;  2HRA A;  1F2E A;  1W4V A;  3TKP A;  5J3R A;  1U88 A;  1B4P A;  1YF1 A;  4KW6 A;  4GRF A;  4ZB6 A;  3IXR A;  3HYP A;  3UBK A;  1EGO A;  4TVE A;  4OWY A;  1KNG A;  1TU8 A;  3QR6 A;  2XPD A;  3D0Z A;  2PPT A;  2HXK A;  4GST A;  3GRX A;  5H5Q A;  4USS A;  1A2L A;  14GS A;  2MMZ A;  3BCI A;  4I2T A;  2LS5 A;  3E0U A;  5DAL A;  1FB6 A;  4G0K A;  4L5O A;  3EUR A;  3GIX A;  2OE3 A;  4ZL9 A;  1SYX A;  2F3M A;  2GLR A;  3FR9 A;  2IMF A;  2L5L A;  2EIQ A;  4ZL8 A;  1NHY A;  2HI7 A;  1BG5 A;  4WR4 A;  4MH2 A;  3TDG A;  4EKZ A;  1JZR A;  4K8M A;  2GSR A;  5HFI A;  4KX4 A;  1BJX A;  5EY6 A;  4K7O A;  2LJA A;  2CA8 A;  1O8W A;  1FB0 A;  4MJC A;  4TR0 A;  1I5G A;  3DGQ A;  5CP1 A;  4EE0 A;  3O6T A;  3BOA A;  2LST A;  3LWA A;  4NHW A;  3FRC A;  2IFQ B;  3TRX A;  1J9B A;  2MBS A;  2XC2 A;  3L9V A;  5CRH A;  5ECI B;  2V2G A;  2FCH A;  1K0C A;  1HNB A;  5IMC A;  2XPE A;  4PQH A;  4NV5 A;  4BWQ A;  2C3T A;  2P31 A;  1Z6M A;  5JCW A;  5AIX A;  4PNF A;  3UJ1 A;  3FZ4 A;  4ID0 A;  1WMJ A;  4HJM A;  1M2B A;  4EL1 A;  1QMV A;  4BL7 A;  3F3R A;  5KN3 A;  3HZ8 A;  4WXT A;  2H0G A;  2AJQ B;  5IPG A;  4GF0 A;  4JE1 A;  3KXO A;  4CHS A;  2YCD A;  3FR6 A;  3D22 A;  3ZZX A;  5IMA A;  1YZX A;  5LD0 A;  2WCI A;  3P90 A;  1H75 A;  1SJ6 A;  1YF0 A;  4BVY B;  4F0B A;  1B8X A;  4WEY A;  1ILO A;  3E3E A;  3ED3 A;  2HSM A;  3HKR A;  4L5L A;  3KEB A;  5CO3 A;  3GV1 A;  2PN8 A;  4NXI A;  2MMA A;  5JCU A;  3ERW A;  2DML A;  5G1K A;  5EL8 A;  4HEA 2;  2GQM A;  1GTA A;  3L9U A;  3M1G A;  1X9S B;  2GQK A;  4GCI A;  2F8F A;  3CSH A;  3HXS A;  3M3M A;  1OC8 A;  1GSY A;  4IJ3 A;  1TI1 A;  1SJZ A;  3VPT A;  1YEP A;  5CAX A;  1JFU A;  1F9M A;  1T1V A;  5GZZ B;  1T4Z A;  1Y6E A;  5DCG A;  2OAD A;  2MMN A;  2VL2 C;  3DXB A;  4LMW A;  3LJR A;  2H1G A;  2K6V A;  4JED A;  1RW1 A;  3RHC A;  9GSS A;  3I69 A;  3I43 A;  2CAI A;  2G0F A;  4FYB A;  1PSQ A;  3PR8 A;  2B7K A;  3U6V A;  1LU4 A;  4KAE A;  1PN9 A;  4QL7 A;  2NVL A;  3ZMK A;  7GSS A;  2EIR A;  4IS0 A;  1B9Y C;  1U6T A;  1XOA A;  2N5F A;  4POK A;  1JLV A;  1BED A;  3OR5 A;  2AYT A;  3FW2 A;  4OFM A;  2IMK A;  1Z7R A;  4FH8 A;  4ZB9 A;  1H4O A;  2I9H A;  2PBJ A;  1QFN A;  1XBS A;  4EDZ A;  2VD0 A;  2FLS A;  2K8V A;  2QGV A;  1WP0 A;  1SL0 B;  4XS4 B;  1FOV A;  2YPM A;  5A4U A;  2E0Q A;  4XIH A;  3VFI A;  2PVQ A;  2VLV A;  4RQX A;  3QAW A;  2YWO A;  1SKW B;  3TJG A;  2HT9 A;  4YAV A;  3KTL A;  4FIW A;  1GL8 A;  3GKN A;  3LYK A;  4K0G A;  3FYG A;  5JWR B;  4DVC A;  6GSY A;  2H6X A;  4ZL7 A;  1QXH A;  3CXG A;  1MDI A; 
#chains in the Genus database with same CATH topology
 4K0N A;  3IDV A;  3PIN A;  1KBN A;  1M3J A;  1V2A A;  3ZRE A;  3DKS A;  3KH7 A;  2GGT A;  4I2U A;  3TGZ A;  3TJF A;  1BX9 A;  3IC4 A;  5L71 A;  1PKZ A;  2DC5 A;  2WW0 A;  2R2J A;  1FVK A;  3Q6O A;  3O3T A;  1XW9 A;  2B5E A;  1TRW A;  1TRS A;  5ABR A;  4O5R A;  4Z2T A;  3GSS A;  1X9W B;  4HOJ A;  3P2A A;  2FNO A;  4DSR A;  22GS A;  2BTO T;  5D93 A;  1PL2 A;  4KSO A;  2R37 A;  1X5D A;  3IE3 A;  4WKW A;  3NZN A;  2H0I A;  1S4B P;  1YJ6 A;  4POB A;  5CYY A;  1A0R P;  4MMM A;  4KCA A;  2YWN A;  2CZ2 A;  1SD9 A;  5IOW A;  1IYI A;  4BPY A;  1TXX A;  1V9W A;  1XCC A;  1ACV A;  3GMF A;  2GTU A;  1PA3 A;  1MD3 A;  2OE0 A;  4PUF C;  2YWI A;  2WVX B;  3APQ A;  4OFT A;  4J56 E;  4PXO A;  1A8L A;  2B5X A;  2CX3 A;  3UOM A;  2YZU A;  4JRR A;  2GQL A;  3CQF A;  2MMO A;  4KB3 A;  4AJ6 A;  2REM A;  3VWU A;  4MZB A;  1ZOF A;  3IAM 2;  2EFC A;  4PHZ C;  2IWT A;  1GWC A;  2H75 A;  1N2A A;  4TR3 A;  1BG1 A;  1PGT A;  2C0E A;  2DJ3 A;  3EMP A;  2HQT A;  1FVJ A;  3LSZ A;  5AN1 A;  3F6D A;  2CX4 A;  4NMU A;  1Z5Y E;  10GS A;  3HJM A;  2A2P A;  2EIO A;  3A5W A;  2XBQ A;  3C7M A;  1SL2 B;  5FWG A;  2B1K A;  4MJA A;  1A24 A;  5ECH B;  2WJU A;  5GSS A;  2YZH A;  2VUP A;  1TDI A;  1A2J A;  2E2G A;  3DIE A;  3HVS A;  5ECQ B;  5CRD A;  1EV9 A;  2H71 A;  2IN3 A;  5IPH A;  3KH9 A;  2C0F A;  3GKM A;  2FUG 2;  4K7N A;  2D2Z A;  5ID2 A;  2NBS A;  2WW2 A;  4XRA A;  2L4Q A;  2R0P A;  5HQP A;  1TU7 A;  1QQ2 A;  5LNK e;  3SBC A;  5G5E A;  4ZXG A;  3U5R E;  4MJE A;  3F63 A;  5HR1 A;  1NHO A;  1GUM A;  