2J9XA

Tryptophan synthase in complex with gp, alpha-d,l-glycerol-phosphate, cs, ph6.5 - alpha aminoacrylate form - (gp)e(a-a)
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
266
structure length
263
Chain Sequence
b'ERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLSRSGVTGAENRGLHHLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKIIEKNLASPKQMLAELRSFVSAMKAASR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPTOPHAN SYNTHASE ALPHA CHAIN
molecule tags Lyase
source organism Salmonella typhimurium
publication title Allosteric Regulation of Substrate Channeling in Tryptophan Synthase: Modulation of the L-Serine Reaction in Stage I of the Beta-Reaction by Alpha-Site Ligands.
pubmed doi rcsb
total genus 102
structure length 263
sequence length 266
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 2006-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2j9xA00
3GIYA 5D09A 4TR9A 3C2FA 2CLKA 3W83A 3B0VC 1N7KA 2VELA 2BXVA 3SGZA 3NPVA 5LHEA 4O8RA 5G4EA 1JCMP 3S5OA 1X6UA 1LOSA 1WXJA 3HGRA 3F4NA 2QCFA 3TSBA 4ADUA 5HR6A 3G0UA 5EA9A 1WYIA 3SSJA 3G1VA 5LNUA 3W7PA 5HULA 4RJEA 3EX4A 4HN4A 3DAQA 5K4ZA 3HQ1A 3L21A 3W1TA 4XQ6A 1KM1A 5F2GA 3CU2A 3DU0A 2WO5A 1FXPA 2A7NA 4BR1A 2ZCGA 3DHDA 1YDOA 4OGZA 5HWNA 1LYXA 3QPYA 2EKCA 4M5PA 1XL9A 1AL7A 1KM5A 1KFJA 3P80A 5CKSA 4IMEA 5CZSA 4X3ZA 4JY9A 3HF3A 5K9CA 1FUYA 4Y9AA 2P1FA 2ISVA 4MFEA 5D05A 1RD5A 4Q33A 4PTNA 3G1XA 3SFKA 5FEZA 4UFIA 1T8XA 4O1CA 3IIOA 3TROA 1Z41A 2E5CA 1H61A 3W9ZA 3OVPA 1B57A 1SSDA 3LXBA 3BLFA 3LGEA 4JDYA 4NU7A 1F5ZA 3M43A 2GVJA 3BLIA 1M7PA 1S3HA 3FS2A 3RFAA 3W7KA 1JQXA 4MIMA 4DF0A 2QCCA 4BFAA 3JR2A 1R2SA 4DO4A 1FDJA 2HTMA 4K39A 4JYDA 4N2YA 3NQGA 3CHVA 1LOLA 5F2LA 1EX5A 4IGHA 2V0TA 2ZRXA 2V5LA 1DVJA 2G96A 1RQHA 4CCDA 1ZCOA 1GVSA 5LNSA 1PE1A 5ABTA 1JCJA 1TPFA 1XM3A 2VEPA 1ME8A 4JX5A 5G2WA 5K9DA 4LS1A 1M5WA 1GZGA 2QDGA 4A21A 4XKYB 1H7XA 1KM6A 3BPWA 3DFPA 1WV2A 2NLIA 2X1SA 4PC8A 2BLEA 1BWLA 2I14A 3SECA 3HG4A 1KM4A 4JYFA 3F03K 1ZAIA 1EP2A 4UIOA 1YXCA 2GUUA 1OFDA 4JGDA 4IXXA 4WOZA 5D38A 2YFOA 3TIMA 1TREA 5G4WA 1MXSA 5AHEA 4BI5A 3LBCA 5HUOA 3W7CA 3E12A 2BX7A 1SZEA 3B0PA 1KFLA 3K30A 2W6RA 3NO5A 3QMRA 4JICA 3W71A 4GUFA 1OYCA 4Y90A 3S6DA 5HUPA 3PSWA 1SO5A 3W2KA 2ALDA 4WZHA 5DY2A 1MEHA 2OT0A 3NQEA 1OFRA 4EVZA 5F2MA 2ZDRA 2NXHA 4GWEA 5KZDA 1EUNA 4ZVJA 3KFTA 3DZ1A 1NF7A 4O52A 4HPJA 2GOUA 3BARA 2QUVA 3NDOA 1O94A 1Q6QA 1NEYA 4DPQA 1ZENA 4QM1A 1DOSA 2VFDA 1TPVA 1VCGA 4DPPA 1IIGA 2NX9A 2QCEA 3MMTA 1UUOA 5LGZA 4C1KA 3W23A 2QJHA 3GR7A 1EP1A 4MY8A 5KZEA 3N2XA 4ZQCA 1C8VA 2GJNA 4Z08A 5KITA 4S2BA 3S5ZA 1BKSA 1TCDA 3PBVA 1TSIA 1KTBA 3LXCA 1KW1A 4PL2A 2FFCA 3DFQA 1JJKA 3STFA 2CLHA 5G2HA 3W7OA 3PUEA 3NR0A 2R14A 3N14A 1ZAJA 5FEXA 3T40A 2Z2UA 3UWWA 3HO8A 2YX0A 2H3BA 2Y6ZA 3LCXA 1ME7A 1R46A 4LVFA 4HNVA 3EEGA 4I9AA 3KXQA 2XN1A 2WOQA 3M5XA 1ZFJA 4M7TA 2VFGA 3HJZA 4XBKA 3Q58A 2P10A 2V81A 1GOXA 1FWWA 1IXOA 1TJPA 4AWSA 1J4EA 1TV8A 5TQLA 2GVLA 5D2TA 3GB6A 3WJXA 3TFXA 1KBJA 4LT9A 3IGSA 3MI6A 5AFDA 4HPXA 2YXGA 1VS1A 1QNVA 2GPTA 3NEVA 3EXSA 4WXYA 1GT8A 1H7RA 3DFSA 4UR8A 2YZRA 4OV4A 1OX5A 1OFAA 5LKYA 3T4CA 1ICPA 4UTJA 5AHLA 2PCQA 1JRBA 3GXPA 1TIMA 1JUEA 1HTIA 4HKPA 2ZBTA 1O95A 4IMCA 1EPXA 4AEOA 1YTEA 1TTQA 5L9FA 3HPXA 3MI3A 3WJSA 1VYRA 3EX6A 4AWTA 2WKJA 2ZTJA 1A50A 1L6WA 4NJJA 4WD0A 3W2NA 1RQBA 4YCOA 2YFNA 3WFAA 3TNOA 1QR7A 4WOQA 3CWNA 3QC3A 1H1YA 4LVAA 5D2VA 2GVGA 3W7LA 2A85A 3UWYA 1MEIA 3T44A 3CIXA 2ZQ0A 5AHMA 4ADTA 3UQNA 1KM2A 3LTYA 4UFJA 4AAJA 1BEUA 1VJIA 3P60A 3P7YA 5AC6A 2E5DA 4YL2A 1WQ5A 1YLVA 3CT7A 4UC5A 1WOAA 3OVQA 5F2IA 1RZMA 3PG8A 1W5OA 3KOFA 1DL3A 1ICSA 1GG1A 3TX9A 3NM3A 4FNQA 3EWBX 4UTTC 2VFEA 3STEA 1VGAA 2NWRA 3A21A 3E49A 3HG2A 1VRDA 1LOQA 1EIXA 2FJKA 2Z0IA 2A7RA 1JQVA 5H2ZA 3MBFA 3PY2A 4FF7A 3BVJA 2TPSA 3NGJA 2C6QA 2RDUA 1R30A 1IXQA 4IMGA 5K7JA 2YGYA 2DJXA 2QJIA 1YDVA 2WNZA 3WK0A 2E09A 2QJGA 3B05A 3HOJA 5DCEA 2H8XA 3MW7A 2E6DA 1W5NA 4EIVA 5D32A 2ZRVA 2Z6JA 3L5LA 1LRQA 2YW3A 1QWGA 3S8HA 2NX1A 4JNMA 3TH6A 3EWZA 1FQ0A 5I3GA 3IGUA 1VHNA 4HT3A 1E51A 3F4WA 3W86A 3EB2A 3G8RA 3G0SA 1OX6A 4MKNA 5KMYA 1DJQA 4JTFA 2CLEA 3C52A 1JCNA 4NXSA 1WOBA 6ALDA 1LORA 3O8AA 3W1PA 3L66A 3KVLA 2NV2A 5C6MA 4UNLA 3IV3A 2A4AA 3V1PA 1Q6OA 3EWXA 3LLDA 2GQ8A 2B7OA 3A23A 5DELA 3M47A 5HINA 1SFLA 1XFBA 1EWDA 3LHWA 1SZFA 1H50A 3CIWA 3SW6A 2QCNA 2EPHA 2PRLA 2CU0A 4RZ4A 3QSTA 1FY6A 1EWEA 3N9RA 3QW4B 3NL6A 3SIZA 4O54A 2QCMA 2DZWA 4X22A 2A0NA 4Y6GA 2Y62A 3QMTA 3U8GA 4RLIA 4MUZA 4MLRA 1PV8A 1G4PA 3FFSA 4O0KA 5I3KA 5D2XA 5D2YA 4UNKA 3LBMA 3C56A 3VE9A 3CQ0A 1B4EA 1XKYA 3CEPA 4PODA 3N2MA 3FLUA 3M5VA 3RMJA 2CWNA 1QOQA 1SR9A 3NM1A 3W1UA 1YPFA 4TMCA 4NX0A 1JRCA 1B3OA 3GAKA 2XFWA 2RDTA 2Y61A 2ZRZA 3TJXA 5K9XA 3PR2A 3MHGA 1MEWA 3AJXA 5F4WA 2JKAA 5AC7A 1VQTA 3QJAA 4QAIA 4NT0A 3G22A 4I7VA 4LTSA 1JCLA 4CQAA 1ALDA 3EX1A 5CPNA 3G1HA 5D03A 3FYPA 4O0ZA 1L9WA 3WJYA 4M6PA 1G4TA 4HNNA 2Y7EA 1YXDA 1GPWA 4UTWA 4IMFA 3LCLA 4Z1CA 3UWZA 1TTPA 2RDWA 2TYSA 1MZHA 3I7SA 1VHCA 4RZ6A 4WX2A 1HO1A 1Z48A 1K02A 1EEPA 1VLWA 5CG7A 1KFKA 3Q94A 4FNSA 3W7HA 1ME9A 4JTHA 4NX5A 3MP3A 4MZ8A 3O6DA 4UTIA 4C1LA 3WK1A 