2J9YA

Tryptophan synthase q114n mutant in complex with compound ii
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
266
structure length
251
Chain Sequence
b'ERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLSHHLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKIIEKNLASPKQMLAELRSFVSAMKAASR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPTOPHAN SYNTHASE ALPHA CHAIN
publication title Betaq114N and Betat110V Mutations Reveal a Critically Important Role of the Substrate Alpha-Carboxylate Site in the Reaction Specificity of Tryptophan Synthase.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Lyase
total genus 92
structure length 251
sequence length 266
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 2006-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2j9yA00
3W86A 1JRBA 1K02A 3LBMA 1HFBA 1H7XA 3KVKA 3P8IA 8TIMA 1KTNA 4MUZA 3LCIA 1W54A 3SECA 2D73A 5F2GA 3OBKA 2WNZA 3GB6A 3VFLA 3QMRA 3R12A 4XKYA 2ZZ2A 2B7QA 3TC6A 4ADUA 1WA3A 4U28A 2WV8A 3PUEA 1OYAA 4Z1CA 3EX2A 3W7IA 2QAPA 3W7HA 4UUIA 5AYXA 3TKFA 3UXAA 3CWOX 2F7FA 4K8EA 3M41A 1PIIA 3W7PA 1K8ZA 5AB3A 1F74A 4IX2A 2XN1A 3MWAA 1A5AA 1YTKA 1W0MA 3P67A 4GE8A 3B03A 3HG3A 2QCGA 3G1DA 5DLCA 1QPRA 2FPVA 5FEPA 1FX6A 1LOQA 4PL1A 2RDUA 2HS8A 3O6DA 5FEWA 3M7WA 5EA9A 1HO1A 3P8JA 4UIOA 5CG7A 5LGZA 2QCDA 5CPNA 2BZNA 5CPOA 3IVSA 4IOTA 2A7PA 2ZRXA 3DBPA 3LTPA 5D2VA 3TK7A 2J27A 2ZA2A 4ADTA 1PL9A 3C2FA 1L9WA 3SJ3A 3QYQA 3PAJA 1XL9A 4IQLA 3BGJA 3W75A 2I14A 3N34A 1VCGA 5EL1A 1IF2A 1FWNA 3P7YA 4ZQOA 3NGJA 3O6YX 1WXJA 1WOBA 3LCWA 5DY2A 3G0XA 3B8DA 3MBFA 3EKLA 2WSRA 4Q33A 5BW6A 4FF7A 4WXYA 2ATMA 3BLFA 2ZBTA 2YDAA 3EWZA 3RMJA 1NVMA 1YXYA 2CWNA 1FCQA 1JUKA 2FIQA 3CT7A 2BXVA 4BI7A 2CZDA 1ZAHA 1KM0A 2Y89A 3TAOA 5G4EA 2CZ5A 3M5ZA 3FS2A 1LLZA 1LRTA 3BLEA 3NQEA 4WOZA 5D32A 3M1ZA 2E09A 2Z1BA 3LXBA 3UWQA 5T26A 3TR2A 3PB0A 3Q94A 3SW6A 1ZAIA 1XUZA 1XDLA 2V8ZA 3R2GA 4O15A 4AHQA 4NT0A 4DF1A 1A53A 1M6JA 4PL2A 1KM4A 2A2IA 2CLEA 2FQIA 4MPQA 1W5QA 2QJIA 3LCGA 5KZDA 4MY1A 5LNRA 4JX6A 4HSOA 4RK8A 1CW2A 3L0GA 3PBYA 2PE4A 3TQVA 5J5RA 3QM3A 1WV2A 1YPIA 4DF0A 3EWWA 2XN2A 4UMAA 2X1UA 1SU5A 1NAL1 2VEKA 2YX0A 2CLFA 1SFJA 3SSJA 3BW3A 7TIMA 4LC8A 4MJZA 1FCBA 3N9SA 1C9DA 1P5BA 2QUTA 1KM2A 1OX6A 3HGJA 4JTGA 2J9XA 2OT1A 5KZEA 2QAFA 2QF7A 2Z0IA 4Y6GA 3BG9A 4IJBA 3EXTA 2ZQ0A 2X1SA 1SUXA 4M7SA 1TPB1 2H90A 3DFOA 4IMEA 4BWLC 1UUMA 2X16A 2VFDA 4O1DA 3NQ6A 3S1UA 3OVQA 4HNVA 3HPZA 3W7JA 3THQA 1MEIA 1IXNA 1ICPA 3LTSA 3W7GA 5A5WA 2YFOA 4QAIA 1LCOA 2DP3A 4LS2A 4QNWA 4ADSA 1GTEA 2TSYA 3C56A 1VC4A 2ZRVA 1RVGA 3LV5A 3TUUA 2VXNA 4X22A 1IIHA 4E2DA 5G2WA 1R47A 5BOOA 1TREA 1THFD 3PY2A 3T40A 3CU2A 3L5AA 1GVFA 2I1OA 3LI0A 1P1XA 1XXXA 2Y85A 