2J9XA

Tryptophan synthase in complex with gp, alpha-d,l-glycerol-phosphate, cs, ph6.5 - alpha aminoacrylate form - (gp)e(a-a)
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
266
structure length
263
Chain Sequence
b'ERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLSRSGVTGAENRGLHHLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKIIEKNLASPKQMLAELRSFVSAMKAASR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPTOPHAN SYNTHASE ALPHA CHAIN
publication title Allosteric Regulation of Substrate Channeling in Tryptophan Synthase: Modulation of the L-Serine Reaction in Stage I of the Beta-Reaction by Alpha-Site Ligands.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Lyase
total genus 102
structure length 263
sequence length 266
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 2006-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2j9xA00
3MP4A 3MW7A 1R2RA 1NAL1 3LHUA 4AF0A 2VKZG 4HNUA 3FIGA 4ZQRA 1YXYA 3WJXA 1SO6A 1YTEA 1FCQA 3PBWA 2YCEA 4AAJA 3W1UA 1B4KA 3CWNA 1WBHA 4O15A 1DV7A 3E96A 5F2GA 3PF3A 1LYXA 3GR7A 2KZHA 2YYUA 4N4PA 3U2OA 1NVMA 3LM7A 3UWVA 4FF7A 3C8FA 1TPEA 2DZXA 4W9TA 3M7WA 3O63A 1EPXA 4EOUA 3C2RA 1W1ZA 1L6WA 2A0NA 3ZWSA 1FCBA 5DCDA 2ZTJA 2NXHA 2A7PA 2A5HA 4KFNA 3N9SA 1W3TA 4CQ9A 3N14A 2R94A 5HQEA 5AHFA 1ME8A 3MMTA 2Y70A 1CW2A 2C16A 4O12A 5LNSA 3I6RA 3HG3A 1GVSA 3LCWA 3M0ZA 1KM3A 1H7PA 1YYAA 2ALDA 2RH9A 1VGAA 1V7YA 3HG4A 2Y89A 4WUIA 5BW6A 3DAQA 3IIPA 2ZBTA 1R30A 2V0TA 4D2JA 3VKJA 3W7NA 1TJPA 1LOQA 1SPQA 1U83A 2FPYA 4UTTA 4Z1DA 1TRIA 1MO0A 4O4VA 2R8WA 2P10A 1O60A 1J2WA 1QWGA 4OV9A 2HTMA 2ZRWA 1ZAJA 1S5VA 2Y85A 1VYRA 1D3HA 3NGJA 1H5YA 3NG3A 4UMBA 1W5PA 3W1AA 1I2OA 5K4ZA 3LB0A 4MLJA 2BWGA 3TDFA 2DZTA 2ZRYA 1V5XA 3IIXA 4N9EA 1BTMA 4G1KA 3STGA 3G1DA 3PBYA 3GDTA 4UMCA 4DF0A 3E12A 2WNZA 1OFAA 3W2JA 3WK3A 3EXSA 4XQ6A 4O53A 3T7VA 1YXCA 2J24A 2Y6ZA 1QOPA 3CWOX 3O05A 1G4TA 3NQMA 4NNBA 1KV8A 3MBDA 1FCVA 4UUIA 4NJHA 1DVJA 1TMHA 5F4WA 4M6PA 3NR0A 1N8FA 1OF6A 1WV2A 1UUOA 1RPXA 5G2WA 4E2DA 4O14A 4UXDA 1KFEA 1JCLA 1EUNA 4RZ5A 1XKYA 1QPOA 4PL2A 1C29A 2Y88A 1DL3A 1ME7A 1OFPA 4JXCA 3EXTA 2QCCA 3ABQA 2O7QA 3MWAA 1HFBA 2JGQA 3SGUA 5DELA 5HUPA 3LCIA 4UFJA 2FPTA 3CB8A 3M5YA 3HPZA 5E1QA 1FX6A 3SIZA 3UPWA 4M6VA 2JKEA 4Y96A 4LV9A 3WJYA 2QR6A 3HG2A 4NNCA 2C6QA 2H6RA 3G3DA 3OEXA 1OF8A 1WA3A 4XBKA 3A5VA 2YDAA 2TRSA 3BW3A 3TAKA 2V2HA 4MZ1A 2ZA2A 2ZRVA 2CLFA 3VE9A 5FF4A 2TMDA 1PE1A 1N55A 4AH7A 2H3DA 3TSDA 1VHNA 3ABRA 1TPC1 1GPWA 4I7UA 4Y90A 3DI1A 2VEIA 1H7XA 5FF2A 4H4IA 1KV5A 4Z08A 4O13A 2J27A 3HBLA 1IF2A 3WJWA 5C2XA 4JYEA 4B5NA 3QC3A 4N9BA 2ATMA 2AGKA 3KVLA 3N19B 1P0KA 2ZA1A 3R12A 3W87A 4NZFA 3M5VA 3UZ5A 1FQ0A 2CLMA 1TTPA 6TIMA 3GX9A 1ZY9A 3B0PA 2RDWA 2YSWA 4GE8A 1HG3A 2ZFAA 4O52A 2JKAA 1SZNA 4JGDA 4PEKA 3IGUA 2CWNA 4WZHA 4EIVA 1P4CA 4LVFA 4WY0B 1FDZA 3MI3A 4FNUA 1DHPA 3G3MA 4JTEA 4WOZA 3PBVA 1FWSA 3W2MA 2NXIA 2JBMA 4E0CA 3BLIA 5H91A 3G22A 4UTUA 3SSJA 4MVAA 1W5NA 2E6AA 3QEZA 4L4LA 3CC1A 2YR1A 2FDSA 2OT0A 4TU1A 2GQAA 2I1OA 1DBTA 3LERA 1K7XA 3P67A 4AMAA 1KFBA 3KVMA 2QJGA 2ZZ3A 3R89A 4Z1CA 5CZTA 4LT9A 1M7OA 1EEPA 1VHCA 2C18A 4QM1A 5FEPA 1RVGA 3WK2A 3NYZA 4EF9A 1LOSA 3STEA 1NSJA 4POCA 1GJPA 5C5YA 4UTIA 1YTKA 1T96A 3LOTA 5G5IA 4TMCA 5LHFA 4QQ3A 4P2VA 3NQAA 5EBUA 1H7OA 2V2CA 3HQ1A 5DXXA 3ABSA 3W1QA 2ZCGA 5T26A 1W54A 3GXNA 3LXBA 3TA6A 2NLIA 4ZVJA 4KKXA 1SZEA 2ZDRA 3WK0A 4X22A 1U5JA 4JR5A 4HHPA 3PM6A 2B7QA 1TPFA 1OK6A 1THFD 3W85A 4AF0B 3ANYA 5FESA 1KBJA 4IMFA 1W3NA 1SW3A 4IUOA 5F4XA 1IIHA 4BI5A 1QNVA 2Z0IA 3V1PA 4JTFA 1RZMA 4GC4A 5AYZA 2C15A 1WOBA 2QJHA 4JY8A 3TH6A 1LROA 4O54A 1I45A 4NVTA 1KFCA 2QAFA 1FXQA 3KFTA 4MZ8A 4FIQA 4JTKA 1AL8A 4E2BA 1H61A 1TB3A 3GB6A 3PUDA 4DPQA 5G4EA 2RKXA 4JY9A 3TQKA 3P8JA 3GDMA 4DBEA 3BW4A 3NPXA 4IPIA 3SGZA 3VCRA 4HIBA 2FQIA 3TQVA 3THQA 1M7PA 3SW6A 1EUAA 3DKLA 3SI9A 2RFGA 1I2PA 2Z2UA 3TCEA 4UR8A 2ZRUA 3BW2A 1KTBA 2OCZA 2OJPA 4HNNA 1XFBA 4NJKA 4MFEA 3W7LA 5CSRA 3KAOA 3PVFA 1PHWA 5CG7A 3T55A 4UFMA 3L68A 3G1SA 3KRZA 1JCJA 3NPWA 5C6MA 4H3DA 3NZ1A 3W7CA 3FKKA 4AHOA 1VQTA 3CTLA 3EB2A 4C1KA 1TYGA 4MY9A 4GUJA 3MO7A 1SFLA 2BLEA 3KVJA 3DFSA 5LGXA 5F2MA 1IXQA 3GLCA 1OJXA 1KFJA 4JTHA 3FFSA 1QFEA 3LLDA 4O0ZA 1IGSA 3WJSA 2Y63A 1P5BA 4O1AA 3W1PA 3BG9A 3QH2A 5HWJA 1B3OA 2CLOA 5EKYA 4XZ9A 5KZMA 4YWIA 4UFHA 3PSVA 3OVRA 4A21A 3TROA 1GQNA 4JEQA 1MEIA 1SZFA 2AAMA 3CHVA 3MJYA 4AEOA 1LLZA 3C56A 3JRKA 3TK7A 4XUGA 3P81A 2QCHA 3DZ1A 1YPFA 4JYDA 2H3BA 1EIXA 2BZNA 3PY2A 5KZEA 5AC6A 1GTEA 3UPBA 3G24A 2ZZ2A 5CGQA 5D05A 2WSYA 1K8XA 4AXKA 1PVNA 1Q6OA 3L0KA 4YCOA 2ZZ4A 5LNVA 3EWZA 3L66A 1F73A 3M5ZA 4RK8A 3HPXA 2Q8ZA 3ABOA 1F05A 1RQBA 4CNPA 5J5RA 4Y6GA 1LLWA 4N9CA 5KMYA 3HO8A 1OHLA 1OYCA 3ZWTA 2E5DA 1OFQA 1F76A 2I14A 4CCEA 2LLEA 1ZALA 2VEMA 2PRHA 3C2VA 5FEZA 1KFKA 3MUXA 1JULA 3S6DA 4N4QA 2V81A 4UC5A 4GUGA 1FWWA 1W37A 2Y7DA 2E09A 4Z1BA 3NL5A 2HSAA 3FJ6A 3C52A 2J9XA 4MFDA 3PBUA 5J5DA 1K8ZA 2ZZ7A 3O6DA 4UTWC 4K38A 1ICPA 3TW7A 3NO5A 1LBFA 2CZDA 1Q45A 1ICQA 3GVGA 4R34A 3N34A 2VEPA 3W1TA 2ISVA 4BI6A 4JS3A 3BPWA 1H7WA 2FLIA 5I3HA 1F74A 4O17A 3P80A 4BFAA 1F6KA 3BO9A 1LOLA 1H1YA 2NX3A 