3R2GA 2WNNA 5D04C 4LS0A 4IX2A 4KWVA 4YXGA 2ABBA 3IVSA 1BWKA 1TRIA 1IXNA 2YR1A 1W31A 3GDLA 5TBOA 2RKXA 1K7EA 4O10A 4N4PA 2CZ5A 1UUMA 3W7MA 1VLIA 1LROA 1TPUA 2J9XA 4MJZA 2CLIA 4KFOA 1X1ZA 2E6FA 2O7QA 2ATSA 4ZZ9A 2EAWA 3GZ3A 4AWUA 3LLFA 3LTPA 3MUXA 4CQ9A 2PC4A 1ZALA 2ZZ2A 3DKLA 4R34A 3M0ZA 3L5MA 3EKLA 1QPNA 4HNUA 2X30A 3KHJA 4NNBA 2YSWA 4O13A 5DXYA 3ABSA 1EA0A 3TMLA 2DZSA 2CLLA 5U4NA 4UUIA 4UTKA 3DFNA 3G1AA 2NWSA 3EWWA 4FX7A 3G1YA 3RF9A 5C54A 5HR7A 3ABOA 1GVFA 1H7OA 3LHTA 2CFFA 3IEBA 3NPXA 4OBTA 2E5BA 2ZRWA 4NUWA 2V82A 3KAOA 2RH9A 3HGSA 4EF8A 4FNRA 5LZLA 2G95A 5D30A 3QF0A 1VPXA 1GWJA 5C55A 1NF0A 2DZPA 1K7FA 2QEZA 5EPDA 1IF2A 2BWGA 2B4GA 1P1XA 1W54A 4K7VA 1KBIA 1ZNNA 3C2RA 3E96A 4FNPA 4O19A 3FJ6A 2ATMA 1S5VA 3TSMA 2OX1A 3W84A 1QMLA 5KTLA 4E38A 5A5WA 5CPMA 4BWLA 1FWSA 2VEIA 3GDKA 4S2CA 3TR2A 3IVUA 3QH2A 1A5BA 3O1NA 2BTMA 4LVBA 3UWQA 4ZQRA 1GG0A 1XUZA 3THQA 1TPWA 2NUYA 3BG9A 3LOTA 2WPBA 2HMCA 2BZNA 4K8HA 3E02A 2G5WA 3PB2A 3TKFA 3EX2A 1L6YA 3NQ8A 2Y88A 5HNRA 3FJLA 4O53A 5G1TA 2A1YA 5MHBA 1SO4A 3DI0A 5LNRA 2D73A 3BW2A 3W75A 1FWRA 4O17A 3TC7A 2C3ZA 2O7SA 3W7IA 2G97A 1CX9A 2ZA1A 3R12A 3ZWSA 3GNDA 3QEZA 2XN2A 4CNOA 2RFGA 2ZZ3A 3N19B 3P5YA 4IUOA 4K7YA 1W1ZA 1J2WA 3W1NA 3I65A 1GYNA 4AHQA 2ZA2A 1TMHA 1W37A 3C61A 4JTJA 2VFHA 2VENA 3MI2A 4LOCA 3B06A 1VYSX 3WJZA 3O16A 1LLWA 1K8ZA 2TRSA 3TQVA 1O4UA 2H90A 1W0MA 2Y85A 4UXDA 3QMSA 2AAMA 4DQWA 4KKXA 1XUUA 3G3MA 3S0CA 3P8JA 2ZTKA 1G4EA 4N02A 5DBUA 4A22A 1A53A 1YADA 3W7NA 3PVFA 1TJRA 2FPYA 2A6NA 4QISA 4AHPA 2Q3OA 1YDNA 2J27A 3SR7A 3OG3A 4M6VA 4QJ1A 1T96A 1JUKA 3NPWA 3CM4A 5FEWA 4UTWC 3G1SA 1RPXA 3GNNA 2NX3A 4A2SA 4JIPA 4CNNA 5HWJA 1QPOA 3P62A 4BK9A 1OF6A 5J5DA 1GVOA 1R2TA 3STGA 4N9BA 3MP5A 5FESA 1XC4A 5D02A 1DV7A 4WJEA 5EKYA 1AW5A 2QCDA 3W1QA 3VI2A 4TMBA 2VEMA 2R91A 1KM0A 4R33A 3VKJA 3N9SA 4QNEA 3NPUA 3QZEA 1F6PA 1LBLA 1X8FA 2RHGA 4DXVA 3NVTA 1YYAA 3THAA 1OHLA 4BI6A 5LNVA 3TUUA 3EKZA 3O05A 2EF9A 2F84A 4R53A 3HGOA 1OVDA 3TE9A 1K3UA 3T78A 3W2MA 2R8WA 4IPIA 4MY9A 1RQEA 4GE8A 1FCUA 2F7FA 3DH7A 2B0MA 2QUTA 3P61A 3OVRA 6TIMA 3ATYA 1RVGA 2JKEA 3LV5A 4UTMA 4LW7A 4BWLC 4LV4A 2HS6A 1K8XA 2CZFA 4D2JA 4OT7A 1M6JA 4MVAA 3RU6A 1SFJA 1KFBA 3W7QA 5FF0A 3BW3A 4QNWA 3SJ3A 2Y7FA 3NQ6A 2FQIA 4PL1A 3V75A 2DU2A 3ZWTA 1O5KA 4KFNA 1WAUA 3LCFA 3P5ZA 1T0OA 1THFD 1XBYA 3AO0A 5LGXA 3G0XA 3LHYA 2OZ0A 3M7WA 3HB9A 5SWUA 1HUVA 4CCEA 1JCXA 2NXGA 2A6LA 3PBUA 4WQ6A 3O15A 4K36A 4HSOA 1DBTA 3I7QA 1IIHA 2C13A 3PBYA 5D2WA 2R94A 3S5NA 2VFIA 3W88A 4O12A 2VFFA 2ZZ4A 5BMXA 2PURA 2V5BA 2I1OA 4U28A 2E68A 2NUXA 1PS9A 4U4MA 1FXQA 1ZAHA 1SSGA 1LTDA 1TPH1 4N6FA 5G1YA 1PCWA 1LLZA 8TIMA 4UTTA 5DY3A 3LTSA 1W5QA 2V2HA 3FEMA 1DJNA 4IQLA 1LBMA 5F4SA 4TO8A 3N73A 1XDMA 4DF1A 4IWWA 3UYCA 3W7EA 2LLEA 5AB3A 3W2JA 1Q6RA 3PUOA 2E77A 2B7PA 3LRMA 1QCWA 1F7BA 4NQ1A 4QSHA 3MO7A 5KINA 3HPSA 5AHNA 4CNPA 1OYAA 2A2IA 4ICNA 1QFEA 3MHUA 4JTKA 2ABAA 3NQMA 3W3OA 5C5YA 4S1FA 3UNDA 4H4IA 1X7FA 4O18A 3NQCA 3UY7A 3IIPA 4IX0A 3NNTA 1D9EA 3RNDA 1HO4A 2JK2A 1GVRA 2ZZ7A 3UXAA 1TQJA 1H51A 3BGGA 2V2DA 3WJWA 1QDSA 2DZVA 5AYYA 4N6EA 3IRDA 3OIXA 3QQ0A 1L2UA 1M7OA 3CTLA 2WJZA 1AW2A 3PULA 3LRLA 4O14A 1I2RA 4LWWA 4Z1BA 5J5RA 2OJPA 2QR6A 3KVMA 5U7SA 4K37A 3H55A 4AF0B 3L0NA 2FIQA 1EUAA 2HS8A 1JR1A 4MZ1A 1G4SA 4IXHA 5E1QA 4OQVA 4JX6A 4AF0A 1Q45A 3E9AA 4IMDA 5CZ0A 4WUIA 3CC1A 4GJ1A 4Y8FA 3O06A 4O4WA 2AQWA 1P5BA 3W87A 3TAKA 3VFLA 3SGUA 2FB2A 3CLMA 4TU1A 4P2VA 3W72A 1A5AA 1O60A 4NJIA 5G5IA 2CZEA 5DXXA 3I68A 3L0GA 1OFEA 2FPVA 2GQ9A 3BK0A 2EGZA 1KV8A 1XCFA 2DORA 1SQ7A 4E2BA 1NFBA 3C8FA 5AN7A 5G2IA 5K3VA 1OFOA 3U6WA 4UFMA 5BOOA 1TTIA 3TA6A 2J6XA 3QSRA 2H3DA 1GYLA 2WQPA 3C2OA 2J9YA 4NZFA 3GDTA 5F4XA 3LCWA 3G18A 3OEXA 4ZQMA 4LC6A 1TB3A 3TCEA 3NQ2A 4DBEA 3IIZA 3GLCA 3VNDA 1Q6LA 5CSRA 2C14A 3W7DA 4OU1A 3GDRA 3TQKA 3R8RA 1QPQA 4HIBA 3LX9A 4H6KA 3HIJA 2CLFA 3PF3A 1LM1A 3BO9A 4K38A 4A2RA 4LS2A 2GJLA 4GUHA 3LHZA 3Q2DA 3H54A 5DLCA 5F1UA 1AL8A 4MOZA 5KSWA 5T26A 4WXZA 1PCKA 3U2OA 3P84A 3UPWA 5A8GA 2FLIA 2QDHA 1D3GA 4XZ9A 1KFCA 1ZJIA 2X1TA 4FX8A 3MJYA 2VXNA 3S5YA 1AG1O 2I9EA 3LHVA 1ONRA 3PBWA 1SZNA 1G6CA 4Z1AA 3W7RA 4N9DA 3PS7A 3VE7A 2B7NA 3GYEA 3DI1A 2J24A 3M6YA 5AHFA 5FF7A 5EL1A 2A7PA 3A9IA 4H3DA 4MY1A 4TIMA 1N8FA 3B03A 3CB8A 5DCDA 2YCEA 3FOKA 4UMCA 4HNTA 4FNTA 3EXTA 3W22A 3LRKA 3UPBA 3PWAA 4MYXA 4ADSA 3DKJA 2DZTA 1OX4A 3B04A 4XKYA 4LC8A 4POCA 3UXDA 4ZMGA 1RR2A 1JCYA 2XN0A 1TPDA 1F76A 4JD4A 3MYOA 3NQVA 3R89A 3W70A 4MZYA 4DO5A 4GUJA 2ISSA 1S5WA 4G1KA 4OE7A 5AHIA 1WA3A 4WY0B 3HG5A 3S42A 5D33A 5CGQA 4JTIA 3T55A 3LERA 1OG0A 5BRBA 2V30A 3UD6A 3JS3A 3NG3A 1PHQA 2BSLA 4JEQA 3S9YA 3BG5A 3KRUA 1LRTA 3DXIA 4M6QA 2QF7A 3NL5A 3LHUA 3CEUA 1XBZA 3GKAA 5LSMA 2VKZG 4Z0JA 1MSSA 1GEQA 3STCA 1T99A 1I45A 3PUDA 3TSDA 4GNJA 5EYWA 1A5SA 2C16A 1B9BA 3M5YA 4N4QA 3S1WA 3PM6A 1XI3A 1VR6A 4ZL1A 1SW0A 4UMBA 3GX9A 2E6AA 1YPIA 2OMAA 2X2GA 1W3TA 3PAJA 1U83A 1F74A 3NZRA 1Z42A 1TV7A 3E0IA 2NZLA 1F05A 1SO3A 1AK5A 1I8JA 4LUJA 3UZ5A 4RXFA 5HWMA 1JUBA 4PFMA 3HGJA 1XBXA 2JGYA 1GQNA 4CLMA 4GXMA 5FEPA 1OFPA 1ICQA 4JDBA 3MBDA 3TV8A 1GVQA 4FXSA 2CZDA 3LDVA 4YCPA 2TSYA 5I3HA 3L2IA 3W1AA 3NQAA 