5KN2 A;  4EVM A;  3CBU A;  2GSS A;  3QMX A;  1YKC A;  1U3A A;  2RM6 A;  4ML6 A;  3CYN A;  4XS1 A;  2O3E A;  1XWG A;  3Q74 A;  3KIJ A;  4F9Z A;  1TK8 B;  4GLT A;  2IIY A;  1MTC A;  2HZE B;  2N5A A;  4PTS A;  2IJY A;  4BVX B;  3M9K A;  1TKD B;  3LFL A;  1S3A A;  5D9X A;  2GVP A;  5H5R A;  1FHE A;  2HRN A;  4NV2 A;  3GN3 A;  1EEM A;  4ILF A;  4I5Q A;  4OFN A;  2HZF A;  2HSN B;  3WT2 A;  3CRT A;  2V6O A;  1VF1 A;  1Q98 A;  2XHF A;  2R5G A;  2H1A A;  1OE8 A;  4RI7 A;  3UL3 A;  3HJO A;  4KDU A;  1HD2 A;  3TOT A;  2GT6 A;  1FAA A;  2V41 A;  2X8G A;  3F9U A;  3FHK A;  4Q5Q A;  2BMX A;  2L6D A;  4F82 A;  1O6J A;  4HUA A;  2LUS A;  5EVO A;  5F07 A;  4ECJ A;  1AC1 A;  1PL1 A;  4JR6 A;  3R2Q A;  5IMD A;  4QL9 A;  2CVB A;  1EWX A;  1URM A;  4P3Y B;  1M0U A;  4KUN A;  1ERT A;  3BCK A;  4PI0 C;  1A8Y A;  2CQ9 A;  1HYU A;  1GLQ A;  5IM9 A;  1VGL A;  5BRT A;  2L57 A;  3ZL5 A;  3IK9 A;  4IQA A;  1V57 A;  5J40 A;  3CTG A;  2BJX A;  5ECO B;  1KEB A;  4LLR A;  1M9A A;  3F4T A;  4ISD A;  2M80 A;  16GS A;  3EVI A;  5HR3 A;  2A2R A;  1S3D A;  3QCP A;  4KA0 A;  1YEX A;  3GL3 A;  3MDK A;  4TXO A;  3VI7 A;  1V98 A;  3VPQ A;  3ZVJ A;  1EP7 A;  3UVH A;  5F05 A;  4K9Z A;  3DRN A;  3F3Q A;  2C1Y A;  3TJK A;  3FK8 A;  2H1B A;  4A5P A;  5DAK B;  2HRF A;  2FWF A;  1WOU A;  3D4M A;  4V1A g;  2IL3 A;  1SK0 A;  3GTU A;  4NHZ A;  4MP4 A;  2CT6 A;  2FHE A;  2L5O A;  2PVO C;  1SKS B;  1JZO A;  5G2Z A;  2HFD A;  3JCM L;  1GSU A;  4N11 A;  5AIV A;  1WRY A;  3RFR C;  1R7H A;  4OCE A;  3IR4 A;  1O73 A;  4MF5 A;  2YAN A;  1ZMA A;  5F0G A;  2UZ8 A;  4GXZ A;  4ZIL A;  5DVB A;  1T3B A;  4DSS A;  4HSC X;  1USB A;  2X49 A;  5IOX A;  2R4V A;  4CY8 A;  3EU3 A;  1M7T A;  1QUW A;  1K0M A;  1F3B A;  1XWK A;  1IYH A;  2V6K A;  2KOK A;  5D8I A;  3LG6 A;  1EOG A;  5A5H B;  3H79 A;  3WYW A;  2DKH A;  1ZL9 A;  2LKU A;  13GS A;  4GWR A;  4ECI A;  2H74 A;  1ZZY A;  1X0R A;  1TTZ A;  2JU5 A;  1OAZ A;  12GS A;  4YKF A;  3DEX A;  1VF2 A;  3A5I A;  2EC4 A;  2FWH A;  5A1N B;  5G1L A;  1GSE A;  5A4V A;  2V32 A;  3UIW A;  1R4W A;  3ZLP A;  1HNC A;  3VUR A;  1FW1 A;  4YKG A;  1Y1U A;  1PRX A;  3Q19 A;  4WBJ A;  2O87 A;  4FYU A;  2AB6 A;  4ZB7 A;  1SL1 B;  2K9F A;  3LOR A;  3EYT A;  1I1I P;  4MZC A;  2FGX A;  3TJJ A;  4IGJ A;  17GS A;  1YVL A;  4IN0 A;  1SKR B;  3APS A;  2OBK A;  1XPV A;  4HDE A;  3ZIV A;  4RI6 A;  1CQH A;  4KGI A;  3ME8 A;  2DLX A;  4KSM A;  4OO4 A;  5DAL B;  3GH6 A;  5HFK A;  2ES7 A;  6GSS A;  1GH2 A;  1Q4J A;  4PNG A;  1OVN A;  6GSW A;  2EFD A;  3QPM A;  1X5E A;  3EWL A;  2F51 A;  4EC0 A;  4L0W A;  3UBL A;  4BA7 A;  2JSY A;  1G7E A;  1V58 A;  4KH7 A;  1JZD A;  1M99 A;  4V2M A;  4MDC A;  2OBI A;  3RPN A;  1SYR A;  3VK9 A;  4WET A;  3UAR A;  18GS A;  1DE1 A;  3PPU A;  2N5B A;  1X9M B;  19GS A;  2JZR A;  4MK3 A;  2VO4 A;  1WPI A;  4OD7 A;  2PWJ A;  1RQM A;  4K2X A;  4LMV A;  2PU9 C;  2DMM A;  4IKH A;  1TK0 B;  3IAS 2;  3W8S A;  3LW9 A;  3V1W A;  4I97 A;  2KUC A;  1C72 A;  2WB9 A;  4TR1 A;  5CRW A;  1XVW A;  3FZ5 A;  1K3Y A;  4GSS A;  2WS2 A;  5IO0 A;  4N10 A;  4BL7 B;  3KD0 A;  5ECP B;  3L4N A;  5HFG A;  3CSI A;  3TJB A;  4N0V A;  5A34 A;  1SJI A;  2GS3 A;  2JAC A;  4J2F A;  3F6F A;  5J9B A;  2HYX A;  4YH2 A;  3UMA A;  4FQU A;  4IBP A;  5C04 A;  1E2Y A;  3MIX A;  2K18 A;  1GNW A;  2OE1 A;  5DQS A;  2GST A;  1GNE A;  2DKI A;  5D96 A;  2O8V B;  1B4Q A;  3DML A;  1J0F A;  1XXU A;  2B3S A;  1E6B A;  4O7H A;  1T7P B;  4LL4 B;  2VM1 A;  2HSY A;  2HSM B;  1THX A;  4G19 A;  4AI6 A;  1B9X C;  1XW5 A;  1WJK A;  2C0D A;  3GNJ A;  2B1L A;  3EC3 A;  4LA1 A;  1YDK A;  3QFB C;  1THO A;  3FZ9 A;  2WDU A;  2DIZ A;  5F8B A;  3M9J A;  5H5S A;  5ELA A;  4YQU A;  4DSQ A;  2X8H A;  1J08 A;  5GAN D;  4G2E A;  2P5Q A;  4QMK A;  5JWQ B;  5J47 A;  3LGC A;  4F2I A;  4D73 A;  3GFK A;  1LBK A;  4MCU A;  1M2A A;  5EPF A;  1OKT A;  3KGK A;  2V1M A;  3A3T A;  3ZFB A;  2VL2 A;  5J41 A;  4CW9 A;  2ZCT A;  1JZW A;  1XZO A;  2AUV A;  2HRK A;  3LXZ A;  1OC9 A;  3ERG A;  4TRX A;  4V2N A;  2MYG A;  2VAF A;  3O76 A;  3BBY A;  2AAW A;  4E8H A;  2DJK A;  6GSX A;  4ECB A;  1TK5 B;  3HJP A;  4MJB A;  1AIU A;  2WUL A;  2H19 A;  