3HGSA 4NVTA 1QPOA 1TPVA 3M5XA 5FEZA 4O11A 3LHUA 3TJLA 1YXCA 4J9JA 4XBKA 3RK8A 4MY9A 1JULA 3G1FA 2FFCA 4MLJA 3QH2A 3PG8A 5DN1A 4JX4A 2AGKA 1GJPA 1Q45A 1NSJA 3C2EA 4K7YA 1DQWA 1ZENA 3T7VA 4MY8A 3VE7A 4KFNA 5D09A 1TB3A 4AVFA 4WY0B 4EF8A 1PHQA 1R30A 1JCJA 1MSSA 3FKRA 4UNLA 1JCMP 3C6CA 4UXDA 1I2RA 3RFAA 4NJHA 2UV8G 5L6UA 4GC4A 1VLIA 4IXXA 3MP3A 2QDHA 1TV8A 3H54A 5FESA 1OJXA 4P2VA 4LVAA 1RR2A 3UZJA 2CLMA 3W23A 1QFEA 4UTKA 4M6PA 3TA6A 1B3OA 5D2TA 3YPIA 1N55A 4JTKA 5IBXA 3SIZA 2EPHA 3TJXA 3MI3A 5LNUA 3F4NA 3FOKA 4POCA 3W6YA 2V2CA 3LB0A 3P60A 4LVBA 4XQ6A 3TXVA 1ONRA 1YDVA 3BO9A 5G5IA 3MP5A 1H7RA 4ZL1A 1OABA 3UXDA 3W7OA 4O28A 4FNRA 3W1QA 3LCHA 2ALDA 5LSMA 4O1CA 1AMKA 3BW4A 4OBTA 1V7YA 3BGGA 4WY0A 4UTUA 3IRDA 2W79A 2G97A 4LY8A 2JKEA 3ABRA 3MHGA 5D2YA 3MMTA 4AWUA 4CNNA 3G1VA 3LOTA 1P0KA 4ZMGA 1SO5A 3L5MA 1MO0A 1H61A 1GPWA 4N02A 4N9CA 5AC6A 3DXIA 1PE1A 2A4AA 5A8GA 5AHFA 3T4CA 2XN0A 2DORA 5D30A 3PBUA 4JTIA 4RXGA 2AQWA 4HHPA 4R34A 1A5BA 3W7MA 1XI3A 1CI1A 5C2XA 5HWNA 2FTPA 2H6RA 5K9CA 1XBVA 4O16A 1LBLA 3M0ZA 3EKZA 4ORMA 3HOJA 1OFBA 4Y90A 4HNNA 4LV9A 2X2GA 1EP2A 1DHPA 3VNDA 1FDZA 3NZRA 2ZA3A 3UNDA 1JVNA 1J2WA 1TRIA 5LNWA 1SSDA 1SO4A 4JR5A 4I7VA 3A5FA 3EWBX 3W1AA 3QC3A 6TIMA 3KRZA 1F6PA 4JTLA 4NZJA 1B9BA 4UFMA 1SW0A 3DHFA 2J24A 1LOLA 1XBZA 1OG0A 4IMGA 3S5YA 4LRTA 5FI8A 1WAUA 3D0CA 2V82A 3TX9A 4FNPA 2DZVA 1X6UA 3FJLA 4JIQA 4Z08A 5C6MA 2YPIA 1LZOA 4NX5A 4UNKA 1ZFJA 1B57A 5DBTA 1TPWA 4LS1A 3U6WA 1G7VA 5HUPA 1GYNA 1GQNA 3N3MA 3MW7A 3ATZA 2E77A 2H3DA 3ANYA 2CLOA 3TCEA 3IGXA 3SR7A 2QR6A 3M47A 5F1UA 3OG3A 3SGZA 3O63A 4HPJA 1XCFA 2JKPA 3HF3A 4U4MA 4MVAA 1FWRA 4PH6A 4S2CA 3GAKA 2NUWA 3I65A 4JD4A 3C4UA 1XUUA 3LRKA 3WJZA 1K7XA 3W9ZA 2IQTA 4BFAA 2QCFA 1T99A 3HG2A 3AO0A 4QJ1A 3UWVA 1TPDA 4MFEA 2H8ZA 1OYCA 4NZFA 4PCFA 4L4LA 3C2RA 3TFCA 4LVGA 3DFQA 2FJKA 4GBUA 5TIMA 1GWJA 1W5MA 4RCXA 3T55A 3W7NA 3NQVA 2E5BA 2JBMA 1K3UA 1YTEA 1QO5A 3CC1A 4LW7A 1ZY9A 1BWKA 3QPZA 4N9EA 4HNUA 2Y61A 2WSQA 4RJEA 1QNVA 2A1YA 3S6DA 4B5NA 1M5WA 1FWWA 5MHBA 4WOQA 1H63A 4LC6A 3W7RA 1J4EA 3UWWA 3M5VA 2A6LA 3C2VA 3LTYA 4WX2A 1NF7A 4XKYB 5FF2A 4ML9A 4UFKA 2B7NA 1H5YA 2V81A 3G3MA 3DHDA 5BNKA 2RFGA 2QCHA 3S1VA 3P5ZA 4NU7A 1HO4A 5AHNA 1TPEA 3G1AA 1FWSA 3PG9A 4I9AA 4UTMA 1VPXA 3UWUA 3NQGA 2B7OA 4N4QA 4NXKA 2ATSA 1T8XA 4O1BA 2E1DA 2R94A 1EX5A 1AG1O 5EY5A 3G0UA 2YR1A 5IBXC 4HSNA 1G4PA 4K7VA 3R8RA 3W07A 3SI9A 1I2PA 4HIBA 1M7PA 1ZNNA 4Z0SA 1VLWA 2WKJA 3L68A 2Z6JA 3W1LA 4OV9A 3TE9A 3HBLA 2QCDB 1KTCA 1LYXA 3ATYA 1VYPX 4MOZA 4JTHA 4MZ8A 2ZZ6A 2NXGA 1GEQA 3IIVA 3LERA 4HNTA 3GNNA 4OGZA 4JTUA 4R53A 5E1QA 3USBA 4X9SA 3HPXA 2WQPA 3K30A 3L21A 3R5EA 1YXDA 3E9AA 4MKNA 4OE7A 3HO8A 4M5PA 3HPSA 4MLRA 3L2IA 3SZ8A 1DVJA 1K8XA 1EB3A 