2J9HA

Crystal structure of human glutathione-s-transferase p1-1 cys-free mutant in complex with s-hexylglutathione at 2.4 a resolution
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
209
structure length
209
Chain Sequence
b'PPYTVVYFPVRGRSAALRMLLADQGQSWKEEVVTVETWQEGSLKASALYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRAKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGSLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTATHIONE S-TRANSFERASE P
publication title Modulating Catalytic Activity by Unnatural Amino Acid Residues in a Gsh-Binding Loop of Gst P1-1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 70
structure length 209
sequence length 209
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2006-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 2j9hA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2j9hA01
1GUKA 2H74A 2IMKA 5F06A 4USSA 3ZREA 3LXTA 1PRXA 1ZGNA 2YPMA 1H75A 2JACA 2KP1A 4MK3A 2I1UA 3OR5A 1JZWA 1R26A 3D0ZA 5COHA 4TR0A 5GAPD 5ECOB 1BYEA 1TRWA 4WBJA 3GN3A 2K6VA 3DVWA 2ON7A 4KDXA 3QDNA 3EC3A 3KP9A 1X5CA 4EKZA 4MDCA 5CREA 3SWLA 3HJPA 3NZNA 1OE7A 2E7PA 3F3QA 4FYUA 3V1WA 2IMFA 1SK1A 2O8VB 4OO5A 1PKZA 5A5KA 3DD3A 2I9HA 4HU7A 1EV4A 4XS1A 2MBSA 4PQ1A 3TJGA 2DJ0A 5JWQB 2HSNB 4NHWA 3DXBA 1PX6A 2NVLA 4IJ3A 4POMA 2HZEA 1BEDA 1TKDB 3EU3A 2IJYA 1VF1A 3F4TA 2HXKA 4GSNA 2MYGA 2JSYA 2BJXA 4K7NA 1Z7PA 1ZMAA 1PL1A 1QMVA 2I81A 2GSQA 5LCZA 1YF0A 3UL3A 1V57A 5EY6A 2N5FA 3RHBA 2JL4A 3F9UA 4PQHA 2HLSA 2DIZA 2Z9SA 2ALBA 4FYBA 4ML1A 1ILOA 1GTBA 2C8UA 3CBUA 3A3TA 3GV1A 1PL2A 2MMAA 4GSSA 4YQVA 4NXIA 2HSHA 2P31A 1K0NA 2IFQB 4O32A 1K3YA 3FEUA 3A2WA 1WOUA 4CW9A 1GUHA 2CZ2A 3L9UA 2YCDA 4KDYA 2PN8A 5BMUA 3LYPA 1WMJA 1XWBA 1U6TA 4POLA 11GSA 4KF9A 3RDWA 3LQ7A 3TB2A 2GSRA 1MDKA 5KN1A 2H1DA 2NPBA 4BVYA 22GSA 1F3AA 4IJIA 4IELA 1Z9HA 3UIWA 3KMNA 1FAAA 2X8HA 1YEPA 3VLNA 1HNCA 4KH7A 1JZOA 5C00A 4OWYA 1Y25A 1THXA 3FR9A 4TKYA 3ZITA 2YWMA 5ECIB 2DJ3A 3FZ5A 2P0GA 1GNWA 1X9MB 3MNGA 5J5NA 4I5QA 4K0NA 4HUAA 3QAWA 5CAXA 3IAM2 2PWJA 1JZRA 1PQNA 3KM6A 4BWQA 2OKAA 4KE3A 2RM6A 2MMNA 5DALA 3VI5A 3C1RA 3FZAA 1ST9A 2K9FA 1HQOA 1JLVA 5DCHA 4FIWA 2MBTA 1M0UA 3I6AA 2WZ9A 2HSYA 4KNDA 3ZFLA 1QXHA 2R4VA 3CRTA 1FB0A 4YQMA 4K7OA 2OBIA 3M3MA 1GSUA 5AIVA 3UBKA 1SJ6A 2H66A 1A2MA 3GL5A 1O85A 3JCML 3ERGA 5ECKB 4L0UA 3J7Yb 2MMZA 3IA1A 5ABRA 4TVEA 5F8BA 8GSSA 3D5JA 4V2MA 2LJKA 4G19A 3EWLA 4X43A 3U6VA 3M0FA 4TOPA 3CRUA 4PQIA 4BL7A 2QKEA 1K0DA 5G31A 2H6XA 4ML6A 1EOHA 1XCCA 1EP8A 1SL0B 1SKSB 2F8FA 3ZVJA 4ULXA 4MCUA 1GSEA 1O6JA 1B48A 3TOTA 2I3YA 1V2AA 1DUGA 5INYA 2C0FA 3H1NA 4JU5A 3GH6A 2PUKC 4E8HA 3CTGA 5A4UA 1SK2A 4MABA 16GSA 5CNWA 4ZBBA 5H5RA 3IE3A 1NM3A 3LXZA 4WXTA 2R2JA 4Q5QA 4TXVA 4FQUA 1K0BA 1HYUA 1Q4JA 2MZCA 4KCEA 4IS0A 1BAYA 2WS2A 3BJ5A 5HR2A 2CVDA 3F6DA 1E2YA 5G1LA 2DJ1A 4DSSA 2HSMB 1SJZA 2DMMA 1B4PA 1EGOA 1QFNA 5G5EA 2VD1A 1A0FA 1HNAA 1DBYA 3KH9A 2FNOA 3APSA 1AQVA 4MJBA 2LNSA 2XHFA 2L4CA 4XS4B 2ES7A 2H01A 1Z6MA 1TRUA 4XTSA 3GUSA 5LD0A 4LMWA 4LMVA 2WRTA 2B6MA 4N10A 3ZYWA 5ECSA 4FYCA 3HY2A 5ECMB 2H1BA 2AB6A 1XPVA 3F4SA 1ERUA 4NMUA 4AJ7A 1SL1B 2DJJA 1FG4A 2R6KA 2H0HA 1Q98A 4E8EA 2V6KA 5D9WA 3Q6OA 4POKA 2M80A 2YWOA 1BJXA 2IMEA 1GSSA 1K0OA 4FH8A 1T7PB 4F03A 2FGXA 4OCEA 3HZ8A 1QUWA 2M72A 2LRNA 4ZBDA 2H6ZA 4PURA 2FWFA 3I69A 3IAS2 2H19A 2FA8A 3K8NA 1OC9B 4KCAA 2P5RA 4IN0A 4KB3A 2N5AA 2O87A 3ISOA 2L5OA 4GRFA 2VUPA 2OE3A 2AAWA 1VRSD 3FY7A 1YF1A 3LSZA 1GTUA 1ZL9A 2A2SA 1XIYA 3M9JA 3IC4A 4JEDA 1TW9A 3G7JA 2A4VA 2LJRA 1SL2B 3ZIVA 2GZPA 3FZ4A 4ILFA 4OFTA 3GSSA 4MJCA 4F2IA 1LBKA 2GQLA 4IGJA 1XW6A 3Q18A 1NW2A 1XFLA 1YJ6A 1ZOFA 1CQGA 1CQHA 5IMFA 5AGYA 4D73A 4PUFC 4L5LA 3IOSA 3LG6A 2JZTA 4TXOB 4QL9A 2RUFA 4IVFA 4YQUA 5LNKe 2I4AA 2GDRA 5DVBA 3TKSA 2VL2C 4WF4A 5ECLB 1PMTA 2E2MA 4HU9A 4AJ8A 1X9SB 1GUMA 1B4QA 3HYPA 1W4VA 2AJQB 3QOUA 3WGEA 2N5BA 3H8QA 1MDIA 2AUVA 4BWSA 3CSHA 3GSTA 4EO3A 1JFUA 2CT6A 3WYWA 3DRNA 2GQMA 3WT2A 1GRXA 3FR6A 1R4WA 4HEA2 3O6TA 4JBBA 3M8NA 3ZFBA 3ZL5A 1U3IA 1A23A 4K0GA 4K9ZA 3UAPA 2GQKA 5H5QA 2WDUA 1TU8A 3UVHA 4LA1A 4IP1A 2YV7A 2E0QA 3FKFA 4XS6A 6GSXA 3HVVA 3LGCA 4IQAA 4HJMA 3DIEA 1SYRA 5J3RA 2CQ9A 3P2AA 3IC8A 2EIRA 2B5XA 2LQQA 1O8XA 1Z5YE 3RPPA 3C71A 3ZRDA 2RIIA 3TCOA 3FRCA 1LJRA 5AIXA 1X0RA 3ERWA 1O8WA 4DEJA 3VWVA 4X1UA 2A2RA 2IL3A 5D9VA 1XW9A 1Z3EA 4BVXB 4EE0A 4V2LA 2CA8A 5KN2A 3GIXA 2PU9C 2ZNMA 2VM1A 3GH9A 4XRDA 1A2LA 1WPIA 1PN9A 3F8UA 1GULA 3L0HA 2LTKA 2V6OA 2FCHA 3O3TA 4GLTA 3KTBA 3IK9A 1V58A 20GSA 1M7TA 2OBKA 1T4YA 1GSDA 1GH2A 2K8SA 4XS4A 5ID2B 3HJMA 4OFMA 2H0IA 4ZL9A 5IIZA 1GLPA 2CAQA 4MZWA 2CZ3A 2B1LA 2XC2A 2TRCP 2FUG2 3RHCA 3F3RA 3AY8A 2NBSA 2JU5A 1YEXA 1YQ1A 4F9ZA 4ZB9A 2VD0A 4I6XA 2LKUA 2YJ7A 3EMXA 4ID0A 1WJKA 4NPBA 2ZUPA 2GZYA 4YAPA 4HOJA 4KSMA 3QMXA 1WWJA 3GTUB 2LJAA 5G2ZA 1J0FA 4XIHA 2YV9A 2FWEA 3BBYA 3IK7A 3IBHA 3VI7A 5CO3A 3SBCA 3VK9A 4F82A 3FW2A 1XWCA 2YOIA 2FLSA 3H79A 3US3A 3TGZA 1TK8B 2L57A 1OC9A 3E9JB 3NOFA 2UZ8A 2FA4A 3BCKA 2HRKB 5G30A 2JZSA 2HT9A 4EUYA 5JCUA 2HRNA 2DBCA 3C73A 1ZCPA 3EINA 4NV5A 3G7YA 4BPYA 5ELGA 3EMPA 5IOXA 1XOAA 1QQ2A 4TR1A 2OACA 3ZZXA 5IMDA 4I8BA 2HRFA 3DVXA 5DCGA 3KZQA 2RUEA 2GTUA 5EL8A 3TJBA 2FHEA 1K0AA 1OAZA 4GCIA 2L59A 3DMLA 1B8XA 2H71A 3L9VA 4MJAA 4N30A 5JCWA 1XVQA 4L5OA 1TK0B 1AUCA 1WP0A 3G9BA 3LJRA 5ECQB 1M9AA 3F4RA 5DAKB 6GSWA 2YZUA 4TXOA 3TOUA 2VCTA 2QC7A 3F0IA 4TR3A 2F9SA 2CV4A 2OE1A 4G9HA 2H0GA 4PX1A 5ECNB 2HNLA 2FWHA 3D6IA 2LRCA 3EVIA 4HDEA 4J2FA 4KUNA 2WFCA 1K0CA 1ZYEA 2VOCA 1B9YC 3GKNA 1G6YA 2VLTA 9GSSA 2AYTA 3I43A 4HZ4A 1VF3A 3MSZA 1KEBA 1K3OA 1M2AA 4EC0A 1T00A 1I5GA 4MH3A 5B6MA 2IMDA 1KTEA 6GSSA 2VM2A 1UVZA 4Q5NA 1S3AA 3E3EA 4ZL7A 3HXSA 1MDJA 4K8MA 2C3NA 3UVTA 1XZOA 3GKXA 2OADA 1MD3A 4F0CA 1K0MA 1XOBA 7GSSA 2YZHA 4KX4A 3ERFA 3PGTA 3PR8A 5EVOA 5GAND 5J4UA 4MP4A 3IHQA 2XBIA 1IYHA 1QK8A 4L8EA 5FHIA 2VCWA 4RUVA 2KOKA 4JR6A 2DSAA 1NSWA 2B1KA 2B3SA 1G7OA 1V40A 2E2GA 1LU4A 2R5GA 4FO5A 2YJHA 1OC8A 1ERVA 2LEGA 1EEMA 3GKMA 1A24A 1M2DA 5D9XA 3HVSA 4BVXA 4RI6A 4LL1B 4LLRA 2YWNA 2HI7A 4WBRD 4MMMA 2ON5A 3CSIA 1GWCA 3I9V2 3RAZA 2YWIA 3QAVA 3EE2A 4PTSA 4AGSA 2HZEB 1OYJA 3D4TA 3EU4A 1O81A 5F07A 5DBQA 4I2UA 1FB6A 3HA9A 5H5SA 1A2JA 4JR4A 3TKSE 2H70A 2KUCA 5AISA 3ZTLA 3S9FA 5ID2A 4WR5A 18GSA 1EEJA 2IPAA 2C0GA 1HD2A 3D21A 1TXXA 2YNXA 5KN0A 4IKHA 2B5EA 2M46A 2HRAA 2VCQA 2RLIA 3MWHA 2LUSA 3MAKA 2GVPA 1J9BA 3GRXA 3WD6A 4OO4A 1G6WA 1TJDA 2WCIA 1BX9A 3TRPA 2IN3A 5ECPB 2ZCTA 1R7HA 2FY6A 1TU7A 3A5WA 1T3BA 2K18A 1XW5A 3UMAA 3ME7A 1O7UA 1H4OA 4Q5FA 2IFQA 4V2NA 3HDCA 2V1MA 5HR1A 3IDVA 2JADA 1EV9A 5GSSA 1K3LA 3ZIJA 3FHKA 4O92A 1OKTA 4TN8A 4HJ2A 5IMVA 4NHZA 2WULA 3QFAC 4N0VA 4BVYB 2LRTA 2L6CA 1Y6EA 2VCVA 3IV4A 2HRKA 1A8LA 5C04A 2AV4A 3TUEA 4PGTA 5KEJA 3H4KA 3J7Yk 1I9DA 1URMA 1WE0A 2C4JA 5CP1A 2P5QA 4EF0A 4YAVA 1OVNA 1OE8A 1GSFA 3GA4A 1N2AA 4H86A 1SKRB 4RQRA 3QR6A 5AN1A 2DMLA 3VPTA 4YH2A 1YKCA 2VCXA 3ZMKA 5A4VA 4EVMA 1PA3A 3CYNA 3P90A 2VAFA 2GS3A 5DALB 1EOGA 4NV2A 2F8AA 5D93A 1A8YA 2OE0A 2L5LA 3PINA 4WEYA 2LNTA 4KDUA 3GX0A 2CAIA 1EZKA 1X9WB 3N9JA 2HQTA 2O7KA 4QQ7A 3W6GA 3KEBA 2X8GA 2PBJA 5J9CA 4V1Ap 3DYRA 4JE1A 3WGXA 2V41A 1TI3A 2J23A 3M9KA 1O73A 1FVKA 1G7EA 1TRSA 3FR3A 3PPUA 3TKRA 4BL7B 2XPEA 3MDKA 5HR3A 1ACVA 3IXRA 2REMA 1ERWA 1JZDA 2HZFA 2DC5A 1XWAA 1GLQA 1Z7RA 3LYKA 1THOA 2PVQA 2C80A 1EP7A 17GSA 1M99A 1SD9A 3W8JA 1GP1A 3UARA 5CYYA 1M9BA 4GQCA 4KGIA 4RI7A 1XXUA 5DDLA 1SENA 2C0DA 1QGVA 1YKAA 5DQYA 3GL3A 1PGTA 5DJLA 3KMOA 2CVKA 4TR4A 3U5RE 2PPTA 4N11A 4I2TA 4LL4B 4L0WA 1BQ7A 2LQOA 4MF5A 2IMIA 1AXDA 3CSJA 4OFNA 1FW1A 1UA5A 1NHOA 2H30A 3TJKA 1WIKA 4HQSA 3LEFA 1B9XC 4DSSB 2GT5A 1GNEA 3DKSA 4X0XA 1EGRA 3TKSC 2HSMA 4EL1A 3Q74A 4CDOA 4JRRA 2QSIA 3UEMA 1F37A 3GX8A 2XBQA 2LS5A 1J08A 1N8JA 1TRVA 4AF2A 5F05A 10GSA 4G0IA 1ZZYA 3VFIA 3EURA 1SK0A 5J41A 5B8AA 4PUAA 19GSA 3C1SA 4K7IA 4KSOA 3QAGA 2GGTA 4WR4A 3L78A 1SJIA 1DE1A 2VCZA 4CHSA 4WF5A 2EIOA 3CXGA 3D22A 3P8WA 1R5AA 2CX3A 3E0UA 3HJOA 1JLWA 5JWOB 1YDKA 1DSBA 3KP8A 5ECHB 3RPNA 2KLXA 5CRGA 4G0LA 1FHEA 5E4WA 2NTOA 3IR4A 2WGRA 3ME8A 4IW9A 4TRXA 4ZXGA 3APOA 4MA9A 2DJ2A 2YN1A 3W8SA 3P7XA 5CRWA 1E6BA 3KGKA 2PERA 1MD4A 12GSA 2C1YA 3R3EA 5IM9A 4XHMA 2LV3A 4EXJA 1KBNA 3O76A 3H93A 1VF4A 1ABAA 1RQMA 1IYIA 2X64A 2BMXA 1T8EB 2K8VA 2H76A 3L4NA 2IWTA 4ACSA 2HE3A 6GSVA 4QL7A 5CRDA 1U3AA 2B7KA 3GNJA 3HHVA 3KD0A 2B7JA 3PH9A 4DSRA 1W89A 2H8LA 4PNGA 3N5OA 4GQFA 2FWGA 3TRXA 2C0EA 1XWGA 4XRAA 1BG5A 3HZ4A 5L71A 2IIYA 3APQA 2V2GA 1AIUA 3F6FA 2JSZA 3ZVJD 4P3YB 5IQYA 1JHBA 2TIRA 3FZ9A 1YZXA 1SU9A 2GZZA 5JWRB 3VWUA 4D73B 2BTOT 2H1AA 2B5YA 3QCPA 2RM5A 5KN3A 1KNGA 4IQ1A 4MPFA 4HQZA 1TOFA 3IPZA 2C3TA 1USBA 1WRYA 1X5DA 5DQSA 1AW9A 4G10A 1S3DA 5IPGA 1GL8A 5HR0A 2PGTA 4PNFA 3TDGA 5GSTA 5DJMA 2YANA 3C8EA 3A2XA 3UJ1A 3M1GA 2X8CA 4OCFA 1FO5A 3UOMA 4DSQA 4ECBA 1PX7A 4NAXA 1UC7A 5ELAA 2C3QA 2H75A 3VPQA 1V9WA 2F51A 3BOAA 4ZB8A 5D8IA 5ECRB 3BCIA 3IRAA 4Q5RA 1PD21 2H72A 3KIJA 4J56E 4BA7A 3LWAA 2GSSA 4POBA 1PSQA 4MJEA 3FYGA 5D9TA 4ECIA 4G2EA 4G0KA 2GT6A 4ISDA 1VGLA 3F63A 2XPDA 1ML6A 3TJJA 5ENUA 4KAEA 5IOWA 1U88A 5HFIA 4EDZA 1AC1A 3Q19A 3EYTA 3HCZA 1TTZA 5GZZB 1V98A 1U87A 2D2ZA 4JZQA 2R3XA 1HNBA 4MH2A 2O89A 13GSA 3KXOA 1ERTA 5D96A 1NHYA 3TJFA 1RW1A 3CMIA 1TI1A 1C72A 4GWRA 3CTFA 4ECCA 2GSTA 1A0RP 2J9HA 5HFKA 2HFDA 3LFLA 1T4ZA 1XVWA 4KA0A 1F3BA 1PKWA 1Z6NA 3VWWA 5IMAA 2DLXA 2VL3A 4V1Ag 3G7IA 2H6YA 1SYXA 1XWKA 3DWVA 1X5EA 1GSYA 3QPMA 5FWGA 5B6NA 1ZYQB 4GSTA 2H1GA 1GTIA 2EC4A 3GURA 4HZ2A 2NDOA 4ZL8A 3R2QA 4ZIJA 5IMZA 1SKWB 2VIMA 2PMTA 1MEKA 1GSQA 5IPHA 3GKKA 1MTCA 4MZCA 2YP6A 1AAZA 2JZRA 2VLVA 1OC3A 2KP2A 2WB9A 1F9MA 2OJLA 1SD8A 1TP9A 5A4WA 4K1FA 6GSYA 5G5FA 2GLRA 1UN2A 1FVJA 4MLYA 4F0BA 2PVOC 4OMVA 5IO0A 4N0ZA 1TDIA 3QD9A 4I97A 4O7HA 1TK5B 2VL2A 2CX4A 1EWXA 4XCSA 1ON4A 1M2BA 4GXZA 2L6DA 3GTUA 2F3MA 2WJUA 4DVCA 4ZILA 3DGQA 4IBPA 5HFGA 3L9SA 3LORA 2DJKA 3HKRA 5CRHA 5G1KA 4MF6A 1R5PA 4O5RA 3ZLPA 4AJ6A 2LSTA 3HVXA 4TW5A 3KH7A 3ZMLA 3TKPA 1RK4A 5F0GA 2CVBA 5J9BA 3KCMA 5EPFA 2L4QA 2FD3A 2R37A 5E59A 3VWXA 3ED3A 1T1VA 3DEXA 4TR1B 4Z7XA 3FK8A 3GMFA 3WT1A 3D4MA 2H73A 1AQXA 1OKDA 1VF2A 2V32A 1AQWA 2TRXA 4RQXA 2VO4A 4KW6A 1FOVA 4WKWA 2OA7A 4WETA 3GYKA 4MPGA 4IHUA 4MZBA 2KHPA 5D73A 3NIVA 1F2EA 4NWYA 4ECJA 5IO2A 4EDYA 2HYXA 5HQPA 5IMCA 3RBTA 5FT3A 3QFBC 4ZBAA 4K6XA 4OD7A 5JCGA 4MF7A 6GSTA 5DAKA 4GF0A 14GSA 2G2QA 3UBLA 2VLUA 3C7MA 4J57E 2MMOA 5B8BA 4IP6A 4GTUA 3BD2A 3GFKA 1F6MC 3VURA 3HD5A 3KTLA 2X99A 5B7CA 3A2VA 2G0FA 4HS1A 4K2DA 1DE2A 2O85A 2VL9A 3GHAA 1XBSA 2DIYA 1G0TA 4ZB6A 3TKQA 3WGDA 1S3CA 3KJYA 2EIQA 3TRQA 2AHEA 4PXOA 1YY7A 2QGVA 4HI7A 1GTAA 6GSUA