1DQWA 4M7TA 2BSLA 1J5TA 1C9DA 4NZJA 4WQ6A 4X9SA 3S1VA 4R33A 3PULA 4LNYA 2WNQA 1I2RA 1DKWA 3W3OA 3LHVA 2RHGA 4NUWA 2CW6A 3SZ8A 3A21A 1UASA 2FIQA 3N2XA 1AW5A 1RQHA 3LBMA 1H60A 3DFTA 3F4WA 4XWUA 4YCPA 2PCQA 3ZFHA 1O4UA 4BK9A 5AC7A 3UNDA 4NQ1A 2H8ZA 2V30A 3R2GA 1G69A 2OMAA 2PE4A 3S5YA 3RK8A 4JICA 4O4WA 2EAWA 3T4CA 5D2TA 2WSRA 2Q8LA 3G8EA 5A5WA 5AYXA 1TPH1 4NT0A 5IBXC 1NEYA 1W56A 2QCNA 2EPHA 3NL2A 1GVRA 1LCOA 3LCGA 4NX0A 3T40A 1KM2A 5HWNA 3E9AA 5HULA 4CNOA 1VH7A 3LCHA 5AFDA 1JUEA 4O1DA 4CQAA 1AMKA 3NQGA 1KM5A 1QR7A 1PCKA 4Z1AA 4H6KA 2FB3A 2NUYA 1HTIA 2BXVA 1TJRA 4IQLA 2WQPA 2CZEA 3U6WA 4MOZA 2Y7GA 1JCNA 2FB2A 2C3ZA 4M19A 4KWWA 1H51A 4LY8A 3PC0A 1SO3A 3FS2A 4PFMA 3GR8A 3OG3A 4S2CA 2Q3OA 3QMRA 3W7EA 3B0VC 4FXSA 2PRLA 3EEGA 1JCMP 2QF7A 2GOUA 3LCLA 1O5KA 4LOCA 3TE9A 1WOAA 3LTYA 3PB0A 2QUVA 3W1NA 3UQNA 3W86A 3DFOA 4O18A 4JX4A 4FX6M 1OFEA 1W5QA 4MJZA 1OFOA 1QPQA 5DBUA 5FEXA 3UXDA 2Y7EA 5HR6A 4O8RA 2YFOA 3W7DA 1VRDA 1KM6A 4LTSA 1WBJA 2YGYA 1QO2A 1SO4A 1KBIA 4IXXA 4QSHA 3W2UA 3G1XA 1X1OA 4K8EA 3UZJA 1GEQA 2O7SA 4O57A 1F2JA 2F7FA 5LNUA 1DORA 1WDWA 3QMTA 4HPXA 4OHQA 1L2UA 1WXJA 1KM4A 3PUEA 1K03A 5AC8A 1OYAA 1N7KA 1ZENA 3Q37A 3A22A 4UTJA 1T8XA 2QCFA 4MY8A 4IJBA 1EWDA 1FBAA 1SSGA 1TV8A 3L5AA 3UY7A 4K37A 3LRKA 3HOJA 8TIMA 4CNNA 3MP5A 4MY1A 1XI3A 4ZQCA 3USBA 3TC7A 5G1TA 3G0UA 2YYTA 3CIXA 1OFBA 4RXGA 4FXRA 4O11A 3DFQA 5HMSA 4QNWA 3HF3A 5AHNA 3EWBX 5EYWA 1VZWA 3LX9A 3IVUA 3FYOA 5U7SA 2E77A 1I2QA 3I65A 2E6YA 3SR7A 4BWLA 4LRSA 5HJLA 4FIRA 3TQ0A 1SZGA 1AK5A 4LS0A 3QPZA 1XBYA 3RNDA 2FJKA 4O1CA 3EWXA 4K36A 1ML1A 3G8RA 3RMJA 3A5FA 4IMDA 1LDCA 3NM1A 3M41A 1DOSA 4M5PA 4Z0JA 4ICNA 1XDLA 3IGXA 3F1QA 3KRSA 1QDSA 4NNAA 1W5MA 1MXSA 3GDLA 1JJKA 5F1VA 4DPPA 5I3JA 1VPXA 5F2LA 1I4NA 1MEWA 5D04C 3OA3A 4UTTC 3W84A 2G95A 4GFSA 1LRTA 5D2VA 4FO4A 3UWWA 4WJEA 1HO4A 3QW3A 2X30A 5IM51 3MP3A 3PG9A 4UTKA 1SW7A 1K02A 3MYPA 5F4SA 3W75A 1S5TA 3H53A 1TREA 1H7NA 4E38A 3YPIA 1VLWA 3W22A 1PHQA 4GRSA 4PCFA 2VC6A 3KOFA 3N2MA 5K9DA 2A7NA 2NZLA 4N02A 2P0OA 3M44A 3NQEA 3HB9A 4O10A 1A5AA 3M5XA 2Z6JA 4K7VA 3M16A 3W1RA 4GNJA 4ALDA 4LUJA 2YXGA 5E0KA 1XUZA 5G2IA 4FEZA 4NX5A 3N9RA 1UB3A 1XM3A 5DBTA 4NJGA 1AW1A 5DCEA 3C3NA 3LHZA 3P84A 1GT8A 4RZ4A 4O19A 3W7MA 1YADA 3FJLA 1SW0A 4JTIA 1QCWA 1OX5A 1FDJA 5TBOA 3TIMA 4NJJA 3OVQA 4LVDA 3W74A 1JCXA 4MKNA 2YPIA 2NV1A 4LUIA 1OYBA 2EF9A 3GAKA 5EMUA 1W5OA 4J9JA 3RF9A 1FWRA 3GXTA 3O6CA 4AB4A 3NPVA 3KXQA 4XKYA 1OX4A 1QMLA 3NQ6A 2G5WA 4Q4KA 3GDKA 4GJ1A 1FWTA 3P7YA 3TKFA 1XDMA 2V5BA 1KM1A 2VFDA 3B8DA 5DY2A 1ZAIA 5LSMA 4BR1A 2V9DA 2YW3A 4DXVA 4N9DA 1GVQA 5F2IA 3W7OA 1T0OA 4BF9A 1K3UA 3STCA 3WK1A 4JD4A 1TPWA 3C2EA 1ONRA 3BK0A 1ZHAA 1JRCA 3PB2A 5ABTA 3O16A 4AVFA 4OBTA 2OX1A 2E6DA 3CIWA 1PL9A 2VELA 3TSMA 1KLZA 1GWJA 1EA0A 5I3KA 3RFAA 4N6EA 5D30A 5FF0A 1TTQA 1W31A 4L4MA 2E5BA 4A3UA 2Y61A 3TJXA 2TSYA 3TAOA 3GNNA 3HPSA 3NQCA 3IIOA 5K3VA 1TPB1 4JNMA 1MSSA 5SWUA 4FNQA 3STFA 2NX9A 4TMBA 3LGEA 2ABAA 4FB7A 5AB3A 3W9ZA 2ISWA 4OGZA 4UR7A 3O15A 1I2NA 1OFRA 1XL9A 2GVJA 3FA5A 4UNLA 4EVZA 1AG1O 1GOXA 2ZA3A 2GPTA 3M1ZA 4PA8A 4LVGA 1K8YA 1JUBA 1D9EA 4MLRA 4ADSA 3C2FA 4AHPA 3Q94A 3S9YA 3W1MA 3O6YX 1GYNA 3W7RA 3LXAA 1MZHA 1GTHA 3DGRA 4S1FA 1R2TA 5LKYA 4LU0A 5AN7A 4LWWA 2IQTA 2QJIA 2NUXA 3CLMA 1ICSA 2R14A 4JIQA 3DKJA 1XC4A 3UWZA 1WYIA 1LP6A 3W7HA 1ADOA 4KFPA 2GJNA 2DORA 1YLVA 2YW4A 2CLLA 3DU0A 3L65A 4ZMGA 2TYSA 1JQVA 1W0MA 2RDUA 1B9BA 3PSWA 3A9IA 3DH7A 3W1XA 1H1ZA 1SSDA 3EWYA 3FOKA 2X1TA 3KX6A 2C1HA 4QITA 2X16A 2JK2A 3JS3A 2R91A 2OT1A 4FNPA 2DZPA 4X2RA 5AOUA 4EWND 2PC4A 2D73A 5I3GA 4U4MA 1TTIA 4WY0F 3QW4B 3I7QA 4TO8A 3AJXA 4DBDA 3ZS4A 3BVJA 3SJ3A 3D0CA 5KZDA 3DHDA 1VYPX 3GNDA 2B0MA 4AHQA 1OX6A 2CZ5A 2ZQ0A 3ATZA 1UBSA 2C19A 4TIMA 2NX1A 2JKPA 1IXOA 3B0UX 3A24A 2WKJA 2ZZ1A 4CCDA 1KTNA 2NXGA 3IVSA 1SUXA 1R46A 3S5OA 5LGZA 4N6FA 2FTPA 3QSRA 3TMQA 3I7RA 1S5WA 2X1RA 3Q2DA 3W2LA 4K6AA 3DBPA 4NXSA 1R47A 5HUOA 5FI8A 4A2RA 2E5CA 1KM0A 3O1NA 4LC8A 4LW7A 1VS1A 3C4UA 3PR2A 3R13A 4UTHA 5CPLA 2DZVA 1ZCOA 1LBLA 1G67A 3CQ0A 3W7QA 5I3FA 1ME9A 1BEUA 3UWQA 4ZL1A 5BMWA 3RLUA 1YTDA 2ATSA 4KFOA 3HG5A 4FNSA 4KWVA 2DU2A 2GUUA 3ZR4A 1UUMA 2EHHA 1TV7A 3TXVA 5CZSA 2B7PA 4HNTA 4ML9A 2J88A 4LS1A 4K8HA 3EX6A 5H2ZA 2ABBA 3R5EA 4JYFA 5AHEA 2J9YA 5G1YA 1ALDA 4HPJA 1YXDA 5CPOA 3TJLA 1VCVA 1XCFA 3MI2A 2GVGA 3JR2A 5K9CA 3OIXA 3NL3A 3B4UA 1T99A 2Y7FA 3MI6A 3P5YA 1JQXA 5BOOA 1KLYA 1S3HA 5L9FA 3I68A 3BGJA 3TW6A 1QPNA 3BG3A 3S0CA 5D2WA 4Z0SA 3SECA 3TU9A 4ADTA 4ZQPA 4DF1A 3NQDA 4UNKA 5KSWA 2CLHA 4ZQNA 3HIJA 1XBVA 1E51A 1J4EA 3L2IA 1JR1A 4QISA 3B04A 3EX3A 5CKSA 3NNTA 2XN1A 3THAA 4X3ZA 3HJZA 1RV8A 3R8RA 4O16A 3G1AA 1LRQA 4RJEA 3C6CA 3G1FA 3WJZA 3LDVA 1GVOA 3NVTA 4AWTA 2CLEA 1CX9A 3G1HA 4QNEA 1NFBA 3UXAA 4I7WA 1UCWA 3MBFA 4JTLA 2QCGA 1HO1A 4IXHA 3M6YA 4RXFA 2CZFA 2V8ZA 3NQVA 2ISSA 4IOTA 3W7IA 2G97A 1X7FA 4XKYB 4A22A 2V2DA 3S1XA 1OX4B 2A85A 4IX0A 3I7SA 1B4EA 2JGYA 1L9WA 4IX2A 1OVDA 1GG0A 1GG1A 3B06A 2PURA 2QCLA 3MYOA 5GVJA 3B05A 4U28A 5HINA 1YDNA 4DO5A 2VEKA 3N73A 5D38A 3P82A 5D32A 5G4WA 3LCXA 4Y9AA 7TIMA 3G1YA 4OQVA 3BG5A 1VR6A 4JIPA 2A21A 3LBCA 3TX9A 1IXNA 2VFGA 3LTPA 