4MIMA 4EF9A 3L67A 1AW5A 3STCA 1R46A 1VR6A 5AYYA 2BWGA 2DJXA 2Y62A 2V2DA 4FX7A 4UTTA 3W1NA 1K7EA 1GT8A 2YCEA 1EWEA 3QRHA 5SWUA 1MZHA 1O5XA 4ZQRA 2EGZA 3OVPA 3N2XA 5CZ0A 5TBOA 4O50A 3BW2A 3W73A 1WYIA 2JGYA 1F2JA 1O94A 4QITA 1R2TA 1WBHA 4IWWA 4JXCA 1W37A 1JCYA 5BMXA 3VKJA 4CQ9A 2YGYA 4XUGA 2A5HA 2PURA 5CZJA 4LUJA 2C13A 3L0KA 2CFFA 1NEYA 4QIUA 1EIXA 2FDSA 3MUXA 3PR2A 3IIXA 3QSRA 5C54A 5FF0A 1FWTA 2X1RA 4N9BA 3GX9A 3KHJA 3EWUA 4BF9A 5J5DA 3WK3A 3O8AA 4R7JA 1QDSA 1HUVA 1RZMA 4JTTA 1XKYA 4UCGA 2Z6IA 3FEMA 4UC5A 3STFA 3U2OA 1FCUA 3HJZA 1TRDA 4S1FA 3DI0A 1IGSA 3G1YA 4XTDA 1TTJA 3M16A 3CM4A 5I3GA 2GOUA 1GZGA 3I6RA 1S5VA 3GXPA 1MXSA 3CQ0A 2A0NA 2B0MA 3GVGA 1OVDA 3MJYA 1JJKA 3OA3A 3P5YA 1GVRA 2NX9A 1SPQA 2Y7DA 3G18A 1LBFA 3O6CA 3LDVA 3QEZA 4K38A 3KVJA 1DKWA 3W83A 3O16A 3G3DA 1SR9A 4DELA 3NYZA 4FX8A 3FYPA 1BTMA 1D3HA 3SY5A 4HN4A 4FO4A 5HNRA 3UD6A 4M6VA 2OX1A 4UFJA 1PS9A 5AHIA 4EIVA 3HB9A 1PHWA 5HR7A 1G4TA 4LU0A 1P4CA 2FPYA 4LVFA 1UJPA 3L5LA 5D03A 2NWRA 2TYSA 3INPA 3W2MA 1QCWA 1SFLA 3TC7A 3IVTA 1SZGA 2C14A 4O19A 3C8FA 2BTMA 3CHVA 3WFAA 4A21A 3B0PA 4IPJA 1Z44A 3N2MA 1TO3A 3W1XA 1KA9F 3A5VA 4N6FA 2VEMA 1VHCA 2QCCA 1BEUA 3W22A 3LRMA 4FHAA 4RZ4A 1KM6A 1LROA 3O06A 1WDWA 4KWWA 3MO7A 3FKKA 5EBUA 3W7EA 4O54A 3LCFA 1L6YA 1H62A 1JCXA 4GUIA 2Z2UA 4IMCA 4TU1A 5EPDA 3IGUA 3GDMA 4PA8A 2A7RA 1KFKA 4GUJA 4DXVA 4KWVA 3NNTA 2ZA1A 3E96A 3E49A 3DFSA 1W5OA 1EUAA 3P61A 2C6QA 1LP6A 4HPXA 4M6QA 5HINA 3QZEA 3LGEA 3PBVA 4Z0JA 3CLMA 2P1FA 4JYDA 3W1MA 3KOFA 3WK1A 2QCEA 4JEQA 3T44A 3GKAA 4RV8A 5HJLA 2GJLA 4CQ8A 2YFNA 1TQXA 1A5SA 4JTSA 2Y7FA 3ZFHA 2PRLA 4BI5A 4IGHA 2R91A 4RKAA 3NQAA 3LHVA 3W71A 5DCDA 4O53A 4UTTC 2ZZ5A 4H4IA 3TH6A 4C1LA 4MYXA 3NL2A 3OVRA 3S5NA 3QMSA 3S1WA 4RXFA 4Q4KA 1WX0A 2NLIA 3RLVA 3W2LA 5F4SA 3LHWA 1VS1A 3NPWA 1H50A 5HR6A 3RNDA 4XWUA 3TMQA 3EX3A 3W7LA 2B7PA 5AFDA 3TV8A 2VFGA 2CZFA 1YPFA 3VE9A 2R14A 5KITA 4JICA 5BRBA 4Z1AA 5IM51 3OHIA 5E93A 2V2HA 2VFHA 3NPVA 3O05A 2V0TA 1Z41A 3MBDA 2RHGA 4ORIA 4RZ6A 1OX4A 4WJEA 5FF3A 1SO6A 3ZS4A 3TQKA 4LRSA 5F2MA 1ML1A 3KXQA 1WQ5A 3DFNA 1KFEA 3ELFA 1UB3A 1KLYA 4OWGA 3W85A 5F4XA 4YCOA 4AXKA 5KTLA 3DH7A 1SQ7A 3KRSA 1XDMA 3HGOA 4RR4A 3PS7A 5CZTA 2ABAA 2OMAA 3TXZA 1TQJA 4GFSA 2J9YA 4ALDA 1AL7A 1BKSA 1LRNA 2OCZA 1O5KA 2A6NA 3GDRA 2EF9A 1EPXA 1KLZA 1Q3NA 1EP3A 3P81A 1NFBA 1OF6A 2GVLA 1Q6LA 3NG3A 1EUNA 3B05A 4UFHA 3W1RA 1JCLA 4S2BA 1TYGA 3UZ5A 3NEVA 5AHEA 2OT0A 2VEIA 4O12A 3CEUA 5DY3A 2FPTA 1GTHA 1ME7A 5CPMA 3MHFA 4AWSA 3PUOA 4O13A 4NJJA 5HWJA 2Q8LA 4M7TA 3TQ0A 3A9IA 1IXOA 3NL3A 4GJ1A 1TTIA 2C18A 1LTDA 1OHLA 2VFFA 3NQ2A 4UMBA 3GK0A 2EKCA 4NQ1A 2X30A 4ZQNA 1HTIA 2E6AA 2G96A 3GDKA 1PV8A 4BR1A 3G8RA 2TMDA 3H55A 2ISSA 2VFIA 3PUDA 1UASA 4MZ1A 5K3VA 