chains in the Genus database with same CATH superfamily
1GUKA 2H74A 2IMKA 5F06A 4USSA 3ZREA 3LXTA 1PRXA 3RGBC 1ZGNA 2YPMA 1H75A 2JACA 2KP1A 4MK3A 1ZYPA 2I1UA 3OR5A 1JZWA 1R26A 3D0ZA 5COHA 4TR0A 5GAPD 5ECOB 4PI0C 1BYEA 1S4BP 1TRWA 4WBJA 3GN3A 2K6VA 3DVWA 2ON7A 4KDXA 3QDNA 3EC3A 3KP9A 1X5CA 4EKZA 4MDCA 5CREA 3SWLA 3HJPA 3NZNA 1OE7A 2E7PA 3F3QA 4FYUA 3V1WA 2IMFA 1SK1A 2O8VB 4OO5A 1PKZA 5A5KA 3DD3A 2I9HA 4HU7A 1EV4A 4XS1A 4Z2UA 2MBSA 4PQ1A 4Z2RA 3TJGA 2DJ0A 5JWQB 2HSNB 4NHWA 3DXBA 1PX6A 2NVLA 4IJ3A 4POMA 2HZEA 1SVOA 1BEDA 1TKDB 3EU3A 2IJYA 1VF1A 3F4TA 2HXKA 4GSNA 2MYGA 2JSYA 2BJXA 4K7NA 1Z7PA 1ZMAA 1PL1A 5J4VA 1QMVA 2I81A 2GSQA 5LCZA 1YF0A 3UL3A 1V57A 5KOWA 5EY6A 2N5FA 3RHBA 2JL4A 3F9UA 4PQHA 2HLSA 2DIZA 2Z9SA 2ALBA 4FYBA 4ML1A 1ILOA 2WVXA 1GTBA 2C8UA 3CBUA 3A3TA 3GV1A 1PL2A 2MMAA 4GSSA 4YQVA 4NXIA 2HSHA 2P31A 1K0NA 2IFQB 4O32A 1K3YA 3FEUA 3A2WA 1WOUA 4CW9A 1GUHA 1N25A 2CZ2A 3L9UA 2YCDA 4KDYA 2PN8A 5BMUA 3LYPA 3RFRC 1WMJA 1XWBA 1U6TA 4POLA 11GSA 4KF9A 3RDWA 3LQ7A 3TB2A 2GSRA 1MDKA 2O36A 5KN1A 2H1DA 2NPBA 4BVYA 4W66A 22GSA 1F3AA 4IJIA 4IELA 1Z9HA 3UIWA 3KMNA 1FAAA 2X8HA 1YEPA 3VLNA 1HNCA 4KH7A 1JZOA 5C00A 4K5RA 4OWYA 1Y25A 1THXA 3FR9A 4TKYA 3ZITA 2YWMA 5ECIB 2DJ3A 3FZ5A 2P0GA 1GNWA 1YVLA 1X9MB 3MNGA 5J5NA 4I5QA 4K0NA 4HUAA 3QAWA 5CAXA 3IAM2 2PWJA 1JZRA 1PQNA 3KM6A 4BWQA 2OKAA 4KE3A 2RM6A 1M3JA 2MMNA 5DALA 3VI5A 3C1RA 3FZAA 1ST9A 2K9FA 1HQOA 1JLVA 5DCHA 4FIWA 2MBTA 1M0UA 3I6AA 2WZ9A 2HSYA 4KNDA 3ZFLA 1QXHA 2R4VA 3CRTA 1FB0A 4YQMA 4K7OA 2OBIA 3M3MA 1GSUA 5AIVA 3UBKA 1SJ6A 2H66A 1A2MA 3GL5A 1O85A 3JCML 3ERGA 5ECKB 4L0UA 3J7Yb 2MMZA 3IA1A 5ABRA 4TVEA 5F8BA 8GSSA 3D5JA 4V2MA 2LJKA 1ZYNA 4G19A 3EWLA 4X43A 3U6VA 3M0FA 4TOPA 3CRUA 4PQIA 4BL7A 2QKEA 4EIPA 1K0DA 5G31A 2H6XA 4ML6A 1EOHA 1XCCA 1EP8A 1SL0B 1SKSB 2F8FA 3ZVJA 4ULXA 4MCUA 1GSEA 1O6JA 1B48A 3TOTA 2I3YA 1V2AA 1DUGA 5INYA 2C0FA 3H1NA 4JU5A 3GH6A 2PUKC 4E8HA 3CTGA 5A4UA 1SK2A 4MABA 16GSA 5CNWA 4ZBBA 5H5RA 3IE3A 1NM3A 3LXZA 4WXTA 2R2JA 4Q5QA 4TXVA 4FQUA 1K0BA 1HYUA 1Q4JA 2MZCA 4KCEA 4O5UA 4IS0A 1BAYA 2WS2A 3BJ5A 5HR2A 2CVDA 3F6DA 1E2YA 5G1LA 2DJ1A 4DSSA 2HSMB 1SJZA 2DMMA 1B4PA 1EGOA 1QFNA 5G5EA 2VD1A 1A0FA 1HNAA 1DBYA 3KH9A 2FNOA 3APSA 1AQVA 4MJBA 2LNSA 2XHFA 2L4CA 4XS4B 2ES7A 2H01A 1Z6MA 1TRUA 1PFOA 4XTSA 3GUSA 5LD0A 2OT3A 4LMWA 4LMVA 2WRTA 2B6MA 1PN0A 2X49A 4N10A 4AKGA 3ZYWA 5ECSA 4FYCA 3HY2A 5ECMB 2H1BA 2AB6A 1XPVA 3F4SA 1ERUA 4NMUA 4AJ7A 1SL1B 2DJJA 1FG4A 2R6KA 2H0HA 1Q98A 4E8EA 2V6KA 5D9WA 3Q6OA 4POKA 1SVMA 2M80A 5A1NB 3CWGA 2YWOA 1BJXA 2IMEA 2A2PA 1GSSA 1K0OA 4FH8A 1T7PB 4F03A 2FGXA 4OCEA 3HZ8A 1QUWA 2EFDA 2M72A 2LRNA 4GDFA 4Z2TA 4ZBDA 2H6ZA 4PURA 2FWFA 3I69A 3IAS2 1SVLA 2H19A 2FA8A 3K8NA 1OC9B 4CY8A 4KCAA 2P5RA 4IN0A 4KB3A 2N5AA 2O87A 3ISOA 2L5OA 4GRFA 2VUPA 2OE3A 2AAWA 1VRSD 3FY7A 1YF1A 3LSZA 1GTUA 1ZL9A 2A2SA 1XIYA 3M9JA 3IC4A 4JEDA 1TW9A 3G7JA 2A4VA 2LJRA 1SL2B 3ZIVA 2GZPA 3FZ4A 4ILFA 4OFTA 3GSSA 4MJCA 4F2IA 1LBKA 2GQLA 4IGJA 1XW6A 3Q18A 1NW2A 1XFLA 1YJ6A 1ZOFA 1CQGA 1CQHA 5IMFA 5AGYA 4D73A 4PUFC 4L5LA 3IOSA 3LG6A 2JZTA 4TXOB 4QL9A 2RUFA 4IVFA 4YQUA 5LNKe 2I4AA 2GDRA 5DVBA 3TKSA 2VL2C 4WF4A 5ECLB 1PMTA 2E2MA 4HU9A 4AJ8A 1FOHA 1X9SB 1GUMA 1B4QA 2QA2A 2WW1A 3HYPA 1W4VA 2AJQB 3QOUA 3WGEA 2N5BA 3H8QA 1MDIA 2AUVA 4BWSA 3CSHA 3GSTA 4EO3A 1JFUA 2CT6A 3WYWA 3DRNA 2GQMA 3WT2A 1GRXA 3FR6A 1R4WA 4HEA2 3O6TA 4JBBA 3M8NA 3ZFBA 3ZL5A 1U3IA 1A23A 4K0GA 4K9ZA 3UAPA 2GQKA 5H5QA 2WDUA 1TU8A 3UVHA 4LA1A 4IP1A 2YV7A 2E0QA 3FKFA 4XS6A 6GSXA 3HVVA 3LGCA 4IQAA 4HJMA 3DIEA 3MYDA 1SYRA 5J3RA 2CQ9A 3P2AA 3IC8A 2EIRA 2B5XA 2LQQA 1O8XA 1Z5YE 3RPPA 3C71A 3ZRDA 2RIIA 3TCOA 3FRCA 1LJRA 5AIXA 1X0RA 3ERWA 1O8WA 4DEJA 2EFEA 3VWVA 4CY6A 4X1UA 2A2RA 4PHZC 2IL3A 5D9VA 1XW9A 1Z3EA 4BVXB 4EE0A 4V2LA 2CA8A 3FMWA 5KN2A 3GIXA 2PU9C 2ZNMA 2VM1A 3GH9A 4XRDA 4EIQA 1A2LA 1WPIA 1PN9A 3F8UA 1GULA 3L0HA 2LTKA 2V6OA 2FCHA 3O3TA 4GLTA 3KTBA 3IK9A 1V58A 20GSA 1M7TA 2OBKA 1T4YA 1GSDA 1GH2A 2K8SA 4XS4A 5ID2B 3HJMA 4OFMA 2H0IA 4ZL9A 5IIZA 1GLPA 2CAQA 4MZWA 2CZ3A 2B1LA 2XC2A 2TRCP 2FUG2 3RHCA 3F3RA 3AY8A 2NBSA 2JU5A 1YEXA 1YQ1A 4F9ZA 4ZB9A 2VD0A 4I6XA 1I1IP 2LKUA 2YJ7A 3EMXA 4ID0A 1WJKA 4NPBA 2ZUPA 2GZYA 5J40A 4YAPA 4HOJA 4KSMA 3QMXA 1WWJA 3GTUB 2LJAA 5G2ZA 1J0FA 5A1NA 4XIHA 2YV9A 2FWEA 3BBYA 3IK7A 3IBHA 3VI7A 5CO3A 3SBCA 3VK9A 2EFCA 4F82A 3FW2A 1XWCA 2YOIA 2FLSA 3H79A 3US3A 3TGZA 1TK8B 2L57A 1OC9A 3E9JB 3NOFA 2UZ8A 2FA4A 3BCKA 2HRKB 5G30A 2JZSA 2HT9A 4EUYA 5JCUA 2HRNA 2DBCA 3C73A 1ZCPA 3EINA 4NV5A 3G7YA 4BPYA 5ELGA 3EMPA 5IOXA 1XOAA 1QQ2A 4TR1A 2OACA 3ZZXA 5IMDA 4I8BA 2HRFA 3DVXA 3IHGA 5DCGA 3KZQA 2RUEA 2UV8G 2GTUA 5EL8A 3TJBA 2FHEA 2WVYA 1K0AA 1OAZA 4GCIA 2L59A 3DMLA 1B8XA 2H71A 3L9VA 4MJAA 4N30A 5JCWA 1XVQA 4L5OA 1TK0B 1AUCA 1WP0A 3G9BA 3F4RA 3LJRA 5ECQB 1M9AA 5DAKB 6GSWA 2YZUA 4TXOA 3TOUA 2VCTA 1BG1A 2QC7A 3F0IA 4TR3A 2F9SA 2CV4A 2OE1A 4G9HA 2H0GA 2O5VA 4PX1A 5ECNB 2HNLA 4AKHA 2FWHA 3D6IA 2LRCA 3EVIA 4HDEA 4MNNA 4J2FA 4KUNA 2WFCA 1K0CA 1ZYEA 2VOCA 1B9YC 3GKNA 1G6YA 2VLTA 9GSSA 2AYTA 3I43A 4HZ4A 1VF3A 3MSZA 1KEBA 1K3OA 1M2AA 4AI6A 4EC0A 1T00A 4AKIA 1I5GA 4MH3A 5B6MA 2IMDA 1KTEA 6GSSA 2VM2A 1UVZA 4Q5NA 1S3AA 3E3EA 4ZL7A 3HXSA 4QMKA 1MDJA 4K8MA 2C3NA 3UVTA 1XZOA 3GKXA 2OADA 1MD3A 4F0CA 1K0MA 1XOBA 7GSSA 2YZHA 4KX4A 3ERFA 3PGTA 3PR8A 4YKGA 5EVOA 5GAND 5J4UA 4MP4A 3IHQA 2XBIA 1IYHA 1QK8A 4L8EA 5FHIA 2VCWA 4RUVA 2KOKA 4JR6A 2DSAA 1NSWA 2B1KA 2B3SA 1G7OA 1V40A 2E2GA 1LU4A 2R5GA 4FO5A 2YJHA 1OC8A 1ERVA 2LEGA 4G01A 1EEMA 3GKMA 1A24A 1M2DA 5D9XA 3HVSA 4BVXA 4RI6A 4LL1B 5A34B 4LLRA 2YWNA 2HI7A 4WBRD 4MMMA 2ON5A 3CSIA 1GWCA 3I9V2 3RAZA 2YWIA 3QAVA 3EE2A 4PTSA 4AGSA 2HZEB 1OYJA 3D4TA 3EU4A 1O81A 5F07A 5DBQA 4I2UA 2HSNA 1FB6A 3HA9A 5H5SA 1A2JA 4JR4A 3TKSE 2H70A 2KUCA 5AISA 3ZTLA 3S9FA 5ID2A 2DKHA 4WR5A 18GSA 1EEJA 2IPAA 2C0GA 1HD2A 3D21A 1TXXA 2YNXA 5KN0A 4IKHA 2B5EA 2M46A 2HRAA 2VCQA 2RLIA 3MWHA 2LUSA 3MAKA 2GVPA 1J9BA 2WVXB 3GRXA 3WD6A 4OO4A 1G6WA 1TJDA 2WCIA 1BX9A 3TRPA 2IN3A 5ECPB 2ZCTA 1R7HA 2FY6A 1TU7A 3A5WA 1T3BA 2K18A 1XW5A 3UMAA 3ME7A 1O7UA 1H4OA 4Q5FA 2IFQA 4V2NA 3HDCA 2V1MA 5HR1A 3IDVA 2JADA 1EV9A 5GSSA 1K3LA 3ZIJA 3FHKA 4O92A 1OKTA 1XG8A 4TN8A 4HJ2A 5IMVA 4NHZA 2WULA 3QFAC 4N0VA 4BVYB 2LRTA 2L6CA 1Y6EA 2VCVA 2WW3A 3IV4A 2HRKA 1A8LA 5C04A 2AV4A 3TUEA 4PGTA 5KEJA 3H4KA 3J7Yk 1I9DA 1URMA 1WE0A 2C4JA 5CP1A 2P5QA 4EF0A 4YAVA 1OVNA 1OE8A 1GSFA 3GA4A 1N2AA 4H86A 1SKRB 4RQRA 2R0CA 3QR6A 5AN1A 5J47A 2DMLA 3VPTA 4YH2A 1YKCA 2VCXA 3ZMKA 5A4VA 4EVMA 1PA3A 3CYNA 3P90A 2VAFA 2GS3A 5DALB 1EOGA 4NV2A 2F8AA 5D93A 1A8YA 2OE0A 2L5LA 3PINA 4WEYA 2LNTA 4KDUA 3GX0A 2CAIA 1EZKA 1X9WB 3N9JA 2HQTA 2R0GA 2O7KA 4QQ7A 3W6GA 3KEBA 2X8GA 2PBJA 5J9CA 4V1Ap 3DYRA 4JE1A 3WGXA 2V41A 1TI3A 4FXYP 2J23A 3M9KA 1O73A 1FVKA 1G7EA 1TRSA 4ZB7A 3FR3A 3PPUA 3TKRA 4BL7B 2XPEA 3MDKA 5HR3A 1BF5A 3IXRA 1ACVA 2REMA 1ERWA 1JZDA 2HZFA 2DC5A 1XWAA 1GLQA 1Z7RA 3LYKA 1THOA 2WVZA 2PVQA 2C80A 1EP7A 17GSA 1M99A 1SD9A 3W8JA 1GP1A 3TU3B 3UARA 5CYYA 1M9BA 4GQCA 4KGIA 4RI7A 1XXUA 5DDLA 1SENA 2C0DA 1QGVA 1YKAA 5DQYA 3GL3A 1PGTA 5DJLA 3KMOA 2CVKA 4TR4A 2WZSA 3EPTA 3U5RE 2PPTA 4N11A 4I2TA 4LL4B 4L0WA 1BQ7A 2LQOA 4MF5A 2IMIA 1AXDA 3CSJA 4OFNA 1FW1A 1UA5A 1NHOA 2H30A 3MIXA 3TJKA 1WIKA 1Y1UA 4HQSA 3LEFA 2VKZG 1B9XC 4DSSB 2GT5A 1GNEA 3DKSA 4X0XA 1S3RA 1EGRA 3TKSC 2HSMA 4EL1A 3Q74A 4CDOA 4JRRA 1YEWC 2QSIA 3UEMA 1F37A 3GX8A 2XBQA 2LS5A 1J08A 1N8JA 1TRVA 4AF2A 5F05A 10GSA 4G0IA 1ZZYA 3VFIA 3EURA 1SK0A 5J41A 5B8AA 4PUAA 19GSA 3C1SA 4K7IA 4KSOA 3QAGA 2GGTA 4WR4A 3L78A 1SJIA 5A34A 2O3EA 1DE1A 2VCZA 4CHSA 4WF5A 2EIOA 3CXGA 3D22A 3P8WA 1R5AA 2CX3A 3E0UA 3HMJG 3HJOA 1JLWA 5JWOB 1YDKA 4AKXB 1DSBA 4X4JA 3KP8A 5ECHB 3RPNA 2KLXA 5CRGA 4G0LA 1FHEA 5E4WA 2NTOA 3IR4A 2WGRA 3ME8A 4IW9A 4TRXA 4ZXGA 3APOA 4MA9A 2DJ2A 2YN1A 5BRTA 3W8SA 3P7XA 5CRWA 1E6BA 3KGKA 2PERA 1MD4A 12GSA 2C1YA 3R3EA 5IM9A 4XHMA 2LV3A 4EXJA 1KBNA 3O76A 3H93A 1VF4A 1ABAA 1RQMA 2A4HA 1IYIA 2X64A 5KOXA 2BMXA 1T8EB 2K8VA 2H76A 3L4NA 2IWTA 4ACSA 2HE3A 6GSVA 4QL7A 5CRDA 1U3AA 2B7KA 3GNJA 3HHVA 3KD0A 2B7JA 3PH9A 4DSRA 1W89A 4N3ZA 2H8LA 4PNGA 3N5OA 4GQFA 2FWGA 4A5PA 3TRXA 2C0EA 1XWGA 4XRAA 1BG5A 3HZ4A 5L71A 2IIYA 3APQA 2V2GA 1AIUA 3F6FA 2JSZA 3ZVJD 4P3YB 5A5HB 5IQYA 1JHBA 2TIRA 3FZ9A 1YZXA 4K5SA 1SU9A 2GZZA 4K2XA 5JWRB 3VWUA 4D73B 2BTOT 2H1AA 2B5YA 3QCPA 2RM5A 5KN3A 1KNGA 4IQ1A 4MPFA 4HQZA 1TOFA 3IPZA 2C3TA 1USBA 1WRYA 1X5DA 5DQSA 1AW9A 4G10A 1S3DA 5IPGA 1GL8A 5HR0A 2PGTA 4PNFA 3TDGA 5GSTA 5DJMA 2YANA 3C8EA 3A2XA 3UJ1A 3M1GA 2X8CA 4OCFA 1FO5A 3UOMA 4DSQA 4ECBA 1PX7A 4NAXA 1UC7A 5ELAA 2C3QA 4HSCX 2H75A 3VPQA 1V9WA 2F51A 3BOAA 4ZB8A 5D8IA 5ECRB 3BCIA 3IRAA 4Q5RA 2WW2A 1PD21 2H72A 3KIJA 4J56E 4BA7A 3LWAA 2GSSA 