2J9YA

Tryptophan synthase q114n mutant in complex with compound ii
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
266
structure length
251
Chain Sequence
ERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLSHHLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKIIEKNLASPKQMLAELRSFVSAMKAASR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPTOPHAN SYNTHASE ALPHA CHAIN
publication title Betaq114N and Betat110V Mutations Reveal a Critically Important Role of the Substrate Alpha-Carboxylate Site in the Reaction Specificity of Tryptophan Synthase.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Lyase
total genus 92
structure length 251
sequence length 266
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 2006-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2j9yA00
3EX1A 4AB4A 1QAPA 4UTMA 2Y7FA 2KZHA 4QNEA 3W1XA 1NF7A 2Y62A 3HGJA 2GQAA 3H55A 4AH7A 4O15A 4CNNA 4L4MA 3EB2A 4ONVA 1DORA 3B04A 3TW7A 1OF8A 2GPTA 5DBUA 3TFXA 4DELA 2OMAA 3UYCA 4AEOA 1K3UA 1I45A 3AO0A 5LNUA 1H5YA 4Q4KA 3W2MA 3DGRA 1XBXA 4JTLA 2DZUA 2CZFA 2VENA 4UMCA 1YXCA 4H6KA 4O10A 4HSNA 1IIGA 1FCBA 2Y7EA 3N2MA 3W7EA 3UPBA 3BK0A 1WOAA 3SJ3A 3T78A 3W1NA 1KLZA 3TH6A 3DFNA 2YW3A 1X6UA 4CCDA 8TIMA 1VLIA 4RLIA 3TC6A 4GUIA 4CNPA 3HG5A 3GX9A 2NZLA 1LRNA 3NPWA 4GXMA 5EA9A 3G1DA 4XBKA 1F2JA 3KOFA 2NXHA 3LRLA 4HKPA 2VFDA 3BG3A 1I2NA 1B57A 4UTTC 1HG3A 1QPNA 3O6CA 2OCZA 2ZQ0A 4K6AA 2W79A 3C8FA 4RKAA 3QMSA 4M7TA 3S1VA 5HUOA 3FJ6A 1DHPA 3SR7A 3W7IA 1TTPA 5F4XA 1YPFA 2VEIA 3I68A 4UMBA 2FQIA 2XN2A 3MJYA 4O13A 1QCWA 4JYFA 1XC4A 1OVDA 4UTWA 1X8FA 4FF7A 1K8XA 2CLHA 1VGAA 2V8ZA 3BG5A 3QH2A 5EBUA 1HO4A 1JJKA 4MZYA 1M5WA 3STFA 4DEFA 2IQTA 4LNYA 5H91A 5KITA 3W73A 4IX2A 4NNCA 3E12A 2VFHA 1KM1A 2WOQA 3RK8A 5KINA 3TQKA 5EKYA 1R2TA 2VFFA 1UCWA 3T4CA 4YXGA 2RHGA 3P84A 1KLYA 1B3OA 2A4AA 3T40A 4RV8A 1H50A 5KTLA 4BI6A 3DZ1A 3MI3A 3W2LA 2V2HA 5CZTA 5LHFA 3KVMA 4JTEA 3W7JA 5D32A 2WQPA 4TMBA 1LM1A 3B06A 1OFAA 4FNSA 2XN1A 4LS0A 1EWEA 4WX2A 1THFD 3TJXA 5CPLA 3EWZA 3NPUA 4MLRA 3A22A 3BLIA 1AMKA 1OX4B 3PM6A 3B4UA 3PC0A 2JKEA 5HWMA 3TA6A 4NX5A 1Z42A 1OFDA 2W0UA 3LHVA 4ZQCA 1VHNA 2CU0A 3MWAA 4NJJA 3Q94A 3PB0A 1Z48A 1B4EA 3CIWA 2ZZ2A 3NQDA 2H3BA 1L6WA 3M5ZA 2ZRYA 5AC6A 2UV8G 4AWSA 5AFDA 3N3MA 1P0NA 1SW3A 3USBA 1SO6A 4DO5A 3QSTA 4QIUA 5F1VA 1BWKA 3W7CA 4OV9A 3FYPA 1TREA 1W5NA 4LS1A 1W3TA 3GR7A 4CQ9A 3Q58A 1JCXA 2BSLA 4UIOA 1XCFA 3DI0A 3G0XA 1WOBA 4PA8A 3NVTA 1LLZA 1WAUA 1QR7A 4W9TA 4EF9A 3G1VA 3IVSA 3PS7A 1W56A 1R2RA 1SSGA 3I6RA 4JTIA 5HMSA 3C2OA 3BW4A 2A5HA 4HIBA 5FI8A 1G4PA 4GRSA 5D03A 3EXTA 5D05A 4LUIA 4JIPA 4OWGA 4ALDA 1WA3A 3HOJA 4CCCA 3UPWA 3G1AA 4PFMA 4O4VA 3O07A 1JQVA 2FDSA 4MPQA 3W85A 5DBTA 2O7SA 1GT8A 5DCDA 3WJZA 1TRIA 1JULA 3MW7A 4WY0A 1H62A 3HGRA 3LI0A 3M47A 4NQ1A 4M6PA 5I3GA 2OJPA 4O4WA 2C0AA 1DJNA 1XBVA 4H3DA 3TXZA 3EWWA 4I9AA 3CHVA 3O15A 1FX6A 1YYAA 3W74A 1NEYA 1SW0A 2X1TA 3RU6A 3MBFA 1GZGA 4KKXA 3LB0A 1I2RA 4MJMA 4K36A 3DBPA 2E1DA 3RFAA 4IQLA 1XDLA 2FB3A 5G2HA 4O1CA 1NSJA 3EX6A 1H7PA 4LRSA 5E1QA 3W23A 3W86A 2V82A 2E5CA 3GDMA 1LTDA 2E5BA 2QDGA 1J5TA 1PV8A 2Z6JA 3P60A 4HPJA 5D33A 2Y89A 3DHFA 3P74A 3O16A 1FXPA 3DKLA 3OBKA 2YW4A 2ZA2A 3CEUA 5DELA 3IGXA 3HMJG 3DU0A 4GUFA 5I3IA 1TTQA 3TUUA 2NUXA 4GUHA 3W7QA 4RZ4A 1KTBA 1R47A 1H1YA 1T8XA 5K3VA 3TNOA 1GG0A 3GXTA 3DH7A 3LXAA 4Z1AA 4AMAA 4AXKA 3QC3A 3E49A 2H3DA 1QFEA 3ZR4A 2PE4A 4MZ1A 3EWUA 3IGSA 1NFBA 1LROA 2R94A 1DKWA 1EX5A 4LVBA 1A5SA 5HJLA 1S3HA 2R91A 4O57A 2PRLA 4AHPA 3IVUA 4UXDA 1L2UA 1H1ZA 2CW6A 1RVGA 4FX6M 4FO4A 2NV2A 1YPIA 5DN1A 4OQVA 1CX9A 3EKLA 5LGXA 4E2DA 4Y6GA 1TPVA 3TJLA 3R2GA 2B7PA 4LVFA 3S42A 4MKNA 3W7NA 1QWGA 2Q8ZA 4K39A 1GVFA 2ZZ3A 1WXJA 3OIXA 4XWUA 3ZS4A 3L21A 4B5NA 5LNSA 1K7FA 3CM4A 3LHUA 4JR5A 4DPPA 2A7RA 4TIMA 2R14A 2C3ZA 4Z1CA 1GQNA 3SFKA 2YZRA 3UWUA 4N9EA 4IUOA 2VEMA 2H8XA 2PRHA 1ME7A 1F7BA 3LXCA 3P81A 2B0MA 2VKZG 1PVNA 2ZZ4A 2H90A 1IIHA 3PB2A 1ZAHA 5HINA 1G7UA 3UY7A 3M41A 3QRHA 5FF4A 3KRZA 4UC5A 3THQA 4LVAA 3CT7A 4OE7A 1I2OA 2G95A 3NQVA 5BMXA 3FFSA 1TB3A 4NJKA 1QMLA 1HL2A 1M7OA 3CIXA 3C2FA 5AB3A 2FJKA 5DCEA 2JKAA 1W31A 3NQ2A 4UNLA 3L65A 4P61A 2ZZ7A 2CLKA 2DP3A 2A2IA 1VZWA 3TKFA 2V5LA 1IXQA 2A6NA 1DOSA 4I7WA 5K9XA 2ZA1A 4HHPA 3EX3A 1TPDA 1KM2A 4IPJA 4WQ6A 5HNRA 3LGEA 1SR9A 2ZFAA 3GNNA 1B4KA 3TC7A 3LCHA 3LLDA 3JS3A 4TU1A 2WSYA 3JRKA 3NQAA 4UTTA 3EX2A 5D37A 2DZVA 4AWUA 1QO2A 3M7WA 1EUNA 2DORA 2JGQA 5DCBA 4RK8A 4K8HA 4G1KA 3R5EA 2RH9A 2P1FA 1JCJA 1GTEA 1AW1A 4RZ5A 1MXSA 4Y96A 1IXNA 4K8EA 4M7SA 2TMDA 4IMGA 2JGYA 2WNQA 3U8GA 3F4WA 3GKFA 1JUKA 3DFPA 3S5NA 4DXVA 3OVQA 3DFSA 3A21A 3NL3A 2Y88A 4JD4A 2DZWA 2Z0IA 3DFQA 3OEXA 5D02A 3LOTA 1LLWA 3CU2A 4CQ8A 5K7JA 4K7VA 1DVJA 2YR1A 3LV5A 2ZRVA 3KVLA 5CPOA 4WJEA 5LHEA 2ALDA 3NPVA 2J88A 3EWYA 2QAFA 3MP3A 4UCGA 1SZNA 2E68A 4PTNA 4Y9AA 3W87A 4O0ZA 3G0UA 4HNNA 1LORA 3QW3A 1DJQA 3L67A 1OJXA 2D73A 2CWNA 3GNDA 4NJHA 1VC4A 5C6MA 3P82A 4RJEA 1BEUA 1W5OA 2Q8LA 4KWVA 5AOUA 4FXRA 5HWNA 2FPVA 3W1MA 1H7XA 4C1LA 1XI3A 3G3DA 4PCFA 2NUWA 3RF9A 5HR6A 4UTLA 1FWRA 4EOUA 3C2RA 1EWDA 3HF3A 2X1UA 1XBYA 4IOTA 4IPIA 1H61A 3DKJA 