2E68A 1RV8A 4FX6M 3R13A 4O1AA 4DO6A 3STGA 2HMCA 1ZHAA 3I7RA 2A85A 3OEXA 5DXXA 5LHEA 5G4WA 1QAPA 4KFPA 3W7QA 4JS3A 4KFOA 3NQ8A 1TSIA 2ZZ7A 3ABQA 3N73A 1F6KA 1R2SA 3V75A 1H1YA 3DKLA 5K2ZA 1L6SA 4ZQMA 1ADOA 3EX1A 1KV5A 4W9TA 5AC8A 2O7QA 3RU6A 3VCRA 3W2NA 4ZQCA 1GG1A 2QJGA 3W2JA 3TROA 4QISA 2ZCGA 2WSYA 2C15A 3IIOA 3I7SA 2NX3A 1F05A 3N14A 2C0AA 2WOQA 2VEPA 1W56A 3S1XA 2Q3OA 4AMAA 1KBIA 3ABOA 2VENA 4K8HA 5KINA 1YADA 5ABTA 3C0JA 4JN6A 1ZJIA 3P62A 4UMCA 2FB2A 3OIXA 2X1TA 5AYZA 2NXIA 1UUOA 3L66A 1GVSA 3L9CA 3O15A 3I68A 4A22A 3LRLA 1TJPA 4WXZA 1GVQA 4AF0B 5K9DA 4GUGA 3W7DA 1RQBA 3CEPA 1DQXA 3DGRA 1I2QA 5K4ZA 1SW3A 4FNUA 1G6CA 3GKFA 1VCFA 3LHYA 4YLWA 2VKZG 4FIQA 1TCDA 2GJNA 3G24A 3BPWA 4BK9A 4ZZ9A 4O10A 3GAYA 4PTNA 4O14A 1W3TA 1H7WA 4UR8A 5KMYA 3P84A 1PCWA 2ZDRA 3S42A 3BARA 4PFMA 4YMZA 4C1KA 3NAVA 3FFSA 5AN7A 3QJAA 1XBYA 1VJIA 3QQ1A 3W2UA 1O95A 4FXSA 2NV1A 5D33A 4N6EA 1SZEA 1SSGA 4OT7A 4R33A 2NWSA 2WNNA 3T78A 5U7SA 1Y0EA 3UWZA 5I3JA 5D2XA 3FIGA 3SFKA 4NJGA 2GQ9A 4O4VA 3GXNA 1FBAA 1QOPA 1G4SA 3B0VC 5HUOA 5F2IA 1N8FA 3QW4B 5GVJA 3NL5A 4MYAA 4AHOA 2OJPA 2LLEA 4JX5A 1I4NA 1TIMA 3F03K 3JS3A 5E0KA 3UPWA 3WK2A 3LHZA 3MHUA 5I3KA 3GDTA 4AF0A 3FJ6A 3V1PA 3KVLA 5HMSA 5H2ZA 2O7SA 2Q8ZA 1VYRA 3TW6A 4IMDA 3W1UA 1GOXA 3EEGA 2BSLA 3NL6A 1WBJA 1YLVA 4QM1A 2YYUA 1OFRA 1EWDA 1TPUA 2XFWA 4E0CA 1FQ0A 4XZ9A 1I8JA 4I7WA 3BG5A 1ALDA 3STEA 2GVGA 1FCVA 1PCKA 2ISWA 4JIPA 2C16A 3PB2A 1H7OA 4O0ZA 1F7BA 3BK0A 2GVJA 4A29A 1F5ZA 1KFLA 2J9ZA 3PWAA 4TMBA 3NQFA 3MYOA 1D9EA 1ZALA 1C8VA 1JUEA 4I7UA 2V5LA 1JR1A 3W84A 3LI1A 3GNDA 3RF9A 4WY0F 4P61A 1W8SA 3EB2A 4DPQA 3QFEA 3FLUA 3KAOA 3M44A 1M7OA 3DI1A 3GYEA 3KVMA 4M19A 1VZWA 1O60A 1KFJA 2CZEA 3VI2A 3TAKA 1U83A 5HQEA 1LM1A 2CLKA 3IEBA 2GUUA 4QNEA 2QCMA 1QWGA 4UTLA 1OFDA 4Z1BA 5KSWA 1X8FA 2FLIA 1TJRA 3M5YA 2V5BA 2ZRYA 4EWND 1OYBA 2YW4A 3NA8A 5DXYA 3IV3A 1L2UA 2CW6A 4DBDA 1VGAA 1W31A 4ZVJA 4UTHA 1H7PA 1G69A 3HGRA 4YXGA 1ICSA 5F2LA 2HS6A 2ISVA 1FDYA 2YZRA 2JGQA 4XBSA 1XFBA 4O0KA 4JTFA 1XBXA 3MYPA 4DBEA 3GLCA 3A21A 4IPIA 1KTBA 2QCLA 3PM6A 4FEZA 4OHQA 3GR7A 4N2YA 1X1ZA 2VFEA 4RZ5A 1OFQA 1VYSX 3NM1A 2NUXA 2DU2A 5D05A 1K8YA 3PVFA 3G1SA 4PEKA 4AHPA 5L9FA 2NUYA 1QO2A 3W76A 3GXTA 4DF2A 1L6WA 3UY7A 4DQWA 2DZXA 4G1KA 2EHHA 1SZNA 5LGXA 2Q3RA 5EKYA 3MP4A 3NPUA 3A23A 1YDOA 2QCNA 3F1QA 1IIGA 1JUBA 2E6DA 3CWNA 1ME8A 2E6FA 4JYFA 4LOCA 3E0IA 3NQDA 3PF3A 5CSRA 1TPH1 2YXGA 3C3NA 4CCEA 3NO5A 4EOUA 2E5DA 2C1HA 3LX9A 2CU0A 1KBJA 2P10A 3TDFA 2ZZ4A 3G1XA 1G67A 1C29A 4NJIA 4N4PA 4LS0A 1DOSA 5LNSA 3NQMA 1HL2A 1QMLA 3G22A 4AH7A 3AJXA 1QPNA 1LORA 3QSTA 1QPQA 5K4XA 4LT9A 1A50A 4AEOA 5D02A 3HIJA 3W72A 3LCLA 1FDJA 2A7NA 4HT3A 3QF0A 1FXPA 1KM1A 3TSBA 1W3NA 1OFEA 1X1OA 3S0CA 4O57A 