4POBA 1PSQA 4MJEA 3FYGA 2H1LA 5D9TA 4ECIA 4G2EA 4G0KA 2GT6A 4ISDA 1VGLA 3F63A 2XPDA 1ML6A 3TJJA 5ENUA 4KAEA 5IOWA 1U88A 5HFIA 4O5QA 4EDZA 4ICYA 1AC1A 3Q19A 3CQFA 3EYTA 4BIKA 3HCZA 1TTZA 5GZZB 1V98A 1U87A 2D2ZA 4JZQA 2R3XA 1HNBA 4MH2A 2O89A 13GSA 3KXOA 1ERTA 5D96A 1NHYA 3TJFA 1RW1A 3CMIA 4YKFA 1TI1A 1TXUA 1C72A 4GWRA 3CTFA 2QA1A 4ECCA 2WW0A 2GSTA 1A0RP 2J9HA 5HFKA 2HFDA 2DKIA 3LFLA 1T4ZA 1XVWA 1F3BA 1PKWA 1Z6NA 4KA0A 3VWWA 5IMAA 2DLXA 2VL3A 4V1Ag 3G7IA 2H6YA 1SYXA 1XWKA 3DWVA 1X5EA 1GSYA 3QPMA 5FWGA 5B6NA 1ZYQB 4GSTA 2H1GA 1GTIA 2EC4A 3GURA 4HZ2A 2NDOA 4ZL8A 3R2QA 4ZIJA 5IMZA 1SKWB 2VIMA 2PMTA 2EFHA 1MEKA 1GSQA 5IPHA 4E68A 3GKKA 1MTCA 4MZCA 2YP6A 1AAZA 2JZRA 2VLVA 1M3IA 1OC3A 2KP2A 2WB9A 1F9MA 2OJLA 1SD8A 1TP9A 5A4WA 4K1FA 6GSYA 5G5FA 2GLRA 1UN2A 1FVJA 2R0PA 4MLYA 4F0BA 2PVOC 4OMVA 5IO0A 4N0ZA 1TDIA 3QD9A 4I97A 4O7HA 1TK5B 2VL2A 2CX4A 1EWXA 4XCSA 1ON4A 1M2BA 4GXZA 2L6DA 3GTUA 2F3MA 2WJUA 4DVCA 4ZILA 3DGQA 4IBPA 5HFGA 3L9SA 5BMUB 2DJKA 3LORA 3HKRA 5CRHA 5G1KA 4MF6A 1R5PA 4O5RA 3ZLPA 4AJ6A 2LSTA 3HVXA 4TW5A 3KH7A 3ZMLA 3TKPA 1RK4A 5F0GA 2CVBA 5J9BA 3KCMA 5EPFA 5J4YA 2L4QA 2FD3A 2R37A 5E59A 3VWXA 3ED3A 1T1VA 3DEXA 4TR1B 4Z7XA 3FK8A 3GMFA 3WT1A 3D4MA 2H73A 1AQXA 1OKDA 1VF2A 2V32A 1AQWA 2TRXA 4RQXA 2VO4A 4KW6A 5A5HA 1FOVA 4WKWA 2OA7A 4WETA 2X4AA 3GYKA 4MPGA 4IHUA 4MZBA 2KHPA 5D73A 3NIVA 1F2EA 4NWYA 4ECJA 5IO2A 4EDYA 2HYXA 5HQPA 5IMCA 3RBTA 5FT3A 3QFBC 4ZBAA 4K6XA 4OD7A 5JCGA 4MF7A 6GSTA 5DAKA 4GF0A 14GSA 2G2QA 3UBLA 2VLUA 3C7MA 4J57E 2MMOA 5B8BA 4IP6A 4GTUA 3BD2A 3GFKA 1F6MC 3LW9A 3VURA 3HD5A 3KTLA 2X99A 5B7CA 3A2VA 2G0FA 4HS1A 3CHXC 4K2DA 1DE2A 2O85A 2VL9A 3GHAA 1XBSA 2DIYA 3HVNA 4PI2C 1G0TA 4ZB6A 3TKQA 3WGDA 1S3CA 3KJYA 2EIQA 3A5IA 3TRQA 2AHEA 4PXOA 1YY7A 2QGVA 4HI7A 1GTAA 6GSUA
chains in the Genus database with same CATH topology
1GUKA 2H74A 2IMKA 5F06A 4USSA 3ZREA 3LXTA 1PRXA 1ZGNA 2YPMA 1H75A 2JACA 2KP1A 4MK3A 1ZYPA 2I1UA 3OR5A 1JZWA 1R26A 3D0ZA 5COHA 4TR0A 5GAPD 5ECOB 1BYEA 1TRWA 4WBJA 3GN3A 2K6VA 3DVWA 2ON7A 4KDXA 3QDNA 3EC3A 3KP9A 1X5CA 4EKZA 4MDCA 5CREA 3SWLA 3HJPA 3NZNA 1OE7A 2E7PA 3F3QA 4FYUA 3V1WA 2IMFA 1SK1A 2O8VB 4OO5A 1PKZA 5A5KA 3DD3A 2I9HA 4HU7A 1EV4A 4XS1A 4Z2UA 2MBSA 4PQ1A 4Z2RA 3TJGA 2DJ0A 5JWQB 2HSNB 4NHWA 3DXBA 1PX6A 2NVLA 4IJ3A 4POMA 2HZEA 1SVOA 1BEDA 1TKDB 3EU3A 2IJYA 1VF1A 3F4TA 2HXKA 4GSNA 2MYGA 2JSYA 2BJXA 4K7NA 1Z7PA 1ZMAA 1PL1A 5J4VA 1QMVA 2I81A 2GSQA 5LCZA 1YF0A 3UL3A 1V57A 5KOWA 5EY6A 2N5FA 3RHBA 2JL4A 3F9UA 4PQHA 2HLSA 2DIZA 2Z9SA 2ALBA 4FYBA 4ML1A 1ILOA 1GTBA 2C8UA 3CBUA 3A3TA 3GV1A 1PL2A 2MMAA 4GSSA 4YQVA 4NXIA 2HSHA 2P31A 1K0NA 2IFQB 4O32A 1K3YA 3FEUA 3A2WA 1WOUA 4CW9A 1GUHA 1N25A 2CZ2A 3L9UA 2YCDA 4KDYA 2PN8A 5BMUA 3LYPA 1WMJA 1XWBA 1U6TA 4POLA 11GSA 4KF9A 3RDWA 3LQ7A 3TB2A 2GSRA 1MDKA 5KN1A 2H1DA 2NPBA 4BVYA 4W66A 22GSA 1F3AA 4IJIA 4IELA 1Z9HA 3UIWA 3KMNA 1FAAA 2X8HA 1YEPA 3VLNA 1HNCA 4KH7A 1JZOA 5C00A 4K5RA 4OWYA 1Y25A 1THXA 3FR9A 4TKYA 3ZITA 2YWMA 5ECIB 2DJ3A 3FZ5A 2P0GA 1GNWA 1YVLA 1X9MB 3MNGA 5J5NA 4I5QA 4K0NA 4HUAA 3QAWA 5CAXA 3IAM2 2PWJA 1JZRA 1PQNA 3KM6A 4BWQA 2OKAA 4KE3A 2RM6A 2MMNA 5DALA 3VI5A 3C1RA 3FZAA 1ST9A 2K9FA 1HQOA 1JLVA 5DCHA 4FIWA 2MBTA 1M0UA 3I6AA 2WZ9A 2HSYA 4KNDA 3ZFLA 1QXHA 2R4VA 3CRTA 1FB0A 4YQMA 4K7OA 2OBIA 3M3MA 1GSUA 5AIVA 3UBKA 1SJ6A 2H66A 1A2MA 3GL5A 1O85A 3JCML 3ERGA 5ECKB 4L0UA 3J7Yb 2MMZA 3IA1A 5ABRA 4TVEA 5F8BA 8GSSA 3D5JA 4V2MA 2LJKA 1ZYNA 4G19A 3EWLA 4X43A 3U6VA 3M0FA 4TOPA 3CRUA 4PQIA 4BL7A 2QKEA 4EIPA 1K0DA 5G31A 2H6XA 4ML6A 1EOHA 1XCCA 1EP8A 1SL0B 1SKSB 2F8FA 3ZVJA 4ULXA 4MCUA 1GSEA 1O6JA 1B48A 3TOTA 2I3YA 1V2AA 1DUGA 5INYA 2C0FA 3H1NA 4JU5A 3GH6A 2PUKC 4E8HA 3CTGA 5A4UA 1SK2A 4MABA 16GSA 5CNWA 4ZBBA 5H5RA 3IE3A 1NM3A 3LXZA 4WXTA 2R2JA 4Q5QA 4TXVA 4FQUA 1K0BA 1HYUA 1Q4JA 2MZCA 4KCEA 4O5UA 4IS0A 1BAYA 2WS2A 3BJ5A 5HR2A 2CVDA 3F6DA 1E2YA 5G1LA 2DJ1A 4DSSA 2HSMB 1SJZA 2DMMA 1B4PA 1EGOA 1QFNA 5G5EA 2VD1A 1A0FA 1HNAA 1DBYA 3KH9A 2FNOA 3APSA 1AQVA 4MJBA 2LNSA 2XHFA 2L4CA 4XS4B 2ES7A 2H01A 1Z6MA 1TRUA 4XTSA 3GUSA 5LD0A 2OT3A 4LMWA 4LMVA 2WRTA 2B6MA 1PN0A 2X49A 4N10A 4AKGA 3ZYWA 5ECSA 4FYCA 3HY2A 5ECMB 2H1BA 2AB6A 1XPVA 3F4SA 1ERUA 4NMUA 4AJ7A 1SL1B 2DJJA 1FG4A 2R6KA 2H0HA 1Q98A 4E8EA 2V6KA 5D9WA 3Q6OA 4POKA 1SVMA 2M80A 5A1NB 3CWGA 2YWOA 1BJXA 2IMEA 2A2PA 1GSSA 1K0OA 4FH8A 1T7PB 4F03A 2FGXA 4OCEA 3HZ8A 1QUWA 2EFDA 2M72A 2LRNA 4GDFA 4Z2TA 4ZBDA 2H6ZA 4PURA 2FWFA 3I69A 3IAS2 1SVLA 2H19A 2FA8A 3K8NA 1OC9B 4CY8A 4KCAA 2P5RA 4IN0A 4KB3A 2N5AA 2O87A 3ISOA 2L5OA 4GRFA 2VUPA 2OE3A 2AAWA 1VRSD 3FY7A 1YF1A 3LSZA 1GTUA 1ZL9A 2A2SA 1XIYA 3M9JA 3IC4A 4JEDA 1TW9A 3G7JA 2A4VA 2LJRA 1SL2B 3ZIVA 2GZPA 3FZ4A 4ILFA 4OFTA 3GSSA 4MJCA 4F2IA 1LBKA 2GQLA 4IGJA 1XW6A 3Q18A 1NW2A 1XFLA 1YJ6A 1ZOFA 1CQGA 1CQHA 5IMFA 5AGYA 4D73A 4PUFC 4L5LA 3IOSA 3LG6A 2JZTA 4TXOB 4QL9A 2RUFA 4IVFA 4YQUA 5LNKe 2I4AA 2GDRA 5DVBA 3TKSA 2VL2C 4WF4A 5ECLB 1PMTA 2E2MA 4HU9A 4AJ8A 1FOHA 1X9SB 1GUMA 1B4QA 2QA2A 3HYPA 1W4VA 2AJQB 3QOUA 3WGEA 2N5BA 3H8QA 1MDIA 2AUVA 4BWSA 3CSHA 3GSTA 4EO3A 1JFUA 2CT6A 3WYWA 3DRNA 2GQMA 3WT2A 1GRXA 3FR6A 1R4WA 4HEA2 3O6TA 4JBBA 3M8NA 3ZFBA 3ZL5A 1U3IA 1A23A 4K0GA 4K9ZA 3UAPA 2GQKA 5H5QA 2WDUA 1TU8A 3UVHA 4LA1A 4IP1A 2YV7A 2E0QA 3FKFA 4XS6A 6GSXA 3HVVA 3LGCA 4IQAA 4HJMA 3DIEA 3MYDA 1SYRA 5J3RA 2CQ9A 3P2AA 3IC8A 2EIRA 2B5XA 2LQQA 1O8XA 1Z5YE 3RPPA 3C71A 3ZRDA 2RIIA 3TCOA 3FRCA 1LJRA 5AIXA 1X0RA 3ERWA 1O8WA 4DEJA 2EFEA 3VWVA 4CY6A 4X1UA 2A2RA 2IL3A 5D9VA 1XW9A 1Z3EA 4BVXB 4EE0A 4V2LA 2CA8A 3FMWA 5KN2A 3GIXA 2PU9C 2ZNMA 2VM1A 3GH9A 4XRDA 4EIQA 1A2LA 1WPIA 1PN9A 3F8UA 1GULA 3L0HA 2LTKA 2V6OA 2FCHA 3O3TA 4GLTA 3KTBA 3IK9A 1V58A 20GSA 1M7TA 2OBKA 1T4YA 1GSDA 1GH2A 2K8SA 4XS4A 5ID2B 3HJMA 4OFMA 2H0IA 4ZL9A 5IIZA 1GLPA 2CAQA 4MZWA 2CZ3A 2B1LA 2XC2A 2TRCP 2FUG2 3RHCA 3F3RA 3AY8A 2NBSA 2JU5A 1YEXA 1YQ1A 4F9ZA 4ZB9A 2VD0A 4I6XA 2LKUA 2YJ7A 3EMXA 4ID0A 1WJKA 4NPBA 2ZUPA 2GZYA 5J40A 4YAPA 4HOJA 4KSMA 3QMXA 1WWJA 3GTUB 2LJAA 5G2ZA 1J0FA 5A1NA 4XIHA 2YV9A 2FWEA 3BBYA 3IK7A 3IBHA 3VI7A 5CO3A 3SBCA 3VK9A 2EFCA 4F82A 3FW2A 1XWCA 2YOIA 2FLSA 3H79A 3US3A 3TGZA 1TK8B 2L57A 1OC9A 3E9JB 3NOFA 2UZ8A 2FA4A 3BCKA 2HRKB 5G30A 2JZSA 2HT9A 4EUYA 5JCUA 2HRNA 2DBCA 3C73A 1ZCPA 3EINA 4NV5A 3G7YA 4BPYA 5ELGA 3EMPA 5IOXA 1XOAA 1QQ2A 4TR1A 2OACA 3ZZXA 5IMDA 4I8BA 2HRFA 3DVXA 3IHGA 5DCGA 3KZQA 2RUEA 2UV8G 2GTUA 5EL8A 3TJBA 2FHEA 1K0AA 1OAZA 4GCIA 2L59A 3DMLA 1B8XA 2H71A 3L9VA 4MJAA 4N30A 5JCWA 1XVQA 4L5OA 1TK0B 1AUCA 1WP0A 3G9BA 3LJRA 5ECQB 1M9AA 3F4RA 5DAKB 6GSWA 2YZUA 4TXOA 3TOUA 2VCTA 1BG1A 2QC7A 3F0IA 4TR3A 2F9SA 2CV4A 2OE1A 4G9HA 2H0GA 2O5VA 4PX1A 5ECNB 2HNLA 4AKHA 2FWHA 3D6IA 2LRCA 3EVIA 4HDEA 4MNNA 4J2FA 4KUNA 2WFCA 1K0CA 1ZYEA 2VOCA 1B9YC 3GKNA 1G6YA 2VLTA 9GSSA 2AYTA 3I43A 4HZ4A 1VF3A 3MSZA 1KEBA 1K3OA 1M2AA 4AI6A 4EC0A 1T00A 4AKIA 1I5GA 4MH3A 5B6MA 2IMDA 1KTEA 6GSSA 2VM2A 1UVZA 4Q5NA 1S3AA 3E3EA 4ZL7A 3HXSA 4QMKA 1MDJA 4K8MA 2C3NA 3UVTA 1XZOA 3GKXA 2OADA 1MD3A 4F0CA 1K0MA 1XOBA 7GSSA 2YZHA 4KX4A 3ERFA 3PGTA 3PR8A 4YKGA 5EVOA 5GAND 5J4UA 4MP4A 3IHQA 2XBIA 1IYHA 1QK8A 4L8EA 5FHIA 2VCWA 4RUVA 2KOKA 4JR6A 2DSAA 1NSWA 2B1KA 2B3SA 1G7OA 1V40A 2E2GA 1LU4A 2R5GA 4FO5A 2YJHA 1OC8A 1ERVA 2LEGA 4G01A 1EEMA 3GKMA 1A24A 1M2DA 5D9XA 3HVSA 4BVXA 4RI6A 4LL1B 5A34B 4LLRA 2YWNA 2HI7A 4WBRD 4MMMA 2ON5A 3CSIA 1GWCA 3I9V2 3RAZA 2YWIA 3QAVA 3EE2A 4PTSA 4AGSA 2HZEB 1OYJA 3D4TA 3EU4A 1O81A 5F07A 5DBQA 4I2UA 2HSNA 1FB6A 3HA9A 5H5SA 1A2JA 4JR4A 3TKSE 2H70A 2KUCA 5AISA 3ZTLA 3S9FA 5ID2A 2DKHA 4WR5A 18GSA 1EEJA 2IPAA 2C0GA 1HD2A 3D21A 1TXXA 2YNXA 5KN0A 4IKHA 2B5EA 2M46A 2HRAA 2VCQA 2RLIA 3MWHA 2LUSA 3MAKA 2GVPA 1J9BA 3GRXA 3WD6A 4OO4A 1G6WA 1TJDA 2WCIA 1BX9A 3TRPA 2IN3A 5ECPB 2ZCTA 1R7HA 2FY6A 1TU7A 3A5WA 1T3BA 2K18A 1XW5A 3UMAA 3ME7A 1O7UA 1H4OA 4Q5FA 2IFQA 4V2NA 3HDCA 2V1MA 5HR1A 3IDVA 2JADA 1EV9A 5GSSA 1K3LA 3ZIJA 3FHKA 4O92A 1OKTA 4TN8A 4HJ2A 5IMVA 4NHZA 2WULA 3QFAC 4N0VA 4BVYB 2LRTA 2L6CA 1Y6EA 2VCVA 3IV4A 2HRKA 1A8LA 5C04A 2AV4A 3TUEA 4PGTA 5KEJA 3H4KA 3J7Yk 1I9DA 1URMA 1WE0A 2C4JA 5CP1A 2P5QA 4EF0A 4YAVA 1OVNA 1OE8A 1GSFA 3GA4A 1N2AA 4H86A 1SKRB 4RQRA 2R0CA 3QR6A 5AN1A 5J47A 2DMLA 3VPTA 4YH2A 1YKCA 2VCXA 3ZMKA 5A4VA 4EVMA 1PA3A 3CYNA 3P90A 2VAFA 2GS3A 5DALB 1EOGA 4NV2A 2F8AA 5D93A 1A8YA 2OE0A 2L5LA 3PINA 4WEYA 2LNTA 4KDUA 3GX0A 2CAIA 1EZKA 1X9WB 3N9JA 2HQTA 2R0GA 2O7KA 4QQ7A 3W6GA 3KEBA 2X8GA 2PBJA 5J9CA 4V1Ap 3DYRA 4JE1A 3WGXA 2V41A 1TI3A 2J23A 3M9KA 1O73A 1FVKA 1G7EA 1TRSA 4ZB7A 3FR3A 3PPUA 3TKRA 4BL7B 2XPEA 3MDKA 5HR3A 1BF5A 3IXRA 1ACVA 2REMA 1ERWA 1JZDA 2HZFA 2DC5A 1XWAA 1GLQA 1Z7RA 3LYKA 1THOA 2PVQA 2C80A 1EP7A 17GSA 1M99A 1SD9A 3W8JA 1GP1A 3TU3B 3UARA 5CYYA 1M9BA 4GQCA 4KGIA 4RI7A 1XXUA 5DDLA 1SENA 2C0DA 1QGVA 1YKAA 5DQYA 3GL3A 1PGTA 5DJLA 3KMOA 2CVKA 4TR4A 3EPTA 3U5RE 2PPTA 4N11A 4I2TA 4LL4B 4L0WA 1BQ7A 2LQOA 4MF5A 2IMIA 1AXDA 3CSJA 4OFNA 1FW1A 1UA5A 1NHOA 2H30A 3MIXA 3TJKA 1WIKA 1Y1UA 4HQSA 3LEFA 2VKZG 1B9XC 4DSSB 2GT5A 1GNEA 3DKSA 4X0XA 1EGRA 3TKSC 2HSMA 4EL1A 3Q74A 4CDOA 4JRRA 2QSIA 3UEMA 1F37A 3GX8A 2XBQA 2LS5A 1J08A 1N8JA 1TRVA 4AF2A 5F05A 10GSA 4G0IA 1ZZYA 3VFIA 3EURA 1SK0A 5J41A 5B8AA 4PUAA 19GSA 3C1SA 4K7IA 4KSOA 3QAGA 2GGTA 4WR4A 3L78A 1SJIA 5A34A 1DE1A 2VCZA 4CHSA 4WF5A 2EIOA 3CXGA 3D22A 3P8WA 1R5AA 2CX3A 3E0UA 3HMJG 3HJOA 1JLWA 5JWOB 1YDKA 4AKXB 1DSBA 4X4JA 3KP8A 5ECHB 3RPNA 2KLXA 5CRGA 4G0LA 1FHEA 5E4WA 2NTOA 3IR4A 2WGRA 3ME8A 4IW9A 4TRXA 4ZXGA 3APOA 4MA9A 2DJ2A 2YN1A 5BRTA 3W8SA 3P7XA 5CRWA 1E6BA 3KGKA 2PERA 1MD4A 12GSA 2C1YA 3R3EA 5IM9A 4XHMA 2LV3A 4EXJA 1KBNA 3O76A 3H93A 1VF4A 1ABAA 1RQMA 2A4HA 1IYIA 2X64A 5KOXA 2BMXA 1T8EB 2K8VA 2H76A 3L4NA 2IWTA 