1NF0A 4FNRA 1HFBA 4R53A 5EYWA 2PRMA 1EEPA 1AK5A 3TSDA 1FDYA 1H7WA 3E02A 1GVQA 1TTIA 3TSMA 4X2RA 3EXSA 2Y85A 1O94A 2QUTA 2VEKA 2YFNA 3LV6A 3WJYA 4S1FA 4CNOA 5KZDA 1HO1A 3VI2A 2CLEA 3G24A 1TO3A 3MI6A 2ZZ6A 4MVAA 4NNAA 3W1AA 2X16A 4QQ3A 2YDAA 1OK6A 3ATZA 4JICA 1O5XA 2A85A 1ONRA 5TIMA 3BPWA 1E51A 1KBIA 4NX0A 4XKYA 4D2JA 4OBTA 2WO5A 3GKAA 4M19A 1OX5A 4UR7A 4OGZA 1P0KA 5K9DA 1QOQA 3MUXA 2G96A 5U7SA 2E77A 3LERA 1JCMP 3UWQA 3M9YA 2ABBA 5J5RA 3O8AA 5BNKA 3ABQA 1V7YA 3IVTA 3L5LA 5AHIA 5FEZA 4JX4A 3W83A 1MZHA 3LCLA 4JXCA 5I3KA 3ELFA 3ABRA 1GYLA 4O28A 3O6YX 1OF6A 1Q6QA 3NQCA 5BRBA 5AYYA 3IRDA 5KSWA 3STEA 2DU2A 2NXIA 2B7NA 1QOPA 3FKRA 3R12A 3UXAA 6ALDA 1EP2A 4X9SA 1V5XA 5F2IA 4AWTA 2X1RA 2RKXA 3W1TA 3PUEA 2C13A 3HG2A 1ZAJA 4ZQOA 3HIJA 4DO4A 3QQ0A 3WK0A 5TBOA 3G1FA 1WV2A 1XL9A 3C2EA 2GVJA 2Q3OA 4YL2A 2E6YA 3VFLA 5KMYA 4WY0B 4AHQA 1GG1A 5K4XA 1I4NA 3HB9A 2HSAA 1DQWA 3ANYA 1Q6OA 1TV5A 1ZENA 5FF0A 3NQMA 3U2OA 3L0NA 4RXGA 4BI7A 4FB7A 2CZDA 1K8ZA 5F1UA 2FFCA 3S9YA 1TTJA 4DQWA 1VCVA 2C16A 3LRMA 4E38A 2YYUA 4AVFA 3TE9A 2EF9A 4JTTA 4HN4A 1ZJIA 4Z0SA 3EWXA 3TQ0A 2E5DA 4LVGA 2ZRUA 4BFAA 2HMCA 5BW6A 1LRTA 1RPXA 3PBWA 1A5BA 1EIXA 3UWYA 2QCDA 3W07A 3NNTA 2Y6ZA 4FHAA 2NX3A 1UB3A 1RQHA 4O1AA 5IBXC 1YXYA 4GUGA 3PF3A 1BWLA 3W1LA 4IXXA 3BARA 3W7PA 3HBLA 3GXNA 3W72A 3L2IA 4ORMA 1VJIA 2A0NA 3G1SA 4WUIA 3STGA 3G18A 1TPFA 3N9SA 4JTSA 4N9CA 5D09A 3G1XA 2LLEA 3P62A 3PBVA 1W1ZA 2QAPA 3IIXA 1TSIA 3MO7A 1YTEA 2BTMA 4POCA 1A5AA 4LOCA 4DF0A 2EAWA 3W22A 3LCXA 3UD6A 1KV5A 3HPZA 4MY1A 3LLFA 4RR4A 4JDYA 3HQ1A 4J9JA 3IIVA 3W7LA 2NX1A 4MUZA 1ML1A 1BTMA 2OT1A 4PH6A 3LHTA 2VFIA 4CLMA 2ZRXA 5C54A 3P61A 4N9DA 4O50A 4BWLC 5LNVA 3JR2A 1K8YA 1TPB1 1ZY9A 3BW2A 2VEPA 4N6FA 3FS2A 1Q45A 2Q3RA 3S5ZA 1GOXA 1R2SA 1XUUA 4O14A 4OHQA 4I7VA 2CLOA 2QUUA 5G1YA 1GVOA 1JR1A 1AG1O 1W3IA 1I2QA 1KM4A 1TCDA 3L9CA 4JTFA 4Z0JA 3W70A 4YCOA 4MYAA 5AHMA 5AC8A 2ZBTA 1ZHAA 3NYZA 4H4IA 5FEPA 3NQ8A 5L9FA 2QJIA 4UUIA 1B9BA 2ZA3A 3UZJA 1ZAIA 3HG3A 3TAKA 5C55A 4GC4A 4GWEA 3W71A 4JTUA 2HTMA 3B0UX 1KA9F 3BGJA 1JRBA 2ZTJA 5HR7A 1KM3A 2PCQA 5DY3A 3WK2A 1VPXA 4OV4A 2BWGA 5CZ0A 1FWNA 3C3NA 3SGZA 4BR1A 4ZMGA 3TU9A 5AHEA 4KFOA 3KVJA 4WZHA 1XFBA 2VXNA 4QAIA 5D30A 4O19A 4O53A 5E0KA 4S2CA 1NAL1 3GVGA 1QNVA 2A7PA 4CCEA 3TFCA 3MHFA 4LW7A 3I7RA 4FNQA 3QZEA 3GDKA 1VYPX 3F4NA 3NEVA 4KWWA 3ZWSA 3F03K 5EPDA 4K38A 5CZJA 1U83A 4ZQPA 3CB8A 3M0ZA 1W5PA 4ZZ9A 5DXYA 2DJLA 1ME8A 3GK0A 2EGZA 4WXZA 1KFKA 4YLWA 4QITA 2DZXA 3M5VA 4NT0A 2TSYA 4UTWC 1OK4A 2E6AA 1SPQA 1LDCA 1FQ0A 1O4UA 1RQBA 1G7VA 2NUYA 4M6VA 3TSBA 1OFPA 4EVZA 4XTIA 2Z1BA 3P8IA 4JX5A 3VCRA 2BLEA 3S6DA 3W1RA 1TPWA 4DF2A 2NWSA 1LOLA 3QW4B 4WY0F 2CLIA 3NQ7A 2QCGA 2QKFA 1G67A 2C1HA 4PODA 3C2VA 3O63A 1OHLA 4Q32A 3UQNA 1JCNA 3UZ5A 4YWIA 3VNDA 1QPRA 1N8FA 3CWOX 4NNBA 5I3JA 4E0CA 4FX7A 1VH7A 3MYPA 2J24A 2QJGA 1VRDA 4FNTA 1TPC1 4WXYA 3W3OA 4JN6A 4IXHA 4X22A 1TJPA 1SW7A 4E2BA 5DLCA 5CGQA 1TPUA 3FA5A 2EPHA 5LZLA 3MI2A 1JCYA 1F5ZA 2Z6IA 1W3NA 3S1WA 4KFNA 1WX0A 3PBUA 3WFAA 1PIIA 3KHJA 5D2XA 3YPIA 2WNZA 1JUBA 3NQEA 1AL8A 1EP1A 2V5BA 3LTPA 2GUUA 2I14A 3PY2A 1L9WA 3NXFA 2WSQA 2Y63A 3E96A 5EY5A 1RV8A 3A24A 3GXPA 1MO0A 1FWSA 1GVRA 2I1OA 3SGUA 1TQJA 5CKSA 5DY2A 1SU5A 4OT7A 1Q6LA 1QDSA 2OZ0A 2FPTA 3TCEA 4Z1BA 4K7YA 2AQWA 2DZTA 1ICQA 3FOKA 4NJGA 4YCPA 1ZFJA 4UTJA 1H51A 2FIQA 3LCGA 3S8HA 2G5WA 3NM3A 5MHBA 1OFRA 4L4LA 4AF0A 2HS8A 3NZRA 3BLEA 3QPYA 2OT0A 3S1XA 4NXSA 2X30A 3DENA 4XKYB 4Y90A 4KFPA 3THAA 3W6YA 3HO8A 4LWWA 2NV1A 3NM1A 1WQ5A 2VOMA 3PBYA 3MP4A 2CZEA 3OG3A 1XKYA 4PEKA 1T96A 1N55A 6TIMA 3QYQA 1CI1A 1MEIA 4GNJA 1UJPA 1LBFA 1C9DA 3W2NA 5LNRA 3HGOA 3L5AA 1OX6A 2TRSA 3BG9A 4EF8A 3ABSA 5DXXA 1BKSA 3KRUA 3G8RA 3UNDA 3VE7A 2WPBA 1XDMA 3IV3A 4FIRA 4JTJA 3VKJA 3EWBX 3P5ZA 4N02A 3PUOA 3IGUA 4FXSA 5AN7A 4IJBA 3OA3A 1KFEA 2YPIA 2FLIA 3KRSA 5K4ZA 3I7SA 2R8WA 4AAJA 2QR6A 1SFLA 4QNWA 1VCGA 3Q37A 1OABA 2B7OA 3B03A 3A9IA 5C5YA 3UY8A 1H60A 3V75A 2WSRA 5AYZA 1KM5A 3W7KA 5J5DA 4N6EA 3DI1A 3A5FA 3O6DA 1GYNA 3G8EA 3TX9A 1KTNA 1OFQA 1DL3A 3W2UA 3R8RA 3L0GA 1CW2A 1IXOA 5H2ZA 5GVJA 5ABTA 4PC8A 3SIZA 4JX6A 4MLJA 3BW3A 3M44A 1D3HA 5TQLA 5G2WA 4N9BA 4A3UA 2O7QA 5F2LA 5IBXA 3QQ1A 1F74A 1KW1A 2CZ5A 1KBJA 1LOSA 3FYOA 1IGSA 1ICPA 3D0CA 2C14A 3HGSA 1TPH1 4WOQA 2P0OA 3LDVA 1OFEA 4FNPA 1YADA 2WNNA 3QMRA 2J9ZA 2X1SA 2CFFA 3TMLA 2V81A 1F05A 3LCFA 3NAVA 1P4CA 4TO8A 1FCQA 1NVMA 2YXGA 4LY8A 1L6SA 5G4EA 2QCDB 2PC4A 3N9RA 1QPQA 4TR9A 3LI1A 1LYXA 1KFBA 4IWWA 4MYXA 2QUVA 3IEBA 2YFOA 3EXRA 1LOQA 1SZGA 1TV7A 5F2MA 4PL1A 3W88A 5G1TA 4JYEA 5I3FA 2YCEA 2E09A 2OX1A 5FF3A 2GQ8A 1L6YA 3NQFA 2WV8A 3O06A 1N7KA 4S2BA 5LGZA 4LV4A 4BF9A 1LRQA 3MHGA 1O60A 2J9YA 1YDVA 4R33A 3DAQA 5FEXA 3M6YA 5FF2A 1W8SA 3L68A 4IX0A 1AL7A 1I2PA 3O1NA 4A2RA 1K7XA 3A23A 1SUXA 1SO5A 1WBJA 4HSOA 3RMJA 3HPSA 3V1PA 4DBDA 5BOOA 4U4MA 1GEQA 1MSSA 1PHWA 4FIQA 1SZFA 2Y61A 3KAOA 1GTHA 4UMAA 2J6XA 3PG9A 5FF7A 4DO6A 1C8VA 2GJNA 4JY8A 3STCA 5C2XA 1ZALA 2PURA 3U6WA 1TPEA 1UUOA 2F7FA 3CTLA 3GLCA 3N19B 1K7EA 3P5YA 3WJXA 3LCWA 5K2ZA 4DPQA 3IIOA 4TX9A 1OFBA 3G1HA 3FJLA 1EPXA 2VFEA 4UFJA 3PVFA 1EP3A 1VYSX 1TV8A 4O1BA 