4POL A;  11GS A;  3J7Y k;  4POM A;  3CWG A;  3VWW A;  4PQI A;  1DUG A;  1TW9 A;  3FMW A;  2WW3 A;  1G6Y A;  4WR5 A;  4PX1 A;  4EUY A;  1UA5 A;  2OAC A;  2GZZ A;  5COH A;  1HNA A;  1U87 A;  3EE2 A;  2R0C A;  5BMU A;  2TRC P;  2I1U A;  3KM6 A;  2I81 A;  5D73 A;  1DE2 A;  2OJL A;  1NM3 A;  4Q5R A;  4ZBB A;  3ZIT A;  2M46 A;  4G01 A;  1AUC A;  3EMX A;  1F3A A;  2H6Z A;  4F03 A;  1R5A A;  2IMI A;  4G0I A;  1JLW A;  2C3Q A;  1T00 A;  4WBR D;  5KEJ A;  2QKE A;  2VCW A;  4MA9 A;  2YOI A;  5AGY A;  2A4V A;  2E7P A;  2JL4 A;  4PUA A;  2H6Y A;  1K3L A;  1GSS A;  4MZW A;  2YP6 A;  4TOP A;  1U3I A;  2MBT A;  1I9D A;  4G0L A;  1Z9H A;  3N5O A;  2TIR A;  3D5J A;  3WGD A;  2H8L A;  4HU9 A;  3DD3 A;  1GSQ A;  5B6M A;  3TOU A;  2VM2 A;  1XW6 A;  2AV4 A;  2FWE A;  3APO A;  3WD6 A;  3HA9 A;  2RII A;  3F8U A;  3RAZ A;  1K0N A;  1T4Y A;  2X4A A;  4DEJ A;  4E8E A;  1YY7 A;  1TRU A;  1Z3E A;  2B7J A;  2FD3 A;  2WVY A;  4ZB8 A;  2KP2 A;  3J7Y b;  3TB2 A;  1GSF A;  1OYJ A;  3L78 A;  2YV9 A;  2VL9 A;  5J4V A;  3QAG A;  5ELG A;  4X43 A;  3A2V A;  4PUR A;  4K6X A;  3TRQ A;  4KDX A;  3LYP A;  3VWV A;  1T8E B;  5LCZ A;  1OE7 A;  3SWL A;  2ALB A;  4AKH A;  5J4Y A;  1SK2 A;  2LNT A;  4EO3 A;  5F06 A;  1F6M C;  1GTU A;  2PMT A;  2AHE A;  2IFQ A;  3GUR A;  3C1R A;  1WIK A;  2IMD A;  4KCE A;  3VI5 A;  3VWX A;  3R3E A;  3EU4 A;  4EIQ A;  4YQV A;  1WE0 A;  1K3O A;  4KE3 A;  1PD2 1;  1AAZ A;  3RPP A;  2M72 A;  2PER A;  4Q5N A;  2K8S A;  5D9W A;  3H4K A;  1ERU A;  1Y25 A;  4MF7 A;  4AKI A;  3ZFL A;  1EOH A;  5B7C A;  1Z6N A;  2RM5 A;  2A2S A;  1QGV A;  2R0G A;  4IVF A;  2X8C A;  4N3Z A;  4HZ2 A;  3KCM A;  2LJR A;  3KMO A;  3IA1 A;  1BF5 A;  3K8N A;  1BYE A;  5JWO B;  1FO5 A;  4Z2U A;  1XWB A;  2VCT A;  2O7K A;  3I6A A;  5DJM A;  4MPG A;  4XS6 A;  5ID2 B;  5ECK B;  2CVD A;  2O36 A;  4KDY A;  2EFE A;  2CV4 A;  3TKR A;  2YJ7 A;  4BVY A;  1PMT A;  1GLP A;  1KTE A;  4IQ1 A;  3EIN A;  2UV8 G;  3C71 A;  3FEU A;  4XTS A;  3TKS E;  3S9F A;  3Q18 A;  4L8E A;  4RUV A;  4MLY A;  3UVT A;  2RUE A;  2JSZ A;  3MSZ A;  5DBQ A;  2WZ9 A;  4IW9 A;  3RBT A;  1ZGN A;  2R6K A;  4JR4 A;  2F8A A;  3DVX A;  3MYD A;  2WRT A;  4HQZ A;  1VF3 A;  3QDN A;  3IOS A;  2H70 A;  2DSA A;  2LEG A;  2H66 A;  3FKF A;  2LRT A;  2H1D A;  2L6C A;  1F37 A;  4HU7 A;  3TKQ A;  2VCX A;  2H73 A;  3HMJ G;  1S3R A;  3CTF A;  3ZIJ A;  1PX7 A;  4EDY A;  3BJ5 A;  3G7I A;  1ZCP A;  4F0C A;  5HR0 A;  1X5C A;  5CRE A;  3TUE A;  4CDO A;  1XOB A;  2HE3 A;  3RHB A;  3ZRD A;  5DCH A;  1WWJ A;  2QA2 A;  1EEJ A;  4HI7 A;  1GUL A;  3MNG A;  3GHA A;  2WFC A;  2LV3 A;  2QSI A;  1BQ7 A;  5JCG A;  3UAP A;  2HSH A;  3LQ7 A;  5D9T A;  2YN1 A;  1GUK A;  1SK1 A;  1GUH A;  3CRU A;  2FA8 A;  2VL3 A;  4I6X A;  3NOF A;  1EP8 A;  2FY6 A;  3IV4 A;  3IBH A;  3F0I A;  3C8E A;  3FZA A;  1MEK A;  4PGT A;  4BWS A;  3ISO A;  4FYC A;  3C73 A;  6GSU A;  3KJY A;  3GKK A;  2O85 A;  3IK7 A;  1TP9 A;  3HCZ A;  2LRN A;  5C00 A;  4XS4 A;  4MPF A;  3MWH A;  4MH3 A;  2CVK A;  3VLN A;  4ZBA A;  4KF9 A;  4IHU A;  2I3Y A;  2A4H A;  1UVZ A;  2J23 A;  3QFA C;  3PH9 A;  2VOC A;  3RDW A;  4X0X A;  5J5N A;  5HR2 A;  3IHQ A;  2VKZ G;  4EXJ A;  2RUF A;  2J9H A;  4TXO B;  4V1A p;  4IJI A;  1HQO A;  1TXU A;  4RQR A;  2GDR A;  5KN0 A;  1G0T A;  2VCQ A;  2DIY A;  3L0H A;  3DVW A;  1VF4 A;  3G7Y A;  2X64 A;  1YKA A;  2KLX A;  1MD4 A;  3TRP A;  2ZUP A;  3CSJ A;  3M8N A;  4MNN A;  2YNX A;  2TRX A;  4OO5 A;  3GTU B;  2DJ1 A;  3N9J A;  5INY A;  2Z9S A;  3HDC A;  4O92 A;  1GSD A;  1OC3 A;  2LRC A;  1PX6 A;  2P5R A;  1M2D A;  2PGT A;  2E2M A;  2LJK A;  3US3 A;  2WVZ A;  5ECM B;  4GSN A;  2NPB A;  2RLI A;  4DSS B;  2HLS A;  3P8W A;  3NIV A;  2PUK C;  1AQW A;  3TKS C;  1V40 A;  3A2W A;  4J57 E;  3KP9 A;  3E9J B;  4JBB A;  4K5R A;  5IO2 A;  5A5K A;  2WVX A;  4NWY A;  4N30 A;  3H8Q A;  1PKW A;  4GQC A;  1G7O A;  1NSW A;  1O81 A;  4K1F A;  1GRX A;  2GT5 A;  3HVN A;  2H72 A;  2FA4 A;  5B6N A;  3D4T A;  3UEM A;  5E59 A;  1A2M A;  1CQG A;  4MF6 A;  4ML1 A;  1N8J A;  2FWG A;  1B48 A;  3FR3 A;  5ECS A;  3ZYW A;  2LNS A;  2DBC A;  4XHM A;  2JAD A;  5ENU A;  1YEW C;  1XIY A;  4K7I A;  2YWM