4ACSA 2HE3A 6GSVA 4QL7A 5CRDA 1U3AA 2B7KA 3GNJA 3HHVA 3KD0A 2B7JA 3PH9A 4DSRA 1W89A 4N3ZA 2H8LA 4PNGA 3N5OA 4GQFA 2FWGA 4A5PA 3TRXA 2C0EA 1XWGA 4XRAA 1BG5A 3HZ4A 5L71A 2IIYA 3APQA 2V2GA 1AIUA 3F6FA 2JSZA 3ZVJD 4P3YB 5A5HB 5IQYA 1JHBA 2TIRA 3FZ9A 1YZXA 4K5SA 1SU9A 2GZZA 4K2XA 5JWRB 3VWUA 4D73B 2BTOT 2H1AA 2B5YA 3QCPA 2RM5A 5KN3A 1KNGA 4IQ1A 4MPFA 4HQZA 1TOFA 3IPZA 2C3TA 1USBA 1WRYA 1X5DA 5DQSA 1AW9A 4G10A 1S3DA 5IPGA 1GL8A 5HR0A 2PGTA 4PNFA 3TDGA 5GSTA 5DJMA 2YANA 3C8EA 3A2XA 3UJ1A 3M1GA 2X8CA 4OCFA 1FO5A 3UOMA 4DSQA 4ECBA 1PX7A 4NAXA 1UC7A 5ELAA 2C3QA 2H75A 3VPQA 1V9WA 2F51A 3BOAA 4ZB8A 5D8IA 5ECRB 3BCIA 3IRAA 4Q5RA 1PD21 2H72A 3KIJA 4J56E 4BA7A 3LWAA 2GSSA 4POBA 1PSQA 4MJEA 3FYGA 2H1LA 5D9TA 4ECIA 4G2EA 4G0KA 2GT6A 4ISDA 1VGLA 3F63A 2XPDA 1ML6A 3TJJA 5ENUA 4KAEA 5IOWA 1U88A 5HFIA 4O5QA 4EDZA 4ICYA 1AC1A 3Q19A 3EYTA 3HCZA 1TTZA 5GZZB 1V98A 1U87A 2D2ZA 4JZQA 2R3XA 1HNBA 4MH2A 2O89A 13GSA 3KXOA 1ERTA 5D96A 1NHYA 3TJFA 1RW1A 3CMIA 4YKFA 1TI1A 1TXUA 1C72A 4GWRA 3CTFA 2QA1A 4ECCA 2GSTA 1A0RP 2J9HA 5HFKA 2HFDA 2DKIA 3LFLA 1T4ZA 1XVWA 1F3BA 1PKWA 1Z6NA 4KA0A 3VWWA 5IMAA 2DLXA 2VL3A 4V1Ag 3G7IA 2H6YA 1SYXA 1XWKA 3DWVA 1X5EA 1GSYA 3QPMA 5FWGA 5B6NA 1ZYQB 4GSTA 2H1GA 1GTIA 2EC4A 3GURA 4HZ2A 2NDOA 4ZL8A 3R2QA 4ZIJA 5IMZA 1SKWB 2VIMA 2PMTA 2EFHA 1MEKA 1GSQA 5IPHA 4E68A 3GKKA 1MTCA 4MZCA 2YP6A 1AAZA 2JZRA 2VLVA 1OC3A 2KP2A 2WB9A 1F9MA 2OJLA 1SD8A 1TP9A 5A4WA 4K1FA 6GSYA 5G5FA 2GLRA 1UN2A 1FVJA 2R0PA 4MLYA 4F0BA 2PVOC 4OMVA 5IO0A 4N0ZA 1TDIA 3QD9A 4I97A 4O7HA 1TK5B 2VL2A 2CX4A 1EWXA 4XCSA 1ON4A 1M2BA 4GXZA 2L6DA 3GTUA 2F3MA 2WJUA 4DVCA 4ZILA 3DGQA 4IBPA 5HFGA 3L9SA 5BMUB 2DJKA 3LORA 3HKRA 5CRHA 5G1KA 4MF6A 1R5PA 4O5RA 3ZLPA 4AJ6A 2LSTA 3HVXA 4TW5A 3KH7A 3ZMLA 3TKPA 1RK4A 5F0GA 2CVBA 5J9BA 3KCMA 5EPFA 5J4YA 2L4QA 2FD3A 2R37A 5E59A 3VWXA 3ED3A 1T1VA 3DEXA 4TR1B 4Z7XA 3FK8A 3GMFA 3WT1A 3D4MA 2H73A 1AQXA 1OKDA 1VF2A 2V32A 1AQWA 2TRXA 4RQXA 2VO4A 4KW6A 5A5HA 1FOVA 4WKWA 2OA7A 4WETA 2X4AA 3GYKA 4MPGA 4IHUA 4MZBA 2KHPA 5D73A 3NIVA 1F2EA 4NWYA 4ECJA 5IO2A 4EDYA 2HYXA 5HQPA 5IMCA 3RBTA 5FT3A 3QFBC 4ZBAA 4K6XA 4OD7A 5JCGA 4MF7A 6GSTA 5DAKA 4GF0A 14GSA 2G2QA 3UBLA 2VLUA 3C7MA 4J57E 2MMOA 5B8BA 4IP6A 4GTUA 3BD2A 3GFKA 1F6MC 3LW9A 3VURA 3HD5A 3KTLA 2X99A 5B7CA 3A2VA 2G0FA 4HS1A 4K2DA 1DE2A 2O85A 2VL9A 3GHAA 1XBSA 2DIYA 1G0TA 4ZB6A 3TKQA 3WGDA 1S3CA 3KJYA 2EIQA 3A5IA 3TRQA 2AHEA 4PXOA 1YY7A 2QGVA 4HI7A 1GTAA 6GSUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GUK A;  2H74 A;  2IMK A;  5F06 A;  4USS A;  3ZRE A;  3LXT A;  1PRX A;  1ZGN A;  2YPM A;  1H75 A;  2JAC A;  2KP1 A;  4MK3 A;  2I1U A;  3OR5 A;  1JZW A;  1R26 A;  3D0Z A;  5COH A;  4TR0 A;  5GAP D;  5ECO B;  1BYE A;  1TRW A;  4WBJ A;  3GN3 A;  2K6V A;  3DVW A;  2ON7 A;  4KDX A;  3QDN A;  3EC3 A;  3KP9 A;  1X5C A;  4EKZ A;  4MDC A;  5CRE A;  3SWL A;  3HJP A;  3NZN A;  1OE7 A;  2E7P A;  3F3Q A;  4FYU A;  3V1W A;  2IMF A;  1SK1 A;  2O8V B;  4OO5 A;  1PKZ A;  5A5K A;  3DD3 A;  2I9H A;  4HU7 A;  1EV4 A;  4XS1 A;  2MBS A;  4PQ1 A;  3TJG A;  2DJ0 A;  5JWQ B;  2HSN B;  4NHW A;  3DXB A;  1PX6 A;  2NVL A;  4IJ3 A;  4POM A;  2HZE A;  1BED A;  1TKD B;  3EU3 A;  2IJY A;  1VF1 A;  3F4T A;  2HXK A;  4GSN A;  2MYG A;  2JSY A;  2BJX A;  4K7N A;  1Z7P A;  1ZMA A;  1PL1 A;  1QMV A;  2I81 A;  2GSQ A;  5LCZ A;  1YF0 A;  3UL3 A;  1V57 A;  5EY6 A;  2N5F A;  3RHB A;  2JL4 A;  3F9U A;  4PQH A;  2HLS A;  2DIZ A;  2Z9S A;  2ALB A;  4FYB A;  4ML1 A;  1ILO A;  1GTB A;  2C8U A;  3CBU A;  3A3T A;  3GV1 A;  1PL2 A;  2MMA A;  4GSS A;  4YQV A;  4NXI A;  2HSH A;  2P31 A;  1K0N A;  2IFQ B;  4O32 A;  1K3Y A;  3FEU A;  3A2W A;  1WOU A;  4CW9 A;  1GUH A;  2CZ2 A;  3L9U A;  2YCD A;  4KDY A;  2PN8 A;  5BMU A;  3LYP A;  1WMJ A;  1XWB A;  1U6T A;  4POL A;  11GS A;  4KF9 A;  3RDW A;  3LQ7 A;  3TB2 A;  2GSR A;  1MDK A;  5KN1 A;  2H1D A;  2NPB A;  4BVY A;  22GS A;  1F3A A;  4IJI A;  4IEL A;  1Z9H A;  3UIW A;  3KMN A;  1FAA A;  2X8H A;  1YEP A;  3VLN A;  1HNC A;  4KH7 A;  1JZO A;  5C00 A;  4OWY A;  1Y25 A;  1THX A;  3FR9 A;  4TKY A;  3ZIT A;  2YWM A;  5ECI B;  2DJ3 A;  3FZ5 A;  2P0G A;  1GNW A;  1X9M B;  3MNG A;  5J5N A;  4I5Q A;  4K0N A;  4HUA A;  3QAW A;  5CAX A;  3IAM 2;  2PWJ A;  1JZR A;  1PQN A;  3KM6 A;  4BWQ A;  2OKA A;  4KE3 A;  2RM6 A;  2MMN A;  5DAL A;  3VI5 A;  3C1R A;  3FZA A;  1ST9 A;  2K9F A;  1HQO A;  1JLV A;  5DCH A;  4FIW A;  2MBT A;  1M0U A;  3I6A A;  2WZ9 A;  2HSY A;  4KND A;  3ZFL A;  1QXH A;  2R4V A;  3CRT A;  1FB0 A;  4YQM A;  4K7O A;  2OBI A;  3M3M A;  1GSU A;  5AIV A;  3UBK A;  1SJ6 A;  2H66 A;  1A2M A;  3GL5 A;  1O85 A;  3JCM L;  3ERG A;  5ECK B;  4L0U A;  3J7Y b;  2MMZ A;  3IA1 A;  5ABR A;  4TVE A;  5F8B A;  8GSS A;  3D5J A;  4V2M A;  2LJK A;  4G19 A;  3EWL A;  4X43 A;  3U6V A;  3M0F A;  4TOP A;  3CRU A;  4PQI A;  4BL7 A;  2QKE A;  1K0D A;  5G31 A;  2H6X A;  4ML6 A;  1EOH A;  1XCC A;  1EP8 A;  1SL0 B;  1SKS B;  2F8F A;  3ZVJ A;  4ULX A;  4MCU A;  1GSE A;  1O6J A;  1B48 A;  3TOT A;  2I3Y A;  1V2A A;  1DUG A;  5INY A;  2C0F A;  3H1N A;  4JU5 A;  3GH6 A;  2PUK C;  4E8H A;  3CTG A;  5A4U A;  1SK2 A;  4MAB A;  16GS A;  5CNW A;  4ZBB A;  5H5R A;  3IE3 A;  1NM3 A;  3LXZ A;  4WXT A;  2R2J A;  4Q5Q A;  4TXV A;  4FQU A;  1K0B A;  1HYU A;  1Q4J A;  2MZC A;  4KCE A;  4IS0 A;  1BAY A;  2WS2 A;  3BJ5 A;  5HR2 A;  2CVD A;  3F6D A;  1E2Y A;  5G1L A;  2DJ1 A;  4DSS A;  2HSM B;  1SJZ A;  2DMM A;  1B4P A;  1EGO A;  1QFN A;  5G5E A;  2VD1 A;  1A0F A;  1HNA A;  1DBY A;  3KH9 A;  2FNO A;  3APS A;  1AQV A;  4MJB A;  2LNS A;  2XHF A;  2L4C A;  4XS4 B;  2ES7 A;  2H01 A;  1Z6M A;  1TRU A;  4XTS A;  3GUS A;  5LD0 A;  4LMW A;  4LMV A;  2WRT A;  2B6M A;  4N10 A;  3ZYW A;  5ECS A;  4FYC A;  3HY2 A;  5ECM B;  2H1B A;  2AB6 A;  1XPV A;  3F4S A;  1ERU A;  4NMU A;  4AJ7 A;  1SL1 B;  2DJJ A;  1FG4 A;  2R6K A;  2H0H A;  1Q98 A;  4E8E A;  2V6K A;  5D9W A;  3Q6O A;  4POK A;  2M80 A;  2YWO A;  1BJX A;  2IME A;  1GSS A;  1K0O A;  4FH8 A;  1T7P B;  4F03 A;  2FGX A;  4OCE A;  3HZ8 A;  1QUW A;  2M72 A;  2LRN A;  4ZBD A;  2H6Z A;  4PUR A;  2FWF A;  3I69 A;  3IAS 2;  2H19 A;  2FA8 A;  3K8N A;  1OC9 B;  4KCA A;  2P5R A;  4IN0 A;  4KB3 A;  2N5A A;  2O87 A;  3ISO A;  2L5O A;  4GRF A;  2VUP A;  2OE3 A;  2AAW A;  1VRS D;  3FY7 A;  1YF1 A;  3LSZ A;  1GTU A;  1ZL9 A;  2A2S A;  1XIY A;  3M9J A;  3IC4 A;  4JED A;  1TW9 A;  3G7J A;  2A4V A;  2LJR A;  1SL2 B;  3ZIV A;  2GZP A;  3FZ4 A;  4ILF A;  4OFT A;  3GSS A;  4MJC A;  4F2I A;  1LBK A;  2GQL A;  4IGJ A;  1XW6 A;  3Q18 A;  1NW2 A;  1XFL A;  1YJ6 A;  1ZOF A;  1CQG A;  1CQH A;  5IMF A;  5AGY A;  4D73 A;  4PUF C;  4L5L A;  3IOS A;  3LG6 A;  2JZT A;  4TXO B;  4QL9 A;  2RUF A;  4IVF A;  4YQU A;  5LNK e;  2I4A A;  2GDR A;  5DVB A;  3TKS A;  2VL2 C;  4WF4 A;  5ECL B;  1PMT A;  2E2M A;  4HU9 A;  4AJ8 A;  1X9S B;  1GUM A;  1B4Q A;  3HYP A;  1W4V A;  2AJQ B;  3QOU A;  3WGE A;  2N5B A;  3H8Q A;  1MDI A;  2AUV A;  4BWS A;  3CSH A;  3GST A;  4EO3 A;  1JFU A;  2CT6 A;  3WYW A;  3DRN A;  2GQM A;  3WT2 A;  1GRX A;  3FR6 A;  1R4W A;  4HEA 2;  3O6T A;  4JBB A;  3M8N A;  3ZFB A;  3ZL5 A;  1U3I A;  1A23 A;  4K0G A;  4K9Z A;  3UAP A;  2GQK A;  5H5Q A;  2WDU A;  1TU8 A;  3UVH A;  4LA1 A;  4IP1 A;  2YV7 A;  2E0Q A;  3FKF A;  4XS6 A;  6GSX A;  3HVV A;  3LGC A;  4IQA A;  4HJM A;  3DIE A;  1SYR A;  5J3R A;  2CQ9 A;  3P2A A;  3IC8 A;  2EIR A;  2B5X A;  2LQQ A;  1O8X A;  1Z5Y E;  3RPP A;  3C71 A;  3ZRD A;  2RII A;  3TCO A;  3FRC A;  1LJR A;  5AIX A;  1X0R A;  3ERW A;  1O8W A;  4DEJ A;  3VWV A;  4X1U A;  2A2R A;  2IL3 A;  5D9V A;  1XW9 A;  1Z3E A;  4BVX B;  4EE0 A;  4V2L A;  2CA8 A;  5KN2 A;  3GIX A;  2PU9 C;  2ZNM A;  2VM1 A;  3GH9 A;  4XRD A;  1A2L A;  1WPI A;  1PN9 A;  3F8U A;  1GUL A;  3L0H A;  2LTK A;  2V6O A;  2FCH A;  3O3T A;  4GLT A;  3KTB A;  3IK9 A;  1V58 A;  20GS A;  1M7T A;  2OBK A;  1T4Y A;  1GSD A;  1GH2 A;  2K8S A;  4XS4 A;  5ID2 B;  3HJM A;  4OFM A;  2H0I A;  4ZL9 A;  5IIZ A;  1GLP A;  2CAQ A;  4MZW A;  2CZ3 A;  2B1L A;  2XC2 A;  2TRC P;  2FUG 2;  3RHC A;  3F3R A;  3AY8 A;  2NBS A;  2JU5 A;  1YEX A;  1YQ1 A;  4F9Z A;  4ZB9 A;  2VD0 A;  4I6X A;  2LKU A;  2YJ7 A;  3EMX A;  4ID0 A;  1WJK A;  4NPB A;  2ZUP A;  2GZY A;  4YAP A;  4HOJ A;  4KSM A;  3QMX A;  1WWJ A;  3GTU B;  2LJA A;  5G2Z A;  1J0F A;  4XIH A;  2YV9 A;  2FWE A;  3BBY A;  3IK7 A;  3IBH A;  3VI7 A;  5CO3 A;  3SBC A;  3VK9 A;  4F82 A;  3FW2 A;  1XWC A;  2YOI A;  2FLS A;  3H79 A;  3US3 A;  3TGZ A;  1TK8 B;  2L57 A;  1OC9 A;  3E9J B;  3NOF A;  2UZ8 A;  2FA4 A;  3BCK A;  2HRK B;  5G30 A;  2JZS A;  2HT9 A;  4EUY A;  5JCU A;  2HRN A;  2DBC A;  3C73 A;  1ZCP A;  3EIN A;  4NV5 A;  3G7Y A;  4BPY A;  5ELG A;  3EMP A;  5IOX A;  1XOA A;  1QQ2 A;  4TR1 A;  2OAC A;  3ZZX A;  5IMD A;  4I8B A;  2HRF A;  3DVX A;  5DCG A;  3KZQ A;  2RUE A;  2GTU A;  5EL8 A;  3TJB A;  2FHE A;  1K0A A;  1OAZ A;  4GCI A;  2L59 A;  3DML A;  1B8X A;  2H71 A;  3L9V A;  4MJA A;  4N30 A;  5JCW A;  1XVQ A;  4L5O A;  1TK0 B;  1AUC A;  1WP0 A;  3G9B A;  3LJR A;  5ECQ B;  1M9A A;  3F4R A;  5DAK B;  6GSW A;  2YZU A;  4TXO A;  3TOU A;  2VCT A;  2QC7 A;  3F0I A;  4TR3 A;  2F9S A;  2CV4 A;  2OE1 A;  4G9H A;  2H0G A;  4PX1 A;  5ECN B;  2HNL A;  2FWH A;  3D6I A;  2LRC A;  3EVI A;  4HDE A;  4J2F A;  4KUN A;  2WFC A;  1K0C A;  1ZYE A;  2VOC A;  1B9Y C;  3GKN A;  1G6Y A;  2VLT A;  9GSS A;  2AYT A;  3I43 A;  4HZ4 A;  1VF3 A;  3MSZ A;  1KEB A;  1K3O A;  1M2A A;  4EC0 A;  1T00 A;  1I5G A;  4MH3 A;  5B6M A;  2IMD A;  1KTE A;  6GSS A;  2VM2 A;  1UVZ A;  4Q5N A;  1S3A A;  3E3E