2J9XA

Tryptophan synthase in complex with gp, alpha-d,l-glycerol-phosphate, cs, ph6.5 - alpha aminoacrylate form - (gp)e(a-a)
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
266
structure length
263
Chain Sequence
ERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLSRSGVTGAENRGLHHLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKIIEKNLASPKQMLAELRSFVSAMKAASR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Allosteric Regulation of Substrate Channeling in Tryptophan Synthase: Modulation of the L-Serine Reaction in Stage I of the Beta-Reaction by Alpha-Site Ligands.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Lyase
molecule keywords TRYPTOPHAN SYNTHASE ALPHA CHAIN
total genus 102
structure length 263
sequence length 266
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 2006-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2j9xA00
3HG5A 1OX4B 1OFDA 3STEA 1ME8A 5I3GA 1O5XA 4MLRA 3W7CA 3M47A 7TIMA 5G4WA 3K30A 4NUWA 1ZALA 2YZRA 3Q94A 1GZGA 4K8EA 4W9TA 2Y89A 3EEGA 1C9DA 1W5MA 4OE7A 2GPTA 1H50A 4LVBA 1MEWA 3UWUA 3WJWA 1T0OA 1WDWA 3M5YA 3LTYA 1XBYA 3G0SA 4K38A 3GVGA 1WAUA 3WJSA 2ZCGA 3U8GA 4IUOA 1A5BA 5I3KA 1VGAA 3CEPA 1R2RA 4JTTA 1LBMA 4JICA 3S5ZA 5CZJA 3DFQA 4O12A 3I7SA 1SSDA 1WYIA 1TO3A 3LB0A 1H7NA 3G1YA 4CQ8A 3M43A 5J5RA 3QZEA 4FO4A 5HUPA 1SSGA 3G1FA 1KV8A 3KX6A 4M19A 4LC8A 4UCGA 5CG7A 6TIMA 4JX4A 4HN4A 3VFLA 5CSSA 1YDOA 1HTIA 1JUBA 3PWAA 4UNLA 4IMCA 3MP4A 4J9JA 3NQ2A 5L9FA 1SZGA 6ALDA 3NQVA 4MFEA 5DY3A 3G1DA 4I9AA 1G67A 3TW6A 4XUGA 1X8FA 1TPH1 1VQTA 4XKYB 3G0UA 2QAPA 2J88A 4UTJA 2A6NA 3TQKA 3KVKA 2XN2A 3OA3A 3R5EA 3BG3A 3W7NA 4I7VA 5DELA 4ZQCA 4BK9A 3HG4A 3IIZA 5K2ZA 2DZWA 2ZZ5A 4LU0A 4CQ9A 2WO5A 3MO7A 1F05A 2NXHA 3OVPA 1QWGA 4S2BA 2X1TA 3QC3A 4JTHA 4E0CA 1H1YA 1LM1A 4IOTA 3NM3A 3NQ7A 3PB0A 1OFRA 4WZHA 2X1UA 1ONRA 1SZEA 4HNNA 2WV8A 4Y8FA 2VXNA 3NNTA 1SO3A 1MEIA 3PSVA 5F1VA 1W0MA 3QW3A 1IXOA 3MBDA 2GJNA 3LHVA 3S1VA 1GVSA 3W1NA 5D38A 1QFEA 2V81A 4RV8A 3U6WA 2ATSA 3C2RA 1WXJA 3TDFA 3W1LA 4UTIA 1B57A 5A8GA 1XC4A 1QPRA 3UWVA 2RFGA 3PG9A 3BPWA 2QUVA 4MY1A 4JTGA 4DF2A 4O28A 4DF1A 3LBMA 5DCEA 1N7KA 1TQXA 2Y6ZA 4FXRA 5C6MA 1JCNA 2Z6IA 1W5NA 1B4EA 3W2NA 2A5HA 3UWYA 3W87A 1YADA 1JULA 5AHIA 1G7UA 3OVRA 4A22A 4ICNA 2YFNA 5HQEA 1FCVA 2UV8G 3R12A 1NEYA 5EA9A 3PULA 1P4CA 2H3DA 2E77A 4A2SA 2V82A 3NQDA 3C3NA 4O8RA 4M5PA 3SY5A 1I2QA 3DI1A 3KRUA 2G97A 2YPIA 5D37A 1RQEA 3KRZA 3FJ6A 4POCA 5E93A 1O4UA 1ZJIA 3L9CA 1HO1A 3M41A 4NJIA 4GC4A 1GG0A 1DL3A 3NG3A 1QAPA 3S6DA 3USBA 2QDHA 3LTPA 4O11A 5BRBA 4CCEA 4C1KA 3OHIA 3P8JA 2Z2UA 1F6PA 1WBHA 1FQ0A 3IVSA 2E68A 3N34A 1YTKA 3LHZA 1FWNA 4JIQA 1L6YA 3KOFA 5D05A 5LHEA 5G2IA 3W2JA 1ZAHA 4X3ZA 4AXKA 1B4KA 2J9XA 3GAYA 5AFDA 1DKWA 4GUJA 2ZDRA 4OV9A 2WSYA 4CCCA 1GJPA 3SJ3A 3DENA 1XFBA 1PHQA 1JQVA 2P0OA 2NV1A 2VEKA 4A2RA 4LRTA 1F2JA 5IBXA 4LT9A 2CZDA 1C29A 3ZR4A 2YCEA 1LRNA 2A21A 1Y0EA 2EKCA 1A5AA 1B3OA 3GB6A 1K3UA 3S5NA 5I3FA 4JTFA 1HO4A 3PUDA 3AO0A 4UTWC 5FF7A 4XZ9A 4N6EA 2NV2A 3S9YA 2QCNA 4WD0A 1X7FA 3G3DA 3H54A 2QKFA 3FLUA 4QITA 3HJZA 3I6RA 3TH6A 3V75A 5KTLA 1MZHA 3M16A 5D33A 1XCFA 2NUXA 2QR6A 2CZFA 3HG2A 4UFKA 2V8ZA 4QNEA 3HBLA 3W9ZA 4XQ6A 4CNNA 1OFBA 3IEBA 3L5AA 2VENA 1QNVA 3W1TA 1W3IA 3A9IA 3DHDA 1VCVA 3VI2A 4S2CA 3IV3A 3TIMA 3NPUA 3R13A 3QM3A 2ALDA 1RR2A 3W6YA 4O57A 1P5BA 2RDTA 5BNKA 3JS3A 2VFFA 1FDJA 1JCLA 4DQWA 5I3IA 3N14A 3P81A 3W73A 4OWGA 1LORA 3M44A 3IVUA 4O15A 4ORMA 3DGRA 5CKSA 5KZEA 1KM5A 2EPHA 4HHPA 4IPJA 5DCDA 1LOSA 3WK0A 1GVFA 3RMJA 1SZNA 4YMZA 4AWUA 1S5WA 2J27A 2J9YA 4NXKA 3G1HA 4KWVA 4NJGA 4ZMGA 3ATZA 1CX9A 3PSWA 2FFCA 4UTKA 2PURA 5BMXA 4JYFA 1JCMP 4ZQMA 3PBWA 3W72A 1VHCA 4PL1A 5HWNA 3GX9A 2FB2A 5K9XA 3EKZA 3SSJA 2BLEA 4OT7A 4K7YA 1SPQA 4L4MA 5FEPA 5AHMA 1R2TA 3QRHA 1N55A 2FQIA 3P74A 1GYLA 3NYZA 5HULA 3G8EA 5DLCA 1AW2A 3SI9A 1A50A 1OK6A 1T96A 1EP3A 1YPFA 1WX0A 3F4NA 1BWLA 1YTEA 2FPTA 2JKEA 3UXAA 2WSRA 3R2GA 2DZUA 2PRLA 2DJXA 5BOOA 4OV4A 2R91A 3UNDA 3QMSA 4BR1A 1PL9A 1Q6LA 2FB3A 4GUFA 4NX0A 2OMAA 4Z1CA 2CLOA 2VFDA 1SUXA 1E51A 3LHYA 3CIXA 2VKZG 3UPBA 3TJXA 3PM6A 3SFKA 2PRMA 4QAIA 1WOAA 1F73A 3B03A 3W85A 1GYNA 2I1OA 4M7TA 3WK2A 3DHFA 1F7BA 2CW6A 3NL5A 1EWDA 3G1AA 1KBIA 5D2TA 1SR9A 4H4IA 2R14A 4RLIA 1K7EA 1YXCA 2VFIA 2ISSA 4IJBA 3QMTA 1VH7A 5D2VA 3HF3A 4HSNA 4N6FA 3NL2A 3PUOA 3MWAA 5BMWA 4HT3A 4NXSA 2ZTKA 3G18A 3L66A 1F76A 3EX3A 2J24A 3R8RA 1TPWA 3QQ1A 1J4EA 4WOQA 3TFCA 3M0ZA 3IIXA 1VYSX 4O16A 4UTUA 4UTMA 5KITA 4MY8A 3E0IA 3W83A 3LI0A 4EF9A 1VPXA 3PBUA 3F4WA 1DJQA 3DZ1A 1DQXA 4N9EA 1I8JA 4LC6A 5DN1A 1LBLA 3EX6A 5HINA 3C52A 4NZFA 4P61A 3W7PA 2B7QA 3S42A 1OVDA 5D32A 2ZRZA 1OYBA 5FEZA 2QF7A 2H8ZA 4JTJA 1SFJA 2ZZ2A 5K4XA 1ZNNA 3IGSA 2ZYFA 1T8XA 2Y7DA 3P61A 3NQAA 5HR6A 1F74A 5KINA 3HPSA 1EWEA 4LS1A 1O60A 1L2UA 2J6XA 3QMRA 4QIUA 1A5SA 5BW6A 5EY5A 3HMJG 1K7XA 3W7QA 1JRCA 4IXXA 2ZZ4A 1K8XA 3ABOA 1QMLA 3W1RA 3L5LA 2O7SA 1TTJA 3MI2A 3TC7A 5DBTA 1I2RA 3PR2A 4KWWA 3NPXA 1QCWA 3QSTA 4LV9A 2C19A 4MIMA 3W7RA 1I4NA 4UTTC 1JCYA 4TIMA 2GUUA 3TAKA 4UR8A 3B06A 4ZQOA 3TA6A 2QCHA 4NNCA 1PV8A 1AW1A 4NQ1A 4X2RA 5L6UA 2TRSA 4HIBA 3NQCA 