3LTSA 2A4AA 4AWUA 1FWNA 1LZOA 4R53A 4AWSA 3QMSA 1H62A 3PG8A 3LCFA 4HKPA 5CPNA 5TIMA 4A2SA 1FY6A 2Z1BA 3IRDA 4ORMA 2HS8A 2QUTA 1EX5A 1Q3NA 3NQ2A 1FUYA 2GQ8A 4DEFA 3QYQA 2DP3A 4GWEA 4P61A 1QOQA 2HS6A 1Z48A 3W07A 4MJMA 4YL2A 3S5ZA 3NOEA 5LHEA 2W79A 3M43A 3W7KA 2W6RA 1EB3A 5FF3A 1DQXA 3L67A 3QRHA 1YDOA 3T78A 4DO6A 1VYSX 5DN1A 3GKFA 4MYAA 5D37A 5K9XA 4R7JA 3N3MA 1KW1A 3G0SA 1SR9A 2DJLA 5C54A 2QAPA 1G4EA 5D2XA 3TC6A 4A29A 2YZRA 5L6UA 3LHWA 1YDVA 4WXZA 5D02A 4UTMA 1AL7A 4JTSA 3NA8A 4CLMA 3VFLA 4S2BA 3LV5A 3EX4A 3EX1A 4OV4A 5K7JA 3GK0A 3FKRA 1D3GA 4GUIA 3S1WA 4PTNA 4YXGA 5KTLA 3OVPA 5EL1A 3P62A 3RU6A 2P1FA 1OFDA 2QDGA 4FX8A 3CT7A 4QJ1A 1TRDA 2ZRXA 1Q6LA 2ZYFA 1XXXA 2HMCA 3DI0A 2QEZA 4MYXA 1Z44A 2W0UA 3INPA 2NUWA 4C1LA 2Q3RA 2FFCA 1L6YA 1BWKA 1TSIA 3DENA 5A8GA 2BTMA 4WOQA 2E1DA 2VXNA 5CPMA 5FF7A 5K4XA 5AHLA 1G7VA 1ZFJA 2QCDA 1HUVA 3W73A 1LORA 4O28A 1PS9A 4JDYA 3QQ0A 4PODA 1W8SA 1F6PA 3CEUA 1TQXA 3F03K 3GYEA 3E0IA 4TX9A 2V82A 4OE7A 4RLIA 1EP1A 1UJPA 1RD5A 2C0AA 1PIIA 2PRMA 4ADUA 4XTDA 1GZGA 3MHGA 3HGJA 4I9AA 4LC6A 1EWEA 3E02A 3TR2A 3L5LA 4O1BA 1LBMA 4JTJA 1NF7A 4JTGA 2DJXA 1A5SA 4UIOA 3B03A 3Q58A 2QCMA 3W1LA 5TQLA 5FEWA 1F7BA 1G6CA 1JUKA 2QDHA 1FDYA 2A2IA 3K30A 2H90A 3NL6A 2X2GA 4MPQA 5BRBA 4TR9A 1KA9F 3L21A 3RLVA 3FLUA 5EA9A 4DO4A 4ORIA 1A5BA 1Y0EA 5DXYA 1WX0A 4IMCA 5G2HA 3QPYA 3LI0A 2QUUA 4LV4A 2E68A 3EXRA 3ATYA 1AW2A 1TPDA 5EPDA 3TV8A 4GUHA 3CU2A 2GQ9A 4GXMA 1WQ5A 4JX5A 3L9CA 2CLIA 2WO5A 3LRMA 2WPBA 2QKFA 3FYPA 3T44A 5EY5A 1W3IA 3NQ8A 1IXPA 3PWAA 4WX2A 1SU5A 2A6LA 3TUUA 2AQWA 2WJZA 4RCXA 3H54A 1P1XA 5HR7A 4M6QA 4BWLC 1LM1A 1TPVA 5BMXA 3LHYA 3LI1A 4HSNA 4XBSA 5CZ0A 2EGZA 1FCUA 3A23A 4JDBA 4RZ6A 5LNRA 3V75A 4WD0A 4RX0A 3U8GA 3BLEA 1VLIA 1JVNA 1DJQA 2VFEA 2I9EA 3UYCA 4JN6A 1TTJA 1XUUA 5CZJA 5DLCA 2VFFA 4IPJA 4NXKA 2WSQA 4IWWA 2XN0A 3MHFA 3BARA 3IIVA 3UD6A 5K2ZA 2Y62A 4FX7A 1KTCA 3UY8A 2B7OA 1QAPA 3HGRA 4OU1A 3QFEA 3BV4A 4RKAA 1JCYA 3C61A 1P0NA 4WXYA 1KFLA 1QPRA 4JTUA 3DFNA 1Q6RA 5DY3A 3M9YA 4O50A 3W88A 2VENA 4QAIA 2YX0A 1X6UA 3QM3A 2X1SA 5LZLA 2VFIA 1I8JA 2J9ZA 2J6XA 2Z6IA 3OBKA 3CPRA 3W6YA 3G0XA 4UFIA 4MZYA 3NEVA 2ZZ6A 1EP3A 1FXPA 1BWLA 4MUZA 4M7SA 3KHJA 3L0GA 2OZ0A 3EX2A 2YFNA 4BI7A 3EWUA 2C14A 3W2NA 4IGHA 5MHBA 3C2OA 3NZRA 2V5LA 3IGSA 3W71A 1Z41A 1K7EA 3O8AA 2C13A 3IEBA 3GZ3A 4ZQOA 1H50A 5CSSA 1M6JA 5LNWA 2CU0A 1RQEA 3L0NA 3LV6A 3LRLA 4UTLA 3ELFA 2FPVA 3IIZA 4LVBA 1VCFA 3F4NA 3EKLA 3P8IA 1TV5A 5KITA 1K7FA 3PUOA 5AHIA 4HT3A 1M5WA 2F84A 3CEPA 4I7VA 3G1VA 4DQWA 2E6FA 3EKZA 4HNVA 3HGOA 2WNNA 4LS2A 2XFWA 3BGGA 3P60A 3GIYA 2NWRA 3P5ZA 4Q33A 3TNOA 4ONVA 6ALDA 3TSBA 4PL1A 3TFCA 1XBZA 2CFFA 3W72A 1LRNA 2RDTA 2EKCA 3NAVA 3LXCA 1G4SA 3BLFA 4YMZA 2VFHA 3H55A 2VOMA 3NM3A 4HSOA 5AYYA 3NQ7A 2DZWA 5HWMA 4UTWA 1ZNNA 3DXIA 3TFXA 2TPSA 4UMAA 1VCGA 1TPUA 1MEHA 2NV2A 2DZSA 3AO0A 4NJIA 3PAJA 3W23A 3SY5A 1CI1A 3IV3A 3LHTA 3W70A 4CQ8A 3VI2A 4OWGA 1O5XA 3G18A 4PC8A 1L6SA 4Y8FA 1O95A 2QCEA 2BX7A 5E93A 3W2KA 2GVLA 3NPUA 4JTTA 4XTIA 3QJAA 1PCWA 3VE7A 3S5NA 2CLKA 3QF0A 3QQ1A 3M47A 1JRBA 1TQJA 1NF0A 2X1UA 1O94A 3KRUA 3S8HA 1HL2A 1IIGA 4RR4A 3IVTA 3KVKA 3NDOA 1B57A 3P61A 2DZUA 4EF8A 4PH6A 3W7JA 2G96A 1WAUA 2A6NA 1SFJA 5IBXA 5I3IA 4N2YA 4FNTA 4YLWA 3CM4A 1XBXA 4O0KA 3GXPA 2B7NA 1SQ7A 1X8FA 5D09A 2QCDB 1QO5A 3S42A 2ZTKA 5F1UA 3C0JA 1TO3A 5D33A 3HMJG 4MIMA 3W7GA 2A7RA 5KINA 3TXZA 4RV8A 3HGSA 1VJIA 1SO5A 2B4GA 2WV8A 2NWSA 3E49A 4HN4A 4WY0A 5U4NA 3UWYA 1TIMA 3WFAA 1GYLA 4OT7A 2GJLA 1H63A 4ZQMA 1Z42A 3GKAA 3DHFA 1LTDA 5DCBA 4IMEA 2H8XA 1X1ZA 1OG0A 2ZRZA 1DJNA 3TMLA 1F5ZA 1A5CA 3LLFA 4DF2A 3QSTA 4FHAA 1C8VA 3NQFA 3OHIA 1OK4A 3QZEA 1A50A 4CCCA 1G7UA 5C55A 4UFLA 1OABA 3W7PA 3W76A 4GBUA 5AHMA 4LVAA 1YPIA 3L5MA 1EP2A 3NXFA 5HNRA 1TCDA 1VC4A 3P74A 1Q6QA 4LRTA 3FEMA 4JX6A 2A1YA 3DFPA 2WOQA 4FNRA 4NU7A 3S1UA 3SFKA 1ZAHA 1BKSA 1RR2A 3GDRA 1ZJIA 3PS7A 3MHUA 3O07A 4Q32A 1H7RA 3VNDA 3EWWA 3UWUA 4ZZ9A 4UCGA 3O06A 4K39A 4QIUA 5BNKA 2XN2A 4DELA 1GVFA 1A53A 1G4PA 2ZZ5A 5D03A 3W83A 4GUFA 4UFKA 4K7YA 3GAYA 1R2SA 4IMGA 1PV8A 2UV8G 5D2YA
chains in the Genus database with same CATH superfamily
2NLYA 2BXZA 4I6VA 3QHNA 3CUFA 1BQGA 3WLLA 4RNFA 3AICA 4ZQRA 3QKZA 1BVWA 1YTEA 1FCQA 2GUYA 3PBWA 1B4KA 2OWXA 1RK6A 1GOOA 1WBHA 2J7CA 1EJSC 1EO5A 2ZX6A 2QQ6A 1NP0A 3IUDA 3PF3A 4N4PA 3WBXA 1IEIA 2OQYA 1Q6CA 1Q8JA 2QNEA 4LPCA 4CN1A 1R5YA 1US2A 4W9TA 4RW5A 3CL6A 3M7WA 5FAJA 1X98A 4MDPA 2ZTJA 3T8LA 1US0A 2WW5A 3WQEA 1W3TA 2PBGA 5AHFA 1CW2A 1Z32X 1P6WA 3WBWA 5A6JA 1KM3A 1VGAA 2CCRA 3C0LA 1R85A 2XZ9A 5HXMA 5BW6A 4XVDA 4E2VA 2SFPA 1OCQA 3K1DA 4D2JA 3PZNA 8A3HA 3A47A 1SPQA 2PDXA 1U83A 2WVTA 1TRIA 1MO0A 3BV7A 1QWGA 1V3MA 2ZRWA 4MWAE 2IPJA 1UD3A 1VYRA 1PZ2A 1W5PA 1XIJA 3GW3A 1XSJA 4NY2A 4C6KA 1XIDA 2D3NA 4MLJA 2BWGA 1TJ2A 5GJNA 4AZCB 3U4FA 1V5XA 3H70A 3STPA 4N9EA 1BTMA 3O0FA 3VCCA 1NIUA 4C1NB 3G1DA 2GSHA 1XD0A 3E12A 2PTZA 3VYLA 4HZMA 3SY1A 3XISA 3T7VA 1EX1A 2BHUA 2NVCA 4QE5A 3NQMA 4X63A 4JCLA 1PIFA 1KV8A 3LPFA 3MBDA 5FA5A 1V6YA 3D46A 4LANA 5F4WA 4F40A 1N8FA 2Z29A 1R9XA 4GXPA 5CPTA 3THDA 4QJ3B 1R0MA 1KFEA 1W3LA 2AGTA 1XKYA 4RZ5A 1QPOA 4QJ5B 4PL2A 5H6HA 1JXJA 