A;  4ZL7 A;  3HXS A;  1MDJ A;  4K8M A;  2C3N A;  3UVT A;  1XZO A;  3GKX A;  2OAD A;  1MD3 A;  4F0C A;  1K0M A;  1XOB A;  7GSS A;  2YZH A;  4KX4 A;  3ERF A;  3PGT A;  3PR8 A;  5EVO A;  5GAN D;  5J4U A;  4MP4 A;  3IHQ A;  2XBI A;  1IYH A;  1QK8 A;  4L8E A;  5FHI A;  2VCW A;  4RUV A;  2KOK A;  4JR6 A;  2DSA A;  1NSW A;  2B1K A;  2B3S A;  1G7O A;  1V40 A;  2E2G A;  1LU4 A;  2R5G A;  4FO5 A;  2YJH A;  1OC8 A;  1ERV A;  2LEG A;  1EEM A;  3GKM A;  1A24 A;  1M2D A;  5D9X A;  3HVS A;  4BVX A;  4RI6 A;  4LL1 B;  4LLR A;  2YWN A;  2HI7 A;  4WBR D;  4MMM A;  2ON5 A;  3CSI A;  1GWC A;  3I9V 2;  3RAZ A;  2YWI A;  3QAV A;  3EE2 A;  4PTS A;  4AGS A;  2HZE B;  1OYJ A;  3D4T A;  3EU4 A;  1O81 A;  5F07 A;  5DBQ A;  4I2U A;  1FB6 A;  3HA9 A;  5H5S A;  1A2J A;  4JR4 A;  3TKS E;  2H70 A;  2KUC A;  5AIS A;  3ZTL A;  3S9F A;  5ID2 A;  4WR5 A;  18GS A;  1EEJ A;  2IPA A;  2C0G A;  1HD2 A;  3D21 A;  1TXX A;  2YNX A;  5KN0 A;  4IKH A;  2B5E A;  2M46 A;  2HRA A;  2VCQ A;  2RLI A;  3MWH A;  2LUS A;  3MAK A;  2GVP A;  1J9B A;  3GRX A;  3WD6 A;  4OO4 A;  1G6W A;  1TJD A;  2WCI A;  1BX9 A;  3TRP A;  2IN3 A;  5ECP B;  2ZCT A;  1R7H A;  2FY6 A;  1TU7 A;  3A5W A;  1T3B A;  2K18 A;  1XW5 A;  3UMA A;  3ME7 A;  1O7U A;  1H4O A;  4Q5F A;  2IFQ A;  4V2N A;  3HDC A;  2V1M A;  5HR1 A;  3IDV A;  2JAD A;  1EV9 A;  5GSS A;  1K3L A;  3ZIJ A;  3FHK A;  4O92 A;  1OKT A;  4TN8 A;  4HJ2 A;  5IMV A;  4NHZ A;  2WUL A;  3QFA C;  4N0V A;  4BVY B;  2LRT A;  2L6C A;  1Y6E A;  2VCV A;  3IV4 A;  2HRK A;  1A8L A;  5C04 A;  2AV4 A;  3TUE A;  4PGT A;  5KEJ A;  3H4K A;  3J7Y k;  1I9D A;  1URM A;  1WE0 A;  2C4J A;  5CP1 A;  2P5Q A;  4EF0 A;  4YAV A;  1OVN A;  1OE8 A;  1GSF A;  3GA4 A;  1N2A A;  4H86 A;  1SKR B;  4RQR A;  3QR6 A;  5AN1 A;  2DML A;  3VPT A;  4YH2 A;  1YKC A;  2VCX A;  3ZMK A;  5A4V A;  4EVM A;  1PA3 A;  3CYN A;  3P90 A;  2VAF A;  2GS3 A;  5DAL B;  1EOG A;  4NV2 A;  2F8A A;  5D93 A;  1A8Y A;  2OE0 A;  2L5L A;  3PIN A;  4WEY A;  2LNT A;  4KDU A;  3GX0 A;  2CAI A;  1EZK A;  1X9W B;  3N9J A;  2HQT A;  2O7K A;  4QQ7 A;  3W6G A;  3KEB A;  2X8G A;  2PBJ A;  5J9C A;  4V1A p;  3DYR A;  4JE1 A;  3WGX A;  2V41 A;  1TI3 A;  2J23 A;  3M9K A;  1O73 A;  1FVK A;  1G7E A;  1TRS A;  3FR3 A;  3PPU A;  3TKR A;  4BL7 B;  2XPE A;  3MDK A;  5HR3 A;  1ACV A;  3IXR A;  2REM A;  1ERW A;  1JZD A;  2HZF A;  2DC5 A;  1XWA A;  1GLQ A;  1Z7R A;  3LYK A;  1THO A;  2PVQ A;  2C80 A;  1EP7 A;  17GS A;  1M99 A;  1SD9 A;  3W8J A;  1GP1 A;  3UAR A;  5CYY A;  1M9B A;  4GQC A;  4KGI A;  4RI7 A;  1XXU A;  5DDL A;  1SEN A;  2C0D A;  1QGV A;  1YKA A;  5DQY A;  3GL3 A;  1PGT A;  5DJL A;  3KMO A;  2CVK A;  4TR4 A;  3U5R E;  2PPT A;  4N11 A;  4I2T A;  4LL4 B;  4L0W A;  1BQ7 A;  2LQO A;  4MF5 A;  2IMI A;  1AXD A;  3CSJ A;  4OFN A;  1FW1 A;  1UA5 A;  1NHO A;  2H30 A;  3TJK A;  1WIK A;  4HQS A;  3LEF A;  1B9X C;  4DSS B;  2GT5 A;  1GNE A;  3DKS A;  4X0X A;  1EGR A;  3TKS C;  2HSM A;  4EL1 A;  3Q74 A;  4CDO A;  4JRR A;  2QSI A;  3UEM A;  1F37 A;  3GX8 A;  2XBQ A;  2LS5 A;  1J08 A;  1N8J A;  1TRV A;  4AF2 A;  5F05 A;  10GS A;  4G0I A;  1ZZY A;  3VFI A;  3EUR A;  1SK0 A;  5J41 A;  5B8A A;  4PUA A;  19GS A;  3C1S A;  4K7I A;  4KSO A;  3QAG A;  2GGT A;  4WR4 A;  3L78 A;  1SJI A;  1DE1 A;  2VCZ A;  4CHS A;  4WF5 A;  2EIO A;  3CXG A;  3D22 A;  3P8W A;  1R5A A;  2CX3 A;  3E0U A;  3HJO A;  1JLW A;  5JWO B;  1YDK A;  1DSB A;  3KP8 A;  5ECH B;  3RPN A;  2KLX A;  5CRG A;  4G0L A;  1FHE A;  5E4W A;  2NTO A;  3IR4 A;  2WGR A;  3ME8 A;  4IW9 A;  4TRX A;  4ZXG A;  3APO A;  4MA9 A;  2DJ2 A;  2YN1 A;  3W8S A;  3P7X A;  5CRW A;  1E6B A;  3KGK A;  2PER A;  1MD4 A;  12GS A;  2C1Y A;  3R3E A;  5IM9 A;  4XHM A;  2LV3 A;  4EXJ A;  1KBN A;  3O76 A;  3H93 A;  1VF4 A;  1ABA A;  1RQM A;  1IYI A;  2X64 A;  2BMX A;  1T8E B;  2K8V A;  2H76 A;  3L4N A;  2IWT A;  4ACS A;  2HE3 A;  6GSV A;  4QL7 A;  5CRD A;  1U3A A;  2B7K A;  3GNJ A;  3HHV A;  3KD0 A;  2B7J A;  3PH9 A;  4DSR A;  1W89 A;  2H8L A;  4PNG A;  3N5O A;  4GQF A;  2FWG A;  3TRX A;  2C0E A;  1XWG A;  4XRA A;  1BG5 A;  3HZ4 A;  5L71 A;  2IIY A;  3APQ A;  2V2G A;  1AIU A;  3F6F A;  2JSZ A;  3ZVJ D;  4P3Y B;  5IQY A;  1JHB A;  2TIR A;  3FZ9 A;  1YZX A;  1SU9 A;  2GZZ A;  5JWR B;  3VWU A;  4D73 B;  2BTO T;  2H1A A;  2B5Y A;  3QCP A;  2RM5 A;  5KN3 A;  1KNG A;  4IQ1 A;  4MPF A;  4HQZ A;  1TOF A;  3IPZ A;  2C3T A;  1USB A;  1WRY A;  1X5D A;  5DQS A;  1AW9 A;  4G10 A;  1S3D A;  5IPG A;  1GL8 A;  5HR0 A;  2PGT A;  4PNF A;  3TDG A;  5GST A;  5DJM A;  2YAN A;  3C8E A;  3A2X A;  3UJ1 A;  3M1G A;  2X8C A;  4OCF A;  1FO5 A;  3UOM A;  4DSQ A;  4ECB A;  1PX7 A;  4NAX A;  1UC7 A;  5ELA A;  2C3Q A;  2H75 A;  3VPQ A;  1V9W A;  2F51 A;  3BOA A;  4ZB8 A;  5D8I A;  5ECR B;  3BCI A;  3IRA A;  4Q5R A;  1PD2 1;  2H72 A;  3KIJ A;  4J56 E;  4BA7 A;  3LWA A;  2GSS A;  4POB A;  1PSQ A;  4MJE A;  3FYG A;  5D9T A;  4ECI A;  4G2E A;  4G0K A;  2GT6 A;  4ISD A;  1VGL A;  3F63 A;  2XPD A;  1ML6 A;  3TJJ A;  5ENU A;  4KAE A;  5IOW A;  1U88 A;  5HFI A;  4EDZ A;  1AC1 A;  3Q19 A;  3EYT A;  3HCZ A;  1TTZ A;  5GZZ B;  1V98 A;  1U87 A;  2D2Z A;  4JZQ A;  2R3X A;  1HNB A;  4MH2 A;  2O89 A;  13GS A;  3KXO A;  1ERT A;  5D96 A;  1NHY A;  3TJF A;  1RW1 A;  3CMI A;  1TI1 A;  1C72 A;  4GWR A;  3CTF A;  4ECC A;  2GST A;  1A0R P;  2J9H A;  5HFK A;  2HFD A;  3LFL A;  1T4Z A;  1XVW A;  4KA0 A;  1F3B A;  1PKW A;  1Z6N A;  3VWW A;  5IMA A;  2DLX A;  2VL3 A;  4V1A g;  3G7I A;  2H6Y A;  1SYX A;  1XWK A;  3DWV A;  1X5E A;  1GSY A;  3QPM A;  5FWG A;  5B6N A;  1ZYQ B;  4GST A;  2H1G A;  1GTI A;  2EC4 A;  3GUR A;  4HZ2 A;  2NDO A;  4ZL8 A;  3R2Q A;  4ZIJ A;  5IMZ A;  1SKW B;  2VIM A;  2PMT A;  1MEK A;  1GSQ A;  5IPH A;  3GKK A;  1MTC A;  4MZC A;  2YP6 A;  1AAZ A;  2JZR A;  2VLV A;  1OC3 A;  2KP2 A;  2WB9 A;  1F9M A;  2OJL A;  1SD8 A;  1TP9 A;  5A4W A;  4K1F A;  6GSY A;  5G5F A;  2GLR A;  1UN2 A;  1FVJ A;  4MLY A;  4F0B A;  2PVO C;  4OMV A;  5IO0 A;  4N0Z A;  1TDI A;  3QD9 A;  4I97 A;  4O7H A;  1TK5 B;  2VL2 A;  2CX4 A;  1EWX A;  4XCS A;  1ON4 A;  1M2B A;  4GXZ A;  2L6D A;  3GTU A;  2F3M A;  2WJU A;  4DVC A;  4ZIL A;  3DGQ A;  4IBP A;  5HFG A;  3L9S A;  3LOR A;  2DJK A;  3HKR A;  5CRH A;  5G1K A;  4MF6 A;  1R5P A;  4O5R A;  3ZLP A;  4AJ6 A;  2LST A;  3HVX A;  4TW5 A;  3KH7 A;  3ZML A;  3TKP A;  1RK4 A;  5F0G A;  2CVB A;  5J9B A;  3KCM A;  5EPF A;  2L4Q A;  2FD3 A;  2R37 A;  5E59 A;  3VWX A;  3ED3 A;  1T1V A;  3DEX A;  4TR1 B;  4Z7X A;  3FK8 A;  3GMF A;  3WT1 A;  3D4M A;  2H73 A;  1AQX A;  1OKD A;  1VF2 A;  2V32 A;  1AQW A;  2TRX A;  4RQX A;  2VO4 A;  4KW6 A;  1FOV A;  4WKW A;  2OA7 A;  4WET A;  3GYK A;  4MPG A;  4IHU A;  4MZB A;  2KHP A;  5D73 A;  3NIV A;  1F2E A;  4NWY A;  4ECJ A;  5IO2 A;  4EDY A;  2HYX A;  5HQP A;  5IMC A;  3RBT A;  5FT3 A;  3QFB C;  4ZBA A;  4K6X A;  4OD7 A;  5JCG A;  4MF7 A;  6GST A;  5DAK A;  4GF0 A;  14GS A;  2G2Q A;  3UBL A;  2VLU A;  3C7M A;  4J57 E;  2MMO A;  5B8B A;  4IP6 A;  4GTU A;  3BD2 A;  3GFK A;  1F6M C;  3VUR A;  3HD5 A;  3KTL A;  2X99 A;  5B7C A;  3A2V A;  2G0F A;  4HS1 A;  4K2D A;  1DE2 A;  2O85 A;  2VL9 A;  3GHA A;  1XBS A;  2DIY A;  1G0T A;  4ZB6 A;  3TKQ A;  3WGD A;  1S3C A;  3KJY A;  2EIQ A;  3TRQ A;  2AHE A;  4PXO A;  1YY7 A;  2QGV A;  4HI7 A;  1GTA A;  6GSU A; 
#chains in the Genus database with same CATH topology
 1GUK A;  2H74 A;  2IMK A;  5F06 A;  4USS A;  3ZRE A;  3LXT A;  1PRX A;  3RGB C;  1ZGN A;  2YPM A;  1H75 A;  2JAC A;  2KP1 A;  4MK3 A;  1ZYP A;  2I1U A;  3OR5 A;  1JZW A;  1R26 A;  3D0Z A;  5COH A;  4TR0 A;  5GAP D;  5ECO B;  4PI0 C;  1BYE A;  1S4B P;  1TRW A;  4WBJ A;  3GN3 A;  2K6V A;  3DVW A;  2ON7 A;  4KDX A;  3QDN A;  3EC3 A;  3KP9 A;  1X5C A;  4EKZ A;  4MDC A;  5CRE A;  3SWL A;  3HJP A;  3NZN A;  1OE7 A;  2E7P A;  3F3Q A;  4FYU A;  3V1W A;  2IMF A;  1SK1 A;  2O8V B;  4OO5 A;  1PKZ A;  5A5K A;  3DD3 A;  2I9H A;  4HU7 A;  1EV4 A;  4XS1 A;  4Z2U A;  2MBS A;  4PQ1 A;  4Z2R A;  3TJG A;  2DJ0 A;  5JWQ B;  2HSN B;  4NHW A;  3DXB A;  1PX6 A;  2NVL A;  4IJ3 A;  4POM A;  2HZE A;  1SVO A;  1BED A;  1TKD B;  3EU3 A;  2IJY A;  1VF1 A;  3F4T A;  2HXK A;  4GSN A;  2MYG A;  2JSY A;  2BJX A;  4K7N A;  1Z7P A;  1ZMA A;  1PL1 A;  5J4V A;  1QMV A;  2I81 A;  2GSQ A;  5LCZ A;  1YF0 A;  3UL3 A;  1V57 A;  5KOW A;  5EY6 A;  2N5F A;  3RHB A;  2JL4 A;  3F9U A;  4PQH A;  2HLS A;  2DIZ A;  2Z9S A;  2ALB A;  4FYB A;  4ML1 A;  1ILO A;  2WVX A;  1GTB A;  2C8U A;  3CBU A;  3A3T A;  3GV1 A;  1PL2 A;  2MMA A;  4GSS A;  4YQV A;  4NXI A;  2HSH A;  2P31 A;  1K0N A;  2IFQ B;  4O32 A;  1K3Y A;  3FEU A;  3A2W A;  1WOU A;  4CW9 A;  1GUH A;  1N25 A;  2CZ2 A;  3L9U A;  2YCD A;  4KDY A;  2PN8 A;  5BMU A;  3LYP A;  3RFR C;  1WMJ A;  1XWB A;  1U6T A;  4POL A;  11GS A;  4KF9 A;  3RDW A;  3LQ7 A;  3TB2 A;  2GSR A;  1MDK A;  2O36 A;  5KN1 A;  2H1D A;  2NPB A;  4BVY A;  4W66 A;  22GS A;  1F3A A;  4IJI A;  4IEL A;  1Z9H A;  3UIW A;  3KMN A;  1FAA A;  2X8H A;  1YEP A;  3VLN A;  1HNC A;  4KH7 A;  1JZO A;  5C00 A;  4K5R A;  4OWY A;  1Y25 A;  1THX A;  3FR9 A;  4TKY A;  3ZIT A;  2YWM A;  5ECI B;  2DJ3 A;  3FZ5 A;  2P0G A;  1GNW A;  1YVL A;  1X9M B;  3MNG A;  5J5N A;  4I5Q A;  4K0N A;  4HUA A;  3QAW A;  5CAX A;  3IAM 2;  2PWJ A;  1JZR A;  1PQN A;  3KM6 A;  4BWQ A;  2OKA A;  4KE3 A;  2RM6 A;  1M3J A;  2MMN A;  5DAL A;  3VI5 A;  3C1R A;  3FZA A;  1ST9 A;  2K9F A;  1HQO A;  1JLV A;  5DCH A;  4FIW A;  2MBT A;  1M0U A;  3I6A A;  2WZ9 A;  2HSY A;  4KND A;  3ZFL A;  1QXH A;  2R4V A;  3CRT A;  1FB0 A;  