4M7SA 4HNTA 1FWRA 3T4CA 4A21A 5DY2A 3VCRA 4AF0B 3LCHA 1TPVA 5LNVA 3L21A 4AF0A 5HUOA 1H61A 4JTKA 1EEPA 2Y63A 4YCPA 2FTPA 1JJKA 2RDUA 3M9YA 3ZWTA 3HG3A 4O4WA 4QJ1A 1OF6A 2AGKA 5LGXA 3JRKA 4BI7A 4Z0JA 3EWWA 4OQVA 4DF0A 1SU5A 3TUUA 4NT0A 4MPQA 3QSRA 4JTUA 3TROA 1NSJA 3MI3A 2BXVA 2E6FA 3KRSA 5KZDA 1TJRA 5K4ZA 1OYCA 1BKSA 3KHJA 3STFA 1OX6A 1MXSA 3GZ3A 1J2WA 2QJHA 3QW4B 3W1MA 1SFLA 1NF0A 2HSAA 1AK5A 2R8WA 3Q37A 3C8FA 3TV8A 1FDZA 3BLFA 4MY9A 4GRSA 2PC4A 3SZ8A 5LKYA 2E5CA 1MSSA 4TR9A 5HWMA 4DPPA 3DKLA 4KFPA 2VEMA 5F4SA 1H7PA 5D30A 2JBMA 1V5XA 1PS9A 1W31A 3T55A 3DI0A 3GDMA 1KFKA 1XDLA 3DFOA 3FKKA 4UXDA 2HS8A 3NGJA 4O10A 1PE1A 1H7WA 1KM4A 3O15A 2V2CA 5FEXA 2A7NA 1HFBA 2H6RA 4FNUA 3U2OA 3UZ5A 3PUEA 3LX9A 4XWUA 2A1YA 4WX2A 3W7MA 1LZOA 4AWTA 5FEWA 1W5OA 2CLIA 4LVFA 4QNWA 1M6JA 1W3TA 3T40A 3M6YA 5KMYA 4JD4A 2ZTJA 4JTLA 3NPVA 2YDAA 2BX7A 4QISA 4BI6A 2VEIA 2JGQA 4TX9A 1SW7A 3LXAA 2CLFA 2DU2A 2EGZA 2HMCA 1WOBA 3CPRA 2FIQA 4BWLA 1IIGA 3H55A 5G1YA 4AHPA 4KFNA 1OABA 1ALDA 1KFJA 4KFOA 1M7OA 2E5BA 1THFD 3LXBA 4XTDA 5AYZA 1GTHA 3GKFA 2QUUA 1TRIA 3DFNA 3BGGA 2FDSA 2DZSA 3HO8A 3L5MA 2DP3A 1AL8A 4TU1A 1DHPA 5J5DA 4M6QA 5U7SA 3BG9A 3NQ6A 4M6PA 1ZCOA 2QCDB 1UASA 2IQTA 1KV5A 2QEZA 3MYOA 3RNDA 4ML9A 4PCFA 3LBCA 3BLEA 5K7JA 2V0TA 5AHEA 4I7WA 1QR7A 4K37A 1TPDA 4JX5A 3YPIA 1UCWA 1FWWA 3E96A 1XKYA 4UFJA 5C2XA 3BVJA 4I7UA 2V5BA 3W1UA 1W3NA 3NR0A 3PBYA 3W76A 5FF4A 3W86A 5G2HA 4MZYA 5G2WA 1DV7A 4E2BA 4MJMA 3CT7A 2CWNA 1AL7A 2ISVA 5EPDA 4Q4KA 2C18A 2ZRUA 2GVGA 3F03K 3M5VA 3UY8A 3UQNA 3SR7A 2A85A 3SIZA 1BWKA 4AWSA 4O19A 4IX2A 2B0MA 3GIYA 3I7RA 4NNAA 5H2ZA 1GVQA 3RK8A 3IVTA 3O6YX 2Q3OA 1YDNA 4NX5A 5KZMA 1PCWA 4FX8A 3MP3A 4RCXA 3UD6A 1TTQA 4KKXA 1TCDA 3G24A 2YGYA 4YLWA 3KVLA 1DOSA 3UXDA 1PVNA 2NWRA 1SW3A 4AEOA 2YFOA 3GXPA 1FX6A 1LRTA 3L0GA 4JNMA 3MUXA 3E12A 3W7GA 1JVNA 3O07A 1CI1A 3O1NA 4MZ8A 3I65A 2PE4A 1SW0A 3OVQA 4O54A 1XBZA 1IXNA 2WJZA 4ZZ9A 2NXIA 3SGZA 3W7DA 2F84A 1VCFA 4DO5A 4LVDA 3S5OA 4N2YA 1LLZA 4UUIA 1LTDA 4DEFA 1PHWA 1U5JA 1DQWA 3TSDA 4LVAA 5FI8A 3WK1A 1D3HA 1FXPA 1TV8A 1XI3A 3W23A 5F2MA 1MEHA 3MMTA 2ZQ0A 1IF2A 2Y62A 4GFSA 4CNPA 3GYEA 5LNRA 3P62A 4GNJA 4XBSA 4IWWA 4PC8A 4PH6A 2DZPA 4WUIA 5AHLA 4N9BA 1K02A 2ABBA 3NOEA 3KVMA 4RJEA 3N2XA 4D2JA 3QF0A 4O1BA 3TE9A 2I9EA 3OEXA 5SWUA 3L0KA 2LLEA 4UNKA 5HR7A 3QFEA 1FWTA 2GQ9A 5EBUA 3P84A 4LY8A 4M6VA 2C15A 3LXCA 4RZ5A 2A4AA 1LYXA 2AAMA 1O95A 2A0NA 2JK2A 5AN7A 2WPBA 1QOPA 4OGZA 5D2YA 2ZFAA 4MJZA 1H51A 3MHFA 5CPNA 3THAA 3WFAA 1IIHA 4FNTA 4DPQA 4LS0A 1KA9F 4N4PA 3QYQA 3L0NA 4ADUA 4AH7A 3W88A 3W1XA 3C4UA 4WY0B 4UFIA 1ZY9A 1ICSA 3CM4A 2CFFA 2NX3A 1OFAA 3BK0A 2OJPA 2QJGA 1H5YA 4ONVA 3NQMA 4MOZA 1H7XA 1IGSA 3P67A 4G1KA 3ABRA 4Z08A 5HJLA 2A2IA 1SZFA 1LOLA 1W54A 3IRDA 4RR4A 1FCUA 2ABAA 1IXPA 4N02A 4JDYA 1SO5A 3I7QA 4JEQA 1ADOA 1EUNA 4LS2A 2BTMA 3IGUA 3MI6A 4WQ6A 3C6CA 3EX2A 5U4NA 1OK4A 3Q2DA 3RFAA 5FF0A 5AOUA 3MBFA 1LROA 3DFTA 5AC7A 3TQ0A 2Q3RA 3PC0A 1GOXA 3LRMA 4IXHA 1YYAA 4BI5A 3W7JA 1KW1A 1TPFA 3TMLA 2DZVA 3G22A 3ZWSA 4UTLA 4FIRA 3B4UA 3THQA 1O5KA 3B8DA 5AYYA 5H91A 3HGJA 2YYUA 1DORA 3FS2A 4MLJA 5EYWA 4JTSA 1G4PA 3VE7A 3G1VA 3EWXA 5FF3A 3ZFHA 1LP6A 3M7WA 3CC1A 3LHUA 2JGYA 1M7PA 4LUIA 4LRSA 1OJXA 1Q6OA 3LERA 5IBXC 2X1RA 3W1AA 2DJLA 3A24A 3IIVA 2OT0A 4A3UA 1A53A 1OF8A 2QCFA 4LUJA 3EXTA 3KVJA 4E2DA 1XM3A 3W74A 4O14A 1ML1A 3C2FA 4NVTA 1VCGA 5HWJA 2V2HA 3RLUA 1XXXA 2C6QA 1EB3A 2ZRVA 3BW4A 2YSWA 5DBUA 1TB3A 1RQBA 3W22A 4UTHA 4OHQA 2A6LA 3NM1A 4Z1AA 3VKJA 3O8AA 5D2XA 4U28A 4LV4A 1TPB1 5AHFA 1TSIA 1VYPX 1UJPA 3IGXA 3QQ0A 1WBJA 2QUTA 3C56A 5F2IA 2Y61A 3N73A 1RZMA 1OYAA 2I14A 2FPYA 5KSWA 1JCXA 2H8XA 4LOCA 1TMHA 3W7OA 3A23A 1G4EA 3RF9A 2DORA 4XKYA 5TQLA 1YDVA 4AHOA 1PCKA 1JUEA 4BFAA 1G69A 4Q33A 1Q45A 1YPIA 3L68A 3LM7A 4FEZA 4BWLC 3CWNA 1C8VA 4O50A 1L9WA 2JKAA 4ALDA 4RZ4A 2QCGA 1FY6A 4CQAA 4O1CA 1ZFJA 1UBSA 1NAL1 3CB8A 1VLWA 3G1XA 3N9SA 2NUYA 2JKPA 1HL2A 5HMSA 2WNZA 1Z41A 1KBJA 2PCQA 1A5CA 3NQFA 4IMDA 4JTEA 3GR8A 4LVGA 3BV4A 5CSRA 5DXYA 3NEVA 4K36A 4PA8A 3UY7A 3MJYA 3NVTA 3M1ZA 3STCA 5LNSA 1HUVA 3D0CA 3W75A 5D02A 3B0VC 2NZLA 2WOQA 1TRDA 3IIOA 2Q8ZA 4PEKA 3LV5A 1XUUA 2W79A 3SW6A 3TKFA 1S5TA 2VOMA 2ZZ6A 3WK3A 3B04A 3NZRA 3C2VA 1X1OA 3ZS4A 4FF7A 3S1UA 3S5YA 4PTNA 3BG5A 1J5TA 4O18A 1GG1A 4Z1BA 1EA0A 2RH9A 3A22A 3LCLA 2VC6A 3O6DA 2XN0A 1OHLA 5A5WA 2WQPA 4JGDA 2D73A 1I45A 4B5NA 1ZENA 5LSMA 4JXCA 5C5YA 4IMEA 3VE9A 1LRQA 1K03A 1G6CA 3CHVA 5DCBA 5F1UA 1G4SA 3LLDA 4UMAA 3GK0A 4EIVA 2VFHA 1UB3A 4UFHA 1TREA 3A5FA 3V1PA 1FCQA 1DBTA 1VR6A 4NJKA 1W37A 1X1ZA 3WJXA 3PS7A 2QCLA 1GEQA 4DO6A 1VJIA 4O1AA 2GQ8A 1KTCA 3FOKA 3LCIA 1EP2A 1LDCA 5TBOA 4BF9A 1X6UA 1I2PA 3GDTA 1VYRA 2FPVA 4NU7A 2ZRYA 3I68A 3FYOA 4MKNA 3BO9A 3LCGA 4AB4A 4ZQPA 3E49A 3OIXA 3FEMA 2Y85A 4TMCA 2HTMA 4K39A 3O6CA 1JQXA 4MYXA 5LNWA 3TU9A 4K8HA 4FB7A 1TTPA 4LTSA 5G4EA 4RKAA 2J9ZA 5EL1A 3GXNA 2BWGA 2AQWA 5ABTA 3TX9A 3CTLA 2NX1A 1UUMA 2VFGA 3M5XA 2G96A 1KTNA 5D04C 3TJLA 3JR2A 1EPXA 3C61A 3E9AA 3EX4A 2Y88A 1W1ZA 4FNSA 3P82A 2NWSA 3EKLA 3O63A 2C3ZA 2KZHA 1KFEA 2FJKA 3F1QA 3OG3A 1QPNA 1Q6QA 3S8HA 1IXQA 4Z0SA 1EX5A 4OU1A 2YR1A 1K7FA 1OFEA 