2DZPA 5U4NA 3M1ZA 1JCLA 3LCIA 4XQ6A 3FIGA 4LS2A 1YTKA 2A7NA 2RDWA 4ML9A 4LV9A 3BVJA 3NL6A 4K37A 4LRTA 4ZVJA 4X3ZA 1SO3A 5I3HA 1WDWA 4JS3A 3GDLA 4ZQRA 5D2YA 2TYSA 1LP6A 4JEQA 1W5QA 1SO4A 1A5CA 4EWND 1R30A 2DJXA 2BZNA 1I8JA 3EKZA 2JKPA 1JQXA 3S5YA 2CLMA 1RQEA 4WOZA 1QO5A 3INPA 3LHWA 4LVDA 5FESA 1VLWA 1Z41A 1JUEA 1UUMA 1PS9A 1KFCA 2AGKA 1A50A 2B4GA 2GVLA 4JIQA 2C18A 3NPXA 1WYIA 3LXBA 3UWZA 3LHZA 4QSHA 2H6RA 3W84A 4XZ9A 3CC1A 4Z08A 2QCEA 3AJXA 2QCCA 3WK3A 1PCWA 1RD5A 4HNVA 4NU7A 3A5VA 4O54A 4O8RA 4UFIA 1JVNA 1IXPA 4ADSA 5CPNA 3L5MA 5K9CA 4NZJA 4MJZA 3M43A 5HUPA 3M5YA 4A21A 4RX0A 1GPWA 2EKCA 5HWJA 3NDOA 4ADTA 1EB3A 1F6KA 1F73A 3VE9A 4O12A 4P2VA 2CLFA 3QSRA 3TK7A 1FCVA 2QCFA 3PSVA 3S0CA 2QCLA 4GUJA 4RZ6A 4IMFA 3W1PA 2QCMA 1LBMA 3C61A 3T7VA 4ADUA 1YLVA 3NO5A 1G4SA 4UTIA 3G1YA 2A6LA 2ISVA 3SI9A 1LCOA 1ZCOA 2P10A 2V2DA 1TYGA 4XUGA 5D2WA 5F4WA 3UWVA 4MIMA 5G4WA 4IMDA 4LT9A 3TAOA 3PR2A 1X1OA 4QISA 4UTKA 4Z1DA 1RZMA 1FBAA 1MEWA 5AHFA 1TMHA 1W5MA 3GR8A 5KZEA 3MYOA 2BXVA 2H8ZA 3M5XA 4UFMA 3KFTA 3QF0A 2I9EA 3H53A 5CPMA 2ATMA 4ZL1A 3TR2A 3M16A 1DQXA 1EUAA 1GJPA 7TIMA 3C4UA 1W0MA 2Y7GA 4UFKA 3HG4A 4FEZA 3W7DA 5D04C 3TIMA 1OYAA 3EEGA 2RDTA 3T44A 3H54A 3SECA 1C29A 3BLFA 4UTHA 1PL9A 1YTDA 2JK2A 2ZTKA 1LBLA 1OG0A 3TW6A 3TXVA 4O11A 1TRDA 3TV8A 1D3GA 1WBHA 3W7HA 3ABOA 4JTHA 1PE1A 4BI5A 2FTPA 5BMWA 3SY5A 2B7QA 3C56A 3W7RA 1F6PA 4O18A 2FPYA 1R46A 5CZSA 4C1KA 2XN0A 5A5WA 5E93A 3N34A 4AF0B 3C6CA 3UWWA 4QM1A 3I65A 3C0JA 5FEWA 3WJWA 1M6JA 3CQ0A 1Y0EA 1YXDA 3SSJA 4WD0A 1K02A 2VC6A 4O52A 4LC6A 2QEZA 3FKKA 4UFHA 5AHLA 3PG8A 1FWWA 3E0IA 3W9ZA 4JTKA 2V30A 1ADOA 4LTSA 3EX4A 4ZQMA 1X7FA 1SSDA 3FEMA 3MP5A 1ME9A 3GDTA 3W7OA 1VS1A 2Y7DA 1VYRA 2ATSA 1TQXA 4NZFA 3I7QA 4NVTA 3CEPA 1XM3A 3LBCA 4N4QA 2NXGA 1Q3NA 1VR6A 2RDUA 2ZRWA 3TMQA 2E6FA 2ZYFA 2NX9A 1J2WA 3GIYA 1FDZA 2VELA 2QCHA 5LSMA 4MZ8A 3LTSA 5CSRA 3S5OA 1EA0A 4UR8A 4JNMA 4JY9A 3OHIA 1KM6A 2V9DA 4IMEA 2A1YA 1P1XA 3T55A 1AW5A 4GFSA 1KV8A 4NXKA 1XUZA 3NQ6A 3NA8A 4UNKA 2VFGA 5LNWA 3MBDA 1HUVA 3RLUA 3W76A 1AW2A 3C52A 5IM51 4FNUA 1FXQA 3W2JA 3TQVA 3S1UA 1OX4A 2ZRZA 3G22A 4HNUA 3PULA 5T26A 1H7RA 4A22A 5A8GA 4MFEA 3GDRA 5CSSA 4Q33A 3RNDA 4A2SA 3N14A 3QPZA 3B0VC 2GJLA 3KX6A 3F1QA 2XFWA 2YGYA 3P67A 1YDNA 1S5WA 4UFLA 3N2XA 5HULA 2W6RA 2GOUA 1FWTA 2G97A 1TIMA 1Z44A 2ISSA 3ZFHA 4AHOA 2C15A 4JDBA 4HPXA 1MEHA 1H7OA 4MY9A 2AAMA 3NL5A 3DHDA 1OYCA 3PAJA 1QPOA 3CWNA 1UBSA 4UTUA 3TROA 4R7JA 3N73A 1W37A 3R89A 4MOZA 4YMZA 1DV7A 4EIVA 2YX0A 3KXQA 3QFEA 4U28A 3K30A 3NL2A 3LBMA 1X1ZA 4M6QA 4ORIA 2CLLA 3OVPA 3RLVA 2HS6A 1T0OA 3B0PA 4OU1A 2J27A 3QM3A 4PL2A 2RFGA 1OYBA 1W54A 1T99A 2ZDRA 1F76A 2Z2UA 3B8DA 2BX7A 3P8JA 1GVSA 4N2YA 3PSWA 1H7NA 5D2VA 3NZ1A 3BV4A 2C6QA 4DBEA 3OVRA 2QF7A 3DFTA 1SQ7A 3NGJA 3TDFA 3L0KA 2YSWA 1FCUA 3E9AA 2WJZA 3QMTA 1IF2A 1H63A 4FX8A 3DXIA 4N4PA 3QEZA 1HTIA 1FDJA 1D9EA 3MMTA 3R13A 4MY8A 1Q6RA 4DF1A 4RXFA 4HNTA 1RR2A 3QJAA 3NQGA 1GWJA 1ZNNA 2ABAA 3DFOA 4LU0A 3LX9A 3KVKA 1O5KA 5AC7A 2JBMA 4O0KA 1G4EA 1KFJA 1G4TA 1KFLA 3NG3A 1PCKA 4O16A 3W1QA 3CLMA 1U5JA 4LUJA 3PWAA 1TJRA 1SZEA 4MFDA 4A29A 5D2TA 1XBZA 4JYDA 5SWUA 4TMCA 3LRKA 3GAKA 3G0SA 4ICNA 1OFOA 4I7UA 1K03A 4LC8A 3BGGA 2X2GA 3ATYA 3IIZA 1G6CA 4XTDA 5KZMA 2NLIA 2EHHA 2ZCGA 4RCXA 1JRCA 3W1UA 1VCFA 4GE8A 3Q2DA 1DBTA 3HJZA 3CPRA 3PUDA 2YYTA 1SFJA 4JTGA 4O1DA 4ZQNA 1O95A 2J9XA 3P7YA 2WKJA 3L66A 5D38A 5LKYA 5HQEA 1FY6A 1P5BA 2ISWA 1J4EA 1FUYA 3LHYA 2V2CA 3LTYA 4GBUA 1UASA 4GJ1A 3W7MA 1LZOA 3GB6A 4IGHA 1YDOA 4JGDA 2ZZ1A 3HPXA 4M5PA 1VHCA 2A21A 3SW6A 3NOEA 1M7PA 1PHQA 3W75A 4O17A 3G3MA 2Y70A 2V0TA 3SZ8A 2C19A 4Y8FA 4XBSA 5F4SA 3GAYA 4HT3A 3MHUA 4BK9A 2TPSA 3W7GA 3UXDA 3BO9A 5AYXA 4NUWA 3WJSA 1KTCA 5EMUA 4IMCA 1S5VA 2NWRA 3GZ3A 5G5IA 5L6UA 1KM0A 2E6DA 2QJHA 3LM7A 2DZSA 5AHNA 5EL1A 1XXXA 2QCNA 1A53A 5CG7A 4BWLA 3FLUA 2GQ9A 3W2KA 3GYEA 5G2IA 2FB2A 1G69A 1VQTA 3P80A 4CQAA 3O05A 3ZWTA 3B05A 2F84A 2GVGA 4R34A 3IIPA 5F2GA 3WK1A 3NR0A 2QDHA 1S5TA 1ICSA 4NJIA 2ZZ5A 1ALDA 4QJ1A
chains in the Genus database with same CATH superfamily
1QAPA 3D6NA 3TYDA 2Y62A 3HGJA 2GQAA 3IJ8A 5ABEA 3WX7A 3HA1A 5D9PA 1OF8A 5DBUA 2OMAA 1R38A 2EKGA 3AO0A 1LUCB 2WZTA 1XSKA 1UR3M 3GH5A 3MUY1 3WF0A 3DGRA 1XBXA 4XVEA 1QNSA 5FL0A 3VC5A 1EZ2A 3ITVA 4HSNA 1GKPA 1IIGA 2R9RA 3H7UA 3U57A 1QTWA 3N2MA 1GOIA 4JFVA 4D8ZA 5FOOA 1TE1A 4C6EA 3LMZA 4XZNX 2INFA 4DAFA 5I0DA 3T78A 3W1NA 3WY1A 3DFNA 2Y2WA 1ZLPA 4RLIA 3I4KA 4CNPA 2GJXB 4AMCA 1GW9A 3G1DA 1TA3A 4M6UA 4UTTC 4FOUA 1QPNA 4W84A 4BY3A 3GVQA 5M03A 1PBGA 3AUOA 1DHPA 3WLMA 5HOSA 3MSYA 1XYFA 1QPKA 5EBAA 1H09A 2V3FA 4JBRA 1CXKA 3I68A 4UMBA 2XN2A 4O13A 1QCWA 4JYFA 1XC4A 1X8FA 4FF7A 2Z1XA 1VGAA 3OG2A 2I9UA 1VFSA 3CL6A 2XFRA 1JJKA 2UY3A 4DEFA 4B4FA 3ARYA 2WJEA 1M65A 4NNCA 3ZYZA 3AYVA 1V08A 3RK8A 5KINA 2PZNA 1KBKA 4UQDA 2A4AA 4PUEA 1H3GA 1HKVA 1RSCA 3VKBA 1FOBA 3WQEA 1JPKA 5JH2A 3MI3A 1C7SA 2V2HA 1TVLA 1AFSA 5D32A 4HOWA 3DGBA 4ROQA 4FZIA 1THFD 4GINA 5CCZA 3A3HA 4CD8A 3QLLA 3A22A 3BLIA 1AMKA 3PM6A 3W01A 1EOKA 1Z9AA 2NSOA 2XM2A 1IWBA 1XV8A 1LT8A 1OFDA 7REQB 2HROA 1XQLA 3KWSA 2CU0A 4URIA 1Z48A 3CIWA 4IP7A 3M5ZA 