2DGAA 2Y88A 4QXIA 2QCCA 3ABQA 4X2PA 2O7QA 4B2DA 1HFBA 4QEHA 3SGUA 4LAZA 1IZKA 1A80A 3CB8A 4GIRA 3HPZA 2CERA 1FX6A 1KXQA 3HU7A 4Y96A 4GH1A 4IP7A 4LV9A 3WJYA 2H6RA 2CYGA 4GJJA 1OF8A 4XBKA 3BW3A 3TAKA 3TZFA 2PAJA 1V51A 1E6NA 1TFVA 4PCNA 3VM7A 4C6BA 4JQ2A 1BGAA 4D6EA 3MV01 4U5IA 4ZODA 1EF2A 2H3DA 3NWRA 5H8MA 4I7UA 4J7RA 3KZSA 1H7XA 4Q4MA 2QVNA 3LQLA 3NQBA 1GZ1A 4L9ZA 4JYEA 4B5NA 4DZHA 3EOLA 1GORA 1DYSA 1IZCA 3R12A 4NZFA 1Q7ZA 3VFCA 3QY6A 2PDGA 4YWSA 1Q6DA 2RDWA 3R11A 4DNMA 5C7VA 4O52A 3U5YA 1G1YA 3GHRA 1JZ5A 3NJ3A 1P4CA 4FNUA 3G3MA 1HJWA 5JXQA 1KRAC 4WOZA 3PBVA 3GSMA 3W2MA 1KXTA 1O12A 4DYKA 4J5NA 1ZTVA 4PTXA 4HA3A 3SSJA 3SM0A 2VQTA 4DJDA 1WAWA 3HPFA 1MRQA 3FSTA 4B91A 3MS8A 2I1OA 5I77A 1O1ZA 3KVMA 4XO6A 3V3WA 4LT9A 4G8TA 3VNZA 1RVGA 2ZOXA 4OOZA 3NYZA 2Y2WA 3STEA 2Z2BA 1NSJA 4UTIA 4FLRA 3LOTA 1QI2A 1B3YA 3NQAA 3MJMA 5EBUA 1GPFA 3CL8A 3HQ1A 1DWGM 5DXXA 3EOEA 2C0HA 3KCJA 3MZNA 4JQ1A 4UOJA 2P5NA 5H8UA 4L1WA 5JIPA 3QKEA 4BF5A 3CQKA 2W66A 1PTDA 2ZDRA 1FRBA 1K9DA 3F7JA 1V6WA 4UCFA 1UR2A 3ANYA 1XGEA 4O8AA 1M68A 1SW3A 4FOKA 1DJIA 5F4XA 1W6TA 1IIHA 4GYJA 2ZC8A 1C90A 2GQ3A 2QV4A 3SY8A 3VDBA 4BF7A 1AL8A 4E2BA 2G4JA 3GB6A 2WMIB 4JY9A 4H9ZA 3GDMA 3PZOA 4HK5A 2Z27A 1AQHA 1V02A 3L4UA 3HV8A 4AWEA 4IPIA 4WKHA 2EO7A 1GOMA 3GFYA 4GYPC 4H8VA 2XH7A 4KIEA 2WWDA 1WDRA 1WZMA 2XVLA 1I2PA 2Z2UA 2VRQA 3TCEA 4LYPA 3JW7A 4IMAA 3EOOA 5M1TA 1JPKA 2ZRUA 5JBEA 2OCZA 3W26A 3OOQA 3VMOA 2PDQA 5FOOA 5C6MA 1RLCL 2ZUWA 4A8RA 3UVIA 4AHOA 1H0GA 4C1KA 3RRXA 4GO9A 4GUJA 3MO7A 3E74A 4C6FA 5A95A 3VNLA 2L5HA 4GC3A 5PTDA 1DJWA 2OYMA 1QFEA 2WMKA 1P5BA 2DSKA 1NWUA 2Z25A 1W9BM 3W1PA 3BG9A 1KNWA 2BHZA 3ITLA 3KS5A 4XZ9A 3NSXA 3PSVA 4ROQA 4Z2IA 2GJXB 5D9MA 3RUBL 3CZ8A 2BMBA 1LG2A 2AAMA 3QTPA 3MJYA 1GKQA 4R7WA 1OEPA 1YPFA 2VC9A 3AU6A 4QTGA 5FJIA 5CSUA 1N8WA 1DJYA 2VEGA 3DFHA 2OKOA 1VD6A 1PVNA 1LG1A 3WUGA 2ZZ4A 4RL3A 3L66A 1F73A 1KKRA 2QUNA 4BA0A 4GG9A 3PZTA 1RQBA 4EE9A 4JEJA 4PGLA 1ZSXA 1C92A 1LLWA 3F2CA 5KMYA 2Y5EA 1R7OA 1WKYA 2V3EA 1JZ3A 1PZ0A 1XLIA 2VGBA 3ZLFA 5C9WA 3PFRA 5C9UA 2PWHA 1ZP3A 4CCEA 3B9OA 1US3A 5LA0A 2ODOA 3IJQA 1YX1A 3KLLA 1RLDA 3S6DA 2H9AB 4N4QA 3FXGA 5ABFB 3CV1A 3CPUA 1TR9A 3MSYA 1BYCA 4X0VA 4MFDA 3PBUA 1PJ9A 5J5DA 4B5XA 3GZAA 4UTWC 4HPNA 1ICQA 3GVGA 3M64A 3RRAA 4Q8MA 3NZQA 3W1TA 3GNRA 4TV5A 2BNJA 3IJ9A 4H8UA 1P48A 1V3LA 1I1XA 3K8LA 4HZ6A 1E0VA 4BFAA 4JNYA 3W28A 1VFHA 1LOLA 1H1YA 5A1AA 2XM1A 3GIQA 2BSLA 4QRNA 1C9DA 4NZJA 3S1VA 3IGHX 3KTCA 4C6PA 1MDLA 3EB3A 3N6HA 3PUGA 3N2XA 1AW5A 3OQEA 3LBMA 1WZAA 1H60A 3ZFHA 5AC7A 3DGBA 3R2GA 3A64A 1Z3NA 2I5QA 3FAWA 3N25A 2PE4A 1GOKA 1S2CA 3RK8A 2WVVB 4LBUA 4H7VA 1A3HA 2EAWA 3GG1A 3GRIA 1WB0A 5I00A 5A6BD 5A5WA 3C0SA 1TPH1 5IBXC 4YTQA 2WB5A 1XGZA 1W56A 5CBBA 2YKKA 2EPHA 1TMLA 3U5UA 3M0YA 1J0IA 1OGSA 1NELA 4MWAB 3T0DA 2CBUA 3RXZA 1QHPA 3E9AA 3EWDA 2X0HA 5HPOA 2E67A 3WLOA 4H6KA 2FB3A 1HTIA 3AQUA 3U6WA 4PYSA 1UKTA 3TN4A 4M19A 4JFVA 4LY8A 3A9BA 3QR1A 1QBBA 5HAOA 2WC3A 3K8MA 1XV8A 2Q3OA 3W7EA 3OZPA 3B0VC 2DSVA 2PRLA 3VZZA 3FA4A 1V6UA 3QGKC 1D8CA 4L56A 1ZZMA 3ZSSA 2Y7EA 5HR6A 3H2AA 4DIAA 2PDNA 4LTSA 4W86A 1TR1A 4KETA 1QO2A 4LAKA 4CU7A 2PC8A 3G1XA 4XAYA 1WE5A 2A3AA 1GEQA 4LF2A 5D4YA 1F2JA 2F7FA 4WDWA 4CEXC 5LNUA 1WDWA 3QMTA 4HPXA 2FH6A 3DOPA 3PUEA 3UR8A 1W2PA 1ZENA 2QHAA 4UTJA 1CEOA 1KXHA 1MW3A 3EMCA 1TV8A 2D0HA 4US5D 4W5UA 3LRKA 3HOJA 4CNNA 1B90A 3HQNA 3MP5A 1JYNA 1DHKA 1GHSA 4PUJA 4Z2GA 2F9RA 2BOEX 2YYTA 3CIXA 1OFBA 4JTRA 3MSRA 4HU4A 4I5UA 3W01A 1UH4A 3DBNA 2IMRA 2WPGA 2FH8A 5EYWA 2OX4A 3LX9A 3R6IA 3IVUA 3FYOA 1SJDA 2BVWA 4IG2A 2W61A 2E6YA 3EMZA 2G0WA 3GTNA 4BWLA 4ML4A 2YBTA 5CAHA 4C5ZA 1J12A 4B4FA 2FJKA 2ANUA 1UQYA 5LIKX 3G8RA 3RMJA 3SN1A 3A5FA 4GACA 4Q8UA 2HK0A 1KQZA 1BSLA 1GGOA 4IICA 3WLTA 4H9TA 1G94A 1JZ4A 4NNAA 1U1HA 4PUNA 1XIBA 1JJKA 1ODZA 1XYLA 1KRMA 3AJ7A 4DPPA 5EU9A 1VPXA 3DX5A 5D04C 1ZL1A 4FO4A 3UWWA 1H49A 3NFUA 1HO4A 3R43A 2X30A 1JGIA 2ZWZA 4CD7A 4AC1X 3SAZA 2ZKMX 4D6DA 3PG9A 4UTKA 3BAWA 3WNMA 4HVXA 1GOWA 3YPIA 1VLWA 1PHQA 4GRSA 2VC6A 4A3RA 2UY5A 1U33A 4YTRA 4LEFA 4BJHA 1TWZA 3M5XA 2Z6JA 4LUJA 2YXGA 1KCZA 3N9RA 1XM3A 4NJGA 3FY1A 2P3EA 5DCEA 1XG3A 3P84A 4RZ4A 1YADA 4HJWA 1SW0A 1FDJA 1HP5A 4ZO9A 3P14A 4MKNA 4EP8C 1HKJA 2NV1A 3GAKA 4O0QA 3RITA 4J9JA 2QVHA 4HA4A 3O6CA 2OGJA 3MWCA 1FWCC 1F8MA 3FVDA 1OX4A 3GDKA 5KEZA 5BZAA 3VNJA 3P7YA 3CUIA 4U3AA 4LYQA 1KM1A 3F2BA 4V28A 3WDHA 3B8DA 3I4KA 1ZAIA 4PUEA 1K6AA 4L4PA 5F2IA 1K3UA 4AC7C 2I57A 1XLHA 2D20A 2D2OA 1JRCA 4U33A 3O16A 4AVFA 1PX3A 3EGJA 3ERPA 3D5HA 4OBTA 1EOMA 4K1GA 3OJGA 1RP9A 2E6DA 1H0IA 4PBFA 4LUSA 4L4MA 1ZUAX 5D8ZA 1KQYA 3E6EA 3TJXA 4UOZA 3DG3A 2J47A 1DIKA 3HPSA 3BJTA 3NQCA 1ENUA 3LG3A 3U2ZA 4S3GA 5SWUA 4TMBA 2QW5A 2XVGA 5RUBA 3H23A 4TXEA 3IUHA 2ISWA 5IXEA 2WBKA 4UQ9A 4HMEA 4ES4A 4PTDA 4UNLA 3DDMA 4DBUA 1JUBA 3BQ5A 4GQQA 2VR4A 5E09A 3NYDA 4NYUA 3O6YX 1GYNA 1AH4A 1R2TA 3J7HA 5KETA 4G1NA 1F8IA 1TWDA 4LWWA 3U48A 3CTTA 2R14A 4JIQA 1CGVA 1WYIA 2HZGA 3BJSA 1ADOA 4E8GA 2QYGA 1J10A 1EQCA 5DMLA 1UZ1A 1YLVA 1QK2A 2CHOA 4QDMA 1EC7A 4KW2A 4ZMGA 1JQVA 4WR3A 1QW7A 2DVUA 1B9BA 1IT7A 3M7SA 3MO4A 1QHOA 3PSWA 3A9IA 1NDVA 3GTXA 2CZVA 