1TQJA 3P5YA 3W7LA 3LCFA 3MW7A 1ZHAA 3HPXA 3HGRA 4N9CA 1G4TA 3AJXA 1QPOA 2YYTA 4YWIA 2ZBTA 2E6DA 1JUKA 2QCMA 2WNQA 2NUWA 4XTIA 3BARA 1OX5A 2ISWA 3NAVA 3QEZA 3LHTA 4UC5A 1KM1A 2GVLA 1YLVA 2GVJA 4RXGA 1NF7A 4MZ1A 3LGEA 4WY0F 3G3MA 3O16A 3G8RA 1KFBA 2CLLA 1AG1O 4NJHA 2QDGA 2YW3A 1DJNA 3C0JA 4X9SA 5GVJA 1WQ5A 1TTIA 3PB2A 1LOQA 2ZA1A 4R7JA 1QO5A 3W84A 3B0PA 3NL3A 1TIMA 2Z1BA 3QH2A 4IPIA 1DVJA 2TSYA 4IMFA 5LGZA 4GUGA 4FNQA 3SECA 4DBDA 4EOUA 1ICPA 3STGA 3FIGA 2W6RA 3NZ1A 2XN1A 5CPLA 1P0NA 1VRDA 4JIPA 1GVOA 3ELFA 4FIQA 3GXTA 1KM2A 3FJLA 1M5WA 5AB3A 1VHNA 5CGQA 4WOZA 1K8ZA 1ICQA 4DXVA 5AC6A 4JYEA 3DBPA 4PFMA 1P1XA 2E09A 2BZNA 3GNNA 1CW2A 1RPXA 4Z1DA 3T78A 2ZRWA 3EWYA 3W1PA 4UTTA 1FBAA 1KM3A 2TYSA 4XBKA 1LCOA 3L2IA 1EUAA 4MFDA 3LTSA 4CCDA 2ZZ7A 1FWSA 2CLMA 3UYCA 1NVMA 3EB2A 3TCEA 4O13A 2QAFA 3GDRA 8TIMA 2TMDA 4WY0A 3CIWA 2CLHA 2EF9A 3LOTA 4JTIA 3LRLA 5LZLA 3O06A 2C0AA 2H3BA 2ZRXA 2OCZA 3T7VA 3CU2A 4CLMA 2DZXA 2E6AA 3FFSA 4GJ1A 4H6KA 2NLIA 2A7RA 2CU0A 4E38A 3GR7A 1F5ZA 3CQ0A 3S0CA 3C2OA 4GXMA 4O53A 2BSLA 3EWUA 2E6YA 3B05A 3NDOA 3LCXA 3PVFA 4AMAA 3W2UA 4ZL1A 3N19B 5T26A 1T99A 5MHBA 4WJEA 5DXXA 4WXZA 3TK7A 3HIJA 5F2GA 3M5ZA 2X1SA 1BTMA 5CZSA 1BEUA 1Q6RA 2B7OA 3MHUA 1H1ZA 4A29A 3LI1A 4HSOA 3L67A 4ZVJA 3GNDA 4OBTA 1S5VA 2RHGA 4NJJA 3NA8A 4AVFA 5E1QA 4TMBA 1N8FA 1YXYA 1MO0A 1SO4A 4FX7A 3MHGA 3GLCA 2RDWA 2QCDA 1EIXA 3PBVA 4QQ3A 3W7HA 3GDKA 4MUZA 1NFBA 1W5QA 3TMQA 3TXVA 2VELA 4YL2A 1TPC1 3W1QA 3HGOA 3S1XA 3DKJA 3TQVA 1W8SA 2VEPA 4K6AA 3HGSA 3FA5A 1QPQA 1FUYA 3A5VA 2ZZ1A 3TC6A 4N9DA 1V7YA 3G0XA 2Z6JA 3QPYA 3UWWA 3WJYA 1S3HA 2HS6A 4FHAA 4RX0A 1H63A 3VNDA 4JY8A 2NX9A 2V30A 3TXZA 3W70A 1XUZA 4EWND 1OFQA 3KAOA 3NO5A 3UPWA 2OT1A 3DAQA 4JYDA 1R46A 5I3HA 2GJLA 4GE8A 1AW5A 4QSHA 1Z42A 2OZ0A 4C1LA 3HB9A 3TR2A 2YX0A 1AMKA 5IM51 2Y7FA 3RU6A 1FDYA 1H7RA 4O17A 1RD5A 1VZWA 1VS1A 3P7YA 1H7OA 3DU0A 2WSQA 3UZJA 5AYXA 1GVRA 2WNNA 2XFWA 3DFPA 3L65A 1Q3NA 3GDLA 1KM6A 2WKJA 3PF3A 1GPWA 1LLWA 3BGJA 3MYPA 1OG0A 2H90A 1SQ7A 2E5DA 4RXFA 1D3GA 4JS3A 5HNRA 4AAJA 4Y6GA 4IMGA 1B9BA 5CZTA 3UWZA 5FESA 4ORIA 1O94A 1GQNA 1RVGA 1I2NA 2CZ5A 3WJZA 3HOJA 5F2LA 3LCWA 3NQGA 4L4LA 4R53A 3LLFA 2C14A 1KFCA 1KLZA 1XL9A 1I2OA 3W2MA 1L6SA 1ZAIA 5EMUA 2A7PA 2OX1A 5TIMA 3FKRA 4PODA 3DFSA 2V9DA 4Y90A 4R33A 1RQHA 2F7FA 4QM1A 5D09A 2CLKA 3RLVA 4GUHA 3O05A 4UFMA 3TAOA 2ZZ3A 2ZA2A 2Y70A 4DBEA 3KFTA 5I3JA 3ANYA 3IIPA 3R89A 1ME7A 3N9RA 3KXQA 5K9CA 1H60A 4LWWA 4Q32A 1XDMA 1D9EA 4O52A 4FX6M 3C2EA 3EXRA 4YXGA 1JR1A 1U83A 2E1DA 5AHNA 3INPA 3TW7A 3NQ8A 3W3OA 5FF2A 3W71A 1FCBA 4ADSA 3GAKA 3NL6A 1YXDA 4O1DA 1ME9A 3DH7A 5CZ0A 4ADTA 4UMBA 1K8YA 1KLYA 3EWBX 4Y96A 4HNUA 5G5IA 5F4XA 4H3DA 1FXQA 1KFLA 4JDBA 2GOUA 1TPEA 5EKYA 2C1HA 4UIOA 4S1FA 3DXIA 3LHWA 1VLIA 2TPSA 2EAWA 2G5WA 3W2LA 1OFPA 2QCCA 4O0KA 4O4VA 1OX4A 3W2KA 4RZ6A 3B0UX 3ATYA 4UFLA 3EXSA 1TYGA 1EP1A 2X2GA 3GKAA 4P2VA 5G1TA 1KM0A 5E0KA 1P0KA 3UWQA 1XBVA 3LDVA 5CPOA 3EWZA 4HKPA 3PAJA 1JCJA 4HPJA 1YTDA 3PG8A 1G7VA 2B7PA 4GWEA 3W7EA 4GBUA 2YXGA 1OFOA 3BLIA 2Z0IA 1TV7A 4U4MA 3LRKA 4ZQRA 2CZEA 3NXFA 1TPUA 1XBXA 1W5PA 1PIIA 3TFXA 3PY2A 4O0ZA 2G95A 4UR7A 5CPMA 2O7QA 4MYAA 3T44A 2B7NA 4WXYA 2EHHA 2X30A 4HPXA 3LV6A 4RK8A 3W7IA 1JRBA 3CEUA 4EF8A 2VFEA 4IGHA 3NQEA 4DO4A 3P80A 2Q8LA 4LW7A 3BW2A 4NNBA 1HG3A 1RV8A 5F4WA 2FLIA 1VC4A 4N4QA 3QPZA 1QOQA 1F6KA 1ZAJA 4NZJA 3N3MA 3HPZA 4FNRA 1TJPA 3TNOA 1GTEA 4JX6A 2YW4A 4UMCA 3TSMA 4JY9A 3CWOX 4IX0A 2X16A 3QJAA 5K9DA 2ATMA 4YCOA 1GT8A 3P8IA 3ABQA 4GUIA 3FYPA 2RKXA 1W56A 4FNPA 5LHFA 3P5ZA 1QO2A 3NPWA 1R2SA 2Y7EA 3W07A 3CLMA 4MVAA 1Z48A 2ZA3A 3W7KA 5AC8A 2CLEA 5C54A 2DZTA 5C55A 4TO8A 3EX1A 1TV5A 4IQLA 1WV2A 2C16A 3Q58A 3N2MA 4UTWA 2P1FA 4X22A 1H62A 2C13A 3MP5A 5D03A 4FXSA 2B4GA 2V2DA 1L6WA 4JR5A 2Y7GA 1R30A 3ABSA 1KTBA 4CNOA 3OBKA 5K3VA 4HNVA 2W0UA 4LNYA 2V5LA 4ZQNA 3H53A 1R47A 5D2WA 3E02A 1LBFA 2R94A 2GQAA 5LNUA 1GWJA 2P10A 4R34A 2QJIA 1QDSA 1Z44A 4DELA 2PRHA 4JN6A 3TSBA 4PL2A 4EVZA 4K7VA 4AHQA 1UUOA 2NXGA 1WA3A 1SO6A 3S1WA 3SGUA 3HQ1A 3A21A 2QCEA 3P60A 3BW3A 3G1SA 4Y9AA
chains in the Genus database with same CATH superfamily
3AQUA 3U7VA 1OX4B 2A3LA 2J7HA 1FWJC 4CD5A 2WZTA 1ME8A 4MDOA 3HU7A 4CD4A 1RA5A 1GZGA 4TOQA 4IIHA 1H50A 2QYGA 3E2RA 2WNWA 4FOKA 2PP1A 1E4NA 3M5YA 3LTYA 1XBYA 3GVGA 1W1VA 2ZCGA 1YKWA 4IUOA 5I3KA 1HJVA 3SCQA 3BXWA 3LZ3A 3CEPA 4GQGA 1R2RA 2R82A 3CZGA 2BS9A 1LBMA 3S5ZA 1US3A 4EACA 1I60A 1YW1A 5LA1A 3UBPC 4XZIA 1SSDA 1WYIA 1REQA 1UKTA 4CQ8A 2IQ0A 1ZBKA 2J75A 1DXIA 3KX6A 4LX4A 4UCGA 4B2DA 4YYFA 1LG1A 4UNLA 4NZ5A 2I56A 2DIEA 4K1GA 1G67A 1X8FA 4CUCA 2FTYA 1VQTA 2OEMA 4AMCA 4PMNA 3KVKA 5M03A 3PN8A 4RE0A 2XIJA 3BG3A 4H8VA 1J8VA 4I8YA 4C6CA 5K2ZA 4QEEA 1LG2A 2WO5A 3DOPA 4PTMA 4LUSA 1ECEA 1QWGA 2BODX 2X1TA 3GXMA 1AJ2A 1DEDA 2E0PA 4S3AA 1TR9A 4WZHA 3NCOA 1SZEA 4GX8A 4ATDA 3PPHA 4MWAA 3SDOA 3MSYA 1SO3A 1JDFA 4MTVA 1W0MA 4H04A 2FHCA 1P6BA 4WSKA 1MXGA 2V63A 2XISA 3R8GA 4RV8A 3M0LA 3W1LA 4UTIA 1XC4A 5D4YA 3HM7A 3IJ9A 2GL5A 3LBMA 4RNFA 1TQXA 4FXRA 3ZR6A 2GGGA 1W5NA 1B4EA 5BROA 2MNRA 3OQ8A 3M0XA 1JULA 1EC8A 1S5NA 4ICNA 2J6VA 1FCVA 4MG4A 4C5ZA 3PULA 1P4CA 3MV11 5I02A 