5AC6A 5AFDA 1Q85A 1B3XA 3USBA 2WBGA 4FP1A 4DUWA 2D69A 1VPYA 8XIMA 4OV9A 3FYPA 1ELSA 1TREA 1JAEA 3DHUA 1L6GA 4PFHA 4CQ9A 1DWFM 1H5VA 4PN2A 4UIOA 1XCFA 4BQ5A 1CXFA 3G0XA 3APTA 1LLZA 5LYRA 3V0TA 3PS7A 3IVSA 4HZ6A 1B0IA 3MWCA 1R2RA 1SSGA 2ZXBA 4MNKA 2PDWA 1E6NA 4W5UA 1AMYA 3UR5A 3BW4A 5FI8A 5CBJA 4B5XA 2O55A 2QDDA 2BY2A 4GRSA 4IG2B 5FSEC 3BAKA 5D05A 1JF6A 4JIPA 2J7GA 3SUWA 1RUSA 1ZB5A 4ALDA 4CCCA 3F7JA 3GM8A 1GQLA 1JQVA 3W85A 2O7SA 3WJZA 4GKLA 1TRIA 3QV6A 4WY0A 2E9BA 3M47A 3ITLA 4G1NA 2OJPA 2VGFA 3WD2A 1R3VA 6XIMA 3O15A 3OBAA 3W74A 1U1UA 4WK9A 1SW0A 1GUVA 1KGWA 3LB0A 1I2RA 1SYTA 4PMDA 3DBPA 2E1DA 2I5QA 4O1CA 4QQUA 3RN6A 4K1GA 3CUGA 1DIOA 3AS3A 2RGMA 2E5CA 2F2KA 5CZKA 2E5BA 4WGHA 3N6QA 4HPJA 1ITXA 2PP0A 5ABFA 3DHFA 1R0MA 3THDA 4ZR8A 1FXPA 3OBKA 4ZO7A 4LSBA 2WWDA 5DELA 4RNIA 1MYRA 3EKGA 1KTBA 4MPKA 4Y9PA 2VZUA 4LAKA 1MXGA 3T0DA 4IQDA 4AMAA 2V38A 4KRTA 3OZYA 3VDAA 2H3DA 1TV2A 1QFEA 3BLKA 4U5KA 4AD3A 2PE4A 3IGSA 3DCPA 4PMUA 2R94A 3EOEA 2ASHA 2E25A 1BVZA 3PHAA 4O57A 3IVUA 5ECUA 3TQPA 5DN1A 1QI5A 1YMYA 4X0VA 2ZE3A 4LVFA 3W7NA 2ZX7A 3K46A 1QWGA 2Q8ZA 1V6YA 4XIAA 4L5ZA 2ZZ3A 1WXJA 2QIIA 1RCXB 4NAFA 1E70M 4A8RA 5LNSA 4DUXA 1K7FA 2A7RA 3UEQA 1EBGA 1J12A 4NAEB 1W9BM 1EC7A 5I06A 4JAWA 1ME7A 4JN7A 4G5DA 4OIFA 3FCPA 1XWYA 4F0MA 1FTXA 2H90A 3PNUA 4GVHA 3PB2A 3KL3A 3ZT7A 5HINA 1G7UA 3M41A 3QRHA 3WNPA 1HNYA 3R10A 1QK0A 3CT7A 4J35A 4OE7A 1I2OA 2ZWYA 5BMXA 1T7LA 4LGXA 4U2ZA 2PI6A 4G56A 1BXNA 4M0XA 1SFSA 1B30A 3KLLA 3VZXA 2J74A 1VPQA 5DCEA 1QASA 1W31A 3NQ2A 1JDAA 3L65A 2CLKA 4JHMA 5TNVA 2A6NA 1DOSA 1S2AA 5K9XA 4C65A 4NASA 4Z2GA 1EJUC 3EX3A 7TAAA 4WQ6A 5HNRA 1E72M 1BRLB 3GR4A 4XAZA 1SR9A 2PLCA 3FSUA 3GNNA 4XZWA 4AZCB 1VFUA 1G1YA 3TC7A 1UOZA 4TU1A 2FZMA 3NQAA 3O0KA 1KQYA 2E1WA 5JXQA 3F4CA 1MMFA 1OT1A 3IJ9A 3MSRA 1E9ZB 4AWUA 3G6LA 3M7WA 1XLDA 2PU1A 3GFYA 2RH9A 2P1FA 5AVHA 4DYJA 3AXKA 1XIEA 4RZ5A 1IXNA 3ITTA 1PX4A 3F4WA 3URNA 3DFPA 4DXVA 4AVOA 1VEPA 3A21A 2DZWA 3BSMA 4KEUA 5D02A 1KR0A 3N12A 3LOTA 5BRPA 4ZEPA 4WJEA 2D2OA 5LHEA 4AC1X 4E8GA 3QQWA 3RCNA 4I9MA 1S2VA 3MMUA 2PGRA 2EG8A 4P8XA 1BGGA 4HNNA 3QW3A 1AQ0A 3L67A 3RJXA 1OJXA 3GZAA 1V93A 1X98A 1P0BA 1FWFC 3OGRA 1VC4A 5C6MA 2Q01A 3H23A 1F3TA 1MWOA 5E70A 3CXOA 2FPVA 3W1MA 2R6OA 4PCFA 3CLWA 1XX1A 3C2RA 3D5HA 3WDIA 4HVXA 1BYDA 1HJVA 4IOTA 3FN9A 1NF0A 5EYWA 2PRMA 3MT1A 2PDXA 1AK5A 5H8UA 1H7WA 5TD4A 4WHBA 4F66A 4X2RA 1D8CA 2Y85A 3LS9A 1EGZA 2VEKA 3WJYA 1PEZA 2KX9A 3EOSA 4YHEA 1TO3A 4G2DA 3ATZA 2WJFA 1O5XA 4I6KA 3TN3A 4CN1A 5FIPA 3SCWA 4D2JA 3N11A 7ENLA 2VOTA 3VNKA 5HNUA 3CUJA 4CU8A 4M19A 2G37A 1H49A 4UR7A 3PANA 2ALRA 1P0KA 3H2NA 5GJNA 4G7FA 4W7WA 5K9DA 1QOQA 3MUXA 5U7SA 3SCPA 3O8AA 3WF1A 3LCLA 3PAOA 5I3KA 3VMOA 4A8NA 4B2DD 2GZXA 3BMXA 5I7GA 3O6YX 4LUSA 3NQCA 4X61A 3ZO9A 4AZ5A 5FJTA 4L4PA 4AY1A 2DU2A 1QOPA 2W9MA 3UXAA 1EP2A 1V5XA 5A6MA 1ISVA 2RKXA 5DRCA 3W1TA 3I4EA 4QCFA 5DT5A 3TN4A 1EDTA 2WWCA 3SCSA 2JEQA 2DSZA 3H21A 3ABXA 1AZ1A 3WK0A 3G1FA 4DHGA 1XL9A 1XSJA 5GQBA 3C2EA 2GVJA 5EMMA 4N42A 1Q2SA 4LB4A 6PTDA 4AXNA 4AHQA 1FFRA 5CLTA 1GG1A 3GIQA 1OSEA 3IUIA 4ZGYA 3M0KA 1XDJA 3KZPA 4GI8A 3ANYA 1TV5A 1ZENA 5FF0A 1VBHA 1HJQA 3WLIA 2A3CA 4NZ5A 5F1UA 1TTJA 3TE9A 4U10A 3LQLA 4LX4A 2HDJA 1V02A 4HN4A 1ZTVA 2E5DA 3VIMA 4LVGA 2D2GA 1EEXA 2IW0A 4FR6A 2X09A 1GVIA 3NZPA 4KWUA 2HMCA 5BW6A 3W07A 1FRBA 5E09A 3BZJA 3WMLA 3QN3A 3KEHA 4H8HA 1FHVA 1BWLA 2GGHA 1QWKA 4IXXA 1AA1B 3W72A 3JZEA 3N9SA 4N9CA 5D09A 4NG3A 3N17A 4BHYA 2QQ6A 2LLEA 6XIAA 1KKRA 3NOYA 1EDGA 1R3RA 3B97A 3M0MA 2BTMA 1A5AA 4LOCA 2P8BA 4CD5A 3LCXA 4FA3A 4MY1A 4RNHA 3HQ1A 4J9JA 4DYEA 2V3EA 4GK8A 1BTMA 4Q4SA 2OT1A 3LHTA 4AY8A 3AALA 3QOMA 2G4JA 1ZY9A 3QLDA 1RP9A 1OG6A 1S3TC 1GVOA 2GWGA 1W3IA 1AG1O 4PTMA 1I2QA 2V63A 2OZ3A 4AD5A 2HBXA 1D7FA 5MKGA 1OEPA 3WUBA 5AC8A 5BCAA 3ITCA 1MNSA 3QY7A 4F9DA 2QJIA 3M64A 1B9BA 5DFAA 4W7VA 3P3BA 1IGWA 3HG3A 2QULA 5BU9A 3I3DA 3W71A 4EXQA 3NIYA 1E6SM 3PZOA 3KOZA 1DPMA 3UT0A 3UW6A 3SCOA 1VPXA 4OV4A 1FWNA 4ZMGA 1E15A 4QAIA 4O19A 3E0LA 3PK7A 2W91A 1J5SA 1G9HA 1QNVA 3BQ6A 3Q67A 5IHRA 1UD4A 4FNQA 2OWXA 2VM8A 4GYFA 3GDKA 1DXFA 3GY1A 4KESA 1B31A 3NEVA 5HMEA 4KWWA 3F03K 4UNIA 4YHGA 4K38A 5EGRA 1U83A 4P7QA 4LCSA 2DIJA 4FLRA 2R82A 3K2GA 5E0CA 4ZZ9A 3E74A 4Q8NA 1ME8A 5G4HC 1P6CA 3WEMA 3IAPA 4AYSA 2EGZA 1KFKA 2BGSA 1WZKA 5CC7A 4JKKA 1CENA 1J9YA 4PMVA 1BXCA 3M5VA 1LDCA 1PTAA 2XFYA 1GJUA 4B2DA 2BHUA 4EVZA 2HVNA 4LBRA 4XTIA 4JX5A 3VCRA 3S6DA 3TYUA 3QW4B 2CLIA 3AICA 2QCGA 4RDZA 3BLDA 4DZIA 3GS6A 2C79A 3COTA 4Q32A 4AZHA 2AOSA 4YWIA 2ACQA 2OB3A 4NNBA 5I3JA 4E0CA 5LA2A 2VMFA 1TV3A 9CGTA 3LSBA 2QJGA 4QJ3B 3A4JA 3IACA 1VRDA 5A2CA 2X41A 1WZAA 3W3OA 1NOFA 5FJIA 2WMJA 4L6OA 3WH5A 3FA5A 2ZX8A 5LZLA 1FWAC 1E1FA 4L65A 2P5NA 3V36A 4FF5A 1JUBA 1TWDA 2JEPA 3H7RA 1AL8A 3PPHA 1EP1A 3ZVHA 2GUUA 4UZSA 4F2BA 5I77A 1VJZA 2WSQA 3LENA 4W8AA 1RV8A 3FJNA 1SJCA 3A24A 3OO2A 1UQYA 4A3YA 1GVRA 3PWIA 1BFNA 1PTGA 4K7YA 2VURA 3GTFA 2EO7A 4M82A 1ZFJA 1H51A 2GDQA 4NI3A 4ERIA 1WDDA 2G5WA 4M29A 1R3QA 4AF0A 4Y9MA 5C0QA 5CJMA 1HZYA 3QPYA 3S1XA 1XLBA 1S1PA 5A69A 4NXSA 4H01A 2ANUA 3HQNA 4KFPA 3THAA 3HO8A 3E2RA 1E73M 4DXKA 1E6PA 4LEFA 