3LV6A 2ZZ6A 1OFQA 3QQ1A 4I7WA 3KRSA 2CLMA 4RK8A 1FBAA 5DN1A 4FIQA 3JRKA 3W07A 1DKWA 1HL2A 2X16A 4ORMA 3LM7A 4ZQPA 4PH6A 4NJKA 2Q8LA 3HG3A 4AB4A 2QAPA 2HSAA 3M1ZA 1DORA 1YTKA 3R5EA 5TIMA 4JYEA 1GJPA 3G24A 4B5NA 1FCBA 3PG9A 5IM51 5KZMA 4P61A 1H62A 5HJLA 2W79A 1QO2A 5I3JA 4X9SA 3B4UA 3GKFA 5GVJA 1V5XA 1I2PA 4E2DA 4ZQNA 4ML9A 2H8ZA 3GK0A 4J9JA 3DHFA 1MO0A 3A24A 3WK2A 1A5CA 3BGJA 1TTJA 3MHFA 4RV8A 1AW1A 3QYQA 4OHQA 2Y70A 1H5YA 3EX3A 3A5VA 3W2LA 1GTHA 2JBMA 3G8EA 3W1MA 1YTDA 2PRMA 4UFLA 4JTTA 1OABA 3I6RA 1G67A 3IVTA 1W3NA 3QW3A 4AVFA 4EOUA 1X1OA 3QM3A 1G7VA 1UBSA 2B7QA 3FKRA 5CZTA 4PEKA 3QRHA 1QO5A 3FKKA 4MFDA 3TC6A 2WSYA 3S1UA 4FX6M 3KRZA 1G7UA 5LHFA 2WNQA 3NL2A 4QQ3A 1PIIA 5CZJA 4O11A 2NV1A 4UFHA 1OF8A 2IQTA 4FEZA 3EWUA 1H7NA 2DP3A 3OA3A 2VC6A 5K2ZA 4O1AA 1FWNA 1KLZA 5BW6A 2X1UA 5D37A 2Y7GA 4RKAA 1JVNA 4FIRA 1VC4A 4AMAA 4JTGA 1LZOA 2X1RA 5CPOA 1P0KA 3L5AA 2NUWA 1FCVA 4WY0A 4ORIA 2Y89A 3TW7A 2CW6A 1W5PA 5LNWA 1VYPX 4IPJA 2ZA3A 4XTDA 4M19A 3UZJA 3TW6A 2AGKA 3OBKA 4EWND 4ZQOA 1FDYA 3ANYA 4DO6A 1LDCA 4LY8A 5EBUA 1H7WA 3M41A 3GXTA 3DFOA 1BTMA 1LRNA 1F2JA 5HQEA 3L0KA 3GXNA 4BF9A 1JULA 3FA5A 4GRSA 1VH7A 1W3IA 3INPA 3M9YA 1W8SA 2H6RA 3C3NA 3LI1A 1K03A 4AHOA 4PCFA 4JTLA 2TMDA 1WBHA 4YMZA 2J9ZA 4JX4A 3W76A 2WSRA 3P74A 4DF2A 3TAOA 5IBXA 1C9DA 2DJLA 4EF9A 5I3FA 4O50A 3KVKA 1N55A 3NQFA 1SO6A 2FDSA 2GQAA 3NZ1A 2A21A 2A5HA 3GVGA 4NJHA 5AOUA 4ALDA 3OHIA 4MPQA 3KVJA 4AXKA 1SPQA 1DQXA 4JTEA 3BG3A 1QPRA 3C6CA 3IIVA 3TK7A 3UWVA 3LXAA 1PVNA 3SZ8A 5CPLA 2PE4A 1R2RA 1K8YA 3Q37A 4GBUA 1ZY9A 1KA9F 3ZS4A 4UTUA 2W0UA 1OK4A 2KZHA 1I4NA 1H1ZA 1G69A 4LV9A 4M7SA 4RX0A 5EMUA 3W6YA 1VCFA 1DHPA 4LRTA 3NOEA 2C15A 1ADOA 3I7RA 1XDLA 3G1FA 1IXPA 5CSSA 4O16A 1KLYA 7TIMA 4FHAA 1KTNA 2E1DA 3LCIA 2P0OA 1ZHAA 4HHPA 4UMAA 2UV8G 4Y96A 1UJPA 2QAFA 4LVDA 4K8EA 2J88A 2QCGA 1F73A 4RXGA 3O6CA 4CQ8A 3CWOX 1UB3A 3W1XA 2PRHA 2Z1BA 3MYPA 2YPIA 3M16A 3C2VA 3L67A 5K4XA 1WDWA 3MWAA 4MJMA 3TQ0A 3IGXA 5BNKA 3LI0A 3MP4A 3ZFHA 3DENA 2ZYFA 3D0CA 4QIUA 5E0KA 5I3IA 3N34A 4Q4KA 3QPZA 1PHWA 3LCHA 1CW2A 2ISWA 3VCRA 3W85A 3C2EA 1TPEA 3O07A 2QKFA 3NXFA 4NZJA 3USBA 3RLUA 4A29A 3NAVA 4QITA 1F6KA 3BW4A 4I7UA 2V8ZA 1SW3A 3L68A 4L4LA 1I2QA 3FIGA 3CPRA 4JS3A 5E93A 3DGRA 5F1VA 3P82A 3TXVA 3BLEA 5FF2A 4DEFA 1LP6A 2VOMA 3NQDA 3W74A 1NSJA 4LRSA 4O1BA 1FWTA 1OFBA 4KFPA 2Q8ZA 3LCGA 3GR8A 1OJXA 2Y63A 2YYUA 4LVGA 3W1RA 3WK3A 4NNAA 3B0UX 3ABRA 1H63A 2QCHA 2WV8A 3W2UA 3RLVA 3P81A 4WY0F 3YPIA 1XBVA 1I2OA 1TYGA 3L65A 1QAPA 3HMJG 1OK6A 4AH7A 5FF3A 4OV9A 1PL9A 4R7JA 1Q3NA 1DQWA 1HFBA 3IIXA 3TXZA 4KWWA 1Z44A 3NL3A 4N9CA 4A3UA 3S1VA 4UR7A 4JN6A 2QCLA 4FXRA 4GFSA 4XTIA 3DFTA 1B4KA 4N9EA 4MYAA 2C1HA 2ZZ5A 2YDAA 3SY5A 1P0NA 4RZ5A 3TDFA 1J5TA 1TQXA 4RCXA 4JXCA 2C19A 1WBJA 4CCCA 3O63A 3GAYA 4BI7A 4YWIA 4UCGA 4JTUA 2OT1A 3A22A 3ATZA 2C18A 4XWUA 1TPC1 2OCZA 3TMQA 3GDMA 1VZWA 3A5FA 2DZXA 1KM3A 1H7PA 5BMWA 4O4VA 4W9TA 1SZGA 1YXYA 3T7VA 3NQ7A 4GUIA 1OX4B 1U5JA 1Y0EA 3G3DA 3R13A 1AMKA 3F1QA 3HPZA 1FX6A 2FB3A 4Z1DA 1L6SA 2E6YA 3KX6A 1D3HA 3NYZA 1SUXA 5AYXA 2Y7DA 1LBFA 4YLWA 1O5XA 3G1DA 3PSVA 4NVTA 3HBLA 4O15A 4XBSA 3TJLA 2NXIA 4UFKA 4MLJA 4Z0SA 4OWGA 2V2CA 2QUUA 1UCWA 1XXXA 1TV5A 4ONVA 1KV5A 2Q3RA 4IJBA 1H60A 1UASA 1K7XA 2EHHA 3W7JA 1VCVA 4XUGA 1W56A 1NAL1 3S1XA 1R47A 3ELFA 5FI8A 1OYBA 3M44A 3W7GA 2VEKA 4NXKA 2C0AA 2JGQA 5FF4A 1TPB1 3EWYA 3DBPA 1GTEA 3FYOA 1RV8A 1QOPA 3N3MA 4FB7A 1IGSA 4LU0A 3B8DA 3O6YX 3L9CA 3BV4A 4UTHA 1FCQA 4DELA 2ZFAA 4JY8A 4E0CA 5AYZA 3QFEA 2Z6IA 2JKPA 1P4CA 1KFEA 4TX9A 1EB3A 4RR4A 1LCOA 5HMSA 3P8IA 1SW7A 1FDZA 1EP3A 3PC0A 1TO3A 3LB0A 1V7YA 3W1LA 4JR5A 3TFCA 3SI9A 2WSQA 4FO4A 1ML1A 4O28A 4JTSA 1KTCA 5EY5A 4JIQA 3ZR4A 4PA8A 4Q32A 3PB0A 3RK8A 3EXRA 4GUGA 4L4MA 3UY8A 1NVMA 1TRDA 5IBXC 3C0JA 3NA8A 3UWUA 1HG3A 2YYTA 1CI1A 1WX0A 5DCBA 4X2RA 3W73A 2V9DA 2QCDB 4LUIA 2DZUA 3TU9A 4NJGA 4O57A 5AC8A 4NNCA 3H53A 3P67A 2ZZ1A 4K6AA 2CLOA 1C29A 4O1DA 5C2XA 1SU5A 3C4UA 4LNYA 1W5MA 5H91A 3ABQA 5L6UA 3M5ZA 4IOTA 4UTLA 4DBDA 2FPTA 1S5TA 4GC4A 2YW4A 5DBTA 2ZRYA 4FNUA 2ZRUA 4HSNA 1I2NA 2FTPA
chains in the Genus database with same CATH superfamily
4GNVA 2CLKA 3IK2A 3H4GA 1TA3B 3BLPX 3KWXA 5LHEA 4J3XA 2QF8A 4DYJA 5G4EA 2X0SA 1JCMP 1ITCA 2RUSA 3BCDA 3F4NA 3TOPA 3TSBA 2FVLA 4ADUA 8RUCA 5HR6A 3F4VA 3SSJA 3PTDA 2IQ0A 3W7PA 5HULA 4JPGA 3SBFA 5A8MA 4KESA 4KCVA 5A3HA 1LLOA 7ENLA 1XLLA 2VC5A 1ISXA 3DU0A 1IGWA 1FXPA 3DHDA 5HWNA 3D6NA 4FLRA 1JD7A 1AL7A 1KM5A 1HX0A 1DE5A 1UWQA 3DIPA 3FSTA 3U48A 5K9CA 2QIIA 4LCSA 3XINA 2ISVA 1JXKA 1AH0A 2C79A 5D05A 1RD5A 4PTNA 3G1XA 1Q6GA 1MXDA 1T8XA 4JFVA 4O1CA 4ZTYA 3IIOA 1VENA 1EEXA 2E5CA 3W9ZA 1IEQA 4FPSA 2CITA 4GVIA 1FRBA 1SSDA 4XD6A 4G6CA 1IR1A 3RFAA 3W7KA 4MIMA 4DF0A 4BFAA 2R6OA 1EJ7L 4A8LA 2ACSA 3GUGA 1FDJA 1QNRA 3MVTA 4K39A 1D2KA 4N2YA 3NQGA 3WUFA 1EX5A 2PTZA 3GR4A 1E3XA 1L8NA 3H7UA 1XRSA 2HK0A 2GL5A 4DBSA 3WFZA 4PBEA 4A21A 1HJUA 4ZB0A 5I7GA 3NXLA 3VA8A 1VFUA 3VDGA 1WV2A 2NLIA 5CLTA 4PC8A 2F9RA 1EZ2A 2I14A 1ONEA 1RAKA 1EP2A 2GUUA 1C93A 1PZ3A 1OFDA 3L7RA 1UH2A 4EXQA 4ZGYA 2YFOA 2Y2WA 2ZX8A 3WH8A 2PS2A 2Z29A 5GPRA 3M46A 3W7CA 1RK5A 3AYVA 1W2VA 2BX7A 