3L65A 3W7CA 1AW1A 4OU1A 3TNOA 1H1ZA 4CNPA 4GUHA 4GWEA 3QW3A 5CSSA 4UFLA 5D37A 2CLLA 5DCEA 1N7KA 1PVNA 1AL8A 4NX0A 3DAQA 4GXMA 2ABBA 3UWYA 4Y9AA 3W1TA 2ZTJA 2WPBA 1LLWA 2I9EA 5I3FA 4H3DA 3UPBA 3W74A 4X2RA 1OF8A 3W7KA 4LVDA 1EA0A 1TTPA 2V9DA 1JRCA 5AHLA 3I7QA 5EYWA 2GQ8A 3CB8A 2J88A 4E38A 5CGQA 5D2WA 3CTLA 3BLIA 2JKAA 3SGUA 4UTJA 2PRHA 1FY6A 4UTWA 3FYOA 5DBUA 4H6KA 1ME9A 3BVJA 3O1NA 4O18A 1KW1A 1G4EA 1S5WA 5LKYA 3W87A 5AHMA 1K03A 1W5PA 1X7FA 3GDLA 1DL3A 1GVOA 2W0UA 1OX4B 3CPRA 4EVZA 5LNVA 4FXRA 3NXFA 1QOQA 4O4WA 1TPFA 1Q6RA 1SO3A 1TV5A 3TMLA 3DKJA 3GR8A 3UQNA 3TFXA 4RX0A 2DZPA 3S5ZA 3M6YA 1E51A 3QQ0A 1CX9A 3L0NA 5LZLA 4LV4A 4UR7A 1DJNA 4Y96A 3RLUA 1O4UA 1P0NA 2NZLA 4ONVA 3NM3A 3Q58A 1KFBA 4FNSA 3KX6A 1JQXA 2V30A 4JDBA 4OV4A 3WK0A 4WZHA 5I3IA 4K37A 4X3ZA 4CNOA 4LTSA 3Q2DA 4MZYA 2E5CA 1G7UA 2WJZA 4PODA 5G2IA 4LWWA 1R2RA 2CLIA 5G2HA 1OX5A 4Q32A 4Z1DA 1NF0A 3FA5A 2BX7A 1EEPA 3IIZA 1SW7A 1RPXA 2RH9A 2Y88A 4LNYA 2JK2A 4Y8FA 2QDGA 2C3ZA 3TIMA 2Y7EA 4A2SA 1DORA 5D38A 2EAWA 3IVUA 1OFPA 3KRUA 3PSWA 3JRKA 4NXSA 4DO4A 5DCBA 2FB3A 1TPC1 1S5TA 2P0OA 2Y70A 3B0UX 3NVTA 2WO5A 2YYTA 1RD5A 5BMWA 1DV7A 5AC7A 4YL2A 2AAMA 3UYCA 4MJMA 3PSVA 3HMJG 4WUIA 3QMTA 5CPLA 3LLFA 2C19A 1I45A 2QUUA 3W1PA 6ALDA 3LXAA 4WQ6A 5CKSA 1SZFA 4MFDA 5DELA 4K39A 3W2KA 5FF4A 1HG3A 4N9DA 1VHNA 2VELA 4IXHA 2NXHA 3NPXA 3EX4A 2ZRWA 3W3OA 5F4WA 3UY8A 1J5TA 4IX0A 3B04A 4NJKA 1VCVA 3JR2A 5D04C 4GRSA 3ABSA 5TQLA 2QEZA 4DEFA 5HULA 1W5NA 1F73A 4NUWA 4JY8A 3E12A 1MEWA 1H7NA 1Q6OA 2ZTKA 4JY9A 2PC4A 3WJSA 4JGDA 2G95A 2YW3A 5FF7A 2Y6ZA 3N19B 2ZZ3A 1ZAJA 1LDCA 5HWMA 3PC0A 4IMFA 3LLDA 3C2OA 3O07A 4K6AA 1OK6A 2J6XA 3C61A 1F76A 1LOSA 1KM5A 5G1TA 1MEHA 4QQ3A 2ZZ1A 1FXQA 5EMUA 4TIMA 3MI6A 1TMHA 3P82A 3EWXA 2DZTA 2H8XA 3B06A 4O17A 3LHTA 4NNCA 3HG5A 3DENA 4XTIA 1S3HA 3A22A 2Y63A 3M9YA 5U4NA 1IXQA 4K36A 2QJHA 2R8WA 1OFAA 2ZRZA 1UBSA 3NDOA 3NR0A 3NZ1A 4AAJA 4JNMA 3DFTA 3A24A 3E02A 2TRSA 2A21A 3WJWA 4PC8A 5F1VA 2HSAA 4GUFA 1ICQA 3TSMA 1VH7A 4CQAA 4IUOA 1LBMA 2G5WA 3DFPA 3LCXA 3ZR4A 3LM7A 1I2OA 3CIWA 3BV4A 2DZSA 4ICNA 4CCDA 1V5XA 5I3HA 3EXRA 1GG0A 1YYAA 2GPTA 4NNAA 1T0OA 3KFTA 1Z42A 1AW2A 2VOMA 4YCPA 3DZ1A 3QPYA 4TMCA 5H91A 1TV7A 4UTWC 3P74A 5C55A 4ZQPA 2NV2A 4LUIA 1JCNA 1OFOA 2WNQA 2OZ0A 5K9XA 4O8RA 3IGSA 3IIPA 4JTEA 3W88A 3S8HA 5K7JA 1RQHA 4FNQA 2GQAA 2HTMA 3M43A 2ZFAA 2Y7GA 4RLIA 4UTIA 3THAA 3W70A 4FB7A 5FEXA 3ZWTA 4CLMA 1OK4A 4DPPA 5AOUA 3NOEA 1XM3A 1VQTA 3NQCA 3NQ7A 4A3UA 1AK5A 2DZUA 2W6RA 1XC4A 3S9YA 4GNJA 3B4UA 5KZMA 3U8GA 2ZYFA 2H3BA 2F84A 1TTQA 2RDTA 4CCCA 3LV6A 4L4MA 4DO5A 3GIYA 3EWYA 1QR7A 5CZSA 4UFIA 2ZRUA 2DJLA 1Z48A 2QUVA 1EP1A 2RKXA 3HG4A 1BWLA 3PBWA 4OQVA 2TPSA 4O52A 1GYLA 2E6YA 4TR9A 1W3IA 1LRQA 4FIRA 