1IEXA 4A6GA 1WQ5A 2VOMA 3PBYA 2CZEA 1T96A 1V0MA 5EMKA 1UJPA 3W2NA 5LNRA 4QE5A 3EMZA 2CKRA 1OX6A 3ABSA 1RY8A 3MANA 3KRUA 1NWTA 1JEZA 3ISIX 2XDFA 1G01A 1NDWA 1R3YA 2J25A 4PTXA 1EKOA 1KFEA 3KP1A 4R27A 3GHRA 2JE8A 2YPIA 1YIXA 1PKMA 3I7SA 1RK5A 1SFLA 4DYKA 1O1HA 2B7OA 1UWRA 2YJQA 4GH3A 3UY8A 1H60A 5AYZA 3ANVA 4JCMA 4H9VA 3L0GA 4CGTA 3A13A 1ENUA 2NQHA 1IXOA 3MV01 5GVJA 4JX6A 1Z89A 3BW3A 3P93A 4S3KA 4A3UA 4W88A 2OVLA 1TZ7A 1VKFA 3KW3A 2X40A 1F74A 3JVAA 3TWAA 3FYOA 1E9YB 2PF0A 3SCVA 2HEJA 1IGSA 4E6MA 2C14A 3HGSA 4WOQA 1S39A 2P0OA 3DERA 1YADA 3QMRA 2CFFA 3TTOA 3FX4A 1MNZA 1P4CA 1FCQA 4W93A 4N7QA 1W32A 2PC4A 4HK6A 4PUMA 4ZSTA 1QPQA 2BVTA 3ONCA 4IGSA 1KFBA 5A8QA 4JTDA 2GL5A 1KQZA 4MYXA 4S3AA 1JPHA 2GVYA 1MW3A 1GCYA 3NZQA 2VDIA 3EXRA 1SZGA 5F2MA 3BSHA 4PL1A 3VGBA 3CAQA 3VD4A 3KBSA 5A94A 5FF3A 4NL1A 3NQFA 3UF9A 5I03A 3DUGA 5LGZA 3IAQA 4AC7C 2L5HA 8XIAA 4LV4A 4BF9A 4UQAA 2OR2A 4R33A 1M04A 3BAYA 5I78A 4JTRA 3DAQA 5FEXA 2WHKA 3L68A 1CLXA 5REQB 3O1NA 4A2RA 3A23A 3T8LA 5I5RA 4BZYA 4QLLA 1J0YA 1YPXA 1GTHA 2XZ7A 4F0SA 3VGFA 3VNLA 3OGSA 4ROPA 5FF7A 1ADDA 4HN8A 4JY8A 5CBBA 2F6KA 4PEEA 4ASTA 1UUOA 2F7FA 4Q22A 1X97A 3MSDA 1QOXA 2OELA 5K2ZA 1XR2A 5CAHA 2QGYA 4OBSA 4TX9A 4H00A 3TTSA 3N6JA 2VFEA 3VZYA 1EP3A 1TV8A 4AIUA 5FJPA 4JTCA 4CEXC 4A3HA 5U4NA 1AJ0A 3W82A 1JCLA 4BJHA 5BXSA 4XQ6A 3ZT5A 1OQFA 1YTKA 4KIRA 1JDDA 1VFFA 4K37A 1OD0A 4M80A 2JIWA 4X3ZA 3BSGA 1WDWA 3GDLA 5D2YA 1GZ1A 3S4TA 1LP6A 1SO4A 1R30A 2OLSA 1I8JA 1CTNA 2CNCA 2VD8A 2OLAA 5IFTA 3KTSA 2CLMA 2XSBA 4HTYA 4WOZA 4H04A 2YCIX 1BKHA 1MDLA 1UUMA 2BS9A 1TMQA 1Y5WA 4K8GA 3DECA 3OVGA 3NPXA 3FDGA 4QSHA 3W84A 1UZ4A 3CC1A 2QCCA 3WK3A 2GK1B 4FAMA 4FK9A 4O8RA 2G4FA 3L5MA 4NZJA 3P14A 4MJZA 1KRBC 1GPWA 3O9NA 5HWJA 1EB3A 4PTWA 1F6KA 2OEMA 4F79A 2A3LA 2WZEA 4O12A 3QSRA 4IFRA 3TK7A 2QXWA 4TTUA 4IMFA 1UR8A 3W1PA 3HN3A 1LBMA 5XIAA 1YLVA 3AU2A 3NDZA 2QVHA 4UTIA 3UR8A 4RDVA 1ZCOA 2P10A 4Y7EA 4MIMA 3AZTA 5G4WA 4LT9A 3TAOA 1X1OA 1LWHA 4W89A 1TMHA 4TX8A 2XINA 8A3HA 4YPJA 2FH6A 2YBTA 3ARRA 2J7DA 3QF0A 1W1IE 3B9AA 4Q4PA 1GJPA 4EK7A 3C4UA 3E0FA 1ZSXA 4FLOA 3IJ6A 1HQTA 4FEZA 3WNKA 4ZE5A 3AWNA 2PDGA 3W7DA 1F3EA 1OYAA 4FLQA 2RDTA 4IQJA 1ISWA 3BC9A 5G1MA 1X39A 3BLFA 4UTHA 1U1HA 5IFPA 1SR0A 1I1XA 3TXVA 4O11A 1DTUA 4GXWA 2Y8KA 1WBHA 3ABOA 1UG6A 2WMIA 3UXLA 2B7QA 3CHDA 1R46A 3VNMA 3RM8A 3VTRA 2XN0A 2HNEA 4FXFA 3UWWA 4XSMA 2XH2A 2JIEA 4QAWA 1M6JA 4PCPA 1Y0EA 3EMQA 1YXDA 2VNCA 3FSTA 4MDOA 3FKKA 4UFHA 3PG8A 4CQBA 2J7CA 3LPOA 3CMJA 4AQLA 2W5FA 3CUHA 3GC5A 1UP3A 1X7FA 2A3HA 2PEVA 4XAPA 1SSDA 4PCNA 4IP5A 4Y8EA 2ATSA 2EPOA 3LA4A 3CEPA 1XM3A 3LBCA 2AQVA 2ZRWA 7ODCA 2ZYFA 3GIYA 1KC7A 3SQLA 4JNMA 1XRVA 3OHIA 3O6AA 1TVNA 3LMYA 1P1XA 1AW5A 2ODOA 3SAZA 3MY9A 3A12A 5LNWA 1R3TA 5C9WA 4JQAA 3MBDA 3W76A 4QP0A 1AW2A 1D2KA 2GDUA 4FS9A 1ONWA 3TQVA 1OX4A 1GPFA 3G22A 3F5KA 4HNUA 5J8LA 1DWJM 3NXLA 1H7RA 2YA2A 2WKGA 2FZDA 5CSSA 2QMKA 2YCKX 3PFRA 4A2SA 1UBPC 3KX6A 5JIPA 5DQPA 2V5CA 2P3ZA 4XO7A 1WDRA 1NFPA 3NSMA 1IWPA 3H2FA 4GACA 5CQ1A 4KS0A 3UCCA 1XH2A 1YX1A 5JBEA 5GNZA 4JHOA 1J0ZA 2G97A 4AX7A 1KCKA 3R8HA 2DT3A 3L4TA 4AHOA 4JDBA 2Q6ZA 2AAMA 5BRQA 3EB4A 4F9JA 3DHDA 1V3LA 5CH9A 3KCLA 4C6MA 4UTUA 4MOZA 1JF5A 1UD6A 3VDGA 1A5OC 4MHBA 2V5KA 3NL2A 3LBMA 4ORIA 2AL2A 1XLGA 2J27A 3QVQA 1T99A 4H83A 1F76A 2BY3A 3B8DA 2BX7A 2EJAA 3PSWA 1H7NA 1WZMA 3BAJA 3T0TA 1HKJA 2J8TA 5I07A 3DFTA 3NGJA 2BHYA 4YTQA 4KMQA 3E9AA 2WJZA 1IF2A 4QCEA 3DXIA 4G7EA 4PYSA 3KBNA 4PUJA 3BWWA 1A5LC 5LIWX 3R13A 2GGGA 3CMFA 1LG1A 2Y0FA 1YW1A 4RUBA 1O5KA 5AC7A 4GCAA 4ERGA 2IPGA 3NG3A 3RX2A 3UZWA 2R1KA 4LUJA 1SZEA 4RE4A 4MFDA 5FJOA 4MAVA 3LGGA 1QK2A 2XZ9A 4AYGA 4PRWA 4PMXA 3M0XA 4I7UA 3U7VA 3MKCA 1G6CA 4A35A 2EHHA 2ZCGA 4RCXA 3B0YA 3VIFA 1P48A 1DJGA 4GE8A 2ISFA 4HZMA 4QJ4B 4XZLX 1C90A 2DIKA 3VZZA 4JTGA 2J9XA 1RH9A 1AH0A 3RU8X 5LKYA 5JBFA 5HQEA 1US3A 3H2MA 2V2CA 4QTGA 3W7MA 1UWTA 1YDOA 4JGDA 2J66A 3HPXA 3WNMA 1VHCA 3SW6A 3WEOA 2FDMA 3B40A 4AFYA 3W75A 2XFFA 2VZOA 1EOMA 3LPFA 5KZ6A 1EYEA 2WNWA 3VDCA 1K4HA 4D72A 2Y70A 3GU9A 3RILA 1WPCA 4DIAA 3MHUA 3ARQA 3IJIA 2XGBA 3D3AA 3GU1A 3W7GA 3UXDA 3BO9A 1UH3A 1U33A 4XISA 2DZBA 1XHGA 3WJSA 2PODA 3WDRA 2NVCA 2NWRA 3GZ3A 5DF0A 5L6UA 1XYZA 1KM0A 2E6DA 4OUEA 3LM7A 3B8WA 5AHNA 1KXVA 3UR2A 4RW5A 3CGTA 2FFIA 3BL3A 2XVLA 5G2IA 3B9NA 4LANA 4CQAA 2WMHA 1X1NA 2GVGA 3BOXA 3KBJA 2QPXA 3NR0A 4IISA 1KCZA 3W28A 4QG9A 4D71A 2ZZ5A 1ALDA 4QJ1A 2D0GA 2KZHA 2A79A 3W1XA 3QV8A 2G3JA 4GYPA 3WMCA 3JZUA 1KRAC 3EB2A 4ONVA 5A8PA 1J01A 2X0SA 4GG9A 5LA1A 4R9XA 1GVYA 4YYFA 1HW6A 1QXLA 5LNUA 4DJDD 4E2OA 3A4WA 4W86A 4JTLA 2DZUA 3P0XA 1E0XA 4O10A 3SCQA 4MWAE 2Y7EA 4ENLA 1M41A 3R0DA 1QHZA 4HMCA 1GQJA 3W7EA 1EHNA 3WN6A 4DN1A 4PMYA 2J7EA 3N2BA 3SJ3A 3S2CA 1KLZA 4QGCA 3TH6A 4PB5A 1MW2A 4IPNB 4GIRA 3GNXA 3WDJA 3TC3A 3HG5A 2NZLA 1VF8A 1WKDA 2OODA 4U31A 2E4TA 2VDHA 4GXMA 3NGFA 3KTXA 2NXHA 2VFDA 3T08A 2XPKA 3SO7A 2Z1VA 4K6AA 4RKAA 4XZIA 5HUOA 3AAMA 3M0HA 5AC5A 3JU2A 2OXNA 3W7IA 3EAUA 5FJUA 4P8VA 1NWUA 3WD3A 2J78A 2Y8UA 3OYZA 1A4MA 3PZMA 2VEIA 4H9XA 2FQIA 3MJYA 4DBUA 3PTKA 2HE5A 2YA1A 1CYGA 3H4XA 4DZAA 2V8ZA 4OBRA 4B5UA 3VM5A 3QH2A 