4KEMA 5FJJA 2X16A 3BCFA 4V33A 3JS3A 2OT1A 4EWND 4U4MA 4W7VA 3PHAA 1QU4A 4WY0F 2FKPA 4TO8A 4DBDA 3E38A 1NARA 2PF0A 3JZUA 3CAWA 3CLWA 3ECQA 4KESA 1MZRA 3COTA 4AHQA 2I17A 1OX6A 2ZQ0A 1UWTA 3GHUA 1UBSA 2C19A 3ZQ9A 3A24A 4R88A 3L23A 3VZXA 3LSCA 2NXGA 1SUXA 3TMQA 3VM5A 1S5WA 3SUUA 2X1RA 1EJUC 4DRSA 5B7YA 4QG9A 5HUOA 3B8WA 3RGTA 3LEPA 2G50A 3SUWA 1TJ1A 1UZ4A 3R8GA 1JYVA 1CXKA 4GKTA 3O1NA 3C4UA 3PR2A 4F3HA 3GVQA 4Y9PA 5AYIA 3MU7A 2WXDM 5JU6A 3UT0A 1DIOA 1HGYA 5I3FA 2FGBA 3GTHA 3RLUA 1E73M 2VGIA 5A6AA 1RVKA 2BV9A 2EHHA 1TV7A 3TXVA 4ERGA 2VOTA 4GVHA 3AMCA 3N04A 2PEVA 5D9NA 5HJYA 1PTGA 4I8YA 2ABBA 2PI6A 3R5EA 3IAPA 2G3MA 3RU8X 1JF5A 4HPJA 1VCVA 1E15A 1SGJA 2GSEA 3NZPA 5K9CA 4CEUC 3NL3A 2CIPA 1IR2A 3P5YA 2Z4GA 2P8BA 5FL1A 4IGMA 1PB0A 2CESA 1K4GA 1WKDA 1V6TA 2CKRA 3IJ8A 3QQWA 3WKZA 3BG3A 1E1CA 4ZXLA 3IACA 4L7ZA 3PZ9A 4ADTA 5AZ1A 4ZQPA 3CUZA 4DF1A 3NQDA 2Y1HA 2RJGA 4KCTA 2CLHA 4D6JA 4ZQNA 3SCVA 5MKGA 3HIJA 1XBVA 1M53A 1CCWB 1J6OA 3FVMA 2FZBA 5BU9A 5C9XA 3WDPP 1MYRA 1X7IA 4GY1A 3R8RA 2QUMA 2VX7A 3G1AA 1LRQA 5DFAA 3G1FA 2J8TA 3LDVA 1GVOA 4AWTA 2XUCA 5BXPA 5JVLA 2ZUMA 1GONA 4LUYA 5CBJA 1TZ9A 4TV6A 3UXAA 3TN6A 1UD5A 2J8FA 2QCGA 3K4DA 2JIEA 3M6YA 3LPGA 4KEUA 4RZBA 2CZFA 3GW0A 3H2NA 3W7IA 3MZ2A 3N17A 1AA1B 3RJYA 4WDUA 3DCPA 4K68A 4XKYB 1XYCA 3S1XA 5A8QA 3I7SA 2PP0A 1B4EA 2RUSA 1L9WA 3VU2A 3WEZA 4IX2A 4GVIA 4DXKA 1OVDA 1WXZA 5GVJA 3B05A 1YDNA 2B81A 3N73A 1OGGA 2OZ8A 3W6LA 5G4WA 4GYFA 4NHVA 3WIJA 4OQVA 3WELA 1EBHA 3WMCA 2VFGA 1ISWA 4U2ZA 2V67A 4C7FA 2BY2A 3L7RA 1HW6A 3T81A 5TIMA 1NWSA 4A2SA 1C7SA 1E1FA 4ORMA 2HS8A 4OECA 3S46A 2QUTA 2Y0FA 1UA3A 2GQ8A 1CLVA 2YXOA 1G9HA 3QYQA 4P61A 4UR9A 1IV8A 4GH3A 4EPEC 4HPHA 4MJMA 3S5ZA 3NOEA 2WM1A 3HQOA 2BASA 2W79A 1XRVA 3M43A 3DEQA 2XFRA 2YA2A 5HNTA 3CQJA 1HZYA 3L67A 3QRHA 1YDOA 1AQ0A 1DWAM 5DN1A 3WQ8A 2I5GA 1TVLA 3H8AA 5K9XA 4B92A 1K9TA 5C54A 3DESA 2QJJA 2MUCA 5CEWA 1KBKA 1FWAC 3GE7A 5D02A 1V08A 3ARQA 3K13A 3S1WA 3U9IA 2CXEA 3RU6A 4FX8A 1OFDA 4UQAA 3CT7A 4P8UA 1L2QA 1Q6LA 2ZYFA 3VIJA 1ECEA 4Y9MA 3DI0A 2QEZA 2X2YA 2W0UA 2NUWA 4C1LA 3RYSA 3TTEA 3BAKA 2PS2A 5A8GA 2NQ5A 3AZTA 2W5FA 4E8CA 5FF7A 2GDUA 4Q4RA 1U1UA 4J3UA 2X42A 1UOZA 4O1EA 4PMNA 2GJPA 4PODA 1M1BA 2A3EA 4R3UA 1DIEA 2WK2A 2W4XA 1UJPA 1RD5A 3UG3A 4KF1A 3SCWA 4WJ8A 2PRMA 2X7VA 4ADUA 1GZGA 3MHGA 1X1NA 4DZAA 5FL0A 3V0UA 2Y8VA 1W3JA 3TONA 1CTNA 1BTCA 1VPYA 3P0XA 1UHVA 1A5SA 2J13A 3VUSA 3W1LA 3PWGA 1F7BA 2A2IA 3NL6A 5BRBA 4MPQA 3T07A 4GCXA 5EA9A 5C8BB 1PIGA 1MNZA 3E2SA 3LI0A 2E68A 3ATYA 1PKYA 5EPDA 1TPDA 4ZOCA 3REQB 4JX5A 1V8EA 4EPBC 4WSKA 2WPBA 5FJOA 2WYSA 1YEYA 4J2MA 3VCNA 2J7FA 4XKMA 3PWAA 3TUUA 3UR5A 2AQWA 4IISA 4QDWA 2PTXA 1P1XA 5HR7A 1C91A 1BYBA 4PR4A 1X38A 1LM1A 3KBMA 5IDIA 2EGZA 1RBLA 3A23A 1BXBA 3B97A 3V75A 2XDFA 3DUGA 2FYMA 4WSJA 3B8UA 5CZJA 4C6OA 2VFFA 3MKVA 4IPJA 3ZT6A 1RCQA 3UD6A 2Y62A 1KTCA 4OU1A 3BV4A 1WUFA 4PEEA 3C61A 3AZSA 1L0PA 1P0NA 4WXYA 2AKZA 5DY3A 3M9YA 1GZJA 3T09A 4O50A 5HMFA 4B15A 2YX0A 3HQPA 5LZLA 4W5ZA 2PWGA 1DJGA 2BGQA 4ATLA 4YHEA 3UF9A 3OBKA 2Q02A 3CPRA 4GZ7A 4HTYA 5IOBA 4MZYA 3ABXA 3IJLA 5CLWA 5I78A 3KHJA 2OZ0A 3L0GA 3EX2A 4ATWA 4ROPA 2C14A 2QT3A 3AAMA 4FA3A 4Z2JA 5XIMA 1Z41A 1MUMA 3BAIA 1XRFA 1EHNA 2FZ8A 4AD3A 3GZ3A 1H50A 2E0PA 2CETA 1M6JA 3TTSA 1WNOA 1VB9A 4JTAA 2CU0A 1RQEA 3LRLA 3WX7A 2WCSA 2Y4SA 1B54A 1TV5A 4DM2A 1V0MA 2VVSA 1BWVA 2YXXA 1QK0A 5CGTA 3PUOA 2OSWA 4AZCA 4D6GA 1M5WA 1WKFA 2QJMA 3VDHA 4C1NA 1DWJM 1YBQB 3ZSTA 1XF0A 5BWAA 3BGGA 3GIYA 2FVMA 4ONVA 3TNOA 3TSBA 4S3EA 2O9RA 4MWAC 3UG8A 4PL1A 4PSRA 2CBIA 3VX1A 2CFFA 2ICSA 3W72A 2OZTA 3BMWA 1FKWA 5HOSA 4F9JA 3SQSA 4GK8A 4QCEA 3OG2A 3JZEA 3MMUA 1PAMA 3VIIA 5AYYA 4Z42C 1W9PA 7ODCA 1ZNNA 1NTHA 1XLGA 4CD6A 3RCMA 1OZMA 3G6LA 4NJIA 3UCDA 3W23A 4UWMA 3SY5A 1CI1A 3GR4A 3LN3A 1HN1A 3CO8A 3W70A 3VI2A 1ZJHA 4ERAA 4Y8FA 3TP4A 3W2KA 1E4IA 3NPUA 1PCWA 1Q8AA 4DWSB 4B9YA 3QQ1A 4GQGA 5A6BA 3BMXA 1S5NA 3M47A 4WRHA 2HISA 3H7RA 3VTRA 4JL2A 1Q7MA 1TMQA 3L4ZA 1GJWA 3VPLA 3W7JA 1WAUA 3VIHA 2J8GA 4UQEA 4GGHA 4IQJA 5I3IA 2DFAA 4E8DA 3SCRA 3GXPA 1X8FA 3OZYA 2XG9A 3UEQA 1RSCA 2ACRA 1WXYA 2E8ZA 1HQTA 1FWHC 3PTMA 3C0JA 1IE7C 5D33A 4IFOA 5KINA 1BPLB 4L5ZA 3VDAA 3EKGA 4NZ4A 1IT8A 2OG9A 2P8CA 4HK7A 2D1ZA 2YLLA 3DHFA 3EEZA 3W25A 1DJNA 3TMLA 5CPSA 4DF2A 3M07A 1RD6A 3A4WA 4NZ5A 1ELSA 2VDIA 1MUCA 1A50A 2PFHA 4UFLA 3VUPA 4Y8EA 4PUWA 2WLZA 1HP4A 1FWDC 1MFVA 4IT1A 1EP2A 1TCDA 4LRTA 4F0RA 2WOQA 3OGRA 4FNRA 3S1UA 1Q13A 1MDRA 1BKSA 3M0LA 3PS7A 3O07A 4Q32A 2VRJA 3VNDA 3CPGA 4I9JA 3V1HA 4ZZ9A 3O06A 4US5A 3AIRA 4QIUA 5BNKA 2XN2A 3SFWA 2D69A 3QHOA 1GVFA 1A53A 4AIOA 2HVNA 2ZZ5A 1EJWC 2UZ9A 4JFUA 5CXPA 3M4HA 4C6MA 1BSIA 1TWSA 2OEKA 1R2SA 1W3KA 2UV8G 1R2RA 5E70A 4HNUA 3DHUA 4DJFD 4L9XA 3PN8A 2WWCA 1SO6A 3TWBA 4KH2A 4TTUA 4O15A 1DV7A 2XM2A 1NQ6A 5I02A 1LYXA 4AZBA 2KZHA 3ARWA 5CJ5A 4CKQA 4MMWA 3UWVA 4FF7A 4DLMA 1EPXA 4PN2A 5C9RA 3DYMA 1LWIA 1L6WA 2A0NA 1YE6A 5DCDA 5AYBA 2A5HA 2WMIA 1Q4WA 3N14A 2R94A 3NGFA 3GXIA 1XC6A 1ME8A 5LNSA 5DO8A 3I6RA 3M0ZA 1QVBA 1YYAA 2ALDA 4U2YA 2RH9A 3HG4A 2Y89A 2NT1A 3IIPA 2ZBTA 3KE0A 2ISFA 2VL4A 2DH3A 3OTRA 4EX4A 3W7NA 1KCXA 2UY3A 4XZHA 1LOQA 