3G1HA 3TU9A 2KZHA 4NNBA 2VC6A 5C5YA 4JYEA 4JDYA 3H53A 1H60A 1D3GA 1ZCOA 3BG3A 1H51A 1KM3A 1KFCA 3ZWSA 1RQEA 3GZ3A 3P80A 1JQVA 4QSHA 4KKXA 3MI2A 1VRDA 3EX6A 1Q6QA 2QKFA 4YWIA 1B4KA 3CIXA 1WOAA 4AWTA 3TSDA 1YDNA 4FNTA 1A5CA 3G8EA 5G1YA 1DBTA 1FUYA 3HQ1A 1KV8A 1DJQA 3LBCA 3WJXA 1U5JA 1IXPA 3LXCA 3R89A 4TO8A 4TX9A 1B4EA 3PULA 4BWLA 3WJYA 1T96A 4E2BA 3DU0A 2NX1A 2BLEA 2PCQA 4HKPA 2RDWA 2YSWA 3Q37A 4AB4A 4WD0A 2PRMA 3F4WA 4JTJA 3G0SA 2CLHA 1I2NA 3S5OA 2B4GA 3TW7A 5LHFA 4D2JA 4A2RA 2DZWA 1K7FA 1W1ZA 1UCWA 3C52A 3EXSA 4BI6A 3N9RA 1YTDA
chains in the Genus database with same CATH superfamily
2VC5A 3MPGA 4HJWA 4NRSA 2VX7A 4Y2WA 5MKGA 1K02A 1OGSA 1TR9A 3WQ4A 1NOFA 1H7XA 1KTNA 4OECA 2BOEX 2D73A 4YHEA 3QMRA 1P0DA 4QLJA 2ZUSA 2INEA 2NT0A 2OEJA 1OYAA 4Z1CA 2QAPA 2OTDA 4UUIA 3TKFA 1B3XA 2WMIB 2DPEA 4QDWA 1F74A 4KCVA 4AVOA 2GDVA 3WD2A 1WDDA 1H11A 2UY5A 4HCLA 5M17A 3EDKA 4GE8A 1M9HA 1XLGA 3B03A 1KBLA 2CITA 3G1DA 3WLMA 5XIAA 4PYSA 1B0IA 2PDXA 5FEPA 1FX6A 4PL1A 2RDUA 5AC4A 3MMUA 3FN9A 3N1AA 3N6JA 3P8JA 2C79A 5CG7A 2HWGA 1QRQA 1A3XA 2RAGA 2OX4A 5CPOA 1NFPA 4IOTA 3SJNA 4U31A 1C3FA 1HKIA 4PTMA 2CBUA 3KS5A 1EH9A 3HFTA 4RW5A 3RX4A 4G8TA 2V6AA 4H9VA 4F3HA 1XH1A 3SN1A 3GYCA 3BGJA 3W6MA 4B5XA 1VCGA 4JHOA 1IF2A 3AMDA 3WQEA 5HJXA 1CECA 3NGJA 2Z1WA 4NY2A 5CPTA 5AVHA 3P14A 3MBFA 3EKLA 4H8NA 3L2MA 3MZ2A 1OC6A 5BW6A 3T81A 3ZLFA 2ZBTA 1R3WA 5EFFA 4P7LA 4Q8OA 2CWNA 4LUTA 4MGGA 2BXVA 2WZEA 4BI7A 2CZDA 4KF1A 4UOZA 1O6IA 3TYUA 2CZ5A 3M5ZA 3FS2A 5HMEA 4D6IA 1K70A 4H19A 1CXLA 3KW3A 2HROA 1UH3A 1V3KA 1DWIM 5GJMA 4C1NA 3ITLA 4QAWA 3PB0A 2V8ZA 1XYLA 4O15A 1W9UA 2ACRA 3E1F1 1P7TB 1WO2A 2VC9A 1O7AA 2A2IA 4MPQA 4XO6A 4MAVA 2I57A 2QJIA 5KZDA 1UH2A 1X6NA 1CW2A 4JFSA 4A3HA 3NQBA 2PE4A 4AQLA 5HQLA 5J5RA 3QM3A 3U4AA 2XN2A 4UMAA 1WKFA 1YEYA 4Y8EA 1UA7A 3WLRA 3SSJA 4IG2B 3GU2A 1CPUA 1P5BA 3EB3A 4WKHA 2J9XA 2OT1A 3IUDA 3L4WA 4Y6GA 1S3TC 4IJBA 4UR9A 1TPB1 4IMEA 3DFOA 1ZRQA 4DZHA 5HAOA 2VFDA 4O1DA 3NQ6A 1JI1A 3SUSA 4CNTA 1WKDA 2J7BA 3OVQA 1L2QA 2A79A 2DIKA 3W7JA 3VD4A 2BOGX 1JI2A 1W1YA 4H7CA 4W86A 4TVDA 2ALRA 4KCUA 1LCOA 4LS2A 4QNWA 1UPPA 2ZRVA 2VXNA 1ZJBA 1JYVA 3CZ8A 1TREA 1THFD 4GK8A 2PLCA 1T7LA 5CC3A 1PPIA 3KTSA 2O4QA 4YHGA 1TWWA 3M5XA 2D0FA 5FEZA 4U2ZA 3TJLA 1YXCA 4XBKA 2J78A 1W1A1 5EMKA 1MRQA 4PMYA 4QXIA 3QH2A 1EHNA 3PG8A 2D1ZA 1A5UA 3C2EA 3WF3A 1DQWA 3T7VA 3VE7A 6REQB 4CVWA 1XRSA 4WY0B 4EF8A 1PHQA 4WSHA 3AYVA 5A8OA 3CL8A 2P53A 3PN8A 3N2OA 3IJQA 1EGVA 4LNCA 1MSSA 2D0HA 3FKRA 4AYSA 4UNLA 1VFFA 2F6UA 4NJHA 4DAIA 5FAJA 4Z17A 3MP3A 4D1IA 4C6CA 4S39A 1OJXA 3CUIA 4LVAA 1Q13A 2VQUA 3BICA 5HDRA 3NZGA 3PANA 4UTKA 3CV6A 2NW0A 1QI4A 3FVDA 3LPFA 1ZPTA 4QLKA 1N55A 4JTKA 3TJXA 4POCA 1FKWA 5BZAA 1QHOA 2YCLA 3GFZA 