A;  1G6W A;  4PI2 C;  1O8X A;  4O32 A;  5B8B A;  2QC7 A;  1DSB A;  1OKD A;  1XVQ A;  2X99 A;  2L4C A;  2NDO A;  1ABA A;  1SVM A;  5ECN B;  3GX0 A;  1ST9 A;  5IMF A;  1Z7P A;  4IP6 A;  2NTO A;  4AJ8 A;  4JZQ A;  2LQQ A;  4Z7X A;  2MZC A;  4ACS A;  3KMN A;  3HD5 A;  1TRV A;  5IIZ A;  4AF2 A;  1M9B A;  3GKX A;  4EIP A;  2VD1 A;  1K0D A;  5ECR B;  1W89 A;  3A2X A;  1AQX A;  1A0F A;  2VLT A;  3WGE A;  5KN1 A;  3DYR A;  4GDF A;  3GA4 A;  1TOF A;  1XWA A;  3TCO A;  3D21 A;  20GS A;  1O85 A;  1ML6 A;  2ZNM A;  1DBY A;  1UC7 A;  1XG8 A;  2JZT A;  3GH9 A;  5IQY A;  4TKY A;  3HY2 A;  4ECC A;  2ON5 A;  3KTB A;  2HNL A;  3IPZ A;  1ZYE A;  1AW9 A;  2HZE A;  1K0A A;  4BVX A;  4TR4 A;  3M0F A;  1ERW A;  3GYK A;  3G9B A;  2KHP A;  3TKS A;  2OKA A;  2WW1 A;  5AIS A;  1LJR A;  2HSN A;  3TU3 B;  2H76 A;  1O7U A;  2VIM A;  2H0H A;  1GP1 A;  2C4J A;  4G9H A;  3AY8 A;  2VCZ A;  4TR1 B;  2WGR A;  1R5P A;  1SU9 A;  1MDK A;  3GL5 A;  2JZS A;  5IMZ A;  3MAK A;  4YAP A;  5B8A A;  4FXY P;  1ZYQ B;  2C8U A;  3IRA A;  3ERF A;  4XCS A;  1S3C A;  1NW2 A;  2H01 A;  1PQN A;  4EF0 A;  5A34 B;  1XWC A;  3G7J A;  4NAX A;  1MDJ A;  1AXD A;  1XFL A;  5D9V A;  1SD8 A;  3QOU A;  3ME7 A;  3ZTL A;  3HVX A;  5DJL A;  5CNW A;  6GSV A;  4X1U A;  1SEN A;  4AGS A;  2O89 A;  1EV4 A;  3HHV A;  2I4A A;  3DWV A;  4FO5 A;  2IPA A;  4IEL A;  4BIK A;  3BD2 A;  3ZML A;  4OCF A;  5GST A;  4WF4 A;  2CZ3 A;  4AJ7 A;  4N0Z A;  5DQY A;  3HVV A;  6GST A;  8GSS A;  2GZP A;  2GSQ A;  2L59 A;  4TW5 A;  1GTB A;  2DJ0 A;  3P7X A;  3D6I A;  4PQ1 A;  3PGT A;  4AKG A;  3IC8 A;  4WF5 A;  1SVO A;  4O5U A;  2IME A;  5J9C A;  4D73 B;  1K0B A;  4ZBD A;  4QQ7 A;  5DDL A;  3L9S A;  1JHB A;  4NPB A;  4G10 A;  1GTI A;  1QK8 A;  3I9V 2;  4L0U A;  2DJ2 A;  1ON4 A;  5CRG A;  2QA1 A;  2HRK B;  2XBI A;  1OC9 B;  4TXV A;  3C1S A;  1TI3 A;  5KOX A;  5DAK A;  3WT1 A;  3CMI A;  1EGR A;  4GQF A;  3H93 A;  2GZY A;  4Q5F A;  3HZ4 A;  1RK4 A;  4HS1 A;  3H1N A;  4HQS A;  2ON7 A;  2YJH A;  2C80 A;  3F4S A;  2C3N A;  4TN8 A;  1FG4 A;  3W6G A;  2H30 A;  2B5Y A;  2VLU A;  4ICY A;  2VCV A;  3WGX A;  5FHI A;  3GX8 A;  4HZ4 A;  4H86 A;  2LQO A;  2KP1 A;  1R26 A;  2F9S A;  4V2L A;  3LXT A;  5G5F A;  5A4W A;  5BMU B;  3KZQ A;  5GAP D;  1PFO A;  5IMV A;  4OMV A;  4MAB A;  3GST A;  5FT3 A;  1YQ1 A;  3ZVJ D;  1ZYN A;  2LTK A;  4XRD A;  4ULX A;  3FY7 A;  2OA7 A;  3LEF A;  2B6M A;  4LL1 B;  4K2D A;  4HJ2 A;  3GUS A;  1BAY A;  3F4R A;  4JU5 A;  4KND A;  3W8J A;  3QD9 A;  4IP1 A;  1AQV A;  1UN2 A;  5A5H A;  2CAQ A;  3KP8 A;  2R3X A;  5ECL B;  2P0G A;  3QAV A;  1TJD A;  2C0G A;  1ERV A;  2G2Q A;  1K0O A;  4ZIJ A;  2YV7 A;  5J4U A;  1EZK A;  1A23 A;  1VRS D;  2EFH A;  4GTU A;  5G31 A;  2DJJ A;  5G30 A;  4YQM A;  1PN0 A;  5E4W A;  4I8B A;  2HRA A;  1F2E A;  3RGB C;  1W4V A;  5A1N A;  3TKP A;  5J3R A;  1U88 A;  1B4P A;  1YF1 A;  4KW6 A;  4GRF A;  4ZB6 A;  3IXR A;  3HYP A;  3EPT A;  3UBK A;  1EGO A;  4TVE A;  4OWY A;  1KNG A;  1TU8 A;  3QR6 A;  2XPD A;  3D0Z A;  2PPT A;  2HXK A;  4GST A;  3GRX A;  5H5Q A;  4USS A;  1A2L A;  14GS A;  2MMZ A;  3BCI A;  4I2T A;  2LS5 A;  3IHG A;  3E0U A;  5DAL A;  1FB6 A;  4G0K A;  4L5O A;  3EUR A;  3GIX A;  2OE3 A;  4ZL9 A;  1SYX A;  2F3M A;  2GLR A;  3FR9 A;  2IMF A;  2L5L A;  2EIQ A;  4ZL8 A;  1NHY A;  2HI7 A;  1BG5 A;  4WR4 A;  4MH2 A;  3TDG A;  4EKZ A;  1JZR A;  4K8M A;  2GSR A;  5HFI A;  4KX4 A;  1BJX A;  5EY6 A;  4K7O A;  2LJA A;  2CA8 A;  1O8W A;  1FB0 A;  4MJC A;  4TR0 A;  1I5G A;  3DGQ A;  5CP1 A;  4EE0 A;  3O6T A;  3BOA A;  2LST A;  3LWA A;  4NHW A;  3FRC A;  2IFQ B;  4X4J A;  3TRX A;  1J9B A;  2MBS A;  2XC2 A;  1SVL A;  3L9V A;  5CRH A;  5ECI B;  2V2G A;  2FCH A;  1K0C A;  1HNB A;  5IMC A;  1ZYP A;  2XPE A;  4PQH A;  4NV5 A;  4BWQ A;  2C3T A;  2P31 A;  1Z6M A;  5JCW A;  2O5V A;  5AIX A;  4PNF A;  3UJ1 A;  3FZ4 A;  4ID0 A;  1WMJ A;  4HJM A;  1M2B A;  4EL1 A;  1QMV A;  4BL7 A;  2WZS A;  3F3R A;  5KN3 A;  3HZ8 A;  4WXT A;  2H0G A;  2AJQ B;  5IPG A;  4GF0 A;  4JE1 A;  3KXO A;  4CHS A;  2YCD A;  3FR6 A;  3D22 A;  3ZZX A;  5IMA A;  1YZX A;  5LD0 A;  4E68 A;  2WCI A;  3P90 A;  1H75 A;  1SJ6 A;  1YF0 A;  