3OGVA 4LF2A 4GX9A 3K30A 4HMDA 3N4EA 4JICA 4LYQA 1KCLA 3W71A 3N29A 1UHVA 4Y90A 5HUPA 1SO5A 5LIXX 2ALDA 3BLOA 3FVDA 5DY2A 2OT0A 4LUTB 2ON3A 4YN5A 4XAZA 3WELA 4UQ9A 4ZVJA 3WFLA 3LGGA 3V4BA 2QHAA 3VNKA 2VX6A 4O52A 5DMNA 1PB0A 2GOUA 3BARA 2ZXAA 3NDOA 3AUOA 3O6AA 4WHBA 4JBRA 1DOSA 3AFBA 2OKOA 2NX9A 2QCEA 1UUOA 4CKQA 2G3MA 3WDJA 3W23A 1QHZA 3ERPA 1UR9A 5KZEA 2DUXA 3N2XA 5JH2A 4Z08A 2YL9A 1BQCA 4S2BA 3VGGA 1BKSA 2IKIA 5HQLA 3AHVA 3DFQA 4PTDA 2CLHA 5G2HA 4U31A 3W7OA 4AD1A 3NR0A 2P53A 3QV9A 3COTA 4AZ6A 4GJIA 3VK5A 3AWNA 3AYTA 5CGTA 1C8XA 1S2TA 1J0ZA 2H3BA 2YX0A 2Y6ZA 1NDWA 3LCXA 1ME7A 3QGAC 1HN1A 1NDVA 1XSKA 4V2XA 3M5XA 1PPIA 3ZJKA 3TR9A 3HJZA 4GO9A 4XBKA 4HD5A 1HT6A 3BSGA 3BSMA 1GOXA 2CBVA 3UG5A 1IXOA 4IFOA 1F6YA 4AWSA 1J4EA 3UGVA 3PPCA 3CZEA 1IV8A 3GB6A 4DUOA 4GBDA 1Z7AA 1V3IA 1XLEA 4HPXA 2VZUA 2GPTA 1GT8A 4QS5A 1KCKA 1OX5A 4UWMA 4NF7A 1IE7C 2PCQA 3M0JA 1GOMA 1HXJA 2VI0A 4IMCA 1EPXA 4MNJA 3L4ZA 2X40A 1US3A 1YX1A 1UKQA 3MI3A 1LJYA 2PGEA 3W6MA 1JIBA 6REQA 4NJJA 3WBWA 3LNPA 5MKGB 2Y8UA 3TNOA 5BWFA 3QC3A 3WBEA 1XV8A 3MVIA 3BC9A 2QULA 1X7IA 3UWYA 2FTWA 2DT1A 6PTDA 2WJDA 1KM2A 5HPOA 4QR6A 3P7YA 4A6GA 5I5RA 2E5DA 1RBOB 4JOMA 4PMUA 2PWDA 4Y7EA 2W5FA 3AALA 1XH0A 5I09A 2EJ1A 3VIIA 1RZMA 1UR8A 5CBBA 4LGXA 3KOFA 2J7FA 4MAVA 4J3TA 1GG1A 1PAMA 3UXIA 4Q22A 2WMGA 5A6LA 3HG2A 3HQPA 4GG9A 4CEUC 4FS9A 1LOQA 1EIXA 3AIEA 5H2ZA 3PY2A 3NGJA 3K1DA 1IXQA 4IMGA 4ZE4A 3DCPA 5K7JA 2DJXA 2QJIA 4YVPA 4F8XA 3B05A 4ZEPA 3HOJA 3RIKA 3U9IA 2E6DA 1W5NA 5D32A 1EGVA 3OODA 2ZRVA 1R3VA 1XLIA 3MT1A 2YW3A 3A4AA 3TOYA 1QWGA 3VTRA 3S8HA 4DM1A 2J6VA 1V02E 3FJNA 1VHNA 3SN4A 3IJ9A 4ILSA 1HZYA 1ZU8A 5KMYA 5EMLA 4CUCA 3WMBA 2CLEA 4NXSA 1WOBA 4HZ8A 2X05A 3R10A 2XIOA 3O8AA 1Q6FA 2NV2A 3AZRA 1OY0A 4QJ3B 2HK1A 2A4AA 3L4UA 3V1PA 1M7JA 3N17A 2FDMA 3B9EA 3GE7A 1W3HA 4EWJA 3EMZA 1RLDA 3LLDA 4Q3MA 3I4KA 2QT3A 5DELA 4S3AA 1FP8A 3M47A 3GHRA 1KB3A 4JQAA 4GZ7A 1XIEA 2PRLA 2NW0A 3N9RA 4XKMA 4H8HA 4J3SA 5TF0A 2QCMA 2VRKA 3UZZA 2DZWA 4A8RA 4AMCA 3UT0A 1GW1A 2CHRA 4JCLA 2Y62A 3S2JA 3U8GA 4MUZA 4RPQA 3MS8A 1PV8A 1UH4A 1G4PA 3FFSA 2HXTA 3IJLA 3TJIA 3WYZA 2ZUMA 3PN8A 3MCMA 4MWAA 3DYMA 3CQ0A 3OJGA 1XKYA 1WZMA 1QNOA 2ZC8A 1XD0A 3NM1A 3GAKA 4HBKA 2QXWA 3WNKA 4QHRA 1B0IA 1XPGA 2XIIA 3UJ2A 4NT0A 4LTSA 4CQAA 2XGBA 3T0TA 4GABA 3FEQA 2X1IA 3WJYA 2ZOXA 4HNCA 3U7BA 4UQBA 2YCIX 1YXDA 1FWAC 4EP8C 2VR5A 4EXBA 3LCLA 4NL1A 3NUKA 3IUIA 2RDWA 1NFPA 3B4YA 2A3CA 4FNSA 1ME9A 3W25A 4C7GA 3CWHA 4MB1A 3MSRA 2OG9A 4C1LA 2WNNA 1MYRA 2DIKA 5HDRA 2ABBA 2PTDA 1DJZA 1BWKA 4H41A 1IXNA 1W31A 2QV5A 4N4PA 2VGBA 1UUMA 1U5HA 4KFOA 4L1XA 4ZZ9A 3WUEA 3FN9A 3MUXA 2X8RA 2WW5A 3URQA 3DKLA 3KRBA 2ZZ2A 3LS9A 4F0KA 5A95A 3M0ZA 3L5MA 2X30A 1GZJA 3KHJA 3QZ6A 1GPFA 3SJNA 1BFNA 4UTKA 2NWSA 3AYSA 2C71A 4DN1A 3OP2A 2BB0A 3T2OA 5HR7A 4S3CA 3LHTA 4OBTA 2CFFA 2E5BA 3DHUA 2V82A 4PRTA 3EOLA 2RH9A 4EF8A 3IWPA 1G94A 1VP5A 5D30A 1R8LA 1ENUA 3H4XA 1DWFM 1YKWA 2XGZA 5C55A 2WKGA 3TYAA 4U2YA 4DVOA 1W54A 2OO6A 2BGQA 2W61A 4P8XA 4ATWA 3TSMA 5A5WA 1JD9A 3E2RA 4S2CA 3IVUA 3PPGA 3QH2A 4PCTA 1OC5A 3BE7A 1GG0A 1WZAA 4JFTA 3B8UA 2OWCA 2QUNA 5CH9A 3E0LA 4D8AA 2WPBA 2HMCA 3WLMA 2CLPA 2G5WA 3PB2A 5HNRA 1GOKA 5C0QA 4P5UA 1SO4A 3VGDA 3HA1A 2OYKA 3WNMA 2C3ZA 1PIGA 1CX9A 4I9JA 1Z3NA 1TUXA 1FWBC 3H2CA 2XN2A 1JAKA 1DJHA 2DUAA 2CWXA 2RFGA 3N19B 4K7YA 4GY7A 3WN6A 4AHQA 1Q2RA 1TMHA 1W37A 1MNSA 4XX6A 2E1WA 3RX3A 3M0XA 1LL6A 4LOCA 2I56A 2J25A 1LWIA 3O16A 1V6WA 2H90A 5DFAA 3WLQA 2DZBA 3N15A 4LJ3A 2GUYA 4DQWA 3TN5A 4PTMA 3S0CA 3SM0A 4E3TA 2ZTKA 2WJFA 1KQYA 2FZNA 4GCAA 3W7NA 1TE6A 3PVFA 4GA8A 2FPYA 2A6NA 3AS3A 1NWTA 4JCMA 3SEPA 1EDGA 2J27A 3SR7A 3OG3A 4GYFA 5I02A 4M6VA 2I17A 4Q6XA 4GXWA 4B3LA 2WWCA 1JUKA 5CBIA 3CM4A 5FEWA 3G1SA 5H8MA 3GNNA 2V68A 4CNNA 5HWJA 1QPOA 3DBNA 1GQKA 1OF6A 4HHHA 1R2TA 1B2YA 1UWSA 4RNIA 1XIDA 4GYKA 4AZIA 5HJYA 1B1YA 4WJEA 1VBHA 3W1QA 5C9XA 1J96A 4TMBA 3VIPA 4JNYA 1WKFA 1KM0A 2PZNA 3WQ4A 1JYVA 4YTUA 2EEXA 2WZEA 4I6KA 3IUDA 3CH0A 4GVGA 3TUUA 4MKVA 2EF9A 2F38A 4HZMA 4GQBA 2R8WA 4IPIA 1UZDA 2F7FA 1RCXB 2B0MA 4M29A 3MUIA 1BRLA 2QUTA 3P61A 4GQQA 3LMYA 1E70M 1RVGA 3S3GA 4UTMA 4ATDA 2CZFA 4DJFC 4XB3A 1M6JA 3RU6A 1KFBA 4QNWA 2WZHA 1AJ2A 2J8FA 1IEVA 2GDUA 3ZWTA 4KFNA 1WAUA 3LCFA 3PZOA 1T0OA 3AO0A 3G0XA 4Q4MA 3M7WA 3MUY1 3HB9A 5SWUA 5FKYA 2GJXB 4CCEA 3EA1A 4WQ6A 5FACA 4K36A 1GONA 1DBTA 2VCBA 4FR1A 4HNOA 3V0UA 3EDKA 3PBYA 2R94A 1ZUAX 2POTA 2PP3A 1R3RA 4O12A 2VFFA 1JL8A 5BMXA 1JZ7A 2PURA 2WZIA 2I1OA 3BANA 1VPQA 3NYDA 4U4MA 1FXQA 3D5HA 1LTDA 1PCWA 1GYMA 2F2KA 2V2HA 4QEEA 1VFOA 2WVVA 4IQLA 1E0VA 5F4SA 3RHGA 3I3DA 2VTFA 4DF1A 5AB3A 4Q8WA 4CQCA 1Q6RA 3LRMA 1EXBA 3R94A 1F7BA 4NQ1A 4QSHA 3NVDA 2VC7A 3F2BA 3ZYZA 3HPSA 4DZ5A 5AHNA 4CNPA 1OYAA 4C6MA 4AIOA 3UNTA 2WHMA 2ABAA 2ACRA 1ITXA 3NQMA 4HMNA 4L9ZA 3UY7A 1YBQB 4IX0A 2JK2A 4L7ZA 1EYEA 1TQJA 3BGGA 2V2DA 2IPWA 1XIFA 4F79A 4N6EA 3OIXA 1K9EA 3QQ0A 3CTLA 1AW2A 4EAMA 2FVKA 1PKLA 1SJBA 3QV7A 5J5RA 4YYCA 7A3HA 3R11A 3H55A 1ZP4A 4IXHA 1Y65A 4B9ZA 3E9AA 4IMDA 2PUZA 2DQWA 3O06A 3STPA 4AZCA 3SGUA 2FB2A 3CLMA 4LQ1A 1GJUA 1M01A 2OTDA 1BSLA 2PWEA 2FPVA 2GQ9A 3BK0A 4K3ZA 2P3ZA 1V0MA 4K8GA 