2FPYA 1HVQA 1RALA 1C93A 2R8WA 4LAUA 4OV9A 2VD9A 1YPXA 2Y85A 3WF3A 3GNPA 3IJ7A 3NGJA 4QHRA 5JIWA 1P6CA 1ITUA 2DZTA 4YPJA 4NF7A 3DG6A 4L4OA 4DF0A 1J93A 3HTWA 1MI3A 1ZPTA 1RK5A 3EXSA 2GJXA 4O53A 4H83A 1ZLPA 2J24A 3GC5A 2Y6ZA 1QOPA 3CWOX 1NOWA 4NIRA 4UUIA 1OSEA 1CYGA 4XAFA 5HMDA 1WV2A 1RPXA 5HPCA 1W9UA 2XGZA 1DL3A 5A6TC 1ME7A 1OFPA 3MQTA 2R1KA 3T0AA 3EXTA 3MWAA 5DELA 3ZJ7A 3CL7A 4UFJA 3WLNA 2FPTA 1GK8A 3UXKA 3SIZA 3UPWA 4R9XA 3QV7A 3WN6A 1JFHA 2QR6A 1JZ8A 5ABEA 3HG2A 1JD9A 1CB7B 1J11A 5IHRA 4C6CA 3AROA 3A5VA 2YDAA 4Z2LA 4PCTA 2WKLA 4H7ZA 3V0TA 4MZ1A 4JN8A 2ZA2A 3VE9A 1O5RA 1B3WA 5ABFA 4IP4A 4B9ZA 1N55A 1R3RA 1M7JA 5A94A 3ABRA 3SCPA 2OQHA 2VEIA 1HL8A 3SJNA 1N2VA 4QJ4B 3GXFA 7REQB 3LMYA 1HJQA 3QC3A 3SCUA 3L4VA 4PFHA 2CBVA 1P0KA 2ZA1A 1C8QA 2HPIA 4KWOA 1FQ0A 1TTPA 1KFWA 4FPSA 3CZGA 2D0GA 3BDKA 2OTDA 1CWYA 3GX9A 1AJ0A 2YSWA 4GE8A 3B9DA 1HG3A 3T0CA 4PEKA 4F0SA 2CWNA 1QI4A 2YDSA 4EIVA 4WY0B 3MI3A 3IJIA 2DSZA 3G1RA 4B16A 2E40A 2O9OA 2NXIA 2WVVA 3ISIX 1HKIA 3APGA 2V5CA 5H91A 2VWSA 1W5NA 4DWSD 3LLXA 3QEZA 3ALFA 3CC1A 4Q8VA 5HNUA 2OT0A 4TU1A 3ITOA 3LERA 3P67A 4LUTA 4A8NA 1HJUA 1V3KA 3R89A 4Z1CA 1HKKA 5CZTA 4MWAA 5IRPA 2YIHA 4JNZA 1EEPA 1FWFC 3GVRA 4QM1A 4FP1A 3WK2A 1LOSA 3N29A 2OZ3A 1UUQA 2XGIA 1YTKA 3PBMA 1FFRA 4P2VA 1FHDA 2XINA 2V2CA 4DI9A 3N4AA 1TVPA 3W1QA 5REQB 2V5JA 3SCTA 1W54A 3GXNA 4ZFMA 4AD1A 4ZVJA 4AXNA 2YA1A 1SZEA 3GH7A 3P3BA 5CSYA 4JR5A 5J8LA 3PM6A 2B7QA 5FACA 4DUVA 4AVOA 4IUOA 3GUGA 3ME3A 4XZWA 5AKQA 5CG0A 5EFFA 3SCNA 2OVLA 4JTFA 1LJYA 4GISA 3GU1A 3AIEA 2C15A 5AYZA 2ZXDA 1WOBA 2GDVA 4GZEA 3O7UA 1UMYA 5I3DA 1DE6A 4O54A 2KX9A 1AQMA 2NQZA 1QPKA 1KFCA 2QAFA 2PTDA 3KFTA 1X97A 3PUDA 4DPQA 2RKXA 3UJFA 2FVKA 2PF8A 1BYAA 2C7FA 1BG4A 1OB0A 2WHLA 3SGZA 5IFTA 1S2AA 3AXMA 4HIBA 3THQA 1OM0A 1NY1A 1VFSA 2Z1XA 3SI9A 2RFGA 1VFMA 1R3VA 5AY7A 1XLAA 1UP0A 2AKMA 1KTBA 4HNNA 1L8PA 3KAOA 3PVFA 5TD4A 3L68A 3KRZA 4H2CA 3R4IA 4RDZA 4H3DA 3NZ1A 3FKKA 3PZGA 1VQTA 3CTLA 4INFA 4J35A 2IXUA 4AVNA 3AOFA 1EJVC 3KVJA 4F0HA 1FWIC 4E6MA 1F6YA 1IXQA 3GLCA 1OJXA 1ZBCA 3FFSA 4O0ZA 3MSGA 1IGSA 3WJSA 3MUIA 3KZPA 1TELA 4O1AA 3QH2A 5LIYX 3VOJA 4FOUA 2VUNA 1KD0A 2GGEA 1Q6FA 4H9MA 1OG6A 3OVRA 1SZRA 4A21A 4WCJA 2WQDA 5CPQA 4DO7A 3CHVA 3B9AA 3TK7A 1B3VA 3N4EA 3DZ1A 4H04A 4RDVA 1MUWA 4WGHA 1EIBA 3L4WA 5A2CA 2ZZ2A 5CGQA 3LQGA 4NP7A 3MTWA 1P1MA 1J0HA 3HM7A 3L0KA 3EWZA 4PMOA 4OBSA 3M5ZA 2Q8ZA 1F05A 3WO8A 3GVWA 4JFTA 1UKPA 5J5RA 1XD1A 4I5RA 2DUZA 4F0KA 1E40A 4GNKB 3GFZA 1VFLA 1OYCA 1P7TB 2E5DA 4IZGA 3AALA 3EB4A 1O68A 4JIIX 4AZ7A 4BQ2A 1KFKA 3VNMA 3T9PA 1UKOA 4UB9A 4UC5A 2Y7DA 2E09A 4Z1BA 1EQPA 1V0KA 3MCMA 2HSAA 3FJ6A 1K8ZA 1P0BA 6XIMA 2ZZ7A 3O6DA 1I9CB 3AYRA 3H2MA 3OQ8A 1ICPA 1BRLB 1LBFA 5GJMA 4R34A 3R0UA 2VEPA 1H7WA 3WYZA 1DE5A 2QS8A 4O17A 1GQKA 4YS1A 1NDZA 1H41A 1DQWA 3GTIA 4M7TA 5EGRA 4WQ6A 4JTQA 3ID7A 3AIVA 1A49A 3NSMA 4CQBA 5DT5A 1DKWA 3W3OA 1VFFA 2XIOA 4NUWA 3AXHA 1UASA 2FIQA 2DQXA 2XVPA 4CCZA 2OSYA 4YCPA 4H8HA 1V77A 3UNDA 4NQ1A 1HL9A 3KLKA 3TLLA 2E28A 3S5YA 6ENLA 3ZYZA 1FWBC 1XH0A 1ITCA 2WSRA 2Q8LA 5AYXA 1UWQA 3AS2A 2QCNA 4H9VA 2CEQA 1JZ6A 4D1JA 3ZT5A 3GYCA 1MNSA 3U0HA 2O9PA 5DRIA 5HULA 3SRKA 4ZR8A 4YTSA 4C6IA 4ILSA 3NQGA 3HN3A 4Z1AA 3CH0A 3CMGA 3EDEA 3E1F1 1EXBA 2CZEA 4QROA 4MOZA 2Y7GA 1JCNA 1VFTA 4KWWA 2Y24A 1H51A 5HQMA 2CPUA 2WJEA 3GR8A 4S2CA 3GG8A 4W88A 3EEGA 3B40A 2OKTA 4LOCA 1O5KA 1U30A 1R9ZA 2X40A 3DFOA 1A5MC 4JX4A 4FX6M 1W5QA 1QPQA 5DBUA 4ZTYA 2HPMA 3UXDA 2J7BA 4O8RA 4F48A 3AXIA 1KM6A 2V68A 3WQVA 4AISA 4HQVA 4TX8A 2F6XA 2BB0A 2VZUA 3UZJA 2HE8A 1JPDX 5FD0A 4JZ5A 3SEPA 5BYWA 5AC8A 1EDGA 4R85A 2A3LA 3A22A 1E6XM 4IJBA 1B3ZA 4LCSA 4CVUA 1SSGA 3L5AA 3UY7A 4K37A 1EPVA 4D72A 3UYIA 3WLIA 4H6EA 4MY1A 2GGGA 1Y5VA 4M80A 1S2VA 4RXGA 3ZJ8A 3HF3A 2UY2A 4ZOAA 2Z1SA 1QRQA 2PGFA 4I5XA 2E77A 1I2QA 4UNIA 4LRSA 4LS0A 4X61A 3QPZA 1WDSA 1XBYA 2E9MA 3ITVA 1XYAA 4AY1A 4KS0A 4DX3A 1V6VA 3EWXA 1JAKA 3HZ3A 3FV9A 1ML1A 3S83A 4KQNA 1LDCA 2OLSA 1DOSA 4CUCA 3F1QA 3HFTA 1W5MA 2QGYA 3GDLA 1DJZA 5HQLA 3EPMA 4LBRA 1LQ2A 4GOAA 4G7EB 4Q7NA 5I3JA 1I4NA 1MEWA 2YL8A 3FCPA 4S3CA 4XAPA 3L12A 4C90A 4GFSA 3PNZA 5DRCA 1K6WA 5D2VA 4WJEA 3WCZA 3OPSA 4FOJA 1ZBVA 3MP3A 1OT2A 3OODA 1SW7A 5F4SA 4DLFA 1Y5WA 2QJNA 1H7NA 4E38A 1ADSA 1Q2SA 2CHRA 4PCFA 3KOFA 3N2MA 2A7NA 2P0OA 3WLQA 1ZQ5A 3NQEA 5LIUX 4JAWA 4JFWA 4DWDA 3QC0A 2YDRA 3W1RA 3M46A 4BY3A 4BHYA 5E0KA 2HVOA 1XUZA 3S6TA 3VA8A 1VBRA 4FEZA 3VOIA 5KZ6A 3GIPA 2ZUUA 3WH9A 7XIMA 4M8UA 5DBTA 4NZ3A 1UP2A 3LHZA 3W7MA 3USZA 3BCJA 5TBOA 3PZMA 3I3BA 3TTQA 1HKVA 3FHQA 4AYSA 1JCXA 3WBEA 3AZRA 4NAEB 2PDBA 2PZNA 2EF9A 2VD8A 5EMUA 3DN5A 3FK4A 3MKKA 3QVQA 4EANA 1IWPA 4QG8A 1JPMA 4XKYA 3WH5A 1QMLA 1XWYA 3F4DA 4GJ1A 2CBJA 3TKFA 3BLPX 3NIYA 4D6HA 3EA1A 3KBSA 2VFDA 4R5EA 4AZ6A 2V9DA 2Z1VA 1EEXA 1ZCCA 4BF9A 4PB5A 5E9XA 4S3KA 2GVYA 1KO0A 1TPWA 2PWFA 1ONRA 2TAAA 1ZHAA 4GY7A 2EJAA 2OX1A 1ZB5A 1Q6EA 5C70A 2Z2AA 2XH2A 1VPQA 4ZGYA 1KLZA 3TOYA 1GWJA 1EA0A 3H21A 4P7NA 5D30A 1V79A 1W31A 1J96A 3QFWA 5FSDC 3QYSA 1QHZA 4ZCWA 3TAOA 3VIMA 1IQ8A 3PK7A 1ONXA 1QWKA 3IIOA 3OU8A 1RCXB 4IP5A 2NX9A 4FB7A 5AB3A 3IJDA 4Z2KA 4IQEA 3QLDA 1JG9A 3TEVA 1OFRA 