4BVY B;  4F0B A;  1B8X A;  4WEY A;  1ILO A;  3E3E A;  3ED3 A;  2HSM A;  3HKR A;  4L5L A;  3KEB A;  5CO3 A;  3GV1 A;  2PN8 A;  4NXI A;  2MMA A;  5JCU A;  3ERW A;  2DML A;  5G1K A;  5EL8 A;  4HEA 2;  2GQM A;  1GTA A;  3L9U A;  3M1G A;  1X9S B;  2GQK A;  4GCI A;  2F8F A;  3CSH A;  3HXS A;  3M3M A;  1OC8 A;  1GSY A;  4W66 A;  4IJ3 A;  1TI1 A;  3CHX C;  1SJZ A;  3VPT A;  1YEP A;  5CAX A;  1JFU A;  1F9M A;  1T1V A;  5GZZ B;  4O5Q A;  1T4Z A;  1Y6E A;  5DCG A;  2OAD A;  2H1L A;  2MMN A;  2VL2 C;  3DXB A;  4LMW A;  3LJR A;  2H1G A;  2K6V A;  4JED A;  1RW1 A;  3RHC A;  4AKX B;  9GSS A;  3I69 A;  3I43 A;  2CAI A;  2G0F A;  4FYB A;  4CY6 A;  1PSQ A;  3PR8 A;  2B7K A;  3U6V A;  1LU4 A;  2OT3 A;  4KAE A;  1PN9 A;  1M3I A;  4QL7 A;  2NVL A;  1FOH A;  3ZMK A;  7GSS A;  2EIR A;  4IS0 A;  1B9Y C;  1U6T A;  1XOA A;  2N5F A;  4POK A;  1JLV A;  1BED A;  3OR5 A;  2AYT A;  3FW2 A;  4OFM A;  2IMK A;  1Z7R A;  4FH8 A;  4ZB9 A;  1H4O A;  2I9H A;  2PBJ A;  1QFN A;  1XBS A;  4EDZ A;  2VD0 A;  2FLS A;  2K8V A;  2QGV A;  1WP0 A;  1SL0 B;  4XS4 B;  1FOV A;  1N25 A;  2YPM A;  5A4U A;  2E0Q A;  4XIH A;  5KOW A;  3VFI A;  2PVQ A;  2VLV A;  4RQX A;  3QAW A;  2YWO A;  4Z2R A;  1SKW B;  3TJG A;  2HT9 A;  4YAV A;  3KTL A;  4FIW A;  1GL8 A;  3GKN A;  3LYK A;  4K0G A;  3FYG A;  5JWR B;  4DVC A;  4K5S A;  6GSY A;  2H6X A;  4ZL7 A;  1QXH A;  3CXG A;  1MDI A; 
#chains in the Genus database with same CATH homology
 4K0N A;  3IDV A;  3PIN A;  1KBN A;  1V2A A;  3ZRE A;  3DKS A;  3KH7 A;  2GGT A;  4I2U A;  3TGZ A;  3TJF A;  1BX9 A;  3IC4 A;  5L71 A;  1PKZ A;  2DC5 A;  2R2J A;  1FVK A;  3Q6O A;  3O3T A;  1XW9 A;  2B5E A;  1TRW A;  1TRS A;  5ABR A;  4O5R A;  4Z2T A;  3GSS A;  1X9W B;  4HOJ A;  3P2A A;  2FNO A;  4DSR A;  22GS A;  2BTO T;  5D93 A;  1PL2 A;  4KSO A;  2R37 A;  1X5D A;  3IE3 A;  4WKW A;  3NZN A;  2H0I A;  1YJ6 A;  4POB A;  5CYY A;  1A0R P;  4MMM A;  4KCA A;  2YWN A;  2CZ2 A;  1SD9 A;  5IOW A;  1IYI A;  4BPY A;  1TXX A;  1V9W A;  1XCC A;  1ACV A;  3GMF A;  2GTU A;  1PA3 A;  1MD3 A;  2OE0 A;  4PUF C;  2YWI A;  3APQ A;  4OFT A;  4J56 E;  4PXO A;  1A8L A;  2B5X A;  2CX3 A;  3UOM A;  2YZU A;  4JRR A;  2GQL A;  2MMO A;  4KB3 A;  4AJ6 A;  2REM A;  3VWU A;  4MZB A;  1ZOF A;  3IAM 2;  2EFC A;  2IWT A;  1GWC A;  2H75 A;  1N2A A;  4TR3 A;  1BG1 A;  1PGT A;  2C0E A;  2DJ3 A;  3EMP A;  2HQT A;  1FVJ A;  3LSZ A;  5AN1 A;  3F6D A;  2CX4 A;  4NMU A;  1Z5Y E;  10GS A;  3HJM A;  2A2P A;  2EIO A;  3A5W A;  2XBQ A;  3C7M A;  1SL2 B;  5FWG A;  2B1K A;  4MJA A;  1A24 A;  5ECH B;  2WJU A;  5GSS A;  2YZH A;  2VUP A;  1TDI A;  1A2J A;  2E2G A;  3DIE A;  3HVS A;  5ECQ B;  5CRD A;  1EV9 A;  2H71 A;  2IN3 A;  5IPH A;  3KH9 A;  2C0F A;  3GKM A;  2FUG 2;  4K7N A;  2D2Z A;  5ID2 A;  2NBS A;  4XRA A;  2L4Q A;  2R0P A;  5HQP A;  1TU7 A;  1QQ2 A;  5LNK e;  3SBC A;  5G5E A;  4ZXG A;  3U5R E;  4MJE A;  3F63 A;  5HR1 A;  1NHO A;  1GUM A;  5KN2 A;  4EVM A;  3CBU A;  2GSS A;  3QMX A;  1YKC A;  1U3A A;  2RM6 A;  4ML6 A;  3CYN A;  4XS1 A;  1XWG A;  3Q74 A;  3KIJ A;  4F9Z A;  1TK8 B;  4GLT A;  2IIY A;  1MTC A;  2HZE B;  2N5A A;  4PTS A;  2IJY A;  4BVX B;  3M9K A;  1TKD B;  3LFL A;  1S3A A;  5D9X A;  2GVP A;  5H5R A;  1FHE A;  2HRN A;  4NV2 A;  3GN3 A;  1EEM A;  4ILF A;  4I5Q A;  4OFN A;  2HZF A;  2HSN B;  3WT2 A;  3CRT A;  2V6O A;  1VF1 A;  1Q98 A;  2XHF A;  2R5G A;  2H1A A;  1OE8 A;  4RI7 A;  3UL3 A;  3HJO A;  4KDU A;  1HD2 A;  3TOT A;  2GT6 A;  1FAA A;  2V41 A;  2X8G A;  3F9U A;  3FHK A;  4Q5Q A;  2BMX A;  2L6D A;  4F82 A;  1O6J A;  4HUA A;  2LUS A;  5EVO A;  5F07 A;  4ECJ A;  1AC1 A;  1PL1 A;  4JR6 A;  3R2Q A;  5IMD A;  4QL9 A;  2CVB A;  1EWX A;  1URM A;  4P3Y B;  1M0U A;  4KUN A;  1ERT A;  3BCK A;  1A8Y A;  2CQ9 A;  1HYU A;  1GLQ A;  5IM9 A;  1VGL A;  5BRT A;  2L57 A;  3ZL5 A;  3IK9 A;  4IQA A;  1V57 A;  5J40 A;  3CTG A;  2BJX A;  5ECO B;  1KEB A;  4LLR A;  1M9A A;  3F4T A;  4ISD A;  2M80 A;  16GS A;  3EVI A;  5HR3 A;  2A2R A;  1S3D A;  3QCP A;  4KA0 A;  1YEX A;  3GL3 A;  3MDK A;  4TXO A;  3VI7 A;  1V98 A;  3VPQ A;  3ZVJ A;  1EP7 A;  3UVH A;  5F05 A;  4K9Z A;  3DRN A;  3F3Q A;  2C1Y A;  3TJK A;  3FK8 