1VF8A 3GU2A 1UR2A 2V82A 3ZT5A 2EPMX 3NQDA 2ZUSA 4M5PA 3KL5A 3DI1A 3KRUA 2YPIA 3LS9A 1RQEA 5H8UA 3AXHA 3R0UA 4POCA 4L61A 2C79A 8A3HA 2J47A 3FXYA 1HO1A 3LNPA 2OU4A 4GC4A 1XH2A 3NG3A 4OFCA 3SQMA 4AVNA 2I17A 1EQCA 4IPPA 3B9NA 1JXKA 3IUDA 1RHCA 3P8JA 2Z2UA 4B92A 1IEQA 4DXXA 1OY0A 3APTA 1XYCA 3QOMA 2E68A 3N34A 1OBAA 1YTKA 3PZ9A 5D05A 1JGMA 4X3ZA 3PNZA 4AXKA 2J9XA 3I3EA 3QY6A 2E4TA 3R25A 2PDPA 3PZQA 4QG8A 2ZDRA 4M82A 4OV9A 3N2OA 2XVNA 1GJPA 2CERA 2IW0A 1JQVA 2X0YA 4JNZA 5JBFA 3KCOA 4TXEA 1HT6A 1YX1A 1C29A 1VBRA 1LRNA 4J3ZA 4Z2IA 2QLYA 1W9VA 4IICA 4RE3A 1B3OA 1K3UA 1S2AA 1B1YA 3IAPA 2YDQA 3WYZA 2OZ3A 4XZ9A 2ESCA 2WLZA 3BGAA 3SCRA 4UQ9A 3VDAA 1CT5A 4N6EA 2PAJA 4MAZA 2NV2A 2CNCA 1RXOB 2C7FA 4XK2A 3GHSA 2V67A 4J2PA 4QITA 3HJZA 3WMCA 4TQTA 4X2PA 3S2LA 4DZIA 3TH6A 4S23A 2WMGA 2QR6A 1ITCA 2PDMA 2CZFA 1UHVA 4C90A 4QNEA 2ZVRA 3ITXA 4RZBA 3U9IA 4XQ6A 3ES7A 3TWAA 3N3TA 3LUTA 1V0LA 3BCFA 2VENA 3GXIA 3W1TA 1W3IA 3DHDA 2PFHA 5CC6A 4JBRA 3VI2A 2HXUA 3H22A 3QM3A 1RR2A 1LUCA 4BQ4A 1P5BA 4Q7BA 4IFOA 5BNKA 3RHGA 2POZA 3N14A 3U5YA 3DCPA 5CQ1A 4OWGA 4ZOBA 1E5JA 4ACYA 3NQBA 3LZ5A 1KM5A 4IPJA 3WK0A 1LOSA 3RMJA 4MNKA 1SZNA 4YMZA 4AWUA 1S5WA 3B9OA 2J9YA 4IL0A 3M0JA 1FFRA 1BVNP 3FHQA 2J7CA 2O9PA 3WQEA 3WQFA 3T1GA 3DDMA 2Q01A 1NWSA 4C7DA 4JTQA 4G5DA 1E4MM 2A3AA 1HXJA 5FOOA 1XFCA 3AMLA 4ZQMA 3PBWA 2QMKA 3WNLA 3GX9A 3SSJA 3N12A 3WD0A 3NSMA 4OT7A 1VAHA 1BG9A 1SPQA 1PWLA 1GKRA 3VZXA 3CB3A 5FAGA 4DIAA 1R2TA 6REQB 3QRHA 1VBJA 3MUCA 3WQ5A 1WKEA 1GYLA 5HULA 3WD4A 1AW2A 1A50A 4WCJA 1V6WA 5CLTA 1T96A 2QDDA 3SCPA 3MMUA 3GVWA 3VK5A 2JKEA 2DZUA 1NOFA 1IZCA 4OBSA 3ARRA 2PWGA 4M1RA 2R91A 4HTYA 3UNDA 2FH6A 4EPEC 4KQNA 1UP3A 4NYYA 4AXNA 1C92A 1Q6LA 1QHZA 4FR6A 3BOFA 4YHGA 4V27A 5A95A 3LSCA 1SUXA 1E51A 2NQLA 3MV01 4JEJA 2VKZG 3UPBA 3ZLHA 5LIUX 3PM6A 4KWOA 2Y1HA 4S39A 3VNYA 3NDYA 4C65A 3LLXA 3WK2A 1OCJA 3WLQA 1J6PA 1UROA 1EWDA 1L0PA 2AKMA 1KBIA 1SR9A 4H4IA 1K7EA 4NYUA 2ISSA 3UZXA 3HFTA 4N6FA 3NL2A 2PA6A 3L4WA 3BLDA 3N4AA 2FVKA 2VMFA 1TPWA 3QQ1A 1J4EA 1XGDA 3TFCA 3M0ZA 4H41A 1V3IA 4O16A 1W17A 2WKLA 4B5TA 1IYXA 3PBUA 1PZ0A 3R8HA 1DJQA 3DG3A 2G41A 1XCWA 2J7BA 3T09A 1WCGA 3PJTA 4JQ1A 1DYSA 1TUFA 4NZFA 5FIPA 4IFKA 4DBUA 1AZ1A 3GC2A 3S42A 1OVDA 1OYBA 1R9XA 3TONA 5FEZA 4JTJA 1IWAA 3BAJA 5K4XA 2OSWA 3K8MA 4HU8A 3IGSA 2HVMA 3W28A 1T8XA 1F74A 2PWFA 2EG6A 2P3EA 1O60A 3QMRA 4P8UA 4NSBA 3MVTA 5BW6A 4JPGA 3HMJG 5TNVA 2NQ5A 4U5IA 1SM9A 2X1IA 2ZZ4A 1G01A 1YIXA 3L5LA 1TTJA 5LIXX 4KWWA 4GCAA 4XBJA 2C19A 1JCYA 4TIMA 1EXPA 3B06A 4ZTXA 4ZQOA 2QCHA 4RUBA 3N29A 4DUVA 1UWIA 4HIBA 3NQCA 1FWRA 3T4CA 1JD7A 3VCRA 1GQIA 5LNVA 1VFHA 3L21A 4JTKA 4S3CA 1EEPA 1OEPA 2FTPA 1JJKA 2RDUA 3TYCA 1LF1A 2CBIA 1PKNA 1QI3A 3G6LA 4OQVA 4DF0A 4WR3A 3L12A 3ZVHB 3VFCA 4PBFA 4AQLA 1X96A 2R1LA 1KGXA 3AU2A 2E1WA 3KRSA 3PBGA 4F40A 3EB3A 4BY3A 1OX6A 1AH0A 1J2WA 3M4HA 5C2CA 3IUHA 2HSAA 3Q37A 3NTYA 5BOFA 3QHMA 1RH9A 4BEQA 4MY9A 2VC5A 1Q6EA 1ZB5A 4WF7A 1B31A 3AHZA 5F4SA 4Y9OA 1H7PA 5D30A 2JBMA 4HBKA 4ZB2A 1PS9A 4GCXA 3MB9A 3KWSA 2QT3A 3GDMA 1KFKA 3IRSA 1UR9A 4MUPA 4UXDA 3R79A 4AZCA 1PE1A 3H12A 1H7WA 3QV8A 2H6RA 4UCFA 2YL9A 2CETA 2WM1A 3U2OA 1PAMA 4XWUA 1SZRA 2A1YA 1JYVA 3ZXWA 3KM8A 4Z17A 5FEWA 2WCSA 1A4MA 4LVFA 4IIFA 3T40A 5KMYA 2YB1A 2UY3A 2ZTJA 1MYRA 2BX7A 4QISA 3M0KA 1IEWA 1QATA 2HMCA 3WQVA 3CPRA 3M6DA 4D9PA 2DH2A 4KFOA 1HX0A 3AXMA 4XTDA 5AYZA 3W37A 1BF2A 1GTHA 1J12A 3DFNA 2QIWA 3TN3A 5F7UA 1AL8A 1DHPA 2XH4A 4J3SA 4M6QA 5A8NA 4B3ZA 1XLKA 1ZCOA 1UASA 2IQTA 1KV5A 4ICCX 4WK9A 4H9MA 3G1RA 4Y9PA 2GDUA 1K6AA 2HXTA 3VCNA 4K37A 3CT2A 1TWIA 1GHSA 2VEGA 4I7UA 3W1UA 3WX7A 3B8TA 5HANA 1B9ZA 5BRQA 3IK4A 3WNNA 3SADA 4I9MA 5AYIA 3U2ZA 2PDGA 3KBVA 4EAYA 1UD6A 2DIJA 3V5CA 3CV1A 1RLDA 5EPDA 4BCEA 2C18A 3UY8A 3WNOA 3UQNA 3SR7A 1LT7A 3AYVA 4HZ7A 4IX2A 4KEMA 1F6YA 1T7LA 1DXEA 3F2CA 1WUEA 3GIYA 3I7RA 3N15A 3AIRA 1YDNA 3CHCA 4ZO7A 3BOXA 3UD6A 1D2KA 3HMCA 4KKXA 3L4VA 2YGYA 5ECVA 2E28A 4AEOA 1E6RA 4B3LA 2PU1A 1KXVA 5HXMA 2OOFA 5CEWA 3CYJA 4ATLA 4MZ8A 3I65A 3KCJA 5CC7A 3OVQA 1E15A 2ADAA 1XBZA 1K70A 3QQWA 2XYLA 4N2YA 1KCLA 2JF6A 3FAWA 4A8LA 4B9ZA 3TSDA 4LVAA 3WK1A 1FXPA 2FYMA 1TV8A 4DWSD 2X41A 1YBQB 3MO4A 3T42A 1UKPA 4GNJA 4CQBA 4PH6A 5AHLA 3W26A 4A3HA 3QR3A 2AQVA 4HNLA 3W25A 3N2XA 5D8WA 3K5XA 4O1BA 2I9EA 4TUFA 1XYAA 2LLEA 1PX3A 3QFEA 4J2MA 1BVWA 3S47A 1IZJA 4D1IA 2NQZA 4YTTA 4M6VA 1WKDA 1SJDA 4WDXA 2A4AA 1LYXA 3IJQA 2JK2A 1H09A 2A0NA 1TZ9A 1JPDX 1QOPA 2WPBA 2QXWA 4PUWA 4OGZA 2D2GA 2ZFAA 2POTA 3KBMA 5CPNA 3THAA 4HU0A 1US2A 1TE6A 2GGJA 3L0NA 3QZAA 3W88A 3HJEA 2GDQA 1ZY9A 1ICSA 4YJ5A 5LXXA 1AQFA 2CFFA 5H6HA 1R8LA 2OJPA 3SRHA 3WUFA 3GFZA 4GY7A 1H7XA 3OTRA 3U5UA 2OQHA 2AOSA 1EZWA 1W54A 4PMRA 3BAIA 1CDGA 3VIFA 3D3AA 4P8VA 2PDYA 1ADOA 1EUNA 4LS2A 4WQ6A 4D6FA 2D22A 3QOKA 4J3XA 4Q22A 3Q2DA 2QULA 2E25A 1Z7AA 4LUTA 4GOAA 3MY9A 1CTNA 4XKMA 3ZWSA 3G22A 4AIOA 3RDKA 3G2GA 4I5UA 4AZCB 4CNSA 2YYUA 3FS2A 3MC5A 1VD6A 3EWXA 2G37A 3ZFHA 3CC1A 3AZTA 1M7PA 1TWSA 3OGRA 2PB1A 4LRSA 3CL7A 2Z1WA 3LERA 3IIVA 2OT0A 1OF8A 2HCVA 3EXTA 4H9YA 1VCGA 2ZDSA 1J9YA 3BQ6A 4MWAC 1XXXA 2RAGA 3CYVA 2YSWA 2XIIA 3JZUA 3W22A 3E0WA 4OHQA 