4YQM A;  4K7O A;  2OBI A;  3M3M A;  1GSU A;  5AIV A;  3UBK A;  1SJ6 A;  2H66 A;  1A2M A;  3GL5 A;  1O85 A;  3JCM L;  3ERG A;  5ECK B;  4L0U A;  3J7Y b;  2MMZ A;  3IA1 A;  5ABR A;  4TVE A;  5F8B A;  8GSS A;  3D5J A;  4V2M A;  2LJK A;  1ZYN A;  4G19 A;  3EWL A;  4X43 A;  3U6V A;  3M0F A;  4TOP A;  3CRU A;  4PQI A;  4BL7 A;  2QKE A;  4EIP A;  1K0D A;  5G31 A;  2H6X A;  4ML6 A;  1EOH A;  1XCC A;  1EP8 A;  1SL0 B;  1SKS B;  2F8F A;  3ZVJ A;  4ULX A;  4MCU A;  1GSE A;  1O6J A;  1B48 A;  3TOT A;  2I3Y A;  1V2A A;  1DUG A;  5INY A;  2C0F A;  3H1N A;  4JU5 A;  3GH6 A;  2PUK C;  4E8H A;  3CTG A;  5A4U A;  1SK2 A;  4MAB A;  16GS A;  5CNW A;  4ZBB A;  5H5R A;  3IE3 A;  1NM3 A;  3LXZ A;  4WXT A;  2R2J A;  4Q5Q A;  4TXV A;  4FQU A;  1K0B A;  1HYU A;  1Q4J A;  2MZC A;  4KCE A;  4O5U A;  4IS0 A;  1BAY A;  2WS2 A;  3BJ5 A;  5HR2 A;  2CVD A;  3F6D A;  1E2Y A;  5G1L A;  2DJ1 A;  4DSS A;  2HSM B;  1SJZ A;  2DMM A;  1B4P A;  1EGO A;  1QFN A;  5G5E A;  2VD1 A;  1A0F A;  1HNA A;  1DBY A;  3KH9 A;  2FNO A;  3APS A;  1AQV A;  4MJB A;  2LNS A;  2XHF A;  2L4C A;  4XS4 B;  2ES7 A;  2H01 A;  1Z6M A;  1TRU A;  1PFO A;  4XTS A;  3GUS A;  5LD0 A;  2OT3 A;  4LMW A;  4LMV A;  2WRT A;  2B6M A;  1PN0 A;  2X49 A;  4N10 A;  4AKG A;  3ZYW A;  5ECS A;  4FYC A;  3HY2 A;  5ECM B;  2H1B A;  2AB6 A;  1XPV A;  3F4S A;  1ERU A;  4NMU A;  4AJ7 A;  1SL1 B;  2DJJ A;  1FG4 A;  2R6K A;  2H0H A;  1Q98 A;  4E8E A;  2V6K A;  5D9W A;  3Q6O A;  4POK A;  1SVM A;  2M80 A;  5A1N B;  3CWG A;  2YWO A;  1BJX A;  2IME A;  2A2P A;  1GSS A;  1K0O A;  4FH8 A;  1T7P B;  4F03 A;  2FGX A;  4OCE A;  3HZ8 A;  1QUW A;  2EFD A;  2M72 A;  2LRN A;  4GDF A;  4Z2T A;  4ZBD A;  2H6Z A;  4PUR A;  2FWF A;  3I69 A;  3IAS 2;  1SVL A;  2H19 A;  2FA8 A;  3K8N A;  1OC9 B;  4CY8 A;  4KCA A;  2P5R A;  4IN0 A;  4KB3 A;  2N5A A;  2O87 A;  3ISO A;  2L5O A;  4GRF A;  2VUP A;  2OE3 A;  2AAW A;  1VRS D;  3FY7 A;  1YF1 A;  3LSZ A;  1GTU A;  1ZL9 A;  2A2S A;  1XIY A;  3M9J A;  3IC4 A;  4JED A;  1TW9 A;  3G7J A;  2A4V A;  2LJR A;  1SL2 B;  3ZIV A;  2GZP A;  3FZ4 A;  4ILF A;  4OFT A;  3GSS A;  4MJC A;  4F2I A;  1LBK A;  2GQL A;  4IGJ A;  1XW6 A;  3Q18 A;  1NW2 A;  1XFL A;  1YJ6 A;  1ZOF A;  1CQG A;  1CQH A;  5IMF A;  5AGY A;  4D73 A;  4PUF C;  4L5L A;  3IOS A;  3LG6 A;  2JZT A;  4TXO B;  4QL9 A;  2RUF A;  4IVF A;  4YQU A;  5LNK e;  2I4A A;  2GDR A;  5DVB A;  3TKS A;  2VL2 C;  4WF4 A;  5ECL B;  1PMT A;  2E2M A;  4HU9 A;  4AJ8 A;  1FOH A;  1X9S B;  1GUM A;  1B4Q A;  2QA2 A;  2WW1 A;  3HYP A;  1W4V A;  2AJQ B;  3QOU A;  3WGE A;  2N5B A;  3H8Q A;  1MDI A;  2AUV A;  4BWS A;  3CSH A;  3GST A;  4EO3 A;  1JFU A;  2CT6 A;  3WYW A;  3DRN A;  2GQM A;  3WT2 A;  1GRX A;  3FR6 A;  1R4W A;  4HEA 2;  3O6T A;  4JBB A;  3M8N A;  3ZFB A;  3ZL5 A;  1U3I A;  1A23 A;  4K0G A;  4K9Z A;  3UAP A;  2GQK A;  5H5Q A;  2WDU A;  1TU8 A;  3UVH A;  4LA1 A;  4IP1 A;  2YV7 A;  2E0Q A;  3FKF A;  4XS6 A;  6GSX A;  3HVV A;  3LGC A;  4IQA A;  4HJM A;  3DIE A;  3MYD A;  1SYR A;  5J3R A;  2CQ9 A;  3P2A A;  3IC8 A;  2EIR A;  2B5X A;  2LQQ A;  1O8X A;  1Z5Y E;  3RPP A;  3C71 A;  3ZRD A;  2RII A;  3TCO A;  3FRC A;  1LJR A;  5AIX A;  1X0R A;  3ERW A;  1O8W A;  4DEJ A;  2EFE A;  3VWV A;  4CY6 A;  4X1U A;  2A2R A;  4PHZ C;  2IL3 A;  5D9V A;  1XW9 A;  1Z3E A;  4BVX B;  4EE0 A;  4V2L A;  2CA8 A;  3FMW A;  5KN2 A;  3GIX A;  2PU9 C;  2ZNM A;  2VM1 A;  3GH9 A;  4XRD A;  4EIQ A;  1A2L A;  1WPI A;  1PN9 A;  3F8U A;  1GUL A;  3L0H A;  2LTK A;  2V6O A;  2FCH A;  3O3T A;  4GLT A;  3KTB A;  3IK9 A;  1V58 A;  20GS A;  1M7T A;  2OBK A;  1T4Y A;  1GSD A;  1GH2 A;  2K8S A;  4XS4 A;  5ID2 B;  3HJM A;  4OFM A;  2H0I A;  4ZL9 A;  5IIZ A;  1GLP A;  2CAQ A;  4MZW A;  2CZ3 A;  2B1L A;  2XC2 A;  2TRC P;  2FUG 2;  3RHC A;  3F3R A;  3AY8 A;  2NBS A;  2JU5 A;  1YEX A;  1YQ1 A;  4F9Z A;  4ZB9 A;  2VD0 A;  4I6X A;  1I1I P;  2LKU A;  2YJ7 A;  3EMX A;  4ID0 A;  1WJK A;  4NPB A;  2ZUP A;  2GZY A;  5J40 A;  4YAP A;  4HOJ A;  4KSM A;  3QMX A;  1WWJ A;  3GTU B;  2LJA A;  5G2Z A;  1J0F A;  5A1N A;  4XIH A;  2YV9 A;  2FWE A;  3BBY A;  3IK7 A;  3IBH A;  3VI7 A;  5CO3 A;  3SBC A;  3VK9 A;  2EFC A;  4F82 A;  3FW2 A;  1XWC A;  2YOI A;  2FLS A;  3H79 A;  3US3 A;  3TGZ A;  1TK8 B;  2L57 A;  1OC9 A;  3E9J B;  3NOF A;  2UZ8 A;  2FA4 A;  3BCK A;  2HRK B;  5G30 A;  2JZS A;  2HT9 A;  4EUY A;  5JCU A;  2HRN A;  2DBC A;  3C73 A;  1ZCP A;  3EIN A;  4NV5 A;  3G7Y A;  4BPY A;  5ELG A;  3EMP A;  5IOX A;  1XOA A;  1QQ2 A;  4TR1 A;  2OAC A;  3ZZX A;  5IMD A;  4I8B A;  2HRF A;  3DVX A;  3IHG A;  5DCG A;  3KZQ A;  2RUE A;  2UV8 G;  2GTU A;  5EL8 A;  3TJB A;  2FHE A;  2WVY A;  1K0A A;  1OAZ A;  4GCI A;  2L59 A;  3DML A;  1B8X A;  2H71 A;  3L9V A;  4MJA A;  4N30 A;  5JCW A;  1XVQ A;  4L5O A;  1TK0 B;  1AUC A;  1WP0 A;  3G9B A;  3F4R A;  3LJR A;  5ECQ B;  1M9A A;  5DAK B;  6GSW A;  2YZU A;  4TXO A;  3TOU A;  2VCT A;  1BG1 A;  2QC7 A;  3F0I A;  4TR3 A;  2F9S A;  2CV4 A;  2OE1 A;  4G9H A;  2H0G A;  2O5V A;  4PX1 A;  5ECN B;  2HNL A;  4AKH A;  2FWH A;  3D6I A;  2LRC A;  3EVI A;  4HDE A;  4MNN A;  4J2F A;  4KUN A;  2WFC A;  1K0C A;  1ZYE A;  2VOC A;  1B9Y C;  3GKN A;  1G6Y A;  2VLT A;  9GSS A;  2AYT A;  3I43 A;  4HZ4 A;  1VF3 A;  3MSZ A;  1KEB A;  1K3O A;  1M2A A;  4AI6 A;  4EC0 A;  1T00 A;  4AKI A;  1I5G A;  4MH3 A;  5B6M A;  2IMD A;  1KTE A;  6GSS A;  2VM2 A;  1UVZ A;  4Q5N A;  1S3A A;  3E3E A;  4ZL7 A;  3HXS A;  4QMK A;  1MDJ A;  4K8M A;  2C3N A;  3UVT A;  1XZO A;  3GKX A;  2OAD A;  1MD3 A;  4F0C A;  1K0M A;  1XOB A;  7GSS A;  2YZH A;  4KX4 A;  3ERF A;  3PGT A;  3PR8 A;  4YKG A;  5EVO A;  5GAN D;  5J4U A;  4MP4 A;  3IHQ A;  2XBI A;  1IYH A;  1QK8 A;  4L8E A;  5FHI A;  2VCW A;  4RUV A;  2KOK A;  4JR6 A;  2DSA A;  1NSW A;  2B1K A;  2B3S A;  1G7O A;  1V40 A;  2E2G A;  1LU4 A;  2R5G A;  4FO5 A;  2YJH A;  1OC8 A;  1ERV A;  2LEG A;  4G01 A;  1EEM A;  3GKM A;  1A24 A;  1M2D A;  5D9X A;  3HVS A;  4BVX A;  4RI6 A;  4LL1 B;  5A34 B;  4LLR A;  2YWN A;  2HI7 A;  4WBR D;  4MMM A;  2ON5 A;  3CSI A;  1GWC A;  3I9V 2;  3RAZ A;  2YWI A;  3QAV A;  3EE2 A;  4PTS A;  4AGS A;  2HZE B;  1OYJ A;  3D4T A;  3EU4 A;  1O81 A;  5F07 A;  5DBQ A;  4I2U A;  2HSN A;  1FB6 A;  3HA9 A;  5H5S A;  1A2J A;  4JR4 A;  3TKS E;  2H70 A;  2KUC A;  5AIS A;  3ZTL A;  3S9F A;  5ID2 A;  2DKH A;  4WR5 A;  18GS A;  1EEJ A;  2IPA A;  2C0G A;  1HD2 A;  3D21 A;  1TXX A;  2YNX A;  5KN0 A;  4IKH A;  2B5E A;  2M46 A;  2HRA A;  2VCQ A;  2RLI A;  3MWH A;  2LUS A;  3MAK A;  2GVP A;  1J9B A;  2WVX B;  3GRX A;  3WD6 A;  4OO4 A;  1G6W A;  1TJD A;  2WCI A;  1BX9 A;  3TRP A;  2IN3 A;  5ECP B;  2ZCT A;  1R7H A;  2FY6 A;  1TU7 A;  3A5W A;  1T3B A;  2K18 A;  1XW5 A;  3UMA A;  3ME7 A;  1O7U A;  1H4O A;  4Q5F A;  2IFQ A;  4V2N A;  3HDC A;  2V1M A;  5HR1 A;  3IDV A;  2JAD A;  1EV9 A;  5GSS A;  1K3L A;  3ZIJ A;  3FHK A;  4O92 A;  1OKT A;  1XG8 A;  4TN8 A;  4HJ2 A;  5IMV A;  4NHZ A;  2WUL A;  3QFA C;  4N0V A;  4BVY B;  2LRT A;  2L6C A;  1Y6E A;  2VCV A;  2WW3 A;  3IV4 A;  2HRK A;  1A8L A;  5C04 A;  2AV4 A;  3TUE A;  4PGT A;  5KEJ A;  3H4K A;  3J7Y k;  1I9D A;  1URM A;  1WE0 A;  2C4J A;  5CP1 A;  2P5Q A;  4EF0 A;  4YAV A;  1OVN A;  1OE8 A;  1GSF A;  3GA4 A;  1N2A A;  4H86 A;  1SKR B;  4RQR A;  2R0C A;  3QR6 A;  5AN1 A;  5J47 A;  2DML A;  3VPT A;  4YH2 A;  1YKC A;  2VCX A;  3ZMK A;  5A4V A;  4EVM A;  1PA3 A;  3CYN A;  3P90 A;  2VAF A;  2GS3 A;  5DAL B;  1EOG A;  4NV2 A;  2F8A A;  5D93 A;  1A8Y A;  2OE0 A;  2L5L A;  3PIN A;  4WEY A;  2LNT A;  4KDU A;  3GX0 A;  2CAI A;  1EZK A;  1X9W B;  3N9J A;  2HQT A;  2R0G A;  2O7K A;  4QQ7 A;  3W6G A;  3KEB A;  2X8G A;  2PBJ A;  5J9C A;  4V1A p;  3DYR A;  4JE1 A;  3WGX A;  2V41 A;  1TI3 A;  4FXY P;  2J23 A;  3M9K A;  1O73 A;  1FVK A;  1G7E A;  1TRS A;  4ZB7 A;  3FR3 A;  3PPU A;  3TKR A;  4BL7 B;  2XPE A;  3MDK A;  5HR3 A;  1BF5 A;  3IXR A;  1ACV A;  2REM A;  1ERW A;  1JZD A;  2HZF A;  2DC5 A;  1XWA A;  1GLQ A;  1Z7R A;  3LYK A;  1THO A;  2WVZ A;  2PVQ A;  2C80 A;  1EP7 A;  17GS A;  1M99 A;  1SD9 A;  3W8J A;  1GP1 A;  3TU3 B;  3UAR A;  5CYY A;  1M9B A;  4GQC A;  4KGI A;  4RI7 A;  1XXU A;  5DDL A;  1SEN A;  2C0D A;  1QGV A;  1YKA A;  5DQY A;  3GL3 A;  1PGT A;  5DJL A;  3KMO A;  2CVK A;  4TR4 A;  2WZS A;  3EPT A;  3U5R E;  2PPT A;  4N11 A;  4I2T A;  4LL4 B;  4L0W A;  1BQ7 A;  2LQO A;  4MF5 A;  2IMI A;  1AXD A;  3CSJ A;  4OFN A;  1FW1 A;  1UA5 A;  1NHO A;  2H30 A;  3MIX A;  3TJK A;  1WIK A;  1Y1U A;  4HQS A;  3LEF A;  2VKZ G;  1B9X C;  4DSS B;  2GT5 A;  1GNE A;  3DKS A;  4X0X A;  1S3R A;  1EGR A;  3TKS C;  2HSM A;  4EL1 A;  3Q74 A;  4CDO A;  4JRR A;  1YEW C;  2QSI A;  3UEM A;  1F37 A;  3GX8 A;  2XBQ A;  2LS5 A;  1J08 A;  1N8J A;  1TRV A;  4AF2 A;  5F05 A;  10GS A;  4G0I A;  1ZZY A;  3VFI A;  3EUR A;  1SK0 A;  5J41 A;  5B8A A;  4PUA A;  19GS A;  3C1S A;  4K7I A;  4KSO A;  3QAG A;  2GGT A;  4WR4 A;  3L78 A;  1SJI A;  5A34 A;  2O3E A;  1DE1 A;  2VCZ A;  4CHS A;  4WF5 A;  2EIO A;  3CXG A;  3D22 A;  3P8W A;  1R5A A;  2CX3 A;  3E0U A;  3HMJ G;  3HJO A;  1JLW A;  5JWO B;  1YDK A;  4AKX B;  1DSB A;  4X4J A;  3KP8 A;  5ECH B;  3RPN A;  2KLX A;  5CRG A;  4G0L A;  1FHE A;  5E4W A;  2NTO A;  3IR4 A;  2WGR A;  3ME8 A;  4IW9 A;  4TRX A;  4ZXG A;  3APO A;  4MA9 A;  2DJ2 A;  2YN1 A;  5BRT A;  3W8S A;  3P7X A;  5CRW A;  1E6B A;  3KGK A;  2PER A;  1MD4 A;  12GS A;  2C1Y A;  3R3E A;  5IM9 A;  4XHM A;  2LV3 A;  4EXJ A;  1KBN A;  3O76 A;  3H93 A;  1VF4 A;  1ABA A;  1RQM A;  2A4H A;  1IYI A;  2X64 A;  5KOX A;  2BMX A;  1T8E