2DORA 5A6AA 3VIOA 4GIAA 1DWJM 3SIMA 1PKNA 3TA6A 3I3EA 4QDWA 3QSRA 2J9YA 4AZGA 3C86A 3OEXA 4ZQMA 5B7YA 1JPHA 5M2FX 3NQ2A 3VNDA 6CGTA 1Q66A 3W7DA 4QG9A 3TQKA 5CJMA 3R8RA 3LX9A 1ADSA 2QDEA 1SJCA 3GU2A 1R86A 4JQ1A 4GUHA 3LHZA 1XQLA 1MW0A 1V0KA 5AZ1A 3NIYA 1MWOA 4MOZA 3GTXA 3W28A 4IIFA 3U2OA 2XIBA 1FOBA 3UPWA 2FLIA 3TYZA 4XZ9A 2X1TA 4GC3A 3S5YA 1AG1O 4W84A 3IACA 1EA9C 3RPMA 1GNXA 1G6CA 3K8KA 3MO4A 1FHUA 3WH9A 4FR6A 5EFFA 2J24A 1R9XA 4DUVA 5FF7A 4TIMA 3QLLA 1XYCA 3FOKA 4UMCA 4WDWA 3KP1A 1F3WA 1G9HA 3QN3A 4J35A 4ADSA 4Z1YA 3IJQA 3B04A 4JFUA 4LC8A 4ZMGA 1JCYA 1O68A 2XN0A 3KZPA 1QK2A 3SCNA 1TPDA 2Z1XA 4DO5A 3MKKA 1S5WA 3KBWA 3VOIA 1WA3A 3QR0A 3S42A 1KKOA 1M3UA 3WLIA 1UROA 5CGQA 4FZIA 1I1WA 4JTIA 1OG0A 1WDRA 1Q4WA 3N12A 1PHQA 3R4IA 3MDWA 4JEQA 1LRTA 5G1MA 4M6QA 4P8UA 3APTA 5A6SA 3KLLA 3KBNA 4LX4A 3EGJA 1EOMA 1V6TA 5LSMA 4ZB5A 3MCOA 3C2YA 3HTWA 4GNJA 5EYWA 2PGWA 2I16A 4R9OA 2BVTA 3M5YA 2BG5A 2YBTA 2J7BA 4R85A 3GX9A 4MHBA 1W8GA 2C1GA 1F74A 3VD4A 3ZM8A 1PTGA 3SN0A 1AK5A 3CHCA 4P7NA 2I5QA 2I9UA 4XIMA 1NOFA 1RP9A 2GSJA 2IXUA 2YCJA 5I07A 4GXMA 1OFPA 1WUFA 2ZWYA 4WSKA 2TSYA 5I3HA 2ICSA 3W1AA 3NQAA 2OQLA 4DWSA 4I7WA 3SCQA 2J75A 1X1NA 2BGNE 2PFHA 2OXNA 1T5AA 4DLFA 1MUWA 3W07A 2E8YA 2XVGA 2X16A 3NURA 1JPKA 4ORMA 4PH6A 4NJKA 4X63A 3U3HA 1WDPA 3HG3A 2QAPA 4D6FA 3ABXA 2E3ZA 4LPCA 1J93A 4QRNA 5FA5A 2BXYA 3QKEA 5TIMA 3G24A 1ITUA 1FCBA 1VEMA 4PUJA 1ZBCA 4WDXA 2GVYA 1QO2A 1WKYA 3DGBA 1CGVA 3IPWA 3B4UA 1D8WA 3GKFA 4D6CA 5GVJA 3WBXA 4C6QA 5J04A 3EAUA 1JZ3A 1LL7A 1UP0A 1MO0A 3L23A 4EPDC 1PWMA 1A80A 1AW1A 4XAGA 1RUSA 2Y70A 1U5VA 5FJPA 3AQUA 4YU1A 1OCJA 2JEQA 1GTHA 3G8EA 8A3HA 2PRMA 4JTTA 3FW6A 2Y24A 3QW3A 4EOUA 2GGHA 4C7DA 4XK2A 5GNXA 2ZKMX 3FKKA 2VDGA 2XWEA 1G7UA 2WNQA 4H9TA 5HANA 4BKNA 3CAVA 4J3VA 4O11A 2IQTA 3UZWA 4HU0A 7PTDA 4HJWA 1H7NA 3TN3A 1KFWA 3C8NA 4NSBA 4JAWA 5J8LA 2E28A 1FWNA 1KLZA 5I3DA 1JVNA 4FIRA 1KR0A 1LZOA 1D3CA 3V16A 5CPOA 3MUZ1 3GU9A 1FA2A 2Z24A 1B30A 1M03A 4IPJA 4AY7A 4DNMA 3DEQA 3MKVA 3PJXA 1YRRA 3VDBA 4EWND 4LY8A 3M41A 2G41A 3DFOA 1O1HA 3RDKA 3GBEA 1F2JA 1FWFC 5C9ZA 3S2LA 3GG7A 3FA5A 1VH7A 1OGBA 3UCCA 1H4PA 2FZ8A 3INPA 1GKQA 2D20A 3CL7A 3GTIA 2YA2A 2H6RA 1LQAA 2OZTA 2ZDSA 3BLKA 1K03A 2ZUNA 4JTLA 3PHAA 1K8CA 4QTGA 3B8TA 3UU0A 3P74A 4G56A 3RPTA 3TAOA 5IBXA 2HNHA 4DWDA 2DJLA 2XM2A 1T40A 4KCWA 4E4FA 3GC4A 5M17A 1GOOA 5C2GA 4CD7A 2PWHA 4MPQA 4GGHA 3KVJA 2XIQA 3Q67A 1SPQA 2X7WA 2Y0FA 4AW7A 2DUZA 3C6CA 2WCSA 1S46A 3IARA 4JIEA 1X96A 2Z1VA 1S2AA 1HQTA 1KA9F 1ZY9A 2G37A 4GCXA 3ZS4A 1HKVA 4PBFA 3NSNA 3SUTA 4UTUA 3N2CA 1AH4A 3N2TA 1UW9A 2EPKX 3W6YA 1VCFA 3LZ3A 5I2UA 3RUBL 4X0NA 1ADOA 3I7RA 1XDLA 4PZVA 3G1FA 1OT1A 5CSSA 3WLHA 5REQB 3GNPA 2OELA 3ARPA 4FHAA 3THDA 4IL0A 4G9PA 1ZHAA 2D0HA 4DLMA 4Y96A 1VEPA 2ZE0A 1LL4A 4LVDA 3WF3A 4KRTA 3SRFA 2WC7A 3LUTA 2NSXA 1UB3A 2PP0A 1KGUA 1TMQA 4WSJA 2BHZA 1FWCC 3M16A 3VGHA 2IKGA 2WMIB 3APGA 5FIPA 3L67A 2PGFA 1WDWA 3IGXA 1JF6A 3CUIA 5I0DA 4S23A 3ZFHA 3IRSA 1AMYA 4KGJA 5E0KA 4ZODA 5I3IA 4DJFA 1DTNA 3N34A 1OZQA 3QPZA 3UF9A 4GD0A 1VFHA 2PDBA 2QKFA 4LAOA 4AD2A 3USBA 1GEHA 1UZHA 2C0HA 3RLUA 1SYTA 1AA1B 4BJHA 3FA3A 1W1TA 2Z4GA 1DEDA 3WDRA 4WIWA 4E8DA 3CUFA 4WKFA 1I2QA 2YCLB 4JS3A 2E67A 3DGRA 5F1VA 3P82A 3ARTA 2XISA 3TXVA 3BLEA 3IUHA 4DEFA 1LP6A 3WQPA 3NQDA 1R5YA 4JNZA 2PI6A 3SQMA 1D7FA 2D3LA 4KFPA 4WDTA 4UR9A 2ZUUA 3GR8A 4M1BA 2YYUA 2WMFA 2R9RA 4PB4A 2PA6A 3QHMA 3YPIA 1ZJAA 1TYGA 3L65A 4D6JA 1XP3A 2BHYA 5FF3A 4TTGA 4R7JA 2QJNA 1DQWA 2IKHA 3GXFA 3WUBA 1PBGA 2VDIA 1KD0A 4N9CA 4UR7A 2QCLA 2OSYA 1DWHM 1QW7A 4MYAA 1P0NA 4OOZA 3EEZA 1ZS2A 2C19A 3SCVA 3GNXA 3O63A 4BI7A 4YWIA 1YMYA 1H0IA 2FH8A 4XWUA 2OCZA 5GJMA 2J13A 4I3GA 5BMWA 3N4AA 3UR5A 3RO6A 4G7EB 5LA1A 1SZGA 3NQ7A 2VP8A 1K70A 1J9YA 3N11A 3EOUA 3EMCA 2ZVIA 2NT0A 3N6HA 4Q4OA 1NP2A 1SUXA 3WQ8A 1XPYA 1MI3A 1UG6A 1V51A 3UPMA 3PSVA 3HBLA 5A6KA 3TJLA 1KXQA 4W8LA 4RL3A 4MLJA 2GWNA 2X42A 2VGGA 4B2DA 2X09A 2BY1A 1XICA 1X6NA 1VCVA 1IT7A 1Z9AA 4R27A 2OODA 3R0UA 3RRAA 1I9CB 2Q01A 1ADDA 3NDYA 3AMLA 1Q6EA 4NXKA 1WKDA 2JGQA 2HDJA 3DBPA 4FB7A 1J0YA 4LU0A 3B8DA 2OLHA 4Y9MA 2ZICA 5D9NA 5H1WA 3PTMA 1UWRA 4AQLA 3GW0A 2JKPA 3FK4A 1KFEA 4TX9A 1E6PA 3UYIA 2F2HA 3WO8A 2OEMA 2TAAA 5HMSA 1E43A 2FMOA 3GHSA 1EP3A 3M0KA 1IEXA 1TO3A 3GVVA 3LB0A 3CBWA 1V7YA 4F9DA 3M0YA 4CQDA 1QUMA 2G50A 4O28A 3GVRA 1DJYA 2AL1A 4JIQA 2NQHA 3BLLA 4Q32A 3RX4A 4L4MA 3BZGA 3UY8A 3ZLGA 2V69A 3SQLA 4IHCA 4BEUA 3NA8A 1QI4A 4ZO9A 2O9RA 1CI1A 1K1DA 4LUIA 2J4GA 3TU9A 4NJGA 2CIPA 4AFYA 5FSEC 2VZTA 1EF2A 1C29A 3EPNA 1XLGA 1A3WA 5L6UA 5FJTA 3CO8A 4PB3A 1ZCCA 1XGDA 1MUMA 1BXBA 1MFVA 1WPCA 2YW4A 3UR8A 4NASA 2ZRUA 4R7WA 1VFFA 3GIYA 4TR9A 3C2FA 4TQTA 1E4LA 1TELA 5I77A 3NPVA 3OTRA 1EFZA 3S5OA 1X6UA 3CUGA 4DXKA 1E9LA 3HGRA 1MQPA 3K46A 1Q85A 4F40A 4EE9A 3PTKA 5M3WA 1Q6CA 4ICMA 3ARWA 4AZHA 1KM1A 5F2GA 3CU2A 4GNKB 1O6IA 2ZCGA 5AC5A 4BZYA 1YDOA 4OGZA 4WCJA 1LYXA 3B3DA 2EKCA 4M5PA 1KBBA 1XL9A 4WRHA 5A6TC 1KFJA 1E6NA 2JF7A 4GYPA 1UZ4A 4X3ZA 4YVVA 5C70A 1QWKA 2P1FA 3SFKA 4UFIA 3TROA 3PTQA 3PFRA 2J79A 5ECUA 1H61A 1RJQA 4PEEA 1ITQA 3OVPA 3E3HA 1Q2SA 1F5ZA 3M43A 3POCA 1CXLA 4W5UA 1JQXA 4H8NA 