3NM1A 4O1FA 3VKJA 4YTRA 2VX4A 4LV4A 3CZJA 3IGXA 1WBJA 2CKRA 2Y61A 4H9VA 5AVNA 5JQ9A 1YPXA 3W7OA 4AISA 4H2CA 2DORA 4XKYA 2J25A 1YDVA 4HYRA 4BFAA 1XV8A 1ISVA 3V0SA 1Y5XA 7PTDA 3LM7A 4BWLC 3UG5A 4C6IA 1XYMA 4ALDA 2REQB 1IR2A 2WZIA 3H2MA 5IHRA 1JDDA 1NQ6A 3WH7A 4JTDA 3VCCA 1XQKA 3CB8A 3G1XA 9RUBA 2NUYA 2ZWYA 2BVYA 1UKQA 3AFBA 1A5LC 1Z41A 1KBJA 2X09A 1BXNA 1Y5VA 2CIPA 3GR8A 4LVGA 3BV4A 5CSRA 3BSMA 3MJYA 3NVTA 4GYKA 4Y9NA 1JDCA 1HUVA 1QJWA 1E9ZB 2VUYA 3RUBL 3B0VC 2WOQA 5AZ0A 3GNRA 3BMVA 2ZZ6A 3B04A 2BASA 3N04A 2PD9A 1VFLA 1Z6KA 3S1UA 3V5FA 4S3DA 1M7XA 3WEZA 4ZA0A 4JGDA 2W5FA 4KEZA 1I45A 1H0GA 5LSMA 1UR0A 3K13A 2QJJA 4KCTA 3LLDA 3AIWA 1V79A 1BVZA 2IXVA 4UMAA 3NSXA 1UB3A 3LENA 3SRKA 3A5FA 3V1PA 1FA2A 4NJKA 3VDGA 2J8FA 2WBKA 3P93A 1GYMA 3WJXA 3EGJA 4GZEA 4L56A 1VJIA 1SMAA 4DJFA 2GQ8A 2BHYA 3PZOA 4UTFA 1NJJA 1EP2A 1LDCA 5TBOA 1AD1A 1XH1A 1X6UA 1I2PA 1VYRA 2FPVA 1VFSA 3I68A 3WEMA 3D3FA 4KT2A 2F6UA 1ISZA 4GX9A 4TMCA 4ZCWA 1UD2A 1TA3A 3WQ6A 3LY0A 3J7HA 1OD0A 4MYXA 1TA3B 2O0TA 1MFVA 4BKNA 1VB9A 4PMVA 1AH4A 1ZBWA 5G4EA 2J9ZA 1R3QA 3FK4A 1MMFA 4MJ2A 2BWGA 5ABTA 4UB9A 4X0VA 3TYUA 2NX1A 5AY7A 4KBXA 1UPMB 1PIFA 2FHBA 4OIFA 5D04C 3JR2A 1MW0A 4FNSA 3Q4DA 2NWSA 2VGBA 3QY7A 4GA8A 2YL8A 1FWHC 4MB5A 3F4CA 1QPNA 1A0DA 2BFGA 1IXQA 1K4HA 5LIKX 2TAAA 1EX5A 2XPKA 4EE9A 1IV8A 1XG3A 2PZNA 3MW7A 1ZHAA 4NL1A 2QMJA 2V68A 4D72A 2ZBTA 4PRTA 2R1PA 2J79A 6A3HA 3AS0A 2NUWA 1DJYA 1ZRQA 2ISWA 3NAVA 2ZC1A 3QEZA 3LHTA 1GJUA 4CEUC 3SM0A 1NF7A 3LGEA 4WY0F 4C6DA 4L64A 3O16A 1J0HA 4UZUA 2CLLA 1WUFA 4QJ3B 2QDGA 4AZBA 1W32A 4MJ4A 3PPGA 3C0JA 3WBWA 5GVJA 3PB2A 2YXXA 1EC9A 2QZRA 3FA3A 4R7JA 2IKGA 4DYKA 1Z89A 2BVDA 3LEPA 1NOUA 4DBDA 3W6MA 4V1XA 4GQRA 3I3BA 4U31A 1VRDA 4P7OA 4HVXA 2HBVA 4A3QA 3GXTA 4QEHA 4JFTA 5A8OA 2QPSA 1K8ZA 5AC6A 4MWAD 3RIKA 4PE8A 3DBPA 2PI6A 1IWPA 4L1XA 2E09A 1ZGDA 1ZJAA 4DJDC 1CW2A 4CU7A 3W1PA 4RNHA 1MFUA 2HWGA 3UYIA 1S39A 4HHLA 4CCDA 2BGQA 1K9DA 1FWSA 2CLMA 1SR0A 2C8NA 3CIWA 1UQYA 4D6IA 3SUSA 4I9TA 2OCZA 3ZJ6A 7TAAA 1YBQA 4GJ1A 2NLIA 2A7RA 4XX6A 4E38A 1V3LA 1FHVA 3GR7A 3C2OA 4HMCA 3EWUA 2E6YA 3A13A 1QOXA 3W2UA 1X1NA 1W9PA 3N19B 5MHBA 2V5JA 4N0RA 3WD1A 1NFPA 2YBUA 3UR8A 1QPKA 3WUBA 1WKFA 1H1ZA 4A29A 1BPLB 3ITYA 4HSOA 4US5A 4H8NA 1V8EA 4GY0A 1ZBCA 5E1QA 1MO0A 1E40A 1Q65A 2HISA 4I90A 4MUZA 2YIHA 1TMLA 1HVXA 3TXVA 3ZSTA 4Q8TA 4PUJA 1BXBA 3KBWA 2RDXA 4IFRA 5ABFA 3DKJA 2VEPA 3HGSA 4Q8OA 1FUYA 2ZUTA 2IKHA 3TC6A 3BJTA 3H21A 1QI5A 3GUWA 4Q4PA 3AXIA 2C1IA 3NO3A 3UWWA 3WJYA 1S3HA 2HS6A 1LUCB 2VGFA 4JCMA 1BG4A 4RX0A 2NVCA 2NX9A 1FHUA 5B7YA 2J77A 4EWND 3NO5A 4L4PA 4LAMA 2VWSA 4EK7A 1GUVA 1AW5A 1NY1A 3S9ZA 4AZHA 3T0DA 1RD5A 4DNMA 1VZWA 3P7YA 1H7OA 2WSQA 3DFPA 3L65A 1GZ1A 1LLWA 1OG0A 3AWOA 4RXFA 5HNRA 2AKZA 4XB3A 4LYRA 3OBEA 4AIBA 3M0YA 5CZTA 3UWZA 4LY4A 2FMOA 4I6VA 5HMFA 3TJ4A 5TF0A 3QV6A 2CZ5A 5F2LA 3AAMA 3NQGA 1UZDA 4L4LA 4QRNA 3LLFA 4INFA 1KBKA 2C14A 1KFCA 1XL9A 2XSAA 1ZAIA 2DV0A 1RSCA 3RPDA 4H9ZA 4B90A 2B81A 1V77A 5TIMA 2V9DA 3DUGA 4R33A 1E0XA 4QM1A 3GTIA 3CMFA 3QBUA 3SURA 2DUXA 3MKKA 3UU0A 1ELSA 4GUHA 4UFMA 3TAOA 4H8UA 1GQKA 3ANYA 3R89A 6TAAA 7ODCA 3N9RA 2F2HA 4L1GA 4YTUA 1J2BA 2Z25A 3W82A 1SFTA 1JR1A 1U2YA 3GG8A 3INPA 3TW7A 3IK2A 3W3OA 2HBXA 2G3NA 4JKLA 4TTGA 2CKSA 2W63A 1FCBA 4L9ZA 3F5KA 3MSRA 4RPQA 4UQBA 5E9XA 3NL6A 2W3ZA 1YXDA 1M9HA 4HPNA 1ME9A 1C7SA 4E6MA 5CZ0A 3UGRA 3WF0A 4ADTA 2BDQA 4H19A 3OP2A 2OVLA 1KFLA 4AUBA 5EKYA 4UIOA 1ZZMA 2WWCA 3UETA 1VLIA 2TPSA 3W2LA 3MDWA 4GVFA 1OX4A 2INFA 3ATYA 3A4AA 4P2VA 5G1TA 1R3WA 1P0KA 3GTXA 3UWQA 1M41A 5CC3A 4JZ5A 1EPVA 1JCJA 3MCNA 4UQDA 3GUGA 1ZBVA 4G56A 4W88A 1J96A 1BWVA 1R0MA 1OT1A 3WLSA 1MNSA 4GWEA 3W7EA 4AEEA 1BD0A 4FK9A 5HA7A 3BLIA 4QXIA 2Z0IA 3LRKA 4MNJA 3K8LA 3SCUA 3MUAA 3Q65A 2DEPA 4UR7A 3N2CA 4JTRA 2V3GA 4RE4A 3E2QA 2EHHA 2XJ7A 1RUSA 4HPXA 1UH4A 3S2JA 4C91A 1JRBA 1QK0A 4EF8A 2BY2A 3CUHA 2HV5A 2Q8LA 3BW2A 4HN8A 5DFAA 2DQXA 1QOQA 1CCWB 1JXJA 3N3MA 1TJPA 4ZEPA 3QKEA 3QJAA 1P7TB 4YCOA 5CPTA 1BYBA 1P7TA 4J27A 4FNPA 3P5ZA 3EPNA 4KEVA 1KCZA 1NTHA 4MVAA 1Z48A 4J4KA 4M80A 4DI8A 4PTWA 3WLTA 2BMBA 5AC8A 2CZVA 3GW3A 2YLLA 4QLLA 1H41A 2DZTA 4CN6A 3T8QA 3VIIA 2FZDA 3BC9A 4R85A 5D03A 3UJ2A 4FXSA 3RO8A 1UD4A 4LCSA 4U10A 1V6VA 1KTBA 4CD7A 1UZHA 2BBFA 3E6EA 3CHEA 4W93A 1S1PA 2V5LA 4ZQNA 3E74A 3KHDA 1IGWA 2R94A 2GQAA 5LNUA 4R5EA 4R7WA 2P10A 1QDSA 4GQQA 4LUTB 2ZVIA 2F8QA 1C7TA 3VKKA 4ZE5A 4FR1A 1SO6A 1D8CA 3FNDA 4B16A 3S1WA 2JFEX 2YL5A 3A21A 4JQ2A 2EG7A 1OFDA 1U1JA 2TODA 3O3RA 1E6QM 1O5XA 1XLFA 4WKAA 4XO6A 4F0HA 3M47A 1ZALA 4W7UA 3Q94A 4HQVA 4K8EA 4W9TA 4DJED 3L4UA 2PF8A 4OE7A 2GPTA 3BOLA 1EGMA 3WJWA 1T0OA 1WDWA 5EMKA 3WJSA 5A6LA 3BH4A 4DJEC 1VGAA 3L7RA 4JTTA 3PBMA 4JICA 5CZJA 4D1JA 5C7HA 2GK1A 4H2HA 2H9AA 3GNOA 1W1IE 4HMNA 1H7NA 3G1YA 4NY2A 4PN2A 3M43A 5J5RA 3QZEA 1D8WA 1K1DA 1CIUA 1KV8A 6TIMA 3ARVA 4JX4A 5BXRA 1X98A 3VFLA 3EDJA 2E9BA 2PDCA 4MNMA 1JUBA 3W53A 4J9JA 3NQ2A 1JL8A 2PF0A 5L9FA 4KESA 3LPGA 1S2CA 4I9AA 3GE7A 1QW8A 4XKYB 3G0UA 4XZWA 2J88A 2PLKA 5IXEA 2A6NA 4B5WA 3R5EA 2D20A 1OWQA 4I7VA 4ZQCA 4BK9A 1DWHM 2GUYA 3EMCA 3UR5A 1FKXA 2VGGA 2W62A 2DZWA 1PB0A 4D8LA 1KWKA 1X6NA 