1JNEA 1XIHA 1XL9A 4D8AA 3VNIA 2GVJA 3FA5A 4EVZA 2NT0A 3E0WA 4MSSA 3WMLA 4PA8A 2QIIA 4LVGA 1K8YA 1RXOB 3C2FA 4AHPA 2HBVA 3S9YA 4FXJA 2DW7A 1MZHA 4S1FA 3QZAA 2HRWA 4M24A 4Q8NA 5AN7A 3LD5A 4M56A 3CLMA 2F6UA 1OC7A 3QGVA 4L61A 1XDJA 4IJRA 4XZNX 2CLLA 4Q4SA 4ZXOA 1W0MA 2RDUA 1H1ZA 3SIMA 2EQDA 4M0XA 3N6QA 3A6OA 1B1YA 5HBFA 2R91A 4FNPA 5I3GA 4A8LA 1UKQA 1TTIA 1XPYA 3H4WA 1TX2A 3AJXA 3VOCA 3ZS4A 2IUZA 3SJ3A 3D0CA 3GNDA 3URQA 2BP1A 1TV2A 3ATZA 3AIWA 4TIMA 3ALGA 1IXOA 3B0UX 2WKJA 3BICA 2ZZ1A 2Z1KA 4GI8A 4AFYA 2Y5JA 3IVSA 4EK7A 1A5KC 1F4HA 4N6FA 1PWMA 4IL2A 4JKMA 3LZ5A 4PULA 1F3WA 4Q4OA 3W2LA 3CBWA 1XRSA 3CMJA 2VR2A 2ZX9A 4J3TA 1VP5A 2KAUC 5FI8A 2VO5A 1PKMA 2WHMA 4G56A 4A2RA 3B9EA 1IHIA 4IIFA 3WQWA 3GY1A 2CKSA 4LC8A 4LW7A 1VS1A 5CPLA 2DZVA 1W1PA 1RBAA 1ZCOA 2DDXA 3VNYA 3UCCA 1RJPA 3WNKA 3PFMA 4ZSTA 4IPPA 3ONBA 1BEUA 3MVTA 3WFLA 2EG6A 1GOIA 3REQA 3HG5A 4KWVA 3VD4A 5CZSA 2W92A 1ISVA 2J88A 4K8HA 4ZSUA 4M29A 4YHGA 3ARYA 2OYLA 4OOUA 3WQFA 5LA1A 3BL3A 1O66A 3MI2A 4F2BA 1YNQA 2GVGA 2GOKA 3VXGA 4GI4A 3RX3A 1F3XA 1TA3B 4PZVA 3TW6A 1XQKA 5D2WA 3SECA 3TU9A 4XIMA 3P6LA 1WZKA 3CO4A 3OZOA 3LSBA 3GXDA 3N2TA 1KXVA 1E51A 3FX4A 1J4EA 2Q09A 2GDQA 4RE0A 1JR1A 4LCRA 4R7OA 1E9LA 3B04A 2D0FA 4FALA 4N42A 5CKSA 3NNTA 3GH5A 3THAA 5G4HC 3WLSA 1MMFA 4KT2A 1S46A 3HJZA 3SUSA 3QOMA 4Z2HA 4H2HA 4O16A 1IR1A 4RJEA 2QPUA 1XIIA 4O1FA 3CV6A 3KL3A 3I6TA 3E0VA 4I7WA 1UCWA 3ZM8A 1LT7A 1HO1A 2DQWA 2PDLA 4RXFA 2VYOA 4IOTA 4I3GA 4WVXA 2C1GA 3MUY1 4H19A 4A22A 4IX0A 4PMVA 2JGYA 3PWIA 5EFDA 2NV9A 5ECVA 1GG0A 1GG1A 3B06A 3PJTA 1VRXA 1X96A 5D32A 3LU2A 4UQCA 4CVWA 4G7FA 3G1YA 3SCSA 4GQBA 3TX9A 1IXNA 4B5VA 3EPNA 2AL2B 2BY0A 2A4AA 4QEEA 1YBQA 4AWUA 3AUOA 4AWSA 4RE4A 3LCFA 1KR0A 4HKPA 1UW9A 5CPNA 3CASA 2Z1BA 4MJ2A 3IRDA 1CENA 3NCOA 1XLFA 1LT8A 2FGLA 1FUYA 3FHAA 1QOQA 1MW1A 1DWFM 1Z48A 4ZTXA 1Q65A 3UETA 4PTWA 3E3HA 3AHVA 3UESA 3RO6A 5J04A 1ITQA 2PODA 3AC0A 3A3XA 1J9YA 3T8QA 4E5TA 3BLDA 4IJCA 2YCIX 4LX4A 4DO6A 2EBNA 1OY0A 1R9YA 2PLKA 3AIUA 4KRZA 4P5UA 2CLPA 5D37A 2IPGA 3BLKA 3SADA 3ZLGA 2DIKA 1R3TA 1KW1A 1SR9A 2O4MA 4CN4A 2VC5A 3B3DA 5D2XA 3DYOA 1JDEA 2FZ9A 1XCWA 1RJRA 3QTGA 5LXXA 3BXWA 3VKAA 4UTMA 1E6ZA 1J0ZA 4JTSA 3WQ5A 3VFLA 4CLMA 3MUAA 2R1NA 3WL1A 4PCSA 3EX1A 2XFFA 4DWSA 1M01A 4MF4A 4HD5A 3MCOA 3WQPA 4YXGA 3OVPA 5EL1A 3UFYA 5LYRA 3P62A 5A6LA 1JYWA 4FF5A 4MADA 1TRDA 2A79A 2HMCA 2WMGA 2IPWA 2ACSA 1W32A 3SRDA 1REQB 3URNA 2J74A 4ASTA 5CBIA 4H6QA 4HU3A 3TZNA 2VCBA 4Y2WA 2VXNA 4QBXA 3WQDA 5AHLA 1G7VA 1ZFJA 4QP0A 2X0YA 2AAAA 1OC6A 1HUVA 3W73A 1LQAA 1LORA 3VGGA 5A69A 2FTYA 4KWUA 1W8SA 2WSKA 3CEUA 2J7EA 3GYEA 3JVAA 3NTYA 2V82A 4OE7A 5E9AA 1EP1A 2C0AA 1PIIA 2J75A 5DF0A 1WDQA 4LFYA 2VNCA 1OCBA 2XJ7A 3FW6A 1VBUA 3L5LA 4O1BA 2JALA 1EGZA 1JZ7A 1NF7A 4HSHA 1QOXA 4HBKA 1F3EA 2DJXA 4AIUA 3VOFA 1FDYA 1PXGA 2VX6A 5BXSA 1KRBC 1M41A 4DO4A 4IMCA 3POHA 2YBVA 4J27A 4ERIA 2J79A 6REQB 3OBAA 3CU2A 2GQ9A 1WQ5A 1V03A 4RNIA 2XIMA 3AMGA 4DZ5A 2C8NA 3N15A 1W3IA 2CXGA 2ZUTA 1SU5A 2PWUA 3QPEA 3H54A 4Q8WA 4EAYA 5H1WA 4BWLC 1XLBA 5BMXA 3LHYA 4NRSA 2Z26A 5GNXA 4RZ6A 5LNRA 4WD0A 3U8GA 3BLEA 1VLIA 2VFEA 4DB7A 3WQ6A 5CJMA 1OINA 3SRFA 2XN0A 4RPPA 4PMJA 3IIVA 4B2DD 3UY8A 4XIAA 2B7OA 3S3GA 1JCYA 2I56A 4MUPA 3APTA 3KRBA 1NU5A 2VZOA 2ONEA 3WENA 3W88A 2VENA 2X09A 4AG0A 3WDIA 4YYFA 1PPIA 3M0JA 3BSHA 1SJBA 3FGCB 1FH9A 3O3RA 1EF3A 3ZR6A 2YOCA 4UFIA 1RCOB 3E0FA 1FXPA 1BWLA 2XVKA 1M9HA 4M7SA 5A6SA 3CHFA 2YFNA 3QOKA 1TV3A 3NZRA 2V5LA 3BURA 2QIWA 1VFOA 1K7EA 2ACUA 2C13A 3BZGA 3OO2A 1E0UA 3VD7A 5LNWA 1E71M 4ZB2A 4UTLA 2FPVA 2ASHA 3F4NA 1VIZA 3HPAA 5KITA 3WD1A 1K7FA 4Q8QA 1EDQA 4PMYA 2F84A 3CUJA 3G1VA 4DQWA 2E6FA 3EKZA 4HNVA 2FHCA 2XFWA 4W8LA 1FH8A 6ALDA 1DIDA 1B3XA 2Z7GA 1U5HA 5CC7A 2PDIA 3TFCA 1XBZA 3VIFA 4DUXA 2E4TA 4DJDD 3NAVA 3CQIA 1G4SA 3CIVA 3IWPA 2OO6A 1M04A 1GQIA 2VOMA 2QMJA 3GHSA 4XAGA 5BROA 5HWMA 4JKKA 4ZBCA 3TFXA 1GHRA 2NV2A 1MEHA 1JGMA 2DZSA 1CGYA 4CU6A 4QGCA 3AO0A 2BGSA 3PAJA 2DSWA 3IV3A 3CYJA 2ZXAA 3S2MA 3OGSA 1D7FA 2D22A 1AFSA 1O95A 2BX7A 4DHGA 3N2OA 2MANA 4L6HA 4JTTA 2MNRA 4XTIA 2QF8A 3S5NA 2CLKA 3JUGA 4REQB 3W0KA 2HNHA 4DJED 3CMFA 1JRBA 4B3LA 1TQJA 3E2VA 5A2AA 3BE7A 1DTUA 4WLCA 3F5JA 1HL2A 1IIGA 3IVTA 3FN9A 4QS6A 1MXDA 3NDOA 1Q7QA 3ANVA 4EWJA 2DZUA 7REQA 3W02A 5DMMA 3A3WA 1EOKA 2C1IA 3WEOA 2A6NA 5ABHA 4N2YA 5HNNA 4UQDA 4YLWA 1XBXA 4O0KA 1WZLA 1JIBA 2QCDB 1O1HA 2JIWA 2ZTKA 4QR6A 3QGAC 4A8IA 3HGSA 4C6NA 5XINA 4U5KA 4GY0A 4HTBA 1E6QM 3E49A 2NWSA 1UZDA 4HN4A 1TE1A 4XO7A 4WY0A 4JIHA 5U4NA 3UA3A 3UWYA 3NVDA 2GJLA 3K4AA 3ENLA 4GZJA 1Z42A 3GG0A 4JQ4A 2WANA 4DNHA 1NWTA 1X1ZA 1NDYA 2HQAA 4IIEA 1UA7A 1IEQA 1F5ZA 3WD3A 3QSTA 4GA8A 4FHAA 3NQFA 2O4QA 4KRUA 3QZEA 4KERA 4CCCA 4YIWA 4ZE5A 5C55A 3TJIA 4DVOA 1OABA 4OBRA 2WZTA 4GBUA 4U31A 3ARTA 1EGVA 1YPIA 4GNVA 3NXFA 3UP8A 2NQHA 2GK1B 1GNXA 5HNRA 3C2YA 4JX6A 3DFPA 4DM1A 1EJRC 2VZSA 2FZMA 2JF6A 1RR2A 5LXEA 1ZJIA 1E0XA 3LPPA 3EWWA 1G01A 4LF1A 3UWUA 4DELA 1V3JA 3OLEA 5REQA 3RO8A 4GUFA 1UR9A 4L9YA 3OHMB 4ATDA 4K7YA 4PTVA 5G1MA 3AHTA 1AODA 1EL3A 1NAL1 2VKZG 3FIGA 3VINA 3HV9A 5C2CA 1YXYA 3SUVA 1UC4A 3W1UA 3DC0A 3UR2A 1QNSA 1CLKA 4W87A 4AD2A 