4QDMA 3PZ9A 3CNYA 3W29A 4LNYA 3S5SA 3WQPA 3W73A 2GSHA 4IX2A 3PZVA 1KM1A 1RJRA 2FMOA 5JVLA 1R2TA 2VFFA 3T4CA 4KF1A 3WSUA 4YXGA 2X2YA 1ODZA 3P84A 1KLYA 2FMNA 1B3OA 4CD4A 3T40A 1DE6A 2Z2AA 4OJYA 4ZCWA 1IE7C 3ENLA 4XUYA 5KTLA 3DZ1A 3T0AA 1BG4A 3W2LA 1K70A 2WQPA 3CBWA 2DFAA 3B06A 5BOEA 1OFAA 1DJWA 2Z28A 4ZXOA 5HK4A 4LS0A 1EWEA 4GA8A 1XLAA 3NPUA 2Y5JA 4PBFA 3OOQA 3PC0A 5HWMA 3TA6A 3WUFA 2W0UA 4HU3A 4XAFA 6A3HA 2BMBA 4ZQCA 2IKIA 2Y1HA 3MWAA 4NJJA 5HNTA 3Q94A 1XKJA 4TV6A 1B4EA 2ZZ2A 1WKFA 1RJPA 2R24A 2CXGA 5C2CA 2VX4A 3OZPA 1SO6A 3WNLA 3UG3A 1F4AA 3T6CA 3GBDA 1K1DA 1LT7A 4CN6A 6CGTA 1J96A 4E3TA 2ESCA 1D8WA 3WZ0E 3CTTA 3OB8A 1W2VA 2O4MA 3G1VA 1OCBA 4NRRA 1UHVA 3PJXA 4EAMA 3AHXA 3C2OA 3S2LA 4IPLA 2A5HA 3S2JA 3B8IA 3EXTA 3NURA 2XWEA 4LXFA 2O4QA 2V5JA 1LQ0A 4OWGA 1XIFA 4ZFCA 3KUMA 3UPWA 3G1AA 4O4VA 3O07A 2XIMA 1MUCA 4KQNA 3D3FA 3EZ4A 1GT8A 1L2QA 5DCDA 2OGYA 1JULA 3WUGA 4M6PA 4XG1A 4O4WA 4Z2IA 1EZWA 1TE6A 1JD7A 3TXZA 4EXBA 1FWCC 1YYAA 4QXIA 3RPDA 4KKXA 2WJDA 3ARVA 3CH9A 1TR1A 2HZGA 1XDLA 4L9YA 1NSJA 4XD5A 4GD0A 2QF8A 3VIGA 1NOUA 1TX0A 2W92A 3W23A 2V82A 3AIBA 1C91A 3GXIA 4B3ZA 2HXTA 2G3IA 3GHSA 4DJDA 1J5TA 3UVAA 4RDYA 1C9WA 2ZA2A 1I6NA 3CEUA 3IGXA 3VKAA 3HMJG 1GOQA 4ZENA 4HOZA 4JFUA 3T9PA 5CPTA 5DRIA 1JAKA 4AU0A 1R3SA 1E3XA 5K3VA 3VILA 3GXTA 1WNOA 3T42A 1FWDC 3E49A 4WGXA 4HNOA 2E28A 2XWDA 4MADA 3T07A 3I6TA 1XF0A 4MZ1A 3T2QA 1NFBA 1LROA 1DKWA 3LZ5A 3HZ3A 5E9AA 2R91A 2Z1WA 1TWWA 1RVGA 4MWAB 2NV2A 3VIPA 1CX9A 4E2DA 4Y6GA 3TJLA 2B7PA 3BMWA 4YTUA 3SQMA 4K39A 2OFJA 4JFTA 1JXJA 4XWUA 3L21A 4B5NA 4PB3A 3WMBA 3FGCB 5B80A 5E6YA 4TIMA 1HIZA 3EPOA 1GQNA 5C2GA 4N9EA 2YCLB 2H8XA 4HHLA 2HE8A 3REQA 2B0MA 1PVNA 2ZZ4A 1ZAHA 3UJRA 2Z27A 3KRZA 1DJXA 1GNXA 5I24A 1V6XA 3DESA 2DV0A 2J47A 4ZODA 3VIOA 3MJMA 2UY5A 1QMLA 2WMKA 1HL2A 1P43A 1W1YA 3CZEA 1RHCA 1IYXA 4IL0A 4RE3A 4PCTA 2ZZ7A 1N2VA 1LG2A 1ZBKA 3VNIA 1VZWA 1GQIA 2J7FA 2ZA1A 4Q4QA 4HHPA 1EL3A 1KM2A 1JPMA 4PULA 1GKQA 1K9DA 2CITA 3S6OA 2ZFAA 3T2PA 1B4KA 3LLDA 4RPPA 2PTZA 2D3LA 3NJ3A 3QV9A 2DZVA 3RR4A 3UG4A 1QO2A 1BLIA 3S9IA 2PUZA 2JGQA 1CB7B 3OZMA 4RK8A 4K8HA 4G1KA 1OIFA 1TJ1A 3AMKA 2VUYA 2XISA 4WDXA 4QRNA 1Q8AA 4XIMA 4Y96A 4K8EA 4M7SA 1KGXA 2JGYA 2WNQA 1V3IA 1TA3B 4RNJA 3DFSA 3VM7A 1J0KA 3RLHA 1KXQA 2Z0IA 2G3FA 3OEXA 4ZO8A 2VVNA 5K7JA 4W8LA 3G77A 1WDSA 3EPNA 3WF2A 2ALDA 3ARUA 2QAFA 3KBWA 1PDZA 1SZNA 2E68A 3W87A 4CU6A 1A3HA 3LPPA 3ABZA 1RJQA 1BEUA 4N0RA 1F6YA 1UC4A 4WIWA 5AOUA 1PDYA 3IS4A 1W3KA 4GKTA 3TP4A 2MUCA 2V6AA 2DGAA 2PGWA 3V5OA 4C1LA 3G3DA 3RF9A 1NTHA 3MSGA 1EWDA 4GBDA 3K13A 4J28A 3T81A 4FNRA 3NYDA 3B8UA 4R53A 4R7WA 4DJFD 1EJSC 4MJ2A 1GK8A 3S83A 1TTIA 4AX6A 4J4KA 1YE4A 2WPGA 1B3ZA 2QUTA 2ZADA 4S1FA 3P2VA 3AIQA 1HO1A 4PTDA 2CLEA 3EDEA 3G24A 2TODA 3MI6A 2ZZ6A 2R1PA 3W1AA 1R9ZA 2WVVA 4H9UA 3RCMA 4JICA 4C5YA 3CS2A 1ONRA 2WSKA 5TIMA 1EO7A 1E51A 1KBIA 3TZFA 5A6BA 3GKAA 4GI4A 2DY3A 3IJDA 1WZLA 3SY8A 4ACZA 3GD6A 2G96A 4CD7A 1MQRA 1L8PA 3L2LA 3M9YA 5BNKA 1V7YA 3L5LA 4JIHA 5FEZA 3W83A 1MZHA 3ELFA 3ABRA 1A47A 4KETA 2PC8A 5BRBA 1TELA 3STEA 2Q8XA 2B7NA 4DJED 4YNGA 3EA3A 4UR9A 4GVIA 2Y5EA 2BY1A 1XYLA 3PNZA 1EJXC 2DZAA 2ZOXA 1X7IA 3TZNA 3HG2A 1TUXA 4LYPA 4HMEA 4ZQOA 4NSBA 3QQ0A 4DO4A 2PA6A 2EJ1A 4QEEA 5BWAA 3ZOAA 4IHCA 4WY0B 1HGYA 2VTFA 3LY0A 4IICA 1I4NA 3HB9A 3PBMA 2R1NA 5IXEA 4HNLA 1Q6OA 1V6TA 2YDRA 4KCWA 5IDZA 4Q8QA 1NQKA 1YNPA 4QEHA 4RXGA 4D6JA 4BI7A 1GGOA 2CZDA 2DIEA 2QS8A 2FFCA 4E38A 2ZC8A 1LF1A 4R85A 1ZJIA 2ISDA 3TQ0A 4J3ZA 2NSXA 2F61A 1LRTA 1RPXA 4GZ7A 3PBWA 4J5NA 1UR0A 2Y6ZA 3MKKA 1UB3A 1CT5A 5ABFB 1TWZA 4XV0A 4GVGA 1YXYA 1QT1A 4GUGA 1P1MA 3VIJA 1PKNA 3TTQA 3HBLA 1U30A 3GXNA 5JBDA 2YL8A 3G18A 1TPFA 4JIEA 3VOFA 3H2AA 1OCQA 3G1XA 1I0BA 3IIXA 3MO7A 1FFQA 1YTEA 5IHSA 3FNDA 4HCDA 1QI4A 3CHCA 3UD6A 3HPZA 3GG1A 4HU8A 3DFYA 3IIVA 3W7LA 3GHUA 1TMLA 4TUFA 1AD1A 3GG7A 1V6WA 1ADSA 4F48A 4GC3A 4CLMA 1BWVA 4BWLC 1EBHA 5BXRA 1K8YA 1TPB1 4PRTA 2VEPA 3FS2A 1Q45A 1XLMA 4Q8MA 2NW0A 3S5ZA 4JIRA 4O14A 1PUDA 4OHQA 2CLOA 1O12A 2QUUA 4MAZA 4JEJA 1IEIA 4NAFB 1KM4A 3IUHA 1B2YA 4AEFA 4MYAA 1W9XA 3SM0A 3WD1A 1ZHAA 3RXZA 4Q8OA 5BYWA 3Q45A 2X8RA 1EXPA 4GQQA 2IKHA 3U2EA 3HM7A 1V02E 2ZA3A 3A9BA 1DEDA 1KB3A 1JPDX 1NH6A 1JZ3A 1HKIA 3H7VA 1V0LA 4QDWA 4JFWA 3K8MA 1BAGA 1CXLA 4K68A 3GC2A 1FVPA 3PPGA 3SQSA 2PCQA 3OTRA 3OGVA 1QJWA 1O66A 3ZXWA 2NLYA 2UZ9A 1KD0A 3SGZA 4KFOA 4V27A 2DW6A 3U2CA 3KVJA 4WZHA 1IV8A 1BSIA 3MVIA 9XIMA 3POCA 4O53A 2ZX9A 3QHOA 3OLEA 5A6SA 4AIEA 2ACUA 4GZEA 3BJFA 2A7PA 2BFGA 3MHFA 2YIHA 2HVMA 1GOOA 1XG3A 1KBLA 3QR1A 1R5YA 1IZKA 1NARA 1JI1A 1F8IA 1VYPX 4EKJA 1XD1A 4QLKA 4GPNA 4ZQPA 2Y4SA 5DXYA 4RPQA 3MDUA 4WXZA 4Q3MA 4YLWA 2O9OA 1V3MA 2DZXA 4NT0A 1T40A 1FQ0A 1C7TA 2NUYA 3TSBA 2QUMA 2PMQA 3WLJA 1TPWA 4DF2A 1LOLA 3A3WA 1FWJC 4DJEA 2QKFA 1J79A 2C1HA 4Q8TA 5DMLA 2YBVA 4JL1A 5D9OA 4IJCA 2P0IA 4AIOA 3R4IA 3UQNA 2ZICA 1XCWA 3CWOX 3RO6A 5HJYA 3M0JA 5HDRA 1AJ2A 3AWOA 4L9ZA 3MVTA 3UBPC 3RAOA 1TPC1 1V8EA 3V5CA 3FA4A 1L6FA 4WXYA 4JN6A 4IXHA 4P7LA 4E2BA 3O3RA 3RRXA 5B7ZA 2VGGA 1REQA 1WDPA 3S1WA 1WX0A 3CASA 3PBUA 3WFAA 3KZSA 2Y24A 1IR2A 4K1WA 5D2XA 3NQEA 3PY2A 1L9WA 3NXFA 