2WANA 3MO7A 2G50A 4C6PA 2BY1A 2NXHA 2P3ZA 5E0CA 3KDOA 1H1YA 1PZ1A 3NM3A 3NQ7A 2J66A 2X1UA 3EEZA 1ONRA 3WNKA 4HNNA 3BV7A 2VXNA 3FAXA 5B7ZA 3PSVA 4ZFCA 5F1VA 3CGTA 3P2VA 5A6BD 2CHRA 3MBDA 2GJNA 2YA0A 1OSEA 3HN3A 2Z1KA 3H4GA 1QFEA 1JGIA 1JCTA 1V08A 1HN1A 1L8PA 3TCSA 5A8GA 1MW3A 3UWVA 2RFGA 3BPWA 2REQA 4GYJA 4DF1A 1WNOA 1N7KA 2Y6ZA 1JCNA 2Z6IA 4PUNA 4QS6A 3W2NA 2A5HA 2BOGX 1YMYA 2BXZA 3W87A 5LIWX 4QGCA 3OVRA 4A22A 4GIYA 2YFNA 2UV8G 3T05A 4ERAA 3QR0A 4PUKA 2H3DA 2V38A 1W1YA 4A2SA 1EDGA 2OODA 2BY0A 2BVTA 3AALA 1XSJA 1TWZA 1I2QA 4XZMX 3IJ8A 3FJ6A 3GW0A 5C9WA 4QX4A 3L9CA 3UFYA 5C9ZA 1YDYA 3WDRA 4A8RA 4O11A 3VC6A 2PDFA 1F6PA 1GGOA 4JIQA 3RLGA 1UKOA 3KOFA 1XLHA 1W2PA 5G2IA 3W2JA 1ZAHA 2ONEA 4GABA 3WBYA 1TR1A 4GUJA 2AGTA 1PHQA 2NV1A 2VEKA 4PYSA 2CZDA 4HK5A 2WMHA 1Y0EA 2EKCA 1WB0A 1VENA 1GHRA 5E9AA 3PUDA 4NI8A 5DANA 2W91A 4U2ZA 3CUFA 5FF7A 3T0BA 2FH8A 4QR6A 4MF4A 3TTEA 1X7FA 3H54A 2QKFA 3N1AA 1C93A 1UWRA 4YN5A 3EB4A 1RVKA 1MXDA 4KF1A 5KTLA 4MWAB 4GD0A 4HMEA 3POHA 4QE5A 4UFKA 5JMUA 2DT3A 3W9ZA 3T0TA 3CH0A 2WVVB 2PGRA 3IEBA 4XSMA 3BJFA 3L5AA 5I24A 3OZOA 4UWMA 3MSGA 1LLOA 3ISIX 5IDIA 3A9IA 3LM3A 3TIMA 3R13A 1OIFA 2ALDA 4Z2LA 1UWAA 1FDJA 1JCLA 4DQWA 5I3IA 3WELA 2UY4A 3P81A 3OODA 4OBRA 2VZUA 1PTDA 3CV7A 2DT1A 2EKGA 3B8WA 3UJSA 3DGRA 4AY7A 5KZEA 5EMJA 3DHPA 3GR4A 1XD0A 4HHPA 5DCDA 5JBDA 4NZ3A 4JN7A 4BHYA 1ITXA 2DVUA 2VZTA 5IDZA 3MQTA 3G1HA 1V93A 1DXFA 1UWTA 4ZMGA 5A69A 3O0FA 2PURA 5BMXA 4JYFA 5E70A 3OGSA 3GSMA 3VNMA 4ZFMA 4GO8A 4PL1A 2D2HA 4QCEA 4ES4A 4TV6A 3B97A 5JVLA 4Y9MA 2PP0A 4PSPA 2FB2A 5K9XA 3EKZA 3UF9A 2BLEA 1A3HA 4K7YA 4W5UA 1ZS2A 1EC7A 4L4MA 3T4WA 3ARSA 4OKDA 1S2VA 3OZPA 3VKCA 4MDPA 2WVTA 1Q63A 1YPFA 1OM0A 3UR2A 1WX0A 3F4NA 1BWLA 3TJIA 3R2GA 2VR4A 1B5TA 5I06A 5BOOA 3KLKA 4BR1A 3WH5A 3NWRA 5HPOA 2FB3A 3AWNA 4GUFA 4Y2WA 1GNXA 1WZKA 4FOJA 1XIJA 4FZIA 2VFDA 3MUZ1 4W84A 3CIXA 4DWSB 4H7VA 4M0XA 1C8XA 2W67A 1WOAA 4G7EB 2FGZA 1F73A 1E5NA 3CZEA 4M7TA 3WQGA 1F7BA 4GYPC 1NOWA 3G1AA 4A4AA 5ABFB 3N6QA 3QV7A 1XPGA 4FLSA 3ONBA 1KXTA 1EZ2A 1VH7A 5BMWA 1CYGA 4NXSA 5XINA 2OLHA 1F76A 2DFAA 3EX3A 2J24A 1RCQA 4Q4MA 1XLGA 1E9LA 4WOQA 5FJRA 3ALGA 1XJBA 5CCZA 3W83A 3SCVA 4EF9A 2VZVA 3EA1A 3F4WA 3MANA 4AZIA 4L5ZA 4LC6A 3EX6A 3C52A 5EMMA 3L2MA 5D32A 2QF7A 1BXCA 1ZTVA 3C5QA 1BRLA 1XX1A 3NQAA 1WKYA 5HR6A 3VGBA 3UW6A 3OVGA 4H01A 4QQUA 1L2UA 2J6XA 4QAWA 3TR9A 5EY5A 3N6JA 4DY1A 2KX9A 1X6LA 2PDNA 2PGWA 4QTGA 3U4AA 3PUGA 3AMCA 2VWTA 1JRCA 4IXXA 4KPLA 2WB5A 5CZKA 3VX0A 1K8XA 4W89A 3ABOA 2JQXA 4KS0A 4Q8VA 3MI2A 4P8XA 3PR2A 1GOWA 4LV9A 1I4NA 3BICA 1F07A 2GUUA 4DZAA 1PV8A 4NQ1A 5L6UA 1QTWA 2TRSA 3A3XA 2Y8KA 4M7SA 1HGWA 1M03A 3FDKA 1WO2A 5DY2A 2ZICA 2OO0A 3LCHA 4PMZA 4AF0A 2WC4A 1T6MA 3HG3A 5I6SA 3TTQA 2AGKA 1H3GA 2WZEA 4BI7A 4ERGA 4Z0JA 2FDMA 4B5SA 4E8DA 4NT0A 2GSJA 4MPQA 3LN3A 3TROA 4KCVA 2MUCA 1UG6A 2I5QA 3RILA 4AX7A 3R0DA 3KHJA 1TIWA 3AHVA 2C71A 3GZ3A 4WJXA 2QJHA 1AK5A 1FVPA 5KZ6A 3PZGA 3AI0A 2QGYA 1FDZA 3P3BA 3MZNA 3AHXA 2DZAA 1XCXA 3LPPA 5LKYA 5HWMA 3UR7A 4KFPA 2VEMA 4MADA 3WQWA 3V18A 2DW7A 3NJ3A 2JIEA 3LMZA 4ACZA 5FCZA 2VQUA 3NGJA 4O10A 2D23A 1KGUA 3S5SA 3O15A 1E71M 3MSDA 4CU6A 5FEXA 1E1EA 1UWQA 3S4TA 2WMIA 6XIAA 4LB3A 2BG5A 2VUNA 3LX9A 3W7MA 4AD0A 1RJRA 1LZOA 4AWTA 3WQ8A 2GVYA 1M6JA 1W3TA 1XIFA 1QNOA 3V1HA 2EJAA 4AVOA 1OGSA 3NPVA 3OBAA 2HQAA 1IT8A 1AQHA 1SW7A 4G9PA 2CLFA 1GOIA 3VPLA 1R85A 1VRXA 1IIGA 1EQPA 3UA3A 4AHPA 4FP1A 1ALDA 1KFJA 3GHRA 4MWAE 2VO5A 5JIPA 2WC7A 4TV5A 3LXBA 2Z2BA 2ZXAA 3CHDA 2QUUA 2DUAA 2ZE3A 2W92A 3HO8A 4HNOA 4TU1A 2Z2AA 1E70M 2FHFA 5J5DA 3BG9A 3H2OA 1TWWA 2IPGA 4CKQA 4Q6XA 3FXGA 2QEZA 1V6YA 3MYOA 3BANA 1AJZA 5CJ5A 2PLCA 2CXEA 4KCUA 2V0TA 5AHEA 4I7WA 4CQDA 1TPDA 3THUA 3RMEA 2HEJA 3YPIA 1FWWA 3E96A 1RK5A 1XKYA 3WF1A 1GK8A 2FMNA 2VDHA 1VIWA 4F2TA 2BY3A 4EX4A 1HJXA 1NDZA 3ZYZA 4MZYA 1F4AA 3AROA 1DE6A 1XYFA 4MJMA 3VGGA 2QF8A 2ISVA 1A0EA 3S83A 2VR2A 1PO9A 3SIZA 3AYTA 2P50A 4O19A 4UQAA 2VHLA 2YB4A 4NNAA 5H2ZA 2AL1A 3RK8A 3O6YX 2Q3OA 1Q7ZA 5KZMA 4RCXA 3EPOA 2CBVA 4GIEA 1TCDA 3G24A 4OOZA 4YLWA 3UXDA 4IJCA 1PVNA 2E9MA 2NWRA 5C9XA 1SW3A 1CXEA 2YFOA 1FX6A 3QHOA 4JNMA 1T5AA 4EPDC 4IP4A 2JALA 1D7KA 3W7GA 1JVNA 3O07A 3GQYA 1FWIC 3DYOA 1CENA 2PE4A 4O54A 5A2AA 4ZZ9A 2NXIA 4PTXA 4A3YA 2F84A 1VCFA 1LLZA 1B3XA 4ECLA 1PHWA 1PWMA 1KQYA 1DQWA 1XRFA 3PZMA 2Q8XA 1SMDA 3FN9A 1XI3A 3AICA 3W23A 5F2MA 3HFYA 2Y62A 1Y8BA 3GYEA 4CN4A 2J7DA 1XGEA 2I16A 3P62A 2OLSA 3GC4A 4XBSA 4X0NA 4AIUA 2RGLA 4N9BA 1KGWA 4H6QA 1K02A 1CPUA 4YIWA 2ABBA 3NOEA 3QLDA 2JIWA 3KVMA 5GJNA 4JFSA 2NT0A 3QF0A 4D2JA 4L6DA 2YDRA 1J10A 4H83A 3OEXA 2XH0A 2VTFA 4UNKA 3UG3A 3RO6A 4GKTA 1G9HA 2GQ9A 3P84A 3RJYA 2C15A 3WKZA 5HQMA 3LXCA 4RZ5A 3BAYA 4CD6A 4O8AA 2AAMA 1M53A 3VIGA 1CLXA 4F0KA 1H51A 1YNYA 2BGSA 3NFUA 1JPHA 1DPMA 4WDTA 4LS0A 4N4PA 4C6LA 1XWYA 1JPIA 4HJFA 4NAFB 2NX3A 3SCOA 3BK0A 1T41A 2ZX8A 1XLMA 2WW5A 3VNKA 3ZR5A 4DXKA 5I79A 1PYMA 2R9RA 3WLMA 2L5HA 3ONCA 4JIRA 4ICMA 3W24A 5HJLA 1HNYA 5FJUA 5IHSA 3U4FA 1TJ2A 3IRDA 1RBAA 2ABAA 3O6AA 5J04A 4RDVA 3GDBA 3OO2A 3MI6A 3C6CA 3ITCA 1QW9A 3WY1A 2QV5A 1OK4A 5ENLA 5FF0A 2YCLB 1LROA 3DFTA 5AC7A 1LWHA 1GOXA 