B;  2K8V A;  2H76 A;  3L4N A;  2IWT A;  4ACS A;  2HE3 A;  6GSV A;  4QL7 A;  5CRD A;  1U3A A;  2B7K A;  3GNJ A;  3HHV A;  3KD0 A;  2B7J A;  3PH9 A;  4DSR A;  1W89 A;  4N3Z A;  2H8L A;  4PNG A;  3N5O A;  4GQF A;  2FWG A;  4A5P A;  3TRX A;  2C0E A;  1XWG A;  4XRA A;  1BG5 A;  3HZ4 A;  5L71 A;  2IIY A;  3APQ A;  2V2G A;  1AIU A;  3F6F A;  2JSZ A;  3ZVJ D;  4P3Y B;  5A5H B;  5IQY A;  1JHB A;  2TIR A;  3FZ9 A;  1YZX A;  4K5S A;  1SU9 A;  2GZZ A;  4K2X A;  5JWR B;  3VWU A;  4D73 B;  2BTO T;  2H1A A;  2B5Y A;  3QCP A;  2RM5 A;  5KN3 A;  1KNG A;  4IQ1 A;  4MPF A;  4HQZ A;  1TOF A;  3IPZ A;  2C3T A;  1USB A;  1WRY A;  1X5D A;  5DQS A;  1AW9 A;  4G10 A;  1S3D A;  5IPG A;  1GL8 A;  5HR0 A;  2PGT A;  4PNF A;  3TDG A;  5GST A;  5DJM A;  2YAN A;  3C8E A;  3A2X A;  3UJ1 A;  3M1G A;  2X8C A;  4OCF A;  1FO5 A;  3UOM A;  4DSQ A;  4ECB A;  1PX7 A;  4NAX A;  1UC7 A;  5ELA A;  2C3Q A;  4HSC X;  2H75 A;  3VPQ A;  1V9W A;  2F51 A;  3BOA A;  4ZB8 A;  5D8I A;  5ECR B;  3BCI A;  3IRA A;  4Q5R A;  2WW2 A;  1PD2 1;  2H72 A;  3KIJ A;  4J56 E;  4BA7 A;  3LWA A;  2GSS A;  4POB A;  1PSQ A;  4MJE A;  3FYG A;  2H1L A;  5D9T A;  4ECI A;  4G2E A;  4G0K A;  2GT6 A;  4ISD A;  1VGL A;  3F63 A;  2XPD A;  1ML6 A;  3TJJ A;  5ENU A;  4KAE A;  5IOW A;  1U88 A;  5HFI A;  4O5Q A;  4EDZ A;  4ICY A;  1AC1 A;  3Q19 A;  3CQF A;  3EYT A;  4BIK A;  3HCZ A;  1TTZ A;  5GZZ B;  1V98 A;  1U87 A;  2D2Z A;  4JZQ A;  2R3X A;  1HNB A;  4MH2 A;  2O89 A;  13GS A;  3KXO A;  1ERT A;  5D96 A;  1NHY A;  3TJF A;  1RW1 A;  3CMI A;  4YKF A;  1TI1 A;  1TXU A;  1C72 A;  4GWR A;  3CTF A;  2QA1 A;  4ECC A;  2WW0 A;  2GST A;  1A0R P;  2J9H A;  5HFK A;  2HFD A;  2DKI A;  3LFL A;  1T4Z A;  1XVW A;  1F3B A;  1PKW A;  1Z6N A;  4KA0 A;  3VWW A;  5IMA A;  2DLX A;  2VL3 A;  4V1A g;  3G7I A;  2H6Y A;  1SYX A;  1XWK A;  3DWV A;  1X5E A;  1GSY A;  3QPM A;  5FWG A;  5B6N A;  1ZYQ B;  4GST A;  2H1G A;  1GTI A;  2EC4 A;  3GUR A;  4HZ2 A;  2NDO A;  4ZL8 A;  3R2Q A;  4ZIJ A;  5IMZ A;  1SKW B;  2VIM A;  2PMT A;  2EFH A;  1MEK A;  1GSQ A;  5IPH A;  4E68 A;  3GKK A;  1MTC A;  4MZC A;  2YP6 A;  1AAZ A;  2JZR A;  2VLV A;  1M3I A;  1OC3 A;  2KP2 A;  2WB9 A;  1F9M A;  2OJL A;  1SD8 A;  1TP9 A;  5A4W A;  4K1F A;  6GSY A;  5G5F A;  2GLR A;  1UN2 A;  1FVJ A;  2R0P A;  4MLY A;  4F0B A;  2PVO C;  4OMV A;  5IO0 A;  4N0Z A;  1TDI A;  3QD9 A;  4I97 A;  4O7H A;  1TK5 B;  2VL2 A;  2CX4 A;  1EWX A;  4XCS A;  1ON4 A;  1M2B A;  4GXZ A;  2L6D A;  3GTU A;  2F3M A;  2WJU A;  4DVC A;  4ZIL A;  3DGQ A;  4IBP A;  5HFG A;  3L9S A;  5BMU B;  2DJK A;  3LOR A;  3HKR A;  5CRH A;  5G1K A;  4MF6 A;  1R5P A;  4O5R A;  3ZLP A;  4AJ6 A;  2LST A;  3HVX A;  4TW5 A;  3KH7 A;  3ZML A;  3TKP A;  1RK4 A;  5F0G A;  2CVB A;  5J9B A;  3KCM A;  5EPF A;  5J4Y A;  2L4Q A;  2FD3 A;  2R37 A;  5E59 A;  3VWX A;  3ED3 A;  1T1V A;  3DEX A;  4TR1 B;  4Z7X A;  3FK8 A;  3GMF A;  3WT1 A;  3D4M A;  2H73 A;  1AQX A;  1OKD A;  1VF2 A;  2V32 A;  1AQW A;  2TRX A;  4RQX A;  2VO4 A;  4KW6 A;  5A5H A;  1FOV A;  4WKW A;  2OA7 A;  4WET A;  2X4A A;  3GYK A;  4MPG A;  4IHU A;  4MZB A;  2KHP A;  5D73 A;  3NIV A;  1F2E A;  4NWY A;  4ECJ A;  5IO2 A;  4EDY A;  2HYX A;  5HQP A;  5IMC A;  3RBT A;  5FT3 A;  3QFB C;  4ZBA A;  4K6X A;  4OD7 A;  5JCG A;  4MF7 A;  6GST A;  5DAK A;  4GF0 A;  14GS A;  2G2Q A;  3UBL A;  2VLU A;  3C7M A;  4J57 E;  2MMO A;  5B8B A;  4IP6 A;  4GTU A;  3BD2 A;  3GFK A;  1F6M C;  3LW9 A;  3VUR A;  3HD5 A;  3KTL A;  2X99 A;  5B7C A;  3A2V A;  2G0F A;  4HS1 A;  3CHX C;  4K2D A;  1DE2 A;  2O85 A;  2VL9 A;  3GHA A;  1XBS A;  2DIY A;  3HVN A;  4PI2 C;  1G0T A;  4ZB6 A;  3TKQ A;  3WGD A;  1S3C A;  3KJY A;  2EIQ A;  3A5I A;  3TRQ A;  2AHE A;  4PXO A;  1YY7 A;  2QGV A;  4HI7 A;  1GTA A;  6GSU A; 
#chains in the Genus database with same CATH homology
 1GUK A;  2H74 A;  2IMK A;  5F06 A;  4USS A;  3ZRE A;  3LXT A;  1PRX A;  1ZGN A;  2YPM A;  1H75 A;  2JAC A;  2KP1 A;  4MK3 A;  1ZYP A;  2I1U A;  3OR5 A;  1JZW A;  1R26 A;  3D0Z A;  5COH A;  4TR0 A;  5GAP D;  5ECO B;  1BYE A;  1TRW A;  4WBJ A;  3GN3 A;  2K6V A;  3DVW A;  2ON7 A;  4KDX A;  3QDN A;  3EC3 A;  3KP9 A;  1X5C A;  4EKZ A;  4MDC A;  5CRE A;  3SWL A;  3HJP A;  3NZN A;  1OE7 A;  2E7P A;  3F3Q A;  4FYU A;  3V1W A;  2IMF A;  1SK1 A;  2O8V B;  4OO5 A;  1PKZ A;  5A5K A;  3DD3 A;  2I9H A;  4HU7 A;  1EV4 A;  4XS1 A;  4Z2U A;  2MBS A;  4PQ1 A;  4Z2R A;  3TJG A;  2DJ0 A;  5JWQ B;  2HSN B;  4NHW A;  3DXB A;  1PX6 A;  2NVL A;  4IJ3 A;  4POM A;  2HZE A;  1SVO A;  1BED A;  1TKD B;  3EU3 A;  2IJY A;  1VF1 A;  3F4T A;  2HXK A;  4GSN A;  2MYG A;  2JSY A;  2BJX A;  4K7N A;  1Z7P A;  1ZMA A;  1PL1 A;  5J4V A;  1QMV A;  2I81 A;  2GSQ A;  5LCZ A;  1YF0 A;  3UL3 A;  1V57 A;  5KOW A;  5EY6 A;  2N5F A;  3RHB A;  2JL4 A;  3F9U A;  4PQH A;  2HLS A;  2DIZ A;  2Z9S A;  2ALB A;  4FYB A;  4ML1 A;  1ILO A;  1GTB A;  2C8U A;  3CBU A;  3A3T A;  3GV1 A;  1PL2 A;  2MMA A;  4GSS A;  4YQV A;  4NXI A;  2HSH A;  2P31 A;  1K0N A;  2IFQ B;  4O32 A;  1K3Y A;  3FEU A;  3A2W A;  1WOU A;  4CW9 A;  1GUH A;  1N25 A;  2CZ2 A;  3L9U A;  2YCD A;  4KDY A;  2PN8 A;  5BMU A;  3LYP A;  1WMJ A;  1XWB A;  1U6T A;  4POL A;  11GS A;  4KF9 A;  3RDW A;  3LQ7 A;  3TB2 A;  2GSR A;  1MDK A;  5KN1 A;  2H1D A;  2NPB A;  4BVY A;  4W66 A;  22GS A;  1F3A A;  4IJI A;  4IEL A;  1Z9H A;  3UIW A;  3KMN A;  1FAA A;  2X8H A;  1YEP A;  3VLN A;  1HNC A;  4KH7 A;  1JZO A;  5C00 A;  4K5R A;  4OWY A;  1Y25 A;  1THX A;  3FR9 A;  4TKY A;  3ZIT A;  2YWM A;  5ECI B;  2DJ3 A;  3FZ5 A;  2P0G A;  1GNW A;  1YVL A;  1X9M B;  3MNG A;  5J5N A;  4I5Q A;  4K0N A;  4HUA A;  3QAW A;  5CAX A;  3IAM 2;  2PWJ A;  1JZR A;  1PQN A;  3KM6 A;  4BWQ A;  2OKA A;  4KE3 A;  2RM6 A;  2MMN A;  5DAL A;  3VI5 A;  3C1R A;  3FZA A;  1ST9 A;  2K9F A;  1HQO A;  1JLV A;  5DCH A;  4FIW A;  2MBT A;  1M0U A;  3I6A A;  2WZ9 A;  2HSY A;  4KND A;  3ZFL A;  1QXH A;  2R4V A;  3CRT A;  1FB0 A;  4YQM A;  4K7O A;  2OBI A;  3M3M A;  1GSU A;  5AIV A;  3UBK A;  1SJ6 A;  2H66 A;  1A2M A;  3GL5 A;  1O85 A;  3JCM L;  3ERG A;  5ECK B;  4L0U A;  3J7Y b;  2MMZ A;  3IA1 A;  5ABR A;  4TVE A;  5F8B A;  8GSS A;  3D5J A;  4V2M A;  2LJK A;  1ZYN A;  4G19 A;  3EWL A;  4X43 A;  3U6V A;  3M0F A;  4TOP A;  3CRU A;  4PQI A;  4BL7 A;  2QKE A;  4EIP A;  1K0D A;  5G31 A;  2H6X A;  4ML6 A;  1EOH A;  1XCC A;  1EP8 A;  1SL0 B;  1SKS B;  2F8F A;  3ZVJ A;  4ULX A;  4MCU A;  1GSE A;  1O6J A;  1B48 A;  3TOT A;  2I3Y A;  1V2A A;  1DUG A;  5INY A;  2C0F A;  3H1N A;  4JU5 A;  3GH6 A;  2PUK C;  4E8H A;  3CTG A;  5A4U A;  1SK2 A;  4MAB A;  16GS A;  5CNW A;  4ZBB A;  5H5R A;  3IE3 A;  1NM3 A;  3LXZ A;  4WXT A;  2R2J A;  4Q5Q A;  4TXV A;  4FQU A;  1K0B A;  1HYU A;  1Q4J A;  2MZC A;  4KCE A;  4O5U A;  4IS0 A;  1BAY A;  2WS2 A;  3BJ5 A;  5HR2 A;  2CVD A;  3F6D A;  1E2Y A;  5G1L A;  2DJ1 A;  4DSS A;  2HSM B;  1SJZ A;  2DMM A;  1B4P A;  1EGO A;  1QFN A;  5G5E A;  2VD1 A;  1A0F A;  1HNA A;  1DBY A;  3KH9 A;  2FNO A;  3APS A;  1AQV A;  4MJB A;  2LNS A;  2XHF A;  2L4C A;  4XS4 B;  2ES7 A;  2H01 A;  1Z6M A;  1TRU A;  4XTS A;  3GUS A;  5LD0 A;  2OT3 A;  4LMW A;  4LMV A;  2WRT A;  2B6M A;  1PN0 A;  2X49 A;  4N10 A;  4AKG A;  3ZYW A;  5ECS A;  4FYC A;  3HY2 A;  5ECM B;  2H1B A;  2AB6 A;  1XPV A;  3F4S A;  1ERU A;  4NMU A;  4AJ7 A;  1SL1 B;  2DJJ A;  1FG4 A;  2R6K A;  2H0H A;  1Q98 A;  4E8E A;  2V6K A;  5D9W A;  3Q6O A;  4POK A;  1SVM A;  2M80 A;  5A1N B;  3CWG A;  2YWO A;  1BJX A;  2IME A;  2A2P A;  1GSS A;  1K0O A;  4FH8 A;  1T7P B;  4F03 A;  2FGX A;  4OCE A;  3HZ8 A;  1QUW A;  2EFD A;  2M72 A;  2LRN A;  4GDF A;  4Z2T A;  4ZBD A;  2H6Z A;  4PUR A;  2FWF A;  3I69 A;  3IAS 2;  1SVL A;  2H19 A;  2FA8 A;  3K8N A;  1OC9 B;  4CY8 A;  4KCA A;  2P5R A;  4IN0 A;  4KB3 A;  2N5A A;  2O87 A;  3ISO A;  2L5O A;  4GRF A;  2VUP A;  2OE3 A;  2AAW A;  1VRS D;  3FY7 A;  1YF1 A;  3LSZ A;  1GTU A;  1ZL9 A;  2A2S A;  1XIY A;  3M9J A;  3IC4 A;  4JED A;  1TW9 A;  3G7J A;  2A4V A;  2LJR A;  1SL2 B;  3ZIV A;  2GZP A;  3FZ4 A;  4ILF A;  4OFT A;  3GSS A;  4MJC A;  4F2I A;  1LBK A;  2GQL A;  4IGJ A;  1XW6 A;  3Q18 A;  1NW2 A;  1XFL A;  1YJ6 A;  1ZOF A;  1CQG A;  1CQH A;  5IMF A;  5AGY A;  4D73 A;  4PUF C;  4L5L A;  3IOS A;  3LG6 A;  2JZT A;  4TXO B;  4QL9 A;  2RUF A;  4IVF A;  4YQU A;  5LNK e;  2I4A A;  2GDR A;  5DVB A;  3TKS A;  2VL2 C;  4WF4 A;  5ECL B;  1PMT A;  2E2M A;  4HU9 A;  4AJ8 A;  1FOH A;  1X9S B;  1GUM A;  1B4Q A;  2QA2 A;  3HYP A;  1W4V A;  2AJQ B;  3QOU A;  3WGE A;  2N5B A;  3H8Q A;  1MDI A;  2AUV A;  4BWS A;  3CSH A;  3GST A;  4EO3 A;  1JFU A;  2CT6 A;  3WYW A;  3DRN A;  2GQM A;  3WT2 A;  1GRX A;  3FR6 A;  1R4W A;  4HEA 2;  3O6T A;  4JBB A;  3M8N A;  3ZFB A;  3ZL5 A;  1U3I A;  1A23 A;  4K0G A;  4K9Z A;  3UAP A;  2GQK A;  5H5Q A;  2WDU A;  1TU8 A;  3UVH A;  4LA1 A;  4IP1 A;  2YV7 A;  2E0Q A;  3FKF A;  4XS6 A;  6GSX A;  3HVV A;  3LGC A;  4IQA A;  4HJM A;  3DIE A;  3MYD A;  1SYR A;  5J3R A;  2CQ9 A;  3P2A A;  3IC8 A;  2EIR A;  2B5X A;  2LQQ A;  1O8X A;  1Z5Y E;  3RPP A;  3C71 A;  3ZRD A;  2RII A;  3TCO A;  3FRC A;  1LJR A;  5AIX A;  1X0R A;  3ERW A;  1O8W A;  4DEJ A;  2EFE A;  3VWV A;  4CY6 A;  4X1U A;  2A2R A;  2IL3 A;  5D9V A;  1XW9 A;  1Z3E A;  4BVX B;  4EE0 A;  4V2L A;  2CA8 A;  3FMW A;  5KN2 A;  3GIX A;  2PU9 C;  2ZNM A;  2VM1 A;  3GH9 A;  4XRD A;  4EIQ A;  1A2L A;  1WPI A;  1PN9 A;  3F8U A;  1GUL A;  3L0H A;  2LTK A;  2V6O A;  2FCH A;  3O3T A;  4GLT A;  3KTB A;  3IK9 A;  1V58 A;  20GS A;  1M7T A;  2OBK A;  1T4Y A;  1GSD A;  1GH2 A;  2K8S A;  