3TLLA 3TYBA 3E96A 5EY5A 3B4YA 3ZT6A 3GXPA 1LLOA 2PWDA 2CHNA 1I9CB 4OT7A 3SADA 4S3FA 2E9LA 1EJRC 1HF6A 2ZX5A 3ZQ9A 3NZGA 2DZTA 4PMRA 5A8NA 2PDUA 4GQBA 1TV4A 2GJPA 3QXBA 3WLHA 3DG6A 4L4LA 4S3JA 4ZOCA 2HS8A 4EX4A 3NZRA 3SRFA 3HJEA 2OT0A 3DHPA 4C6IA 3DENA 4C6KA 2E8YA 2PP3A 1FHUA 3W6YA 3VDHA 2IQDA 4LWWA 1NWSA 3WYZA 3GW3A 3L4WA 3MP4A 4P7NA 1XISA 2E9MA 1N55A 1PKYA 1HX0A 4Q4MA 3LK6A 3HGOA 3G6MA 1JFXA 2WVUA 3KBVA 4LUSB 1BKSA 4CNSA 3UNDA 2WPBA 3IV3A 4PCSA 3VKJA 4CQCA 4XK2A 2REQA 4N02A 3TJ4A 4BQ4A 3VXGA 4FXSA 4IJBA 3KE0A 3OA3A 3VC6A 3KRSA 3RDKA 1LL4A 1VFOA 2QR6A 2Z26A 3VOHA 1VCGA 2ONEA 1OABA 3UWEA 3CUXA 3A9IA 2FKPA 2OYKA 3V75A 3W7KA 4N6EA 3DI1A 4H6RA 3A5FA 3G8EA 3CV2A 1KTNA 1OFQA 3H2CA 1IT0A 3WBYA 3W2UA 3R8RA 1CW2A 4I5XA 3AZSA 4MLJA 4YTRA 3IV8A 2PDQA 4HYVA 3ITGA 5TQLA 4G9PA 3EA2A 5D9NA 1V3HA 5LIKX 2OTDA 5F2LA 3BAWA 1FP8A 5IBXA 3QQ1A 2CZ5A 1IT7A 1KBJA 1LOSA 5CPSA 5EFFA 3D0CA 1DIDA 3NCOA 4C7DA 1OFEA 4FNPA 2J9ZA 4MB4A 4ZBCA 1Q4WA 5C9UA 5M1TA 3LCFA 3AS2A 1KXHA 5LIYX 1NVMA 2YXGA 3ALGA 3ARXA 1K4GA 4NKCA 2IXVA 4GISA 2OQHA 1Q7MA 2RJGA 3F2DA 4HD5A 1LYXA 7XIMA 1PIFA 3WIJA 2E3ZA 2QUVA 3IEBA 1EHAA 3GG8A 4A05A 1Z3NA 2YFOA 4KGJA 3ME3A 5I3FA 3W88A 5G1TA 3SBFA 2MNRA 5HPOA 2E09A 2HNHA 2GQ8A 3O06A 3KM8A 4S2BA 4PSRA 1SJAA 1LRQA 1LWIA 2ZUVA 4H2HA 3MPGA 2Z1KA 1CWYA 1GOMA 3E5BA 4F0LA 1AH4A 2WCSA 4JQ3A 1SUXA 4HSOA 3RMJA 5FKYA 1PHWA 3AU6A 2GFTA 3PG9A 3AMCA 5MKGB 4OKDA 2GJNA 1U1JA 1ZALA 3U6WA 1TPEA 3N19B 2VX5A 1K7EA 3P5YA 3WJXA 4DPQA 3UETA 4QE4A 3GQYA 3CYVA 1KWKA 1OFBA 3G1HA 5CJ5A 4UFJA 3PVFA 3WH7A 2VEFA 1VYSX 3I3EA 2C8NA 4O1BA 1EF3A 4NZ1A 1ECEA 2DZPA 2FHFA 3LU2A 3DN5A 4JN8A 3ARPA 2V3GA 3LCIA 4DNMA 2FZNA 2RDXA 4I8YA 2RDWA 4LV9A 3BVJA 3C86A 1WXYA 4ZVJA 1SO3A 5I3HA 4GLEA 4P5UA 1FH7A 4JEQA 2PWEA 4EWND 3ERPA 2OOGA 3LNMA 2GDVA 3N1AA 1JQXA 4IQEA 1UWUA 3S5YA 5C7HA 1IT8A 2D0HA 1QO5A 4I9TA 4R5EA 4DWSC 1VEOA 1VLWA 1A3XA 1KFCA 3AJ7A 1A50A 2B4GA 3RPTA 3UWZA 3LHZA 4JQ2A 2EBNA 2H6RA 4XZ9A 3WEZA 3AJXA 2PU0A 1RD5A 4IM4A 4MWAC 4NU7A 4KRUA 3A5VA 4O54A 3OQEA 1JVNA 5CPNA 4Q4OA 4YWSA 2BDQA 4X63A 1MVYA 4RX0A 3B9DA 2NQZA 2ZUSA 1ZZMA 4L6DA 4HZ7A 2VCAA 3TOPA 3VE9A 1QW8A 2CLFA 3WELA 3T4WA 3PSVA 4DB7A 1E6RA 2QCLA 4GUJA 4RZ6A 1Z32X 2QCMA 3T7VA 5H1WA 5H8MA 3U48A 1G0CA 2XHYA 1UR4A 1VP5A 2C0HA 4FXJA 3SI9A 2F6XA 2FTWA 3MCMA 1TYGA 3H22A 5D2WA 1Q7ZA 4A8IA 4UTKA 1R3WA 4IMDA 3PR2A 4QISA 3NO1A 1FBAA 1MEWA 3CUIA 1UH2A 3L2MA 3GE7A 3GR8A 3K8KA 2DSVA 2YB4A 3MYOA 4TX6A 2BXVA 2H8ZA 3M5XA 5DX7A 4MSSA 4UFMA 1CEOA 2I9EA 4FSAA 4ZL1A 2ATMA 1GKRA 7TIMA 2BODX 2QMJA 2XH4A 1W0MA 4C6LA 4PMOA 2OKOA 4DAIA 3GVRA 4PBGA 4CN4A 3HG4A 3KS6A 3M6DA 3TIMA 3T44A 1KRMA 4KERA 1FWGC 2V69A 2ZTKA 1CNVA 4ZTYA 1LBLA 2B81A 1OG0A 3XISA 3V0UA 2PD9A 1D3GA 2GWNA 4BI5A 2ZXQA 4TV5A 3W7RA 3CQKA 2FPYA 3LN3A 5CZSA 1J10A 4YTSA 4KCTA 3APYA 5A5WA 1TWSA 4QG6A 5E93A 4AF0B 2FGBA 4ATLA 5FEWA 1JZ6A 3SSJA 2VR4A 4HA4A 3FYYA 4Z2HA 4LC6A 3VNYA 5D8WA 2OQYA 4KCUA 3UXIA 4NYUA 3W9ZA 4JTKA 3TYAA 3AHVA 1ADOA 1QNPA 2NVDA 1E56A 1Q2RA 3N4AA 2QJNA 1TQXA 2OX4A 1PB0A 1F07A 3WQGA 2RDUA 3TMQA 1V03A 1J2WA 2PTWA 4H19A 3GWQA 3IARA 3KP0A 4I9JA 2PDMA 3TW9A 2VGBA 1RXOB 4LFYA 1JDCA 3L7RA 1A4LA 4JOMA 1P6BA 4GFSA 4NXKA 2J77A 4Q6XA 1NFGA 4HP5A 3NQ6A 4H41A 3LBOA 1UD8A 2WZHA 4P7RA 1AQHA 2VZVA 1CZ1A 1JGMA 3AS1A 3W2JA 1UKSA 4B5VA 1W91A 4OVXA 5MF5A 4C7FA 1WUEA 5A8GA 4MFEA 3GDRA 1V77A 3QPZA 3B0VC 4H9ZA 2FHBA 3F1QA 3BJTA 2CBIA 4RL3A 3PFMA 2XH0A 3ZVIA 1XS2A 4HOXA 2CIPA 4G6CA 3IUDA 2WHJA 2W6RA 3E2SA 2GOUA 1AUSL 3OPSA 1TIMA 3ZFHA 1H41A 1UYQA 4GX8A 4HPXA 1H7OA 3DG7A 2EQDA 3L4ZA 1UOKA 3CWNA 4RW3A 4R7JA 3N73A 1XLIA 3R89A 4YMZA 2YX0A 4D6IA 1XQKA 4U28A 4XZHA 1CGWA 4S3DA 4LALA 4OOZA 2CLLA 3OVPA 4V15A 2DVTA 1T0OA 4DLFA 2QV4A 3QM3A 5CSYA 5BROA 1OYBA 2Z2UA 4O1EA 3EPMA 4UWMA 2OEJA 3NZ1A 4NP7A 3BV4A 4S3BA 3W26A 4IUGA 4ZB2A 4KIEA 2QGHA 3L0KA 3T0BA 4HSHA 2GOKA 4ZSUA 3VPLA 2IPJA 3QEZA 2O56A 1D9EA 3MMTA 2ZC1A 1Q6CA 2AMXA 4MY8A 3CT2A 1Q65A 2H9AA 1DJZA 1EQCA 5EMLA 3RUBL 4IFKA 2JQXA 3CL7A 1GWJA 3E2VA 4LU0A 1XIHA 1F61A 2QLYA 3KVKA 2FVKA 2FJUB 2J7HA 4PBEA 3LSCA 1W1TA 2RUSA 3N6HA 1TJRA 3SCUA 4W8BA 3ZJ8A 1MQPA 5D2TA 3W6MA 1NIUA 1M7JA 1XGZA 4JYDA 4D8AA 4AD4A 3WDQA 2X2GA 2HVOA 1EIBA 1JRCA 1VCFA 1JYVA 2NQLA 3PUDA 1SFJA 4ZQNA 5CPQA 3AIVA 2WKJA 5D38A 4WLCA 4B91A 4RE2A 3VOJA 1P5BA 3BH4A 1FA2A 2ISWA 4GX9A 1FUYA 3FXGA 3UVIA 4LCRA 2CBUA 1CB2A 1UZ1A 4GJ1A 2AQOA 4EACA 4GHRA 4DBWA 3EOUA 2UY4A 4LAMA 1IEVA 1N8WA 2VYOA 2ZZ1A 1Q6DA 2A21A 4Q7NA 5FCZA 3NWRA 1M7PA 1PHQA 2E7FA 4Q8UA 4I90A 5CSUA 1S38A 4O17A 3NQBA 3URQA 2F9RA 2V0TA 3CJPA 3N3TA 3SZ8A 1BVWA 3V5FA 4XD4A 1WP6A 4ACYA 2E8ZA 3EA1A 2ADAA 4TVDA 4BK9A 4HJWA 5I3DA 4GY7A 2PDYA 1V7AA 2VVSA 1UR9A 4S38A 4LNCA 5AYXA 4NUWA 3MCOA 3CUFA 1XYCA 3WCZA 3MUZ1 4IMCA 1S5VA 1YNYA 3ZLHA 3N29A 3SN1A 1NM9A 9XIAA 4J3VA 5EL1A 2FTYA 1SMAA 3ANUA 4BWLA 2GQ9A 3W2KA 3P80A 3O05A 4H9MA 3UPMA 2F84A 3WNOA 2W27A 3HMCA 5C9XA 1ICSA 2X42A 1V6UA 4AB4A 2ZUUA 2C7FA 3V18A 1FKXA 1NF7A 3WBWA 4AH7A 4O15A 1KCXA 4CNNA 4L4MA 3M07A 2ACSA 1DORA 4BS0A 1E0WA 2PGFA 2HV5A 4DELA 3NSNA 4DWDA 4AEOA 1K3UA 1I45A 2ZUWA 1H5YA 2QNEA 3HTWA 3SUTA 1UP2A 2WQDA 2VENA 4UMCA 