3E5PA 1KW1A 1FWCC 2QPXA 2DZVA 4NP7A 1G5AA 3W00A 4UTLA 3TZFA 3B8DA 5AYYA 1HZYA 4Z2JA 3NVDA 1HKIA 4MLJA 3VE7A 3P0XA 1TG7A 3A3HA 2OR2A 4D6HA 3M7WA 5B80A 4PMOA 3WMLA 4B4FA 5HMDA 1EIBA 1YRRA 2OPJA 1AD4A 1OJXA 1Q6OA 3MWCA 4XD6A 3A24A 1XLBA 1UP0A 4E2DA 3M07A 4NVTA 2YBVA 3UJEA 1FOBA 5HWJA 4JIHA 2OELA 3BW4A 2A3BA 4LSBA 1E0VA 4URIA 1RQBA 3OOQA 1RALA 1XIMA 3O8AA 3WDHA 1W3HA 1VYPX 1UJPA 4GYPA 2IKJA 3C56A 5F2IA 3N73A 3B0XA 4GY1A 2I14A 1DE5A 1PIGA 1JCXA 1ZP4A 1GZJA 4WGXA 1TMHA 2D3NA 5H1WA 4PMQA 4IUGA 1G4EA 3RF9A 1PJ9A 3H8AA 1A3XA 1WAWA 1JUEA 4KWUA 1WDRA 1Q45A 2BOEX 4J40A 3CWNA 4O50A 1RK6A 1QT1A 1C90A 3WLRA 3AZRA 3CZ8A 4PMXA 4Q8WA 4CQAA 4O1CA 1ZUAX 3ZSSA 1FH7A 2Q71A 4KRZA 1GOMA 1TKKA 1F3TA 3QR1A 1F3WA 5HMSA 3R43A 2PCQA 4NASA 3UG8A 3VDBA 3NQFA 3KS6A 4IMDA 2GGIA 3TLLA 4PA8A 2J78A 3T0AA 3M1ZA 3BE7A 1EJVC 5LNSA 2VVSA 2E40A 1IHIA 3D0CA 2G3FA 1C9WA 4ZOCA 4Z42C 3HURA 5CBJA 3IIOA 5DT5A 3S1GA 3T07A 2PC8A 1S5TA 5I23A 2VOMA 3TN4A 2DUZA 1J6OA 4LF2A 1KB3A 4PTDA 1R87A 3NZRA 3A47A 3C2VA 1X1OA 2EO7A 3ZS4A 4IPNB 4PTNA 1J5TA 1EA0A 2RH9A 2VC6A 1CLVA 2XN0A 1OHLA 3SIMA 2WQPA 3N2TA 4CQCA 1RP9A 5FJIA 4IJRA 3GHTA 4JXCA 1PZ3A 1LRQA 2PD5A 1MVYA 3CHVA 5DCBA 4US6A 2IUZA 1M7JA 4LCRA 2D69A 4JN8A 3VGDA 4DVOA 3GK0A 4EIVA 2XSBA 1JZ4A 1VR6A 4QE4A 2CHOA 1FWFC 4R27A 3DIPA 3E0LA 4Q4OA 2WZHA 2YZ5A 3F5LA 1RBOB 4I9JA 4M24A 3GDTA 1GONA 2ZRYA 3FYOA 9XIMA 3BO9A 1Q8JA 3LCGA 1UMLA 2J7FA 2ZUNA 1OD8A 4AB4A 4ZQPA 2FGLA 4UNIA 1NDYA 7REQA 2Y85A 3FSUA 3KEHA 5CPQA 3O6CA 1JQXA 4REQA 4AWEA 1OZMA 4FB7A 3CZKA 3O9NA 5HPCA 3CJPA 4WDWA 3GXNA 4G2DA 2PWUA 3D5HA 4CNTA 1J5SA 1ITUA 1UUMA 2Y8VA 1QI4A 5I7GA 3AS3A 3B3DA 2G4JA 2Y88A 3LGDA 2BV9A 1OGBA 5KETA 4QS5A 1POJA 4F9DA 1X7IA 5BWAA 2QV4A 1R9ZA 1KFEA 2FJKA 3F1QA 3GNXA 3OG3A 4Y7EA 3T08A 3S8HA 3H2NA 4DRSA 1JZ2A 1TQJA 4XUYA 3W7LA 2WPGA 3DBNA 3VILA 3HGRA 4ACZB 3S46A 3AJXA 1QPOA 5EGRA 1ENUA 4Q7NA 2AMXA 3OGVA 1JUKA 5XIMA 2GSHA 2WNQA 3PZVA 1VPQA 1WDDA 4TVUA 1J0YA 1UH3A 1KM1A 4RXGA 2NV9A 5A6KA 4JHOA 3G3MA 1KKRA 3VXGA 3I4KA 2XGIA 1Q2RA 2YW3A 1A80A 1FWDC 2E3ZA 3CAWA 2ZA1A 3GBEA 1R9YA 1TIMA 4GZ7A 1MQPA 1DVJA 5I5RA 3MKVA 4IMFA 4UOQA 1DJIA 1Y65A 1YE6A 4GUGA 4FNQA 3SECA 3CAQA 1V0KA 3TTYA 3WSUA 4JL1A 4Q8QA 1P0NA 3A4XA 1QBAA 4JIPA 1GVOA 1J11A 3NURA 3FJLA 1M5WA 3WLHA 2INZA 3CUIA 5AB3A 1VHNA 1MRQA 2X8RA 4XV0A 1Q6DA 2W4XA 4J3WA 4YHEA 1BHGA 2FTWA 3PZNA 1BQCA 2BZNA 3N6HA 2ZRWA 3TVAA 2OZTA 5AYBA 3RJXA 1KM3A 4XBKA 4DJEA 1XQLA 3FVDA 3L2IA 3VNJA 1EUAA 3LTSA 3PP7A 4ROQA 2ZZ7A 3UYCA 4F0LA 4E3TA 4PRRA 1NVMA 3EB2A 4O13A 1WXYA 2QAFA 2CLHA 2EF9A 3LOTA 1ZP3A 2YCIX 3MCOA 4NHVA 4OJYA 3AUJA 4R88A 3CPGA 5E6ZA 1O5QA 3CU2A 4CLMA 2ACRA 1FWAC 3JVAA 1DTNA 2E6AA 1E56A 2ZUMA 3HV8A 3REQA 4GJIA 4GXMA 4O53A 2BSLA 2P88A 1HKVA 1WDQA 2Z7KA 3B05A 3PVFA 3ICJA 4EXQA 1S3TC 4HK6A 2V5KA 5T26A 1A5NC 1JFXA 2PDLA 3NZGA 4WJEA 2VYOA 3FV9A 1P43A 3HIJA 3BZGA 3M5ZA 1BTMA 1BEUA 3WLIA 1JNEA 2DT0A 1AODA 3L67A 1EFZA 2RHGA 3CUZA 3XINA 3BL3A 4TMBA 3C0LA 3E2SA 4LB4A 1SO4A 3MHGA 3AYSA 2DVXA 4EWJA 1NFBA 1E6NA 1JYXA 4PMDA 4YL2A 3T8LA 2WVSA 3MMDA 3UG4A 2C91A 2OYLA 1XGZA 1QPQA 1TMQA 3A5VA 3O2LA 4AD1A 2ZZ1A 1A49A 2Z6JA 3QPYA 2CPUA 2WKGA 2EXOA 4TTUA 3RLHA 3OPSA 5GJPA 2WMJA 3UT0A 5H8PA 3QTPA 4ZO9A 2V30A 1DWIM 4PULA 5GNXA 1OFQA 3UPWA 2WHLA 1R46A 3C3UA 5I3HA 3L4YA 1Z42A 2IKIA 4PUEA 2Y7FA 1L6GA 3RU6A 1FDYA 3GVVA 4JFWA 3DU0A 5AYXA 1CLKA 5E09A 2XFRA 3S2CA 2WKJA 3PFRA 3W01A 2E5DA 2YJQA 4UQEA 4AAJA 4IMGA 3IJDA 1O12A 2Y24A 1Q4WA 2X40A 1O94A 2D0GA 1RVGA 4ZBCA 1JEZA 3WJZA 3HOJA 3KBJA 1ZLPA 3V3WA 4Q4QA 1KLZA 1I2OA 4FPSA 2NQHA 5EMUA 2A7PA 3LGGA 4IGNA 3AC0A 4OOUA 3KW3A 4Y90A 1XIBA 2F7FA 1V4YA 4AD4A 2CLKA 1XSKA 3DG6A 3V16A 5IOBA 1PKYA 4DBEA 4FOUA 4BA0A 4L1WA 3FHAA 5I3JA 3TN6A 3IIPA 4LXFA 1NDWA 1O5RA 1X8CA 1H60A 2HZGA 4LWWA 1QI0A 4Q32A 1D9EA 4O52A 4FX6M 2ZX5A 1U83A 2E1DA 1J79A 1CGXA 2ZXBA 2VEFA 2OSYA 5CLWA 1UWSA 3W71A 1HF6A 1HL9A 1V7AA 4I8DA 4ADSA 3C0QA 3MJMA 1EO5A 1N8WA 2MANA 2DSKA 4NKCA 4N7QA 4LBSA 4BQ2A 1FH9A 4HNUA 4Y96A 3TC3A 5F4XA 4E4PA 2A3EA 4GXPA 4Z2HA 2PS2A 1L6FA 2GOUA 1TPEA 2C1HA 3DXIA 5KEZA 3LHWA 1OFPA 2QCCA 3KP0A 1CECA 4RZ6A 2J62A 1FRBA 3THCA 4LPCA 1O66A 2X2GA 1KRCC 1RBLA 4IQDA 4HKPA 3PAJA 3BAXA 4FI4A 1E4LA 1YTDA 1QW7A 5DRIA 1J0KA 1UP2A 1ZL1A 3FJNA 3S6TA 3UVAA 2B7PA 3K4WA 1OFOA 4NZ4A 1E73M 1E4IA 1EGVA 3FYYA 1EA9C 4HCLA 4U3CA 3UWEA 1L8NA 2XSXA 4V1YA 1TWDA 4O0ZA 4H9UA 4MYAA 2CYGA 2B7NA 4TVDA 1JZ7A 3VIKA 4WXYA 2X30A 1OB0A 3W7IA 2E8YA 3ZJKA 4LW7A 4F0SA 1HG3A 5M1TA 1GW9A 1RV8A 3K4AA 2FLIA 1EJRC 2G8ZA 4N4QA 3RG6A 4ZTYA 3QPZA 2XDFA 3U7BA 3GXDA 4JX6A 2YW4A 3ZZ1A 4JY9A 1P1MA 4IX0A 5M2FX 1KRAC 2ATMA 3PWIA 4NAFA 1CXFA 3ABQA 2OKTA 2RKXA 2QGHA 4M6UA 3KOWA 1XYBA 1QO2A 4DUOA 2ZA3A 1OIMA 4JIEA 3W7KA 4Q8UA 2XVLA 1TV3A 1ONXA 5C55A 3LU2A 3N2MA 2P1FA 4HNCA 2C13A 3OJGA 3DFHA 2B4GA 4E4FA 4JR5A 1L6WA 2HE8A 3NZPA 4RDYA 3IJLA 5K3VA 1UQZA 3TN5A 1E9IA 4GI4A 3E02A 1LBFA 4JQ4A 3UJRA 1GOKA 3WNPA 2WAGA 4R34A 2QJIA 1Z44A 4DELA 2PRHA 4JN6A 1QNSA 1X97A 2AQOA 4K2SA 1A5UA 2NLYA 3HQ1A 4YYCA 3P60A 3BW3A 4Q4KA 3HPAA 4Y9AA 3G1SA 4W8LA 3C0SA 3HG5A 3ARUA 3STEA 4TX8A 3HQNA 3LQGA 3RCMA 3W7CA 7TIMA 3K30A 4NUWA 2YZRA 1FFQA 