4Y7EA 3WQWA 3N6HA 5G5IA 3SB0A 4ZSTA 1XLJA 4B9ZA 3UXDA 4LJ3A 3VIPA 4ZFMA 2XGZA 3F2CA 4OBTA 2FGLA 1GW1A 2G97A 3FA4A 3AHXA 4XVDA 1US3A 2HVOA 3IACA 3WENA 3LOTA 3LMZA 3L5MA 5FCZA 2PWVA 4LB3A 1H61A 1EDTA 4HVXA 3P6LA 4N9CA 2V38A 5AC6A 2JF6A 3R25A 2DT2A 1PE1A 4C60A 3DYMA 1E9YB 4XZMX 2XSAA 4QJ5B 2HK1A 4DJEA 1UH4A 1QNRA 1MQQA 4HHPA 3WG6A 1LL7A 2FTPA 2H6RA 4O16A 3ANVA 3EKZA 3HOJA 2WVSA 3ZR6A 4HNNA 1FDZA 2XVKA 2ZA3A 1EDGA 1JVNA 3GHUA 4PMRA 1KD0A 3UXKA 1TE1A 1SM9A 2BY1A 4M1RA 3A5FA 3QC3A 1E0VA 4NZJA 4UFMA 2IMRA 1BQCA 2W3ZA 1OG0A 3S5YA 1WAUA 3UR8A 1OGGA 3VNKA 3BXWA 2DZVA 2QVNA 5JVLA 1LQ2A 4UOQA 5BWFA 4HPNA 1LZOA 3T07A 3UT0A 3H2NA 1IEQA 4C6FA 1A5OC 1XIHA 4QJ4B 1WP6A 5HUPA 1GQNA 3MW7A 1NDWA 4RE4A 4RNFA 2H3DA 3IGXA 1YDYA 2PLJA 3WLLA 3LENA 5ECVA 3WF4A 5I2UA 1A5KC 3SR7A 1UR3M 3HZ3A 5F1UA 3OG3A 3GSMA 3B0XA 3M0JA 3VGGA 1OCJA 3HF3A 1V02A 3LA4A 2PP1A 4MVAA 4PH6A 1R7AA 3NO3A 9RUBA 3C4UA 2ZUMA 4J3VA 4IGSA 5LYRA 4D8LA 4BFAA 1T99A 4S3KA 4W84A 1LUCB 1TVNA 1XICA 2Q01A 4L4LA 3C2RA 2GZXA 3CAVA 4LVGA 1UQZA 3DFQA 3CQJA 3NDYA 4W7VA 3NQVA 2JBMA 1YE6A 3CC1A 3CUJA 3QPZA 4IGMA 2HK0A 5MKGB 3S6DA 1M5WA 5A6BD 3ARYA 3M5VA 2A6LA 3UWEA 3KZSA 2UY3A 1VB9A 1CGVA 3R6IA 2HNEA 3S9ZA 3DHDA 3UGRA 5BNKA 2RFGA 4E6MA 4B5TA 4TVCA 1WUEA 3BOLA 3M64A 4NU7A 1HO4A 4F2BA 2OQLA 1GJUA 2PDYA 1VPXA 4U5IA 1FHLA 3TVAA 1T40A 3QKEA 4MM1A 4PMUA 1AG1O 2BGQA 4HNLA 1KCZA 3G0UA 4GKTA 2YR1A 3NZPA 4D6EA 1G4PA 4K7VA 4E4UA 1VFOA 1ZNNA 3WDRA 1TV4A 4GI4A 4OV9A 3RU8X 3HBLA 3K8LA 1KTCA 4E3VA 3CAWA 2NXGA 1UOZA 3ZSTA 1D7KA 3IIVA 1KCXA 3ARRA 4AU0A 3MTWA 3N9KA 5AC5A 3TYDA 3IJDA 4P8UA 5DFAA 5EU9A 3G5EA 5CC7A 4HZMA 4MKNA 3HO8A 3L2IA 4GNKB 1K9FA 1AODA 2DGAA 3SURA 3BAJA 2VDGA 1EB3A 1J96A 3L67A 1M41A 5AYYA 3S1GA 3VGDA 2BWGA 4DAFA 1B9ZA 1EF3A 3LK6A 2Y62A 4AWEA 4IFOA 4H9YA 1BXNA 3GBDA 1DJXA 5E6YA 1EWEA 1KKRA 1JXKA 4JEJA 1MZHA 2EGZA 4Q8NA 4DJEC 4KWUA 5CZ0A 1PZ3A 1E0TA 2Q8XA 4PZVA 2GGJA 4QITA 1O68A 4C7GA 3RO6A 2PDPA 3I3EA 5BMXA 4PMZA 2PURA 1BG4A 4C1NB 2CFFA 5IHRA 2DH3A 3AXKA 1EIXA 2FDSA 3OBAA 3PR2A 3IIXA 5FF0A 1CGWA 3E5PA 4L1XA 1VJSA 2X1RA 3WBAA 3SY8A 4N9BA 3EWUA 1IEWA 3O8AA 3PPHA 4JTTA 1W9XA 3FEMA 2J7EA 4S3JA 3HU7A 1SR0A 3STPA 4KEZA 1TRDA 2HXUA 3DI0A 3QHOA 2O9PA 2OSXA 3AOFA 2DQXA 1R5YA 2YDQA 3B9NA 3T05A 1TTJA 4CU6A 3UZZA 4EE9A 3CM4A 3RIKA 5I3GA 2GOUA 5EMYA 3I6RA 3KHDA 3RDKA 1C90A 4H9XA 1XIEA 3GG1A 4KRZA 3VNMA 4A8NA 2A0NA 3XISA 1OVDA 3BOFA 2VGGA 2NX9A 1SPQA 1LBFA 3O6CA 5A8QA 2A3CA 3R1ZA 1E9IA 3W83A 4YVPA 3O16A 3IJ8A 2VX4A 2INZA 3FYPA 1HP4A 1MZRA 3SY5A 3PPFA 4HN4A 3L4YA 1NWUA 1HGYA 2YBVA 4WR3A 1PS9A 4H04A 4MWAA 3W02A 3HB9A 2ESCA 1GW9A 2FPYA 1UG6A 5HXMA 5D03A 1B31A 2TYSA 3QY6A 3PWIA 4WGXA 2VZTA 3IVTA 4PBGA 4BF7A 3B0PA 1AA1B 1EQPA 5FJJA 1AH3A 