A;  2H1B A;  4A5P A;  5DAK B;  2HRF A;  2FWF A;  1WOU A;  3D4M A;  4V1A g;  2IL3 A;  1SK0 A;  3GTU A;  4NHZ A;  4MP4 A;  2CT6 A;  2FHE A;  2L5O A;  2PVO C;  1SKS B;  1JZO A;  5G2Z A;  2HFD A;  3JCM L;  1GSU A;  4N11 A;  5AIV A;  1WRY A;  4OCE A;  1R7H A;  3IR4 A;  1O73 A;  4MF5 A;  2YAN A;  1ZMA A;  5F0G A;  2UZ8 A;  4GXZ A;  4ZIL A;  5DVB A;  1T3B A;  4DSS A;  1USB A;  2X49 A;  5IOX A;  2R4V A;  4CY8 A;  3EU3 A;  1M7T A;  1QUW A;  1K0M A;  1F3B A;  1XWK A;  1IYH A;  2V6K A;  2KOK A;  5D8I A;  3LG6 A;  1EOG A;  5A5H B;  3H79 A;  3WYW A;  2DKH A;  1ZL9 A;  2LKU A;  13GS A;  4GWR A;  4ECI A;  2H74 A;  1ZZY A;  1X0R A;  1TTZ A;  2JU5 A;  1OAZ A;  12GS A;  4YKF A;  3DEX A;  1VF2 A;  3A5I A;  2EC4 A;  2FWH A;  5A1N B;  5G1L A;  1GSE A;  5A4V A;  2V32 A;  3UIW A;  1R4W A;  3ZLP A;  1HNC A;  3VUR A;  1FW1 A;  4YKG A;  1Y1U A;  1PRX A;  3Q19 A;  4WBJ A;  2O87 A;  4FYU A;  2AB6 A;  4ZB7 A;  1SL1 B;  2K9F A;  3LOR A;  3EYT A;  4MZC A;  2FGX A;  3TJJ A;  4IGJ A;  17GS A;  1YVL A;  4IN0 A;  1SKR B;  3APS A;  2OBK A;  1XPV A;  4HDE A;  3ZIV A;  4RI6 A;  1CQH A;  4KGI A;  3ME8 A;  2DLX A;  4KSM A;  4OO4 A;  5DAL B;  3GH6 A;  5HFK A;  2ES7 A;  6GSS A;  1GH2 A;  1Q4J A;  4PNG A;  1OVN A;  6GSW A;  2EFD A;  3QPM A;  1X5E A;  3EWL A;  2F51 A;  4EC0 A;  4L0W A;  3UBL A;  4BA7 A;  2JSY A;  1G7E A;  1V58 A;  4KH7 A;  1JZD A;  1M99 A;  4V2M A;  4MDC A;  2OBI A;  3RPN A;  1SYR A;  3VK9 A;  4WET A;  3UAR A;  18GS A;  1DE1 A;  3PPU A;  2N5B A;  1X9M B;  19GS A;  2JZR A;  4MK3 A;  2VO4 A;  1WPI A;  4OD7 A;  2PWJ A;  1RQM A;  4K2X A;  4LMV A;  2PU9 C;  2DMM A;  4IKH A;  1TK0 B;  3IAS 2;  3W8S A;  3LW9 A;  3V1W A;  4I97 A;  2KUC A;  1C72 A;  2WB9 A;  4TR1 A;  5CRW A;  1XVW A;  3FZ5 A;  1K3Y A;  4GSS A;  2WS2 A;  5IO0 A;  4N10 A;  4BL7 B;  3KD0 A;  5ECP B;  3L4N A;  5HFG A;  3CSI A;  3TJB A;  4N0V A;  5A34 A;  1SJI A;  2GS3 A;  2JAC A;  4J2F A;  3F6F A;  5J9B A;  2HYX A;  4YH2 A;  3UMA A;  4FQU A;  4IBP A;  5C04 A;  1E2Y A;  3MIX A;  2K18 A;  1GNW A;  2OE1 A;  5DQS A;  2GST A;  1GNE A;  2DKI A;  5D96 A;  2O8V B;  1B4Q A;  3DML A;  1J0F A;  1XXU A;  2B3S A;  1E6B A;  4O7H A;  1T7P B;  4LL4 B;  2VM1 A;  2HSY A;  2HSM B;  1THX A;  4G19 A;  4AI6 A;  1B9X C;  1XW5 A;  1WJK A;  2C0D A;  3GNJ A;  2B1L A;  3EC3 A;  4LA1 A;  1YDK A;  3QFB C;  1THO A;  3FZ9 A;  2WDU A;  2DIZ A;  5F8B A;  3M9J A;  5H5S A;  5ELA A;  4YQU A;  4DSQ A;  2X8H A;  1J08 A;  5GAN D;  4G2E A;  2P5Q A;  4QMK A;  5JWQ B;  5J47 A;  3LGC A;  4F2I A;  4D73 A;  3GFK A;  1LBK A;  4MCU A;  1M2A A;  5EPF A;  1OKT A;  3KGK A;  2V1M A;  3A3T A;  3ZFB A;  2VL2 A;  5J41 A;  4CW9 A;  2ZCT A;  1JZW A;  1XZO A;  2AUV A;  2HRK A;  3LXZ A;  1OC9 A;  3ERG A;  4TRX A;  4V2N A;  2MYG A;  2VAF A;  3O76 A;  3BBY A;  2AAW A;  4E8H A;  2DJK A;  6GSX A;  4ECB A;  1TK5 B;  3HJP A;  4MJB A;  1AIU A;  2WUL A;  2H19 A;  4POL A;  11GS A;  3J7Y k;  4POM A;  3CWG A;  3VWW A;  4PQI A;  1DUG A;  1TW9 A;  3FMW A;  1G6Y A;  4WR5 A;  4PX1 A;  4EUY A;  1UA5 A;  2OAC A;  2GZZ A;  5COH A;  1HNA A;  1U87 A;  3EE2 A;  2R0C A;  5BMU A;  2TRC P;  2I1U A;  3KM6 A;  2I81 A;  5D73 A;  1DE2 A;  2OJL A;  1NM3 A;  4Q5R A;  4ZBB A;  3ZIT A;  2M46 A;  4G01 A;  1AUC A;  3EMX A;  1F3A A;  2H6Z A;  4F03 A;  1R5A A;  2IMI A;  4G0I A;  1JLW A;  2C3Q A;  1T00 A;  4WBR D;  5KEJ A;  2QKE A;  2VCW A;  4MA9 A;  2YOI A;  5AGY A;  2A4V A;  2E7P A;  2JL4 A;  4PUA A;  2H6Y A;  1K3L A;  1GSS A;  4MZW A;  2YP6 A;  4TOP A;  1U3I A;  2MBT A;  1I9D A;  4G0L A;  1Z9H A;  3N5O A;  2TIR A;  3D5J A;  3WGD A;  2H8L A;  4HU9 A;  3DD3 A;  1GSQ A;  5B6M A;  3TOU A;  2VM2 A;  1XW6 A;  2AV4 A;  2FWE A;  3APO A;  3WD6 A;  3HA9 A;  2RII A;  3F8U A;  3RAZ A;  1K0N A;  1T4Y A;  2X4A A;  4DEJ A;  4E8E A;  1YY7 A;  1TRU A;  1Z3E A;  2B7J A;  2FD3 A;  4ZB8 A;  2KP2 A;  3J7Y b;  3TB2 A;  1GSF A;  1OYJ A;  3L78 A;  2YV9 A;  2VL9 A;  5J4V A;  3QAG A;  5ELG A;  4X43 A;  3A2V A;  4PUR A;  4K6X A;  3TRQ A;  4KDX A;  3LYP A;  3VWV A;  1T8E B;  5LCZ A;  1OE7 A;  3SWL A;  2ALB A;  4AKH A;  5J4Y A;  1SK2 A;  2LNT A;  4EO3 A;  5F06 A;  1F6M C;  1GTU A;  2PMT A;  2AHE A;  2IFQ A;  3GUR A;  3C1R