4XS4 A;  5ID2 B;  3HJM A;  4OFM A;  2H0I A;  4ZL9 A;  5IIZ A;  1GLP A;  2CAQ A;  4MZW A;  2CZ3 A;  2B1L A;  2XC2 A;  2TRC P;  2FUG 2;  3RHC A;  3F3R A;  3AY8 A;  2NBS A;  2JU5 A;  1YEX A;  1YQ1 A;  4F9Z A;  4ZB9 A;  2VD0 A;  4I6X A;  2LKU A;  2YJ7 A;  3EMX A;  4ID0 A;  1WJK A;  4NPB A;  2ZUP A;  2GZY A;  5J40 A;  4YAP A;  4HOJ A;  4KSM A;  3QMX A;  1WWJ A;  3GTU B;  2LJA A;  5G2Z A;  1J0F A;  5A1N A;  4XIH A;  2YV9 A;  2FWE A;  3BBY A;  3IK7 A;  3IBH A;  3VI7 A;  5CO3 A;  3SBC A;  3VK9 A;  2EFC A;  4F82 A;  3FW2 A;  1XWC A;  2YOI A;  2FLS A;  3H79 A;  3US3 A;  3TGZ A;  1TK8 B;  2L57 A;  1OC9 A;  3E9J B;  3NOF A;  2UZ8 A;  2FA4 A;  3BCK A;  2HRK B;  5G30 A;  2JZS A;  2HT9 A;  4EUY A;  5JCU A;  2HRN A;  2DBC A;  3C73 A;  1ZCP A;  3EIN A;  4NV5 A;  3G7Y A;  4BPY A;  5ELG A;  3EMP A;  5IOX A;  1XOA A;  1QQ2 A;  4TR1 A;  2OAC A;  3ZZX A;  5IMD A;  4I8B A;  2HRF A;  3DVX A;  3IHG A;  5DCG A;  3KZQ A;  2RUE A;  2UV8 G;  2GTU A;  5EL8 A;  3TJB A;  2FHE A;  1K0A A;  1OAZ A;  4GCI A;  2L59 A;  3DML A;  1B8X A;  2H71 A;  3L9V A;  4MJA A;  4N30 A;  5JCW A;  1XVQ A;  4L5O A;  1TK0 B;  1AUC A;  1WP0 A;  3G9B A;  3LJR A;  5ECQ B;  1M9A A;  3F4R A;  5DAK B;  6GSW A;  2YZU A;  4TXO A;  3TOU A;  2VCT A;  1BG1 A;  2QC7 A;  3F0I A;  4TR3 A;  2F9S A;  2CV4 A;  2OE1 A;  4G9H A;  2H0G A;  2O5V A;  4PX1 A;  5ECN B;  2HNL A;  4AKH A;  2FWH A;  3D6I A;  2LRC A;  3EVI A;  4HDE A;  4MNN A;  4J2F A;  4KUN A;  2WFC A;  1K0C A;  1ZYE A;  2VOC A;  1B9Y C;  3GKN A;  1G6Y A;  2VLT A;  9GSS A;  2AYT A;  3I43 A;  4HZ4 A;  1VF3 A;  3MSZ A;  1KEB A;  1K3O A;  1M2A A;  4AI6 A;  4EC0 A;  1T00 A;  4AKI A;  1I5G A;  4MH3 A;  5B6M A;  2IMD A;  1KTE A;  6GSS A;  2VM2 A;  1UVZ A;  4Q5N A;  1S3A A;  3E3E A;  4ZL7 A;  3HXS A;  4QMK A;  1MDJ A;  4K8M A;  2C3N A;  3UVT A;  1XZO A;  3GKX A;  2OAD A;  1MD3 A;  4F0C A;  1K0M A;  1XOB A;  7GSS A;  2YZH A;  4KX4 A;  3ERF A;  3PGT A;  3PR8 A;  4YKG A;  5EVO A;  5GAN D;  5J4U A;  4MP4 A;  3IHQ A;  2XBI A;  1IYH A;  1QK8 A;  4L8E A;  5FHI A;  2VCW A;  4RUV A;  2KOK A;  4JR6 A;  2DSA A;  1NSW A;  2B1K A;  2B3S A;  1G7O A;  1V40 A;  2E2G A;  1LU4 A;  2R5G A;  4FO5 A;  2YJH A;  1OC8 A;  1ERV A;  2LEG A;  4G01 A;  1EEM A;  3GKM A;  1A24 A;  1M2D A;  5D9X A;  3HVS A;  4BVX A;  4RI6 A;  4LL1 B;  5A34 B;  4LLR A;  2YWN A;  2HI7 A;  4WBR D;  4MMM A;  2ON5 A;  3CSI A;  1GWC A;  3I9V 2;  3RAZ A;  2YWI A;  3QAV A;  3EE2 A;  4PTS A;  4AGS A;  2HZE B;  1OYJ A;  3D4T A;  3EU4 A;  1O81 A;  5F07 A;  5DBQ A;  4I2U A;  2HSN A;  1FB6 A;  3HA9 A;  5H5S A;  1A2J A;  4JR4 A;  3TKS E;  2H70 A;  2KUC A;  5AIS A;  3ZTL A;  3S9F A;  5ID2 A;  2DKH A;  4WR5 A;  18GS A;  1EEJ A;  2IPA A;  2C0G A;  1HD2 A;  3D21 A;  1TXX A;  2YNX A;  5KN0 A;  4IKH A;  2B5E A;  2M46 A;  2HRA A;  2VCQ A;  2RLI A;  3MWH A;  2LUS A;  3MAK A;  2GVP A;  1J9B A;  3GRX A;  3WD6 A;  4OO4 A;  1G6W A;  1TJD A;  2WCI A;  1BX9 A;  3TRP A;  2IN3 A;  5ECP B;  2ZCT A;  1R7H A;  2FY6 A;  1TU7 A;  3A5W A;  1T3B A;  2K18 A;  1XW5 A;  3UMA A;  3ME7 A;  1O7U A;  1H4O A;  4Q5F A;  2IFQ A;  4V2N A;  3HDC A;  2V1M A;  5HR1 A;  3IDV A;  2JAD A;  1EV9 A;  5GSS A;  1K3L A;  3ZIJ A;  3FHK A;  4O92 A;  1OKT A;  4TN8 A;  4HJ2 A;  5IMV A;  4NHZ A;  2WUL A;  3QFA C;  4N0V A;  4BVY B;  2LRT A;  2L6C A;  1Y6E A;  2VCV A;  3IV4 A;  2HRK A;  1A8L A;  5C04 A;  2AV4 A;  3TUE A;  4PGT A;  5KEJ A;  3H4K A;  3J7Y k;  1I9D A;  1URM A;  1WE0 A;  2C4J A;  5CP1 A;  2P5Q A;  4EF0 A;  4YAV A;  1OVN A;  1OE8 A;  1GSF A;  3GA4 A;  1N2A A;  4H86 A;  1SKR B;  4RQR A;  2R0C A;  3QR6 A;  5AN1 A;  5J47 A;  2DML A;  3VPT A;  4YH2 A;  1YKC A;  2VCX A;  3ZMK A;  5A4V A;  4EVM A;  1PA3 A;  3CYN A;  3P90 A;  2VAF A;  2GS3 A;  5DAL B;  1EOG A;  4NV2 A;  2F8A A;  5D93 A;  1A8Y A;  2OE0 A;  2L5L A;  3PIN A;  4WEY A;  2LNT A;  4KDU A;  3GX0 A;  2CAI A;  1EZK A;  1X9W B;  3N9J A;  2HQT A;  2R0G A;  2O7K A;  4QQ7 A;  3W6G A;  3KEB A;  2X8G A;  2PBJ A;  5J9C A;  4V1A p;  3DYR A;  4JE1 A;  3WGX A;  2V41 A;  1TI3 A;  2J23 A;  3M9K A;  1O73 A;  1FVK A;  1G7E A;  1TRS A;  4ZB7 A;  3FR3 A;  3PPU A;  3TKR A;  4BL7 B;  2XPE A;  3MDK A;  5HR3 A;  1BF5 A;  3IXR A;  1ACV A;  2REM A;  1ERW A;  1JZD A;  2HZF A;  2DC5 A;  1XWA A;  1GLQ A;  1Z7R A;  3LYK A;  1THO A;  2PVQ A;  2C80 A;  1EP7 A;  17GS A;  1M99 A;  1SD9 A;  3W8J A;  1GP1 A;  3TU3 B;  3UAR A;  5CYY A;  1M9B A;  4GQC A;  4KGI A;  4RI7 A;  1XXU A;  5DDL A;  1SEN A;  2C0D A;  1QGV A;  1YKA A;  5DQY A;  3GL3 A;  1PGT A;  5DJL A;  3KMO A;  2CVK A;  4TR4 A;  3EPT A;  3U5R E;  2PPT A;  4N11 A;  4I2T A;  4LL4 B;  4L0W A;  1BQ7 A;  2LQO A;  4MF5 A;  2IMI A;  1AXD A;  3CSJ A;  4OFN A;  1FW1 A;  1UA5 A;  1NHO A;  2H30 A;  3MIX A;  3TJK A;  1WIK A;  1Y1U A;  4HQS A;  3LEF A;  2VKZ G;  1B9X C;  4DSS B;  2GT5 A;  1GNE A;  3DKS A;  4X0X A;  1EGR A;  3TKS C;  2HSM A;  4EL1 A;  3Q74 A;  4CDO A;  4JRR A;  2QSI A;  3UEM A;  1F37 A;  3GX8 A;  2XBQ A;  2LS5 A;  1J08 A;  1N8J A;  1TRV A;  4AF2 A;  5F05 A;  10GS A;  4G0I A;  1ZZY A;  3VFI A;  3EUR A;  1SK0 A;  5J41 A;  5B8A A;  4PUA A;  19GS A;  3C1S A;  4K7I A;  4KSO A;  3QAG A;  2GGT A;  4WR4 A;  3L78 A;  1SJI A;  5A34 A;  1DE1 A;  2VCZ A;  4CHS A;  4WF5 A;  2EIO A;  3CXG A;  3D22 A;  3P8W A;  1R5A A;  2CX3 A;  3E0U A;  3HMJ G;  3HJO A;  1JLW A;  5JWO B;  1YDK A;  4AKX B;  1DSB A;  4X4J A;  3KP8 A;  5ECH B;  3RPN A;  2KLX A;  5CRG A;  4G0L A;  1FHE A;  5E4W A;  2NTO A;  3IR4 A;  2WGR A;  3ME8 A;  4IW9 A;  4TRX A;  4ZXG A;  3APO A;  4MA9 A;  2DJ2 A;  2YN1 A;  5BRT A;  3W8S A;  3P7X A;  5CRW A;  1E6B A;  3KGK A;  2PER A;  1MD4 A;  12GS A;  2C1Y A;  3R3E A;  5IM9 A;  4XHM A;  2LV3 A;  4EXJ A;  1KBN A;  3O76 A;  3H93 A;  1VF4 A;  1ABA A;  1RQM A;  2A4H A;  1IYI A;  2X64 A;  5KOX A;  2BMX A;  1T8E B;  2K8V A;  2H76 A;  3L4N A;  2IWT A;  4ACS A;  2HE3 A;  6GSV A;  4QL7 A;  5CRD A;  1U3A A;  2B7K A;  3GNJ A;  3HHV A;  3KD0 A;  2B7J A;  3PH9 A;  4DSR A;  1W89 A;  4N3Z A;  2H8L A;  4PNG A;  3N5O A;  4GQF A;  2FWG A;  4A5P A;  3TRX A;  2C0E A;  1XWG A;  4XRA A;  1BG5 A;  3HZ4 A;  5L71 A;  2IIY A;  3APQ A;  2V2G A;  1AIU A;  3F6F A;  2JSZ A;  3ZVJ D;  4P3Y B;  5A5H B;  5IQY A;  1JHB A;  2TIR A;  3FZ9 A;  1YZX A;  4K5S A;  1SU9 A;  2GZZ A;  4K2X A;  5JWR B;  3VWU A;  4D73 B;  2BTO T;  2H1A A;  2B5Y A;  3QCP A;  2RM5 A;  5KN3 A;  1KNG A;  4IQ1 A;  4MPF A;  4HQZ A;  1TOF A;  3IPZ A;  2C3T A;  1USB A;  1WRY A;  1X5D A;  5DQS A;  1AW9 A;  4G10 A;  1S3D A;  5IPG A;  1GL8 A;  5HR0 A;  2PGT A;  4PNF A;  3TDG A;  5GST A;  5DJM A;  2YAN A;  3C8E A;  3A2X A;  3UJ1 A;  3M1G A;  2X8C A;  4OCF A;  1FO5 A;  3UOM A;  4DSQ A;  4ECB A;  1PX7 A;  4NAX A;  1UC7 A;  5ELA A;  2C3Q A;  2H75 A;  3VPQ A;  1V9W A;  2F51 A;  3BOA A;  4ZB8 A;  5D8I A;  5ECR B;  3BCI A;  3IRA A;  4Q5R A;  1PD2 1;  2H72 A;  3KIJ A;  4J56 E;  4BA7 A;  3LWA A;  2GSS A;  4POB A;  1PSQ A;  4MJE A;  3FYG A;  2H1L A;  5D9T A;  4ECI A;  4G2E A;  4G0K A;  2GT6 A;  4ISD A;  1VGL A;  3F63 A;  2XPD A;  1ML6 A;  3TJJ A;  5ENU A;  4KAE A;  5IOW A;  1U88 A;  5HFI A;  4O5Q A;  4EDZ A;  4ICY A;  1AC1 A;  3Q19 A;  3EYT A;  3HCZ A;  1TTZ A;  5GZZ B;  1V98 A;  1U87 A;  2D2Z A;  4JZQ A;  2R3X A;  1HNB A;  4MH2 A;  2O89 A;  13GS A;  3KXO A;  1ERT A;  5D96 A;  1NHY A;  3TJF A;  1RW1 A;  3CMI A;  4YKF A;  1TI1 A;  1TXU A;  1C72 A;  4GWR A;  3CTF A;  2QA1 A;  4ECC A;  2GST A;  1A0R P;  2J9H A;  5HFK A;  2HFD A;  2DKI A;  3LFL A;  1T4Z A;  1XVW A;  1F3B A;  1PKW A;  1Z6N A;  4KA0 A;  3VWW A;  5IMA A;  2DLX A;  2VL3 A;  4V1A g;  3G7I A;  2H6Y A;  1SYX A;  1XWK A;  3DWV A;  1X5E A;  1GSY A;  3QPM A;  5FWG A;  5B6N A;  1ZYQ B;  4GST A;  2H1G A;  1GTI A;  2EC4 A;  3GUR A;  4HZ2 A;  2NDO A;  4ZL8 A;  3R2Q A;  4ZIJ A;  5IMZ A;  1SKW B;  2VIM A;  2PMT A;  2EFH A;  1MEK A;  1GSQ A;  5IPH A;  4E68 A;  3GKK A;  1MTC A;  4MZC A;  2YP6 A;  1AAZ A;  2JZR A;  2VLV A;  1OC3 A;  2KP2 A;  2WB9 A;  1F9M A;  2OJL A;  1SD8 A;  1TP9 A;  5A4W A;  4K1F A;  6GSY A;  5G5F A;  2GLR A;  1UN2 A;  1FVJ A;  2R0P A;  4MLY A;  4F0B A;  2PVO C;  4OMV A;  5IO0 A;  4N0Z A;  1TDI A;  3QD9 A;  4I97 A;  4O7H A;  1TK5 B;  2VL2 A;  2CX4 A;  1EWX A;  4XCS A;  1ON4 A;  1M2B A;  4GXZ A;  2L6D A;  3GTU A;  2F3M A;  2WJU A;  4DVC A;  4ZIL A;  3DGQ A;  4IBP A;  5HFG A;  3L9S A;  5BMU B;  2DJK A;  3LOR A;  3HKR A;  5CRH A;  5G1K A;  4MF6 A;  1R5P A;  4O5R A;  3ZLP A;  4AJ6 A;  2LST A;  3HVX A;  4TW5 A;  3KH7 A;  3ZML A;  3TKP A;  1RK4 A;  5F0G A;  2CVB A;  5J9B A;  3KCM A;  5EPF A;  5J4Y A;  2L4Q A;  2FD3 A;  2R37 A;  5E59 A;  3VWX A;  3ED3 A;  1T1V A;  3DEX A;  4TR1 B;  4Z7X A;  3FK8 A;  3GMF A;  3WT1 A;  3D4M A;  2H73 A;  1AQX A;  1OKD A;  1VF2 A;  2V32 A;  1AQW A;  2TRX A;  4RQX A;  2VO4 A;  4KW6 A;  5A5H A;  1FOV A;  4WKW A;  2OA7 A;  4WET A;  2X4A A;  3GYK A;  4MPG A;  4IHU A;  4MZB A;  2KHP A;  5D73 A;  3NIV A;  1F2E A;  4NWY A;  4ECJ A;  5IO2 A;  4EDY A;  2HYX A;  5HQP A;  5IMC A;  3RBT A;  5FT3 A;  3QFB C;  4ZBA A;  4K6X A;  4OD7 A;  5JCG A;  4MF7 A;  6GST A;  5DAK A;  4GF0 A;  14GS A;  2G2Q A;  3UBL A;  2VLU A;  3C7M A;  4J57 E;  2MMO A;  5B8B A;  4IP6 A;  4GTU A;  3BD2 A;  3GFK A;  1F6M C;  3LW9 A;  3VUR A;  3HD5 A;  3KTL A;  2X99 A;  5B7C A;  3A2V A;  2G0F A;  4HS1 A;  4K2D A;  1DE2 A;  2O85 A;  2VL9 A;  3GHA A;  1XBS A;  2DIY A;  1G0T A;  4ZB6 A;  3TKQ A;  3WGD A;  1S3C A;  3KJY A;  2EIQ A;  3A5I A;  3TRQ A;  2AHE A;  4PXO A;  1YY7 A;  2QGV A;  4HI7 A;  1GTA A;  6GSU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...