3UGRA 4IP4A 1TVNA 4AY8A 1UWIA 2QCCA 4DO4A 1J6PA 3TTQA 1ZRQA 1LOLA 3JW7A 1O5RA 1XYAA 4IH3A 2V0TA 5JMUA 1C3FA 1RQHA 3KCJA 4CCDA 1ZCOA 1GVSA 5LNSA 1XM3A 5G2WA 1GJWA 1M5WA 5I79A 2QDGA 4C90A 5C7HA 1CXIA 4XKYB 1H7XA 1U1HA 3DFPA 3FNDA 1PTAA 1BWLA 2PMQA 3SECA 2AL2A 3TZNA 1KM4A 3QOMA 5CC7A 1YXCA 3FJ4A 4WOZA 3D3AA 4TX8A 5G4WA 5H8UA 1MXSA 5AHEA 4BI5A 3LBCA 2EG7A 5HUOA 2C8NA 3C0SA 3E12A 2O9PA 1SZEA 5I00A 1DIKA 5M1TA 3TWBA 4B16A 3K1GA 1REQA 3W2KA 2PDJA 1MEHA 1RH9A 1Z69A 2ZDRA 5DT7A 3H8AA 1W9UA 1EX1A 2A3BA 4HPJA 4P8VA 1EC7A 3CGTA 2OLAA 1XINA 4O8AA 1O94A 1RBLA 4QM1A 3BLDA 2VFDA 3NO3A 4GPNA 1MRQA 4W7UA 1NDYA 4M24A 3AYRA 2PDPA 3O7UA 3AHTA 3F5LA 1EBHA 2DT0A 2QJHA 2CKRA 2FYMA 2I7GA 4F2BA 2Y5EA 4ZQCA 4CN1A 3WUGA 5KITA 3S5ZA 3OO2A 3PBVA 1TSIA 1KTBA 1E9ZB 4PL2A 1PIFA 2FFCA 1BQGA 3MB9A 2R14A 3UA4A 3N14A 4XZLX 2MANA 4H2CA 2JF6A 2XN1A 2WOQA 3BL3A 1ZFJA 3CYVA 3CMGA 2VD8A 3ITVA 3VZZA 4Z2GA 4HHLA 4QLLA 1MMFA 5D4YA 2Y8KA 3URNA 1US2A 2VZVA 1TV8A 4IMAA 5TQLA 4WR3A 3S9IA 3BURA 4G2DA 4LT9A 2B81A 1XRVA 3L4WA 1QNVA 3NEVA 5I78A 4WXYA 3WLJA 3T4WA 3GXMA 7TAAA 1XIJA 1J6OA 4IF2A 5CC6A 1TIMA 1VD6A 3KOXA 1HTIA 1W9BM 3GTNA 4OBRA 4DUXA 4AEOA 2PDYA 4QGCA 3A4WA 1TTQA 5L9FA 3ZJ7A 4HJFA 3EX6A 3F2CA 4L80A 1EGZA 2ZTJA 3ZT6A 2YFNA 2IS7A 3WFAA 2DVUA 3U57A 1H1YA 4LVAA 2F6KA 1TWIA 1UKTA 2GVGA 3N6QA 3RM4A 3T44A 3B9DA 3QR1A 2CZVA 2PEVA 3GTHA 3BMWA 2X41A 3K4AA 1A5KC 3ITOA 4UNIA 1Q4NX 4LBUA 4S3BA 3P60A 4YL2A 2CXEA 2UY3A 4UC5A 1WOAA 1RD6A 4NYUA 3SADA 5F2IA 3PG8A 3CUXA 1ICSA 2HBXA 5E0FA 3NEHA 2VFEA 1VGAA 3A21A 3RPDA 1VRDA 2FJKA 3OHMB 2A7RA 5BXRA 3MBFA 2HEJA 3BVJA 2TPSA 4FF7A 2RDUA 3ARZA 1XIHA 2YGYA 1YDVA 2WNZA 2E09A 2QJGA 2I57A 3TC3A 3W26A 4UTFA 3MW7A 5D8ZA 2CBUA 3MMUA 2NX1A 4RUBA 1E51A 4HT3A 3W86A 2QNEA 3G0SA 4ROPA 1OX6A 4MKNA 3W81A 1DJQA 3OGSA 3C52A 1OBAA 4WJXA 4C5YA 5LIKX 3KVLA 3IV3A 4UB9A 4M81A 4H8UA 3EWXA 3THUA 5LYRA 2GQ8A 3SY8A 3KCLA 4J2MA 1SFLA 1XFBA 1EWDA 2DGAA 3CIWA 4NZ4A 3AZTA 1WDDA 1W9DM 2EPHA 4XD3A 4J28A 3QSTA 1FY6A 1FWIC 5JUVA 4ICCX 4O54A 2QYGA 1JYXA 1OD8A 2R1KA 4Y6GA 3OIHA 3QMTA 3FVMA 3OQ8A 3ARQA 4ZR8A 1JXJA 3BMXA 4EACA 2NQJA 5D2XA 5D2YA 4UNKA 3THCA 2UZ9A 2VDHA 4LUYA 2HRWA 3H2MA 4UOQA 3VGEA 3RCMA 3CEPA 3EOOA 1SZRA 3E0VA 4IICA 1GVYA 1XH1A 1J10A 4FALA 1N8WA 4DYEA 3W1UA 1YPFA 4CVWA 1B3OA 3VNMA 2ZRZA 4XO7A 1XYBA 5DRCA 3VM7A 3VGFA 3LN3A 2XFFA 1MEWA 2WKLA 3AXKA 1H11A 1CEOA 2MNRA 3CNYA 4H9MA 3QJAA 1XC6A 2PC8A 1CWYA 1JCLA 1YHTA 3LBOA 3FYPA 2Z1WA 1QBBA 1G4TA 4M6PA 3VD5A 4LH8A 3OPSA 5HK4A 1JPIA 4Z1CA 4RDVA 4ZBCA 5H8PA 1TTPA 3B97A 1MZHA 4RZ6A 1HO1A 1Z48A 3N25A 1K02A 1EEPA 5CG7A 4DJDA 3CPGA 3LK6A 1DQUA 1HP5A 2ZIDA 4JTHA 3JZEA 2J7EA 5TNVA 3GH5A 1A0DA 1C92A 1QW8A 2BOEX 1HKMA 4YXGA 2QLYA 4GLEA 6ENLA 3RR1A 2YR1A 3GDLA 2AMXA 1K9FA 2RKXA 3BAWA 5BZAA 1K7EA 4M3PA 4MM1A 4O10A 1U33A 2J8TA 2CZ5A 3ARYA 4MG4A 2W92A 4JQ4A 5BU6A 2EAWA 2V63A 3LLFA 3LTPA 1UWUA 2PC4A 2XZ9A 4R34A 4FOJA 2BY3A 1QPNA 4HNUA 4MMWA 4HOWA 4NNBA 4O13A 3FHQA 1XRFA 2DZSA 1HF6A 5U4NA 3CV2A 3DFNA 1R3QA 3G1AA 4ACZA 4N7QA 3ZR5A 3EWWA 3WX7A 4HOXA 2Z26A 3WH6A 1W3KA 4HP5A 1H7OA 4N42A 3NPXA 2ZRWA 1W1YA 3VOFA 1E0UA 4FOKA 4FNRA 5LZLA 2G95A 2BOGX 1XLDA 4NZ5A 5DO8A 3RGTA 3N1AA 3MV11 4YWSA 1TZ7A 3VX1A 4HSHA 5EPDA 1IF2A 2BWGA 4TX6A 2B4GA 1VJZA 4K7VA 3C2RA 5JBDA 2W62A 4CQBA 4JIIX 1UA7A 3BUVA 2EPNA 2QVHA 4O19A 2ATMA 1S5VA 2PBGA 3W84A 1X6LA 1BYAA 2BMBA 5HMFA 4B3KA 3O1NA 4DXXA 3KE0A 1CLXA 1EKOA 2BTMA 5A6MA 4H19A 1A5LC 4ZQRA 1Y8BA 1YNQA 4BEQA 3OVGA 5FJJA 1TPWA 3FY1A 3DYPA 4RDWA 3LOTA 1BTCA 4K8HA 4Z2LA 3NJ3A 1L6YA 1IZCA 3FJLA 2QIWA 4AZCB 1S1PA 5G1TA 2A1YA 3UWEA 3DI0A 3OGRA 3SCWA 5LNRA 4W8AA 2JE8A 3TC7A 3AS2A 2ACUA 3R58A 3AJ7A 4LUSA 3W7IA 2ZA1A 3GY1A 4CNOA 2G4JA 3A12A 3N13A 1F4HA 4JTJA 3S5SA 1V0LA 2VENA 3K8MA 2OPJA 1DIDA 3F4DA 4U3AA 4HNLA 2VYOA 3AI0A 1UD3A 1CGTA 1K8ZA 2TRSA 3TQVA 1O4UA 1H5VA 1W0MA 3GFZA 1S5MA 1UD6A 2YL6A 4UXDA 3QMSA 3GDBA 4KKXA 1M1BA 1RCQA 3G3MA 3P8JA 3EOSA 4A3RA 3TLLA 2D2GA 2IUZA 4PCPA 4QISA 3IV8A 3PWGA 4HZ6A 1S2UA 4GHRA 4KS0A 4DIAA 1T96A 2YIHA 3MKCA 1GHRA 1UD5A 3GM8A 4B9YA 1EO7A 3W4RA 4A2SA 4JIPA 3P62A 3EWDA 3MP5A 5HNNA 4F0HA 1W32A 1DV7A 4GVFA 4YTQA 1AW5A 2QCDA 4L6OA 3KWSA 6REQB 4KEMA 1RJRA 4R33A 2OZ8A 3N9SA 4QNEA 1V93A 3NPUA 1FTXA 3GIPA 1E4NA 1X8FA 2RHGA 5JQ9A 2V5DA 4J1OA 4BI6A 1OHLA 5LNVA 2PDQA 2W3ZA 3O05A 3HGOA 1OVDA 3M4HA 1BHGA 1K3UA 2DFAA 2QVNA 1I6NA 3T78A 3W2MA 2XFYA 3GSMA 3C3UA 1V77A 3ZVHA 3M0MA 1GZ1A 4HA4A 4LYRA 4DJEC 6TIMA 3EDJA 1I75A 3ATYA 1A5UA 2VMFA 1QU4A 4XVEA 4BWLC 4FI4A 2HS6A 2G3NA 1HNYA 3BOXA 4D2JA 3UR2A 4MVAA 3EA3A 4XUYA 2Y7FA 4C1NB 4KPLA 2QPSA 3V75A 5I03A 3ZIZA 1CECA 4IFKB 5LGXA 4MWAD 1Y5WA 4CD6A 2YDQA 4H6RA 3NGFA 2NXGA 3OW1A 1F8MA 2XH7A 4D72A 3TYUA 4QE4A 3NWRA 4ZCWA 4ZFMA 3CL6A 3VMPA 2ZZ4A 3CMJA 3MWCA 4U28A 1I1XA 3SSZA 1R9ZA 4XAFA 4DYKA 1ZAHA 5G1YA 1ZQ5A 3AIUA 2CBIA 2DVXA 3TN6A 1OB0A 2INFA 3FEMA 1DJNA 1BG9A 1VIWA 3AU6A 3N73A 3WD4A 1TV3A 5AVHA 3UR7A 4CD8A 3PUOA 1NM9A 5HXMA 1V6UA 1AQHA 1E1CB 2OQHA 3V7PA 3AIVA 3CZLA 8XIMA 4ICNA 3M07A 1QFEA 3SRKA 4JTKA 1X7FA 4O18A 3NQCA 5FD0A 2FKPA 3RNDA 4ZO7A 2V5JA 4CN4A 1KRAC 1XLFA 4DAIA 2ZZ7A 3UXAA 1C7SA 2ISFA 2XM1A 4ZO8A 