A;  1WIK A;  2IMD A;  4KCE A;  3VI5 A;  3VWX A;  3R3E A;  3EU4 A;  4EIQ A;  4YQV A;  1WE0 A;  1K3O A;  4KE3 A;  1PD2 1;  1AAZ A;  3RPP A;  2M72 A;  2PER A;  4Q5N A;  2K8S A;  5D9W A;  3H4K A;  1ERU A;  1Y25 A;  4MF7 A;  4AKI A;  3ZFL A;  1EOH A;  5B7C A;  1Z6N A;  2RM5 A;  2A2S A;  1QGV A;  2R0G A;  4IVF A;  2X8C A;  4N3Z A;  4HZ2 A;  3KCM A;  2LJR A;  3KMO A;  3IA1 A;  1BF5 A;  3K8N A;  1BYE A;  5JWO B;  1FO5 A;  4Z2U A;  1XWB A;  2VCT A;  2O7K A;  3I6A A;  5DJM A;  4MPG A;  4XS6 A;  5ID2 B;  5ECK B;  2CVD A;  4KDY A;  2EFE A;  2CV4 A;  3TKR A;  2YJ7 A;  4BVY A;  1PMT A;  1GLP A;  1KTE A;  4IQ1 A;  3EIN A;  2UV8 G;  3C71 A;  3FEU A;  4XTS A;  3TKS E;  3S9F A;  3Q18 A;  4L8E A;  4RUV A;  4MLY A;  3UVT A;  2RUE A;  2JSZ A;  3MSZ A;  5DBQ A;  2WZ9 A;  4IW9 A;  3RBT A;  1ZGN A;  2R6K A;  4JR4 A;  2F8A A;  3DVX A;  3MYD A;  2WRT A;  4HQZ A;  1VF3 A;  3QDN A;  3IOS A;  2H70 A;  2DSA A;  2LEG A;  2H66 A;  3FKF A;  2LRT A;  2H1D A;  2L6C A;  1F37 A;  4HU7 A;  3TKQ A;  2VCX A;  2H73 A;  3HMJ G;  3CTF A;  3ZIJ A;  1PX7 A;  4EDY A;  3BJ5 A;  3G7I A;  1ZCP A;  4F0C A;  5HR0 A;  1X5C A;  5CRE A;  3TUE A;  4CDO A;  1XOB A;  2HE3 A;  3RHB A;  3ZRD A;  5DCH A;  1WWJ A;  2QA2 A;  1EEJ A;  4HI7 A;  1GUL A;  3MNG A;  3GHA A;  2WFC A;  2LV3 A;  2QSI A;  1BQ7 A;  5JCG A;  3UAP A;  2HSH A;  3LQ7 A;  5D9T A;  2YN1 A;  1GUK A;  1SK1 A;  1GUH A;  3CRU A;  2FA8 A;  2VL3 A;  4I6X A;  3NOF A;  1EP8 A;  2FY6 A;  3IV4 A;  3IBH A;  3F0I A;  3C8E A;  3FZA A;  1MEK A;  4PGT A;  4BWS A;  3ISO A;  4FYC A;  3C73 A;  6GSU A;  3KJY A;  3GKK A;  2O85 A;  3IK7 A;  1TP9 A;  3HCZ A;  2LRN A;  5C00 A;  4XS4 A;  4MPF A;  3MWH A;  4MH3 A;  2CVK A;  3VLN A;  4ZBA A;  4KF9 A;  4IHU A;  2I3Y A;  2A4H A;  1UVZ A;  2J23 A;  3QFA C;  3PH9 A;  2VOC A;  3RDW A;  4X0X A;  5J5N A;  5HR2 A;  3IHQ A;  2VKZ G;  4EXJ A;  2RUF A;  2J9H A;  4TXO B;  4V1A p;  4IJI A;  1HQO A;  1TXU A;  4RQR A;  2GDR A;  5KN0 A;  1G0T A;  2VCQ A;  2DIY A;  3L0H A;  3DVW A;  1VF4 A;  3G7Y A;  2X64 A;  1YKA A;  2KLX A;  1MD4 A;  3TRP A;  2ZUP A;  3CSJ A;  3M8N A;  4MNN A;  2YNX A;  2TRX A;  4OO5 A;  3GTU B;  2DJ1 A;  3N9J A;  5INY A;  2Z9S A;  3HDC A;  4O92 A;  1GSD A;  1OC3 A;  2LRC A;  1PX6 A;  2P5R A;  1M2D A;  2PGT A;  2E2M A;  2LJK A;  3US3 A;  5ECM B;  4GSN A;  2NPB A;  2RLI A;  4DSS B;  2HLS A;  3P8W A;  3NIV A;  2PUK C;  1AQW A;  3TKS C;  1V40 A;  3A2W A;  4J57 E;  3KP9 A;  3E9J B;  4JBB A;  4K5R A;  5IO2 A;  5A5K A;  4NWY A;  4N30 A;  3H8Q A;  1PKW A;  4GQC A;  1G7O A;  1NSW A;  1O81 A;  4K1F A;  1GRX A;  2GT5 A;  2H72 A;  2FA4 A;  5B6N A;  3D4T A;  3UEM A;  5E59 A;  1A2M A;  1CQG A;  4MF6 A;  4ML1 A;  1N8J A;  2FWG A;  1B48 A;  3FR3 A;  5ECS A;  3ZYW A;  2LNS A;  2DBC A;  4XHM A;  2JAD A;  5ENU A;  1XIY A;  4K7I A;  2YWM A;  1G6W A;  1O8X A;  4O32 A;  5B8B A;  2QC7 A;  1DSB A;  1OKD A;  1XVQ A;  2X99 A;  2L4C A;  2NDO A;  1ABA A;  1SVM A;  5ECN B;  3GX0 A;  1ST9 A;  5IMF A;  1Z7P A;  4IP6 A;  2NTO A;  4AJ8 A;  4JZQ A;  2LQQ A;  4Z7X A;  2MZC A;  4ACS A;  3KMN A;  3HD5 A;  1TRV A;  5IIZ A;  4AF2 A;  1M9B A;  3GKX A;  4EIP A;  2VD1 A;  1K0D A;  5ECR B;  1W89 A;  3A2X A;  1AQX A;  1A0F A;  2VLT A;  3WGE A;  5KN1 A;  3DYR A;  4GDF A;  3GA4 A;  1TOF A;  1XWA A;  3TCO A;  3D21 A;  20GS A;  1O85 A;  1ML6 A;  2ZNM A;  1DBY A;  1UC7 A;  2JZT A;  3GH9 A;  5IQY A;  4TKY A;  3HY2 A;  4ECC A;  2ON5 A;  3KTB A;  2HNL A;  3IPZ A;  1ZYE A;  1AW9 A;  2HZE A;  1K0A A;  4BVX A;  4TR4 A;  3M0F A;  1ERW A;  3GYK A;  3G9B A;  2KHP A;  3TKS A;  2OKA A;  5AIS A;  1LJR A;  2HSN A;  3TU3 B;  2H76 A;  1O7U A;  2VIM A;  2H0H A;  1GP1 A;  2C4J A;  4G9H A;  3AY8 A;  2VCZ A;  4TR1 B;  2WGR A;  1R5P A;  1SU9 A;  1MDK A;  3GL5 A;  2JZS A;  5IMZ A;  3MAK A;  4YAP A;  5B8A A;  1ZYQ B;  2C8U A;  3IRA A;  3ERF A;  4XCS A;  1S3C A;  1NW2 A;  2H01 A;  1PQN A;  4EF0 A;  5A34 B;  1XWC A;  3G7J A;  4NAX A;  1MDJ A;  1AXD A;  1XFL A;  5D9V A;  1SD8 A;  3QOU A;  3ME7 A;  3ZTL A;  3HVX A;  5DJL A;  5CNW A;  6GSV A;  4X1U A;  1SEN A;  4AGS A;  2O89 A;  1EV4 A;  3HHV A;  2I4A A;  3DWV A;  4FO5 A;  2IPA A;  4IEL A;  3BD2 A;  3ZML A;  4OCF A;  