1YXCA 2NT1A 4H6KA 1GHSA 2ZE0A 3WQ8A 2I17A 3KRBA 1R7AA 3LZ3A 1FCBA 3DEQA 3G5EA 1UC5A 4E4FA 5I09A 2A3AA 5EFDA 3BK0A 1WOAA 2PDLA 4P8WA 1BG9A 2YW3A 1X6UA 1XIMA 4CCDA 2Z7KA 2QPSA 1A3WA 1EGMA 1UMYA 1VLIA 5HATA 4GUIA 3TC6A 1X8CA 2WMIB 3ONBA 3NPWA 2P50A 2ZWZA 3G2GA 1E1CA 1XIGA 1JYXA 3TA9A 3LRLA 3UFYA 1I2NA 1HG3A 1DQUA 3PZTA 2W79A 1MXDA 4M7TA 3KWXA 4DX3A 1P7TA 1XFCA 1VFTA 1W9DM 4JPGA 2BV9A 3SR7A 1TTPA 2I56A 2HWGA 1XPYA 1YPFA 1S5MA 1TIWA 2PDNA 1K8XA 4DM1A 4IPPA 4FLSA 4JTAA 5EBUA 2E0PA 1HO4A 4MZYA 1M5WA 3STFA 3TVAA 4ZO6A 1VBJA 5FAJA 1K9FA 1E43A 3VAVA 5EKYA 3KDOA 2OLHA 4C6PA 4YU1A 1UWIA 3AHYA 4GFIA 4XSLA 1VFLA 3H70A 3I6EA 4JFSA 1H50A 1KBBA 4BI6A 1UD5A 2CKSA 5LHFA 4JTEA 4ICMA 1A49A 5FD0A 3S47A 3KHDA 2HK1A 1E0UA 4FNSA 3O0FA 1MZRA 4B5TA 4WX2A 1QUMA 2OO0A 1XYAA 1GJWA 1OX4B 1PZ0A 3XIMA 3L4UA 4V1YA 4NX5A 5CJNA 4F4RA 3PB0A 3K1GA 2ZRYA 4FOJA 2UV8G 1UP0A 4AWSA 1P0NA 4IIHA 1TZ9A 4A8LA 3QSTA 1CCWB 3OJGA 1YBQA 3AROA 2KAUC 3KTCA 2PTYA 3WLPA 1BWKA 3W7CA 1NDYA 4LS1A 4XZBA 2D0FA 1JCXA 5JH1A 2DT1A 4S39A 4TXEA 4KH2A 1WAUA 2DEPA 3GNPA 4W9TA 3WBEA 4EF9A 3LEPA 1W56A 3VD7A 5JUVA 3N18A 4JTIA 1J0IA 5HMSA 2DUXA 2AL2B 2CZVA 1TUFA 4HIBA 2VWTA 5D03A 3SGGA 4LYQA 3JUGA 1AH3A 5B7YA 4MUPA 5AKQA 4Y9NA 4TOQA 4MPQA 2X7WA 2HK0A 3GNOA 1VJSA 3PP7A 3MW7A 4L4OA 3HGRA 4G7EB 4NQ1A 1M03A 4QJ5B 5I3GA 4CVWA 3W02A 2XSXA 4H3DA 3WQ6A 3EWWA 4I9AA 3UCQA 2P8CA 1FX6A 1C8QA 4ZOBA 2X1TA 1DYSA 3RU6A 1GZGA 4LUTA 3K4AA 3VUSA 4IT1A 1EXBA 1DJYA 3RFAA 1TJ2A 4IQLA 2V5DA 4HYRA 2FB3A 2X7VA 2PCEA 3H12A 3EX6A 1H7PA 2XU2A 5JIWA 1Q8JA 1EX1A 5E1QA 5CG0A 1PV8A 1K9EA 3P60A 2Y89A 2YW4A 3RR1A 4GOAA 2PBOA 1JG9A 3DU0A 4GUFA 1A80A 3GTIA 3GH7A 2NUXA 4GUHA 1H1YA 2QJMA 1T8XA 4L1WA 3T8QA 3W81A 2GGIA 2VL4A 1GG0A 2J79A 5FSDC 4Z42C 4Z1AA 8RUCA 3QC3A 1J18A 1FH9A 4XAYA 4D6HA 5I00A 2Z00A 1EX5A 1IWAA 4LVBA 5HJLA 1PSCA 4M1BA 3XINA 1S3HA 3OA5A 2PRLA 4AHPA 1H1ZA 3GNRA 4FO4A 4M56A 1YPIA 1K77A 3BGAA 5LGXA 3GVWA 3PTQA 1YRRA 2PDIA 6REQA 4I5UA 3R2GA 2XG9A 3OIXA 1W9VA 2D24A 4JR5A 1RBAA 1Q63A 3LNPA 4ZXLA 3AYSA 4Z1CA 3J7HA 2YZRA 1XLFA 4MTVA 3UWUA 2PDPA 1SM9A 3C0QA 5DMMA 2VC7A 3E0VA 3N25A 1ITCA 2PRHA 4S3EA 1F7BA 1AQMA 1M68A 3P81A 1J6OA 2VEGA 4XD3A 4AZBA 3S9ZA 4AVNA 1AODA 1BYAA 3THUA 4ES4A 3FFSA 3THCA 1TB3A 4NJKA 2IQ0A 4UQCA 1XIDA 5I23A 3ARZA 1ZJAA 2DUZA 3AC0A 3C2FA 3CIXA 5AB3A 1U2YA 2FJKA 3SUVA 3VD9A 3UZYA 2GJRA 2JKAA 5DEZA 3TKFA 2V5LA 1IXQA 1ZL1A 3SFWA 3K1DA 3LQGA 4IPJA 4QFUA 1OC7A 2HQAA 3LGEA 1ISYA 3SUSA 4IIFA 3LCHA 3JS3A 4OOUA 4HBKA 2ACRA 4UTTA 3BANA 3UXKA 2YDSA 1W9UA 2JF6A 2XM1A 5GNYA 2G41A 5EMJA 5FJJA 4NZ4A 4QBXA 3R0KA 3BMVA 1YQ2A 3SCTA 1AW1A 4RE0A 1MXSA 5FACA 1GQKA 4LF1A 2TMDA 4GGBA 3U8GA 1JUKA 4DWSA 2QDEA 3S5NA 2OYLA 2DSUA 4JD4A 5LIUX 2O0TA 1QI3A 3DFQA 1A0DA 4H7ZA 1QI0A 2OWWA 1ITUA 1ECQA 3CU2A 4ATWA 4CQ8A 4K7VA 2YR1A 1OIMA 2ZRVA 5CPOA 2VGIA 3ZR6A 3FDKA 4IFOA 2J88A 1SVDA 3E3HA 3EWYA 3BOFA 3CZGA 3RMEA 3VUPA 3HQPA 3MO4A 4PTNA 4Y9AA 4O0ZA 1R6WA 1LORA 3GSMA 1J2BA 3FW6A 2CPUA 2OO6A 1Z8AA 3FAXA 4LH8A 3GNDA 4L7ZA 4NJHA 2EXOA 3P82A 4IL2A 4RJEA 4US5D 4ZB5A 4KWVA 3GXFA 5HWNA 4B5WA 1J8VA 1B3VA 2YKKA 2EPMX 1FWRA 4EOUA 3CWHA 4UOQA 2VC5A 2X1UA 1JNEA 1XBYA 3QY6A 4IPIA 1H61A 4HPHA 1HFBA 1HP4A 4WJXA 3TSDA 1FDYA 1QNOA 2PPGA 3NFUA 3TSMA 2QT3A 1W1PA 3SB0A 2YFNA 4F0RA 5C7VA 5KZDA 4S3GA 3VI2A 1U5HA 1UD2A 4MVAA 1S2UA 2DSWA 2X16A 4WEVX 2RAGA 4W85A 4LAUA 3BJSA 3ICJA 3EDDA 4IMAA 4XKYA 4GNKB 1E9LA 4OBTA 2I57A 1FHDA 1OX5A 2IS7A 1KKOA 4DY1A 4XZMX 4JKMA 2YL9A 3VGGA 2E77A 2VX7A 3LERA 2VZSA 4OZOA 3UWQA 5J5RA 3ABQA 3WDHA 4HMNA 2WW5A 3IJ7A 4JXCA 1RLCL 4O28A 4DZHA 1OF6A 1Q6QA 1S2CA 1B54A 2PTXA 2WVTA 5KSWA 2Y8VA 6TAAA 3S3GA 3R12A 6ALDA 4X9SA 1M01A 2VRJA 5F2IA 4E4UA 2WHMA 1GYMA 2OGJA 3NVDA 4Z2JA 1ZAJA 2OU4A 2WC3A 1EPVA 2R1LA 1PX8A 3MTWA 3HIJA 4D1JA 1WV2A 3DC0A 4ZOAA 4PE8A 5DMYA 5GJMA 1PZ1A 3D46A 3FHQA 3U0HA 4YL2A 3R1ZA 1LL6A 2IKGA 4MNLA 4X2PA 4OFCA 3R0UA 1DQWA 4HU4A 3WF3A 5CLWA 1RP8A 3PZUA 3U2OA 1K8ZA 4INFA 3BUVA 4C1NA 3S9YA 4DQWA 2YYUA 4B16A 4CD6A 2E67A 2EF9A 4JTTA 4NZCA 5A8OA 3EWXA 3TYZA 4QE1A 5AC4A 3N2CA 4HQVA 4H6EA 1A5KC 4BFAA 1HJSA 1A5BA 1EIXA 3UWYA 2QCDA 3VU2A 4FHAA 4C90A 1RQHA 3WENA 4O1AA 1B3WA 1BHGA 2NQ5A 3GO2A 3PTMA 3W1LA 3W7PA 3L2IA 2ZXAA 4ORMA 1ONEA 3LPGA 2XGZA 3G1SA 4W87A 3STGA 4DNHA 4JTSA 3WH8A 3F2CA 3P62A 3EDJA 2QAPA 2VI0A 1AQFA 2EAWA 3W22A 3ARWA 4PR4A 4M3PA 1PZ2A 1QI2A 3LLFA 4RR4A 2C91A 4JDYA 4PSPA 1H0IA 2VQUA 5AZ0A 4MB1A 1UKTA 3P6LA 1VIZA 3NSXA 1RALA 4PH6A 3GIPA 3WH6A 3A6OA 4N9DA 4O50A 2WM0A 4XO6A 1ZJBA 3JR2A 2XIOA 4JQ4A 5BU6A 3BW2A 4N6FA 1VFMA 1ZBCA 1OGGA 2Q3RA 4M1RA 5HJXA 1GOXA 1XUUA 2WXDM 3K4WA 4Y2WA 1WKEA 3CYJA 1Y5XA 3W53A 4W4QA 3L9CA 5E0FA 4I3GA 4JTFA 4Z0JA 5JU6A 2D3NA 3W70A 3FAWA 4Z2KA 4YCOA 4QDPA 1SZRA 3B8TA 4H4IA 1MQQA 1DHKA 3NQ8A 3WLLA 4US5A 1US2A 1V6VA 4UUIA 3REQB 5FAGA 4U3AA 1ZAIA 3TAKA 5C55A 2CXEA 2DQWA 4GWEA 4JTUA 2HTMA 1HJWA 5ABHA 3B0UX 1K8CA 5HR7A 1KM3A 2J75A 3ALFA 3U3HA 2BWGA 2BY0A 3C3NA 4BR1A 3II1A 4TQTA 4IGNA 1GZJA 5D30A 4KPLA 3FY1A 5E0KA 4ZTXA 1O6IA 4S2CA 3GVGA 2CHRA 4S3CA 4CCEA 3TFCA 3ZSSA 4E4PA 3Q65A 4DUVA 4Q8VA 4LW7A 1PPIA 1F4HA 3PZGA 5T9CE 3VCNA 3M0LA 3F5JA 5