2GZXA 1L2UA 2WJZA 4PE8A 3LRLA 1A0CA 3V18A 4YS1A 2PDNA 4PMJA 2E9BA 4AF0B 3L0NA 4AC7C 5HQMA 2FIQA 1A3XA 1JR1A 3DG6A 4MZ1A 4KMQA 4JX6A 3VCCA 4Q4PA 3REQA 4GACA 1P7TA 2AKZA 1MVYA 3BAJA 3CC1A 5B7ZA 4O4WA 1P5BA 4IUGA 1XLKA 4DWSC 3PJWA 4TU1A 3GD6A 4P2VA 3W72A 4NJIA 1QOXA 3PFMA 5DXXA 3SCOA 3ARSA 2FGLA 3RCNA 2HE8A 4C60A 2G3JA 3WF4A 2Z2AA 3PBMA 2PP1A 1NFBA 4AX6A 3QPEA 4DZHA 4NAEB 5BOOA 1TTIA 4KW2A 1CXFA 3E5BA 5F4XA 3LCWA 4TVDA 4LC6A 1TB3A 1E6ZA 3FSUA 3TCEA 4DBEA 3IIZA 4AWEA 1ZP3A 2XU2A 2Z1KA 4KH2A 3CS2A 1B3WA 1R3TA 1F4AA 4QX4A 3PF3A 1LM1A 3DECA 2OKTA 4K38A 4U10A 1UIOA 2GJLA 3Q2DA 2HPIA 4DJDC 3VO0A 3N2OA 4UBPC 1EDQA 2VUNA 3QLDA 4ZENA 5A8OA 5KSWA 3T09A 1OGGA 2XVLA 4FLOA 3AMCA 3JU2A 3NTYA 3P84A 5EFDA 1UWAA 3VZYA 1ZJIA 2VXNA 2EPOA 1FWHC 2I9EA 4V33A 1ONRA 4CD4A 4CNUA 5I24A 3QV6A 2EPLX 5CSUA 1XLBA 1PSCA 3W7RA 1DJGA 2GSEA 2EBNA 3VE7A 3GYEA 4IIBA 1VF8A 2UY5A 4DX3A 4KWSA 2CBJA 4H3DA 3P3BA 2WQDA 9XIAA 3CB8A 1K9TA 5DCDA 2YCEA 5JVLA 4HNTA 4BHYA 4PMZA 3EXTA 1UBPC 3LRKA 4HCLA 3U0HA 3EPOA 3VABA 4J27A 2OVLA 2DZTA 1EOKA 1OX4A 7REQA 1Q8JA 2HJPA 4HN8A 4QROA 3MU7A 2V6AA 4JD4A 3R89A 4GUJA 4C7FA 4ERAA 2ONEA 3IS4A 3HJEA 5I06A 1IT8A 3BG5A 4GJJA 1PZ0A 3MANA 3KRUA 3PZ9A 1DJWA 2QF7A 4HVXA 3GG1A 1KR1A 3TTSA 1VAHA 4MKSA 3EPMA 2VKZG 4Z0JA 2NLYA 2QPUA 1GEQA 3H26A 2QMJA 2WBKA 2E40A 3CAQA 1WO2A 3DUGA 3S1WA 2YB4A 1VR6A 2HZGA 4ZL1A 4QEHA 1JCTA 4KGLA 3PAJA 1U83A 1ODZA 2OQYA 3ES8A 1DHKA 4XAPA 1HL8A 2NZLA 2RAGA 2DZAA 1SO3A 4N0RA 4J3UA 1TVPA 2A3AA 1N82A 4RXFA 4UZUA 4PUUA 1JUBA 4PFMA 3HGJA 3BV7A 4CLMA 5LA2A 5TAOA 3N2BA 4JDBA 4JHMA 1Q13A 4NRRA 1QRQA 1YBQA 2HNEA 4XAYA 4KCUA 3BICA 3KUMA 1FBAA 5FAGA 1H1NA 3CTTA 3TP4A 2R1MA 1DKWA 1HL2A 1MW3A 3PPHA 4A8NA 3GVWA 4QCFA 1HJSA 3ARVA 5T9CE 4WK9A 1E15A 2AAAA 4JYEA 4B5NA 4JTDA 5KZMA 5HJLA 3LA4A 4BS0A 3KM8A 2GQ3A 2PDIA 5I3JA 1XG4A 3VMNA 2WBGA 4E2DA 4H7CA 4ZOBA 4E6MA 4I8DA 2W67A 2V3FA 3OYXA 5A94A 2VM8A 1RY0A 2CETA 1JYNA 4J9JA 1O12A 4RNHA 3WK2A 4RV8A 4REQA 3QYQA 4OHQA 2QJJA 4W86A 1H5YA 2XPKA 3A5VA 3W1MA 2XH0A 3VNYA 2GSHA 2D2JA 1G67A 4AVFA 5A8QA 1X1OA 5A6BA 3CZGA 1R6WA 1UBSA 2B7QA 3LPOA 5HNTA 1QO5A 1FHLA 3HPAA 3M0IA 2C7FA 3G77A 3GC5A 4MFDA 3TC6A 4M56A 5HMEA 2OEKA 2VJXA 4FX6M 5HPCA 3KRZA 5LHFA 2B31A 4J40A 1WDSA 4AISA 1L0PA 5CZJA 2PLKA 2YLLA 2RJGA 5A1AA 1P0EA 2VC6A 5K2ZA 4O1AA 2DEPA 5BW6A 4A4AA 1P48A 1YNPA 2CCRA 4MJ2A 4S3KA 5G4HC 4AMAA 4JTGA 2X1RA 5T91A 4EXAA 1C8YA 3GU1A 1JGMA 2NUWA 1FCVA 1UR0A 2DQXA 4ORIA 2Z1SA 2Y89A 3Q45A 3TW7A 3QTGA 2CW6A 1W5PA 3QY6A 4Y8EA 5LNWA 3E2QA 3EKGA 3OBKA 4PMRA 4US5D 4A3YA 1FDYA 4ZQOA 5IRPA 3BTNA 3VXGA 1KRMA 1TCMA 2OWXA 2G0WA 4QE5A 4URIA 1BTMA 4TOQA 1JULA 4GRSA 4BF7A 2GK1A 3MZ2A 1W8SA 4R3UA 4LYKA 4PCFA 1VBJA 4F0LA 3V35A 3VIGA 2WSRA 3HFTA 1TWWA 4E2VA 4DF2A 1XW8A 1U2YA 5B80A 5I3FA 4EF9A 2VZSA 6XIMA 1N55A 2A21A 3GVGA 5DRIA 3OHIA 1XGZA 4JTEA 3RRXA 1P0DA 1NH6A 1XIGA 1HKKA 2I5IA 3LXAA 3UWVA 3GZAA 4LEFA 1T7LA 5LA0A 3KZSA 3SZ8A 1M65A 2PE4A 1R2RA 2FHCA 4GBUA 4B4HA 4TXEA 1PEZA 2Z7KA 3FXGA 4GINA 1H1ZA 1G69A 4LV9A 4PRRA 2DSVA 5EMUA 2DSUA 1VRXA 4Q6JA 3FHAA 5E09A 4MSSA 2P76A 4MDOA 7TIMA 4RNJA 5CC3A 2DH2A 1GUVA 3LCIA 3PZUA 4DI9A 4UMAA 4AEFA 2HVOA 1UJPA 2CHOA 4K8EA 3WNLA 2QCGA 3O6CA 1KGWA 2PRHA 1N8IA 1UKSA 2XGIA 3XISA 2D22A 5BNKA 4MJMA 1X98A 3TQ0A 3WSUA 2C91A 2O56A 4C6FA 5JBEA 2BASA 1BVNP 3LI0A 3LNMA 3VINA 1V3MA 3CH9A 3DENA 2CYGA 4XZBA 1NIUA 1HKWA 2V5KA 1PHWA 3IJ6A 3VCRA 3W85A 1XHGA 1AFSA 4JKLA 3C2EA 3IK4A 3VKKA 1EO5A 3ITGA 3NXFA 1MDRA 2INZA 3OOQA 4YTTA 4A29A 2OOGA 4QITA 4AVOA 4AD3A 1SW3A 5ABFB 1Q65A 5E93A 5A6BD 1PKMA 1J11A 2WWDA 4FXJA 3W29A 1H0GA 2VOMA 2G8ZA 1B3VA 1K9DA 1UWTA 5HBFA 1WXYA 5BXSA 4CGTA 1OJXA 2Y63A 4LVGA 3W1RA 4BQ2A 4NNAA 2PCEA 2ADAA 4WSHA 3FGCA 1XBVA 3W24A 3HMJG 3WNPA 3PWIA 4AH7A 1PL9A 1BVWA 3UG3A 2PDFA 4ERIA 4GZIA 4MNLA 1V3JA 3NL3A 3SAZA 4JN6A 4FXRA 2FJUB 2CHNA 1CGUA 4MADA 4F2UA 3DFTA 3QC0A 3FA4A 3AUJA 2VEGA 4TTUA 2ZZ5A 1ZL1A 4FF5A 4RNFA 1XWYA 3B40A 3QKZA 4JXCA 1FP9A 3T0BA 2J77A 4MAZA 3CQIA 3RAOA 2ZUVA 3DG3A 1NTHA 2VWTA 4C6DA 1JDDA 2AMGA 3ATZA 3RR4A 3T2QA 3AICA 4K1GA 3GDMA 1VZWA 3MSGA 1Q8AA 4D71A 2DZXA 1KM3A 1BAGA 3TONA 1W1PA 3EA2A 3WBYA 4W9TA 3N04A 2NVCA 4XZIA 4H9ZA 3T7VA 3WLSA 2Z2BA 3TWAA 1GOWA 3TYDA 1Y0EA 3G3DA 1UR2A 1AMKA 1O66A 2O9OA 4Z1DA 3KX6A 1D3HA 3NYZA 1C91A 3GHUA 4DAFA 1JEZA 1LBFA 2P0IA 1CBGA 2ESCA 3G1DA 1UOZA 4NVTA 1NWSA 4O15A 4XBSA 1TJ0A 3R8HA 3T1GA 1RSCA 1SGJA 3ME3A 4OWGA 1UCWA 2VO5A 3OBAA 1XXXA 1HIZA 3WQEA 1OC6A 3UXLA 4MDPA 3KLKA 1KV5A 2E25A 1DPMA 3W7JA 2WC3A 5BOFA 2QQ6A 1OYBA 2CC0A 1V3KA 3B8SA 3W7GA 4KEZA 2EKGA 1FFRA 3EWYA 1GTEA 3N3MA 1IGSA 3OLDA 1SFSA 3URBA 4PMOA 4P8WA 3VU2A 2VCCA 3BV4A 4A3QA 1V8EA 2DH3A 5DF0A 1XYLA 4B15A 1E5JA 1WP6A 2XG9A 2YBVA 4IG2A 4NIRA 4JR5A 3TFCA 2XVNA 2WJEA 2WSQA 1J0IA 4JN7A 3ZJ8A 4JTSA 4MTVA 1JPMA 4YIWA 3GTFA 3EXRA 1RA5A 1BG4A 3QOKA 5AECA 9XIMA 3N9KA 3RCYA 4PGLA 5IBXC 4ZA0A 3MSYA 3VFCA 1ISVA 1HG3A 3ZZ1A 2KX9A 4PUNA 1A0EA 2QCDB 4S3JA 4O57A 3U4AA 1UJQA 1UP2A 2YOCA 2ZZ1A 3A64A 2CERA 2YDSA 4LNYA 1W5MA 4V15A 3M5ZA 4IOTA 2UWFA 4DBDA 3H7RA 1S5TA 1TWSA 4Q8TA 1JZ8A 4GFIA 2ZXBA 1DXFA 3B0VC 1N7KA 2VELA 2BXVA 3SGZA 1SR0A 1EBGA 2E9MA 1LOSA 