5GST A;  4WF4 A;  2CZ3 A;  4AJ7 A;  4N0Z A;  5DQY A;  3HVV A;  6GST A;  8GSS A;  2GZP A;  2GSQ A;  2L59 A;  4TW5 A;  1GTB A;  2DJ0 A;  3P7X A;  3D6I A;  4PQ1 A;  3PGT A;  4AKG A;  3IC8 A;  4WF5 A;  1SVO A;  4O5U A;  2IME A;  5J9C A;  4D73 B;  1K0B A;  4ZBD A;  4QQ7 A;  5DDL A;  3L9S A;  1JHB A;  4NPB A;  4G10 A;  1GTI A;  1QK8 A;  3I9V 2;  4L0U A;  2DJ2 A;  1ON4 A;  5CRG A;  2QA1 A;  2HRK B;  2XBI A;  1OC9 B;  4TXV A;  3C1S A;  1TI3 A;  5KOX A;  5DAK A;  3WT1 A;  3CMI A;  1EGR A;  4GQF A;  3H93 A;  2GZY A;  4Q5F A;  3HZ4 A;  1RK4 A;  4HS1 A;  3H1N A;  4HQS A;  2ON7 A;  2YJH A;  2C80 A;  3F4S A;  2C3N A;  4TN8 A;  1FG4 A;  3W6G A;  2H30 A;  2B5Y A;  2VLU A;  4ICY A;  2VCV A;  3WGX A;  5FHI A;  3GX8 A;  4HZ4 A;  4H86 A;  2LQO A;  2KP1 A;  1R26 A;  2F9S A;  4V2L A;  3LXT A;  5G5F A;  5A4W A;  5BMU B;  3KZQ A;  5GAP D;  5IMV A;  4OMV A;  4MAB A;  3GST A;  5FT3 A;  1YQ1 A;  3ZVJ D;  1ZYN A;  2LTK A;  4XRD A;  4ULX A;  3FY7 A;  2OA7 A;  3LEF A;  2B6M A;  4LL1 B;  4K2D A;  4HJ2 A;  3GUS A;  1BAY A;  3F4R A;  4JU5 A;  4KND A;  3W8J A;  3QD9 A;  4IP1 A;  1AQV A;  1UN2 A;  5A5H A;  2CAQ A;  3KP8 A;  2R3X A;  5ECL B;  2P0G A;  3QAV A;  1TJD A;  2C0G A;  1ERV A;  2G2Q A;  1K0O A;  4ZIJ A;  2YV7 A;  5J4U A;  1EZK A;  1A23 A;  1VRS D;  2EFH A;  4GTU A;  5G31 A;  2DJJ A;  5G30 A;  4YQM A;  1PN0 A;  5E4W A;  4I8B A;  2HRA A;  1F2E A;  1W4V A;  5A1N A;  3TKP A;  5J3R A;  1U88 A;  1B4P A;  1YF1 A;  4KW6 A;  4GRF A;  4ZB6 A;  3IXR A;  3HYP A;  3EPT A;  3UBK A;  1EGO A;  4TVE A;  4OWY A;  1KNG A;  1TU8 A;  3QR6 A;  2XPD A;  3D0Z A;  2PPT A;  2HXK A;  4GST A;  3GRX A;  5H5Q A;  4USS A;  1A2L A;  14GS A;  2MMZ A;  3BCI A;  4I2T A;  2LS5 A;  3IHG A;  3E0U A;  5DAL A;  1FB6 A;  4G0K A;  4L5O A;  3EUR A;  3GIX A;  2OE3 A;  4ZL9 A;  1SYX A;  2F3M A;  2GLR A;  3FR9 A;  2IMF A;  2L5L A;  2EIQ A;  4ZL8 A;  1NHY A;  2HI7 A;  1BG5 A;  4WR4 A;  4MH2 A;  3TDG A;  4EKZ A;  1JZR A;  4K8M A;  2GSR A;  5HFI A;  4KX4 A;  1BJX A;  5EY6 A;  4K7O A;  2LJA A;  2CA8 A;  1O8W A;  1FB0 A;  4MJC A;  4TR0 A;  1I5G A;  3DGQ A;  5CP1 A;  4EE0 A;  3O6T A;  3BOA A;  2LST A;  3LWA A;  4NHW A;  3FRC A;  2IFQ B;  4X4J A;  3TRX A;  1J9B A;  2MBS A;  2XC2 A;  1SVL A;  3L9V A;  5CRH A;  5ECI B;  2V2G A;  2FCH A;  1K0C A;  1HNB A;  5IMC A;  1ZYP A;  2XPE A;  4PQH A;  4NV5 A;  4BWQ A;  2C3T A;  2P31 A;  1Z6M A;  5JCW A;  2O5V A;  5AIX A;  4PNF A;  3UJ1 A;  3FZ4 A;  4ID0 A;  1WMJ A;  4HJM A;  1M2B A;  4EL1 A;  1QMV A;  4BL7 A;  3F3R A;  5KN3 A;  3HZ8 A;  4WXT A;  2H0G A;  2AJQ B;  5IPG A;  4GF0 A;  4JE1 A;  3KXO A;  4CHS A;  2YCD A;  3FR6 A;  3D22 A;  3ZZX A;  5IMA A;  1YZX A;  5LD0 A;  4E68 A;  2WCI A;  3P90 A;  1H75 A;  1SJ6 A;  1YF0 A;  4BVY B;  4F0B A;  1B8X A;  4WEY A;  1ILO A;  3E3E A;  3ED3 A;  2HSM A;  3HKR A;  4L5L A;  3KEB A;  5CO3 A;  3GV1 A;  2PN8 A;  4NXI A;  2MMA A;  5JCU A;  3ERW A;  2DML A;  5G1K A;  5EL8 A;  4HEA 2;  2GQM A;  1GTA A;  3L9U A;  3M1G A;  1X9S B;  2GQK A;  4GCI A;  2F8F A;  3CSH A;  3HXS A;  3M3M A;  1OC8 A;  1GSY A;  4W66 A;  4IJ3 A;  1TI1 A;  1SJZ A;  3VPT A;  1YEP A;  5CAX A;  1JFU A;  1F9M A;  1T1V A;  5GZZ B;  4O5Q A;  1T4Z A;  1Y6E A;  5DCG A;  2OAD A;  2H1L A;  2MMN A;  2VL2 C;  3DXB A;  4LMW A;  3LJR A;  2H1G A;  2K6V A;  4JED A;  1RW1 A;  3RHC A;  4AKX B;  9GSS A;  3I69 A;  3I43 A;  2CAI A;  2G0F A;  4FYB A;  4CY6 A;  1PSQ A;  3PR8 A;  2B7K A;  3U6V A;  1LU4 A;  2OT3 A;  4KAE A;  1PN9 A;  4QL7 A;  2NVL A;  1FOH A;  3ZMK A;  7GSS A;  2EIR A;  4IS0 A;  1B9Y C;  1U6T A;  1XOA A;  2N5F A;  4POK A;  1JLV A;  1BED A;  3OR5 A;  2AYT A;  3FW2 A;  4OFM A;  2IMK A;  1Z7R A;  4FH8 A;  4ZB9 A;  1H4O A;  2I9H A;  2PBJ A;  1QFN A;  1XBS A;  4EDZ A;  2VD0 A;  2FLS A;  2K8V A;  2QGV A;  1WP0 A;  1SL0 B;  4XS4 B;  1FOV A;  1N25 A;  2YPM A;  5A4U A;  2E0Q A;  4XIH A;  5KOW A;  3VFI A;  2PVQ A;  2VLV A;  4RQX A;  3QAW A;  2YWO A;  4Z2R A;  1SKW B;  3TJG A;  2HT9 A;  4YAV A;  3KTL A;  4FIW A;  1GL8 A;  3GKN A;  3LYK A;  4K0G A;  3FYG A;  5JWR B;  4DVC A;  4K5S A;  6GSY A;  2H6X A;  4ZL7 A;  1QXH A;  3CXG A;  1MDI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...