4HA3A 4GNVA 3UEQA 1W5MA 4NILA 2GOKA 4FALA 3B9AA 3NXLA 1MEWA 3UWUA 3ITGA 1CB2A 1MNZA 3G0SA 4K38A 4LFYA 1WAUA 4JQ3A 1AUSL 1CBGA 5BXSA 1A5BA 1FP8A 1CGVA 3S6OA 1YEYA 2GVEA 1OCBA 3DFQA 1B90A 3ABZA 4O12A 1TO3A 3GG1A 3SQLA 4H6EA 3EOUA 4FO4A 4HCHA 3PAOA 5HUPA 3G1FA 5D9MA 1F61A 5CG7A 3VOJA 4IP7A 4B5VA 1EYWA 3MP4A 3W38A 1KD0A 1SZGA 6ALDA 3NQVA 2XGZA 3A6OA 1W2VA 5DY3A 3TW6A 4XUGA 2GLKA 1POKA 2Q02A 3TQKA 5C71A 2Z1VA 3S3GA 4XAYA 2UWFA 4P7NA 3W7NA 3BCJA 3HG4A 3IIZA 2ZZ5A 1JYNA 4CQ9A 3OVPA 4FSAA 3E0VA 4S2BA 3QC3A 1UW9A 4JTHA 4E0CA 1LM1A 3PPFA 3SN4A 4M8UA 5FKYA 1BGGA 1V3KA 3CMGA 3V7PA 2WV8A 4Y8FA 1V0NA 3NNTA 5CSUA 1BYCA 1MEIA 1ESWA 4MMWA 1E6ZA 4ZO6A 3QW3A 4ROPA 4UOZA 4C6FA 1IXOA 4GGBA 4C7GA 3LHVA 3S1VA 1EJUC 3W1NA 5D38A 2V81A 4PB4A 1JF5A 2ATSA 3PHAA 4H1ZA 1TZZA 4MY1A 4GVGA 2QUVA 4JTGA 4C60A 4DF2A 4JL2A 1KCKA 4ZOEA 3E1F1 2W66A 4S3GA 1CGUA 5DCEA 4OTKA 4DN1A 1OC5A 5C6MA 1OG6A 4K68A 5AHIA 1G7UA 4S3EA 5HQEA 3R12A 5ECUA 1I9CB 3F5JA 1UYQA 2FZ8A 4AD5A 4B5UA 3W27A 5I3DA 1IT0A 3SY5A 3KE0A 5D37A 3KRZA 1W8GA 2A79A 1ZJIA 2J74A 1DL3A 2CXGA 3V36A 1QAPA 3S6DA 1A0CA 2QDHA 3N4EA 3APYA 3LTPA 5BRBA 1DWAM 3V5OA 3ZOAA 2NW0A 4B4HA 3TP4A 1FQ0A 3E5BA 5DMNA 1VFMA 2VCAA 1L6YA 2BOFX 1J93A 4Z2KA 4PUMA 2GJXB 3GAYA 3PZUA 5AFDA 3GTFA 3DEQA 3VZYA 1ISYA 3SJ3A 4QP0A 4W7WA 3PPCA 3VINA 2PUZA 4C6MA 4ML4A 4LT9A 3ZR4A 4P5UA 1A5AA 3GB6A 2WHKA 3ZVHA 3MT1A 3TYAA 4QDPA 4JTFA 3AO0A 2ASHA 3WQDA 5AC4A 4MB3A 5I03A 2QCNA 4C7FA 3G3DA 1KR0A 1B0IA 1O6IA 4JOMA 4PEEA 2Q09A 4DHGA 1NWTA 3I6RA 4LAZA 3ZIZA 1DJWA 4DM1A 1UC5A 3T2QA 4IMAA 1MZHA 3PFMA 4F0MA 1XCFA 2NUXA 3HG2A 2VR5A 2ICSA 2V8ZA 3HBLA 1OQFA 4CNNA 1OFBA 3T9PA 4BZYA 4DM2A 3TLQA 3NDZA 4G8TA 1JDEA 3N11A 4MM1A 4S2CA 3IV3A 3UZYA 3W6YA 4O57A 5HOSA 4DAFA 2RDTA 3JS3A 2VFFA 4PGLA 1BF6A 2PTXA 4GYFA 3RGTA 4GBDA 2VX5A 3M44A 4ORMA 1OZQA 3CUXA 1Z9AA 2GUBA 1AJ0A 3SRFA 4C6KA 1GVFA 3DC8A 1NU5A 1BRLB 4XSLA 2PDHA 4WJ8A 1UZ1A 4C6NA 3VTRA 3WLNA 4NXKA 2V3DA 4NJGA 2RJHA 3ATZA 1RA0A 3PSWA 4WLCA 2E7FA 2FFCA 4UTKA 3QGVA 2GZXA 5EFDA 4GHRA 1JCMP 2XGBA 3W72A 5JXQA 3E38A 1XRTA 3ARYA 5HWNA 4AG0A 3A4JA 3KTSA 1V6UA 3P14A 3DC0A 1B54A 5FEPA 2XIBA 3WBEA 2C1GA 2CWXA 4PBGA 1N55A 3HV9A 4X61A 2XWEA 2FQIA 5EFFA 2I5GA 1L2QA 3WLLA 3P74A 3NYZA 4PR4A 4DJFD 1ZPTA 3URBA 4XZBA 3I6EA 2NVAA 2FPTA 2X7VA 3UXAA 2WSRA 3EMZA 2PRLA 4LCQA 3U3HA 4OV4A 3QMSA 3FY1A 4OECA 2OZ8A 1PL9A 1T8QA 5CGMA 1UC4A 2OMAA 4NX0A 4Z1CA 2CLOA 1C8YA 5DEZA 3SN0A 5A8QA 4LALA 3LHYA 1QK2A 4XAZA 3TJXA 1QUMA 3SFKA 1G1YA 4PMJA 3B03A 3DHFA 5I09A 3VU2A 1P6WA 2YLAA 3CUGA 3NUKA 2OOGA 2R14A 3VO0A 1HL8A 4JAWA 4IJBA 3QMTA 3EDEA 1DJZA 3PUOA 3D6NA 1F3EA 4HT3A 3VAVA 2HDJA 3OG2A 2ZTKA 3G18A 3L66A 5DT7A 2CESA 3R8RA 4A6GA 3UZWA 2XZ7A 4P7QA 4JHZA 1VYSX 4UTUA 4UTMA 1Q7QA 3AIBA 3KUMA 3K1DA 4MY8A 3E0IA 3LI0A 2OGYA 1VPXA 4QHRA 4FS9A 4HMDA 1DQXA 2HVOA 4N9EA 2PWHA 2H9AB 5DN1A 1LBLA 1H1NA 5HINA 4QDMA 3MMWA 1P0BA 1UOKA 2DSZA 3W7PA 2B7QA 5CGTA 2H8ZA 1VFTA 5A8PA 1HKJA 2ZYFA 5KINA 3HPSA 3NO1A 1EWEA 2EPNA 4LS1A 1EF2A 1LL7A 3DESA 4QIUA 1A5SA 1NWUA 2V5CA 3QGAC 1K7XA 3W7QA 2OQLA 3VC5A 5FD0A 1GW1A 4PRWA 2WJFA 3BSHA 4EAMA 5CBBA 3TC7A 5DBTA 3NIYA 4KIRA 3W7RA 3QV9A 3TTSA 1O7AA 3VA8A 1CGTA 3T81A 4PCPA 4AW7A 4HNTA 1HP4A 4A21A 4US5D 5I0DA 4J7RA 1JZ3A 4KETA 4MGGA 3KOXA 5HUOA 1H61A 4K1WA 2Y63A 4GG9A 3Q67A 3VKBA 2Z1SA 4O4WA 4QJ1A 5A6SA 1OF6A 3WQ4A 1A5KC 4M3PA 5HMEA 1W1B1 5LGXA 3JRKA 3EWWA 1H2JA 1SU5A 1EJ7L 1KXQA 3M0IA 4JTUA 1NSJA 2E6FA 2O9OA 3DHUA 1OYCA 1BKSA 3B8SA 3QFWA 3GHUA 1P48A 8XIAA 4DBWA 1R3SA 4WSHA 4KGLA 1SFLA 4LF1A 2R8WA 2YCJA 3VD9A 1TV2A 3AOFA 3C8FA 3BLFA 4QFUA 3LG3A 1K9FA 3SZ8A 2VC9A 3AIVA 4TR9A 4DPPA 5FAJA 4KMQA 4C1NA 1UIPA 2PEVA 1Q6FA 3QGKC 5ABEA 1W31A 1EOMA 1ZQ5A 3DI0A 1V02A 3VOGA 2O4QA 4OVXA 3LQLA 3NOYA 2HS8A 2D2JA 1S2TA 1A4LA 1FWEC 3LBOA 1NIUA 1KM4A 2V2CA 4UQCA 1EF3A 2XH2A 3CH9A 3WDPP 3UZ5A 4WX2A 5JUVA 1W5OA 2G3MA 3ERPA 4NZ1A 4QNWA 3M6YA 4JD4A 3SO7A 3CO4A 2YDAA 1GJWA 2XVKA 2PDWA 3RX2A 1W1A1 4TX9A 2OEJA 2YXOA 2EGZA 3TNBA 1XRVA 4BWLA 3E2VA 1TX2A 2I9UA 2A3CA 3CZLA 2ACUA 4WVXA 4ZSTA 2E5BA 3GTHA 4S3KA 1TRIA 3BGGA 4RDWA 4DX3A 3L5MA 1Q7MA 3SJNA 3VABA 5U7SA 3PTQA 3NQ6A 1QHPA 4M6PA 2WCGA 3OYXA 2EQDA 4ML9A 4DNHA 5LIYX 1LQ2A 2PTDA 3MA8A 4GK8A 3BLEA 5K7JA 5HATA 1QR7A 2WZMA 4JX5A 1UCWA 3H7UA 1H5VA 2V5BA 2XFFA 2GSEA 3NR0A 3PBYA 3W76A 5G2HA 4XAGA 4YTSA 1SJCA 5G2WA 4QG6A 1U5HA 4GH3A 2CWNA 5DQPA 2PTWA 4JTAA 2VI0A 1PSCA 2ZRUA 2GVGA 3F03K 3M5VA 4BS0A 3CTTA 3R94A 2HNEA 3R4IA 4AWSA 5FSEC 1U30A 2B0MA 3WL1A 1LQ0A 1UD3A 4FX8A 3MP3A 2PWEA 1TTQA 2ZKMX 5DRCA 2QS8A 4J3VA 4Z2GA 3KVLA 4W87A 1MDLA 2C0HA 3GXPA 1LRTA 2J8TA 3FGCB 4GINA 3MUXA 4IISA 2XU2A 3BDKA 4AEFA 3E12A 1E72M 3TYBA 3PJXA 5DF0A 1SW0A 1GOOA 1IXNA 1X39A 3MKCA 3N4FA 2UY2A 4DO5A 3S5OA 1DP0A 3VIMA 2CBJA 3CS2A 2AAAA 4DEFA 1RAKA 1XIGA 1JG9A 1XS2A 2WHMA 3NGFA 3T2OA 2F2KA 1H0IA 2D24A 1D3HA 5FL0A 4QSFA 1MRAA 1MEHA 2ZQ0A 3MMTA 4CNPA 4GFSA 5CC5A 3MTWA 2HVNA 4D6GA 3HZ3A 4PC8A 4WUIA 4KW2A 4C6BA 4ZENA 1YNPA 1DIEA 4RJEA 3UJFA 3IGHX 4HD5A 3AISA 5CBIA 1VKFA 1RLCL 3SBFA 3TE9A 4O1EA 4GLEA 2PCEA 5HR7A 4WRHA 3SUVA 3R0KA 1OT2A 5EBUA 1PKMA 4Q8MA 3SCTA 4W5ZA 1WXZA 3EZ4A 1V0MA 1O95A