3GR7A 2YYUA 8XIAA 5M2FX 3U2OA 3TN5A 1NVMA 3LM7A 1RY8A 1S3TC 1UWUA 1TPEA 3ARUA 3UNTA 3T6CA 5CAKA 1CXEA 1FCBA 2O92A 2A7PA 2Z1WA 1XS2A 4KFNA 3N9SA 9RUBA 1OD8A 3IUIA 5E6ZA 4XB3A 2C16A 4WDTA 4O12A 4LYKA 3E5PA 3LCWA 1XYBA 1ITXA 2UY4A 2QPSA 1SYTA 1TWIA 4RUBA 4DZIA 4WUIA 3DAQA 3TYDA 2VGFA 1R30A 2V0TA 4BZYA 2YJQA 1VFUA 1EHAA 1KGUA 1MXGA 2A3HA 3A4AA 1L6FA 3IPWA 1FHVA 4UTTA 2INEA 2P10A 1J2WA 2HTMA 4DBWA 1F61A 2X7WA 1HKMA 1HIZA 4WF7A 3QN3A 3NG3A 2WCAA 3LS9A 4UMBA 5K4ZA 2PWVA 2WZEA 5CJNA 3AIQA 3IIXA 4G1KA 5AVHA 4XX6A 3LMZA 1EH9A 1B2YA 1TKKA 2PMQA 2WNZA 1OFAA 3WK3A 1PZ3A 4H9UA 1YXCA 4XD4A 5TNVA 3O05A 3PZIA 4NNBA 4H7CA 1FCVA 3L4TA 2E7FA 4RPQA 1DVJA 1TMHA 1B5TA 2Q01A 3NR0A 1OF6A 1UUOA 5G2WA 4E2DA 3IK4A 1EUNA 3PPFA 3VKDA 3BOXA 3CJPA 1C29A 3CWHA 4JXCA 3ZVHB 2J7DA 2JGQA 1HXJA 1JI1A 1Q5MA 1V3HA 1E9ZB 2XSAA 3PZVA 4PMXA 1N82A 5E1QA 1J79A 1P7TA 5IFPA 2JKEA 4NNCA 3SQMA 2C6QA 3OEXA 1FP9A 5A6KA 3ARRA 3ZXWA 5D8WA 2EG7A 2ZRVA 1TVNA 4K1WA 2TMDA 4RV3A 1KB3A 4AH7A 1TG7A 1TPC1 4F9DA 4Y90A 3DI1A 3U2CA 1BRLA 5FF2A 3VGEA 4H4IA 1AH3A 1KV5A 3LY0A 4O13A 2YZ5A 3HBLA 1XRTA 3KHDA 4N9BA 2AGKA 3KVLA 3UBPC 3W87A 3M5VA 2VURA 2F6KA 6TIMA 4GI9A 4A35A 3CT2A 2ZFAA 3TWAA 1SZNA 4JGDA 2RGMA 4TTGA 1E0WA 1WUEA 4HN8A 1MW0A 3AI0A 4XD5A 3IGUA 1IWBA 3LUTA 4WZHA 5CC5A 3SBFA 3LPOA 4JTEA 1FWSA 2QZRA 1BAGA 1DXEA 1HJXA 2DVTA 1JF6A 3G22A 4UTUA 3Q67A 3FDKA 4MVAA 2E6AA 3AYVA 5CCZA 4L4LA 2DVXA 3EDFA 1AZ2A 3UZZA 1X8CA 3OIHA 4G6CA 4WK9A 1DBTA 1KFBA 2ZZ3A 1R38A 2R1PA 4WSHA 2DIEA 2IQDA 2VVNA 5BU6A 4EF9A 6TAAA 1EJTC 4RDYA 1NH6A 4POCA 2I5IA 1GJPA 2PB1A 2ZADA 3ZR5A 3R25A 3ITTA 1UWRA 5G5IA 4W85A 4WGXA 4J28A 4QQ3A 3IS4A 3ZIZA 3MDWA 5LIWX 3R79A 1H7OA 3ABSA 4KEZA 1W1VA 2ZCGA 4MG4A 4MKSA 2QMKA 3W53A 2FVLA 3II1A 1E1EA 3LXBA 3QR0A 3TA6A 4MNLA 4D9PA 3E5BA 3UGVA 1ZGDA 4KKXA 4LY4A 4YYCA 2FHFA 4RNHA 3GQYA 4X22A 1U5JA 1XLKA 1OK6A 2CNCA 4AF0B 3WFZA 5FESA 1NOFA 1KBJA 4IMFA 4ACZB 1QTWA 3BZJA 2NSXA 4BI5A 1QNVA 1QUMA 4YJ5A 3MV11 3ITGA 1AD1A 4F8XA 2QJHA 2OR2A 4KBXA 5T8GA 3PNUA 4FI4A 4YVVA 2ALRA 3WUFA 4DBSA 2FGZA 4AMCA 1XH1A 4NVTA 4PUKA 3QHMA 3ZO9A 1FXQA 2DV0A 4MZ8A 2VZVA 4ZOEA 1H61A 4AY7A 1TB3A 5G4EA 1XQLA 3P8JA 3CZJA 1YW1A 4PE8A 1XIFA 3VCRA 2HK1A 1V6XA 2ADAA 3SW6A 5M5DA 1EUAA 3WF4A 3MUCA 4B5UA 3BCDA 2PSNA 1TCMA 1HX0A 2QPXA 5A8PA 4UR8A 1EKOA 3L4XA 2OJPA 3W7LA 3R8HA 5CSRA 5CG7A 4J3SA 3T55A 3G1SA 3NPWA 3G6MA 1QNQA 1L8NA 3QBUA 1Z89A 4HZ8A 2OFJA 3RPTA 4A3HA 3SSZA 1SFLA 2BLEA 2XPKA 4XBJA 2QLYA 3DFSA 5LGXA 5F2MA 3VGDA 3G2GA 2P3ZA 4JTHA 3LLDA 2Y63A 2ZE0A 1AJZA 2XWEA 3ANUA 3MKCA 4PUMA 3RM4A 1T40A 3RAOA 4HGXA 4XV0A 4JIRA 4UFHA 1HVXA 5DQPA 4V15A 3FNDA 4G7EA 4Z17A 1MEIA 4AEOA 3JRKA 1XINA 3UWEA 4XUGA 3RMEA 1XFCA 4AIBA 1EIXA 4Q8PA 3T0TA 2IQ0A 2BZNA 3PY2A 5KZEA 5AC6A 3RCYA 3G24A 4HMNA 2W3ZA 2WSYA 1K8XA 4AXKA 3D6NA 4YCOA 4RK8A 3HPXA 4J3XA 1KRCC 4IUGA 1O5QA 4Y6GA 2WAGA 4N9CA 4JKLA 5GPRA 1AMYA 1F07A 4LEQA 1F76A 2I14A 1PKLA 2VTFA 2VEMA 2FJUB 5FEZA 2PPGA 5EMYA 3GNOA 1JULA 3FYYA 3EDKA 2V81A 1K70A 2JF7A 1FWWA 4GUGA 1W37A 4AZHA 3C52A 2J9XA 1UPPA 5DMYA 3BOFA 5H8PA 2DZBA 2A3BA 1W9XA 4HNOA 5C2GA 4NAEA 5JBFA 3ZT7A 3TA9A 3KUMA 3WBAA 4LXFA 4K38A 3TW7A 3KBNA 1BVZA 3PTKA 2POTA 3N34A 4Q4PA 2ISVA 2YDQA 1E4LA 4JS3A 3WLJA 2G3JA 5I3HA 1F74A 1EJ7L 1XP3A 1F6KA 3BO9A 2NX3A 1AVAA 2WBGA 3PULA 2AQVA 3DYPA 1EYWA 3A21A 4DAIA 5ENLA 2OYKA 1RQHA 3I6EA 3DFTA 4NILA 1O4UA 4BK9A 2H8ZA 2V30A 1G69A 3N18A 2OMAA 1KCKA 1JL8A 4JICA 4AY8A 5FJRA 4FK9A 3OYZA 3G8EA 2D2JA 1QNPA 2POZA 4GIAA 1NEYA 3ZOAA 1GVRA 3N12A 1V3IA 3BANA 1NWRA 8XIMA 3LCGA 4NX0A 4J3VA 5HWNA 1W1B1 2PD9A 3LENA 1VH7A 1LF1A 1JUEA 4O1DA 1E9IA 4QE4A 1KM5A 1QR7A 1PCKA 1R3QA 4IGSA 1VBGA 2BXVA 1TJRA 4IQLA 3AHYA 2FB2A 1OGBA 2C3ZA 1FWGC 4HOZA 1SO3A 3CYVA 3QMRA 4FXSA 3PJXA 1JCMP 4HPGA 2REQA 1DWHM 3BAJA 4PRTA 1WOAA 3PB0A 2QUVA 3UQNA 3W86A 3CAQA 4O18A 4XZMX 3I10A 1UC5A 2IKIA 4IF2A 4MJZA 5FEXA 1A5NC 1EO7A 1RA0A 5GNYA 3H26A 1PEZA 3GFXA 4D8ZA 4NKCA 1VRDA 3V18A 2YGYA 4HNLA 3HJEA 4QAWA 1YDYA 4LCQA 4IXXA 4L6DA 4EPKA 3ICJA 4XZIA 4O57A 4WDXA 2C79A 2P50A 4MJ4A 4OHQA 1K1DA 1L2UA 1WXJA 1OYAA 3TYZA 1EFZA 1MFUA 2VP8A 1C9WA 4HCLA 4S3DA 1T8XA 2QCFA 4TX6A 1TX0A 4HCDA 8TIMA 2V5DA 1V7AA 4FSAA 2DT1A 3UCQA 3CHEA 5GQBA 3USBA 2R6OA 3AS1A 3TC7A 1XGDA 3G0UA 2VDHA 4PUUA 5CLTA 4FXRA 4AZ5A 3DFQA 4QNWA 4LQ1A 4XUYA 1VZWA 3BH4A 3GUWA 3WY1A 4XVEA 2XH4A 1UH3A 4ZA0A 3SR7A 1JXKA 1OCNA 1W9VA 3MUZ1 4S3FA 4FIRA 1UIOA 1Z8AA 3RNDA 3RDKA 4O1CA 3AWNA 3H24A 4M5PA 4Z0JA 2G3IA 4OJYA 2WVSA 3IGXA 3QV6A 1K9FA 2OLHA 3KRSA 4E3TA 1QDSA 4AW7A 1ONWA 8CGTA 3SCQA 2GYIA 4NL1A 2D2GA 5F1VA 2EPNA 3EDDA 3VKBA 1CECA 2GZXA 4J3ZA 5F2LA 7PTDA 3T08A 3OA3A 4I9TA 3GC2A 3AYTA 3AMLA 3W84A 4IL0A 3R10A 4F2UA 1FP8A 3QY8A 3WD4A 1TUFA 1PYMA 3QW3A 5IM51 1CXHA 4GKLA 2Z28A 1MRAA 1UJQA 2ZDSA 1K02A 1SFSA 5I06A 1S5TA 1IGWA 3M6DA 3VIGA 3WEMA 1KBBA 1TA3A 1C8YA 3PTQA 4HHHA 4WKAA 3PZQA 4C6EA 5DANA 5K9DA 2NZLA 3W38A 1A4LA 3M44A 3HB9A 4K7VA 4WKFA 3M16A 1BKHA 4ZENA 2ZICA 2ON3A 4ALDA 4E4UA 3T2PA 1RHCA 5G2IA 2VCCA 4B3ZA 4NX5A 3B8TA 1UB3A 1FKXA 1AW1A 3ITCA 3C3NA 5CH9A 2ZX8A 3I3EA 4JTIA 2OXNA 1OX5A 4UZSA 3VDCA 4NJJA 3GBDA 3OVQA 1DP0A 4NZCA 3FXYA 4LVDA