1O7AA 5T8GA 2BY0A 3H22A 2QCFA 3G0UA 1WYIA 3KOWA 3G1VA 3H70A 2WM1A 5LNUA 2A3HA 1EJTC 1BVZA 3CT2A 1W17A 2WANA 5K4ZA 2Y4SA 2QS8A 1JZ4A 4V1YA 3HQ1A 3W1TA 1WXZA 5JXQA 2A7NA 4BR1A 1NP0A 3KTXA 3QTPA 4Y2WA 1UP3A 4NG3A 3U2CA 3P80A 4GKLA 4LXFA 4IMEA 3HF3A 1FUYA 1EHAA 4UCFA 4Q33A 3VIJA 4HK7A 5FEZA 1CGYA 4LB3A 2VURA 1NOWA 3BJFA 5JIPA 4AUBA 4IQEA 4GZJA 3GIQA 1B57A 3NZQA 1W1B1 1XD1A 4JDYA 4ATLA 4NU7A 2GVJA 3BLIA 5ABEA 3FS2A 3USZA 4IL2A 3S4TA 1KWKA 4A3HA 4F66A 1GQLA 1YPXA 3VIKA 1R2SA 4EKJA 1RLCL 1CPUA 4JYDA 2BS9A 3CHVA 1YIXA 3URAA 5BWAA 4IGHA 4XD4A 2Z00A 5IXEA 2V5LA 2G96A 2Q8XA 2WLYA 1KXHA 1KWGA 1M9HA 2VEPA 1ME8A 4JX5A 1NELA 5K9DA 4LS1A 3DDMA 5CC5A 3HZ3A 2P8BA 1IR2A 4W85A 4U33A 1OG6A 1OZMA 2X1SA 4QG6A 2BLEA 3VOCA 3U4FA 1XCWA 3CQKA 4GO8A 3S9ZA 4XISA 4JYFA 4UIOA 4JGDA 3WEMA 3GXIA 3VAVA 3AS0A 2PLMA 4L9XA 1KFLA 1GVIA 2WNWA 3UJFA 3M0LA 1XSIA 3TNBA 4GUFA 4F9JA 2PU0A 4DM2A 3NQEA 3LSCA 3APYA 4EVZA 1RBAA 1S2CA 5F2MA 2NXHA 2V3EA 3MSDA 4GI4A 4LCQA 2YXOA 1EUNA 4L4OA 3AHXA 3KFTA 3DZ1A 1ISYA 5GNZA 2DDXA 3ARXA 8XIAA 1ONXA 4EPBC 3KS5A 2OYMA 3MDUA 4DUWA 1J12A 4L5ZA 1VCGA 1BPLB 2TODA 3WQ5A 5LGZA 4HYVA 4C6OA 4C65A 3GR7A 1EP1A 1IWBA 4MY8A 1RJPA 4K2SA 5A8NA 3FDGA 2FGBA 1TWDA 1C8VA 2BNJA 4R9XA 4PMQA 1TCDA 3A6OA 3OG2A 1KW1A 4GQ0A 1JJKA 3RX2A 3T8LA 3PUEA 3CIVA 1IZJA 4YTSA 1ZAJA 5FEXA 1JDFA 2Z2UA 3UWWA 3HO8A 1NJJA 1E0XA 1R46A 4LVFA 5A2AA 4HNVA 4I9AA 3KXQA 2VNCA 2VOTA 2XYLA 4M7TA 2GGJA 2P10A 1A47A 1UKOA 3GG8A 3VC5A 1K6AA 1KBJA 3IGSA 3MI6A 5AFDA 4L4PA 2PTXA 1OD0A 1GHSA 2V3GA 3DFSA 2YZRA 4UR8A 4MGGA 3T4CA 3PNUA 3TTEA 1EQCA 1P1MA 3VNZA 2XWDA 3VVGA 2HISA 1E71M 3GXPA 1JUEA 2GDQA 4HKPA 1O95A 3E2VA 3W37A 1VB9A 1QHPA 1VYRA 1QPKA 1IYXA 1PZ1A 1QI5A 4AWTA 1A50A 4Q8VA 1QTWA 4WD0A 2VWSA 3W2NA 3VYLA 1QI0A 4XZMX 4YCOA 1QR7A 1I0DA 5EMYA 3CWNA 4KIRA 1B3ZA 4ERGA 2DSWA 4YHGA 1MEIA 3RYSA 3CIXA 5HMDA 3DX5A 4IIDA 3TVAA 5AHMA 4EAYA 4JTRA 3UQNA 3LTYA 2XSXA 2NQZA 1QI3A 3QQWA 4AAJA 1BEUA 1VJIA 1ZSXA 3ZVHB 3TEVA 2YB1A 4AZ5A 2JEPA 5FOOA 1WQ5A 1YLVA 3CT7A 3N6JA 2WHKA 1BWVA 3T07A 3TX9A 4HMEA 3EWBX 2NWRA 3E49A 3KL5A 4U5KA 2Z0IA 3E0FA 1S5NA 1E1EA 1EPVA 2IW0A 1IZKA 4OUIA 2XH4A 3FXYA 3CV7A 2H8XA 3VDHA 4B2DD 1XFCA 3NZPA 4NYYA 4Y9PA 2D23A 2Z6JA 3L5LA 1IQ8A 3VM5A 3CQJA 3TH6A 1FQ0A 1MNZA 3IGUA 4QQUA 3F4WA 3G8RA 3G6LA 4C6KA 3BAIA 2NSOA 4HZ7A 4JTFA 1JCNA 5BXPA 4MUPA 1LORA 3W1PA 2VGFA 3L66A 5C6MA 1F8IA 4UNLA 1W9XA 3L4YA 1DWAM 1JPDX 5D9MA 4JTQA 1XKJA 3AMGA 1YEYA 4M80A 3A23A 3H24A 1FWJC 4H83A 4HGXA 3LHWA 1SZFA 1H50A 1JFXA 4D8LA 2CU0A 1R85A 4KCTA 4RZ4A 3SIZA 3NL6A 2YCLA 2A0NA 3FV9A 3T0CA 3GO2A 4O0KA 1WKEA 4QXIA 2E4TA 3LBMA 4M51A 1DXIA 1PXGA 1OGSA 3C56A 4G8TA 1BF6A 4HCDA 4HYWA 3CHEA 3VE9A 3N2MA 3FLUA 3M5VA 3RMJA 3WNNA 4M1RA 2CWNA 3OQEA 4GH1A 1SR9A 4JL2A 2J47A 3VOGA 4TMCA 1JRCA 3FX4A 4ZO6A 2SFPA 2OGJA 3PR2A 4WKAA 5K9XA 3MHGA 2P8CA 3IJ8A 1EH9A 3AJXA 1V4YA 5F4WA 2JKAA 3MZNA 5AC7A 2BHUA 1VQTA 3KW3A 4ENLA 3EX1A 5CPNA 3G1HA 3HU7A 1L9WA 1T8QA 1GPWA 4YNGA 3BOLA 3UWZA 4F48A 1SVDA 2TYSA 3I7SA 3WMLA 1KFKA 3Q94A 4UQAA 4HPNA 4KF1A 4QJ4B 2HVMA 3MP3A 4MZ8A 4BF5A 4XZHA 1P6BA 5GJPA 3R2GA 4JKMA 4LS0A 4IX2A 5C2CA 1ZBKA 4GY0A 3UBPC 5E9XA 4XO6A 4GIRA 1WUEA 5GQBA 4LF1A 2CXGA 4RV3A 5DANA 4NAFA 3HPFA 1ZJBA 4MWAC 4HA1A 1X1ZA 2O7QA 5BCAA 3GZ3A 4AWUA 4HMCA 1ZALA 3NFUA 4W8BA 3EKLA 3VC6A 2NV9A 2ZX9A 2QMKA 1EA0A 2PD9A 3TMLA 3BWWA 4UUIA 1IWAA 3AISA 4FX7A 4IM4A 4Q7BA 1QT1A 3B9OA 2RDXA 2YLAA 1GVFA 5JIWA 3N18A 3UG4A 1Q5MA 4QAWA 3S1GA 2J78A 3SN1A 1SFTA 3QF0A 5DEZA 4JIRA 2BDQA 1VPXA 1GWJA 1NF0A 3DYOA 2QEZA 1P1XA 4AD4A 3UETA 2GGGA 3RO8A 1KBIA 1ZNNA 3E96A 5LIYX 3U2ZA 3EDDA 2BV9A 4FNPA 3KBMA 4HU8A 3FJ6A 3BJSA 3QY7A 2OX1A 1QMLA 3CAKA 1TJ1A 4E38A 5CPMA 3AC0A 3H6OA 4BWLA 3TR2A 3GDKA 3II1A 4D6HA 3LSBA 1UR3M 4LVBA 3UWQA 2JFEX 1RK6A 4NZ1A 3AXIA 4Z2KA 3THQA 3CV1A 4HPGA 1IWPA 3BG9A 5BRPA 4IISA 1V79A 3LLXA 3EX2A 2AL2B 2Y88A 4O53A 3AIRA 3S83A 4JIHA 3GW3A 3R8GA 4OIFA 4ASTA 4ROQA 3CMFA 3W75A 4O17A 1GK8A 2O7SA 1RA0A 2G97A 1RVKA 3R12A 4DBWA 4L65A 4ZOEA 3ZWSA 3QEZA 9CGTA 5ABGA 3F5KA 3P5YA 3M64A 2GOKA 3C61A 2WZMA 3QZAA 3BAXA 4AIBA 1QI2A 2OB3A 3JVAA 1EC9A 1LLWA 2AQVA 2OR2A 2O0TA 5ABFA 2AAMA 1B90A 1IT0A 2W91A 4DY1A 1Z89A 1A5OC 4YPJA 4A22A 3AIQA 1YADA 3TQPA 2EO7A 2PDWA 4AHPA 1PDZA 2Q3OA 3CUZA 4JZ5A 3PK7A 1YDNA 4H6QA 3GYCA 5CLWA 4ECLA 3L2LA 3N4FA 1VPYA 4UTWC 3ISIX 4NHVA 4BK9A 3H23A 5J5DA 3TTOA 2XJ7A 1UOKA 4A35A 1E6RA 4HPHA 5FESA 1POJA 2PWFA 4DNHA 4PYSA 5D02A 4CN6A 5MKGA 2PDMA 2QV4A 3WDHA 4KIEA 3VI2A 2PDUA 3TYEA 2VEMA 2R91A 1OCQA 2OGYA 2FTYA 3DHPA 2F6UA 2J8GA 3TLQA 2UBPC 1LBLA 4Q4QA 4DXVA 3NVTA 1YYAA 3VKDA 3V1HA 1NWUA 3EKZA 1E0TA 3EB4A 4IFKA 2F84A 3LPPA 2BGSA 3EMQA 1E6QM 3ZMRA 3R0DA 2VT0A 4MB3A 1A4LA 3VOHA 1FCUA 4X61A 3DH7A 2HPMA 3GG0A 1M7XA 5GNYA 3WF2A 3LV5A 1R38A 4LW7A 1XS2A 4OFCA 1K8XA 3MQTA 5EB8A 2VD9A 5AYBA 4OT7A 4QE1A 1SFJA 2QJMA 3G6MA 3ONCA 3BW3A 3SJ3A 2XHYA 5IOBA 2PU1A 1J0HA 4IGSA 1GQJA 2VEFA 2FQIA 1O5KA 1E0WA 2Z7GA 3P5ZA 3LHYA 2OZ0A 3LPFA 1RP8A 1HUVA 3FYYA 2O55A 2WSKA 3L12A 2ZC1A 4C5ZA 1JCXA 3L2MA 2A6LA 3O15A 4HSOA 1C90A 1E1CA 1MQQA 3GQYA 2VFIA 3W88A 2WSPA 2V5BA 5IDIA 2QDDA 4H01A 2GGEA 2E68A 5ECVA 1CCWB