2OR2A 3A5VA 4DJFD 4GGBA 1VHCA 2I17A 3W22A 4FHAA 2QVHA 3SFWA 1A0EA 3K1GA 3R10A 3OYXA 1EC9A 1WDWA 3MO7A 2E8YA 3FKKA 1FFRA 1LG1A 1RSCA 4MNLA 4PEEA 2Z2UA 3ANUA 4TU1A 1B90A 2C1IA 3O0KA 4PA8A 2A7RA 2XTKA 4UTFA 2ZA1A 4LF2A 3FCPA 3EGJA 3GH5A 3WDPP 3DFSA 1W5OA 4L56A 3P61A 2C6QA 1LP6A 4M6QA 4NAFB 1SJAA 3KTXA 3GTIA 3UVAA 4RDZA 3CLMA 4JYDA 4M56A 5TAOA 3KOFA 2VR2A 3ZJKA 2J13A 1VBRA 4C65A 4WDUA 1RY8A 3T44A 5HJLA 4MNKA 2YFNA 1W6TA 1TQXA 4KIRA 3VIKA 3RPTA 4BA0A 4MB1A 4IGHA 1BYCA 4K2SA 4YS1A 4O53A 3KL0A 1XYBA 1DJWA 3U57A 5DMMA 2IKIA 3H23A 3NIYA 3H2EA 3A4WA 4Q4KA 2YA2A 3KCOA 3BE7A 5A69A 3NPWA 3TEVA 5HR6A 1ISXA 4XWUA 3LYEA 2VFGA 4I9TA 2CZFA 2VX6A 2R14A 4N42A 4Z1AA 5IM51 3IWPA 3OHIA 3VCNA 2V2HA 3N29A 3VIHA 3O05A 4P5UA 1Z41A 3GVVA 1IWPA 2YZ5A 1X96A 3GU1A 1SO6A 1VRXA 4QG8A 5C9UA 1WQ5A 4I6KA 2J8FA 4OWGA 3W85A 3RR4A 4H8UA 5F4XA 5JIPA 3E38A 4O0QA 4ZA0A 3CUGA 5KTLA 3DH7A 3HGOA 6ENLA 2FTYA 3EMQA 3ZVIA 3TXZA 1S2TA 1TQJA 4CU8A 3OO2A 4ALDA 3EOLA 1XPYA 4XX6A 4NI3A 3WN6A 1OF6A 2GVLA 1XLKA 2YL6A 1TYGA 3UZ5A 1UIPA 3RCNA 2HBVA 3SQMA 2VEIA 3MMDA 2FPTA 1GTHA 1POKA 5HANA 3F4DA 2WWDA 1IHIA 2W9MA 3PNZA 2MANA 3CJPA 4MWAC 1Q85A 3VOGA 4PUNA 4JFWA 1V08A 2OZTA 2YB1A 2BHZA 1HTIA 1Q4WA 4DY1A 7CGTA 2XIMA 1PV8A 2EO7A 9XIAA 3H55A 2ISSA 1DTNA 5K3VA 4X2PA 2HMCA 2A85A 1OD8A 1BLIA 3ZT7A 2Y0FA 4PUUA 1RBAA 3DKLA 4ZQMA 4UNIA 2O7QA 3CXOA 1JFHA 2SFPA 5LIYX 1Q5MA 2WSYA 3GFYA 2C15A 3N14A 1TUFA 2WOQA 3D3AA 4G2DA 3V5OA 1KBIA 3ABOA 4K8HA 5JUVA 5ABTA 1XWYA 1R3RA 1ITUA 2NXIA 3WL0A 3EDDA 3O15A 4WSKA 5JBFA 4Z42C 4GG9A 1V8EA 1TJPA 1XKJA 3AXMA 4JQ3A 1CLKA 3LD5A 3CEPA 5A2AA 1UWUA 1I2QA 5FACA 1SW3A 4FNUA 2VKZG 2BDQA 2WXDM 4FIQA 2GJNA 4LBSA 1JZ3A 3G24A 3BPWA 4BK9A 1FWHC 3TTSA 4PTNA 3GAYA 1QHPA 1EXPA 4C1KA 3G1RA 2NQ9A 3W2UA 4FXSA 1X1NA 3LN3A 1SSGA 4OT7A 1E0UA 4XG1A 3T78A 5U7SA 4OTKA 5I3JA 5D2XA 4O4VA 1QOPA 1GONA 1H09A 3MVTA 2XU2A 4GH1A 2W91A 1N8FA 3NL5A 3UETA 4MG4A 3JS3A 5E0KA 3WK2A 4AEFA 3KBMA 5DT5A 3GDTA 1N8IA 4D6DA 1M68A 2HCVA 4JTAA 4PUJA 3H4GA 3SRKA 1C8YA 1X8CA 2KAUC 3HURA 2H9AB 3GTHA 1GOXA 3EEGA 1KGWA 3WEOA 1WBJA 4MB4A 2YYUA 2QQ6A 4E0CA 1TPUA 2BFGA 5GJNA 4XZ9A 2ZKMX 4QBXA 3KL3A 4I7WA 1ALDA 3EWCA 4PR4A 1DYSA 1PCKA 4S3DA 1YNYA 1ZTVA 3PB2A 1F7BA 3TR9A 1F5ZA 2J9ZA 4B9YA 1ISZA 1PWLA 1ONEA 2PS2A 4RPPA 3MYOA 3H2OA 1JUEA 1XD1A 4WY0F 3K5XA 4ZXOA 4U3CA 1P1MA 3AJ7A 4UZUA 1HGWA 4KWSA 2PODA 1O60A 8XIAA 4HBKA 1I75A 2GSEA 2CLKA 3IEBA 2GUUA 4QCFA 1QWGA 1TJ1A 3QY8A 5KSWA 4LUSA 5CC5A 3SRHA 4BZYA 1DWHM 3KCLA 3AIWA 1UWSA 3BZJA 1RCOB 1HN1A 5CAKA 4DBDA 1VGAA 4J3ZA 1G69A 2VGFA 5A6MA 3HGRA 2ZIDA 1ICSA 1XG3A 3N04A 2HISA 3MSDA 5I09A 5DO8A 3H7RA 3MYPA 2WW5A 4MWAB 5HJYA 2XJ7A 1KTBA 1XPGA 5I3DA 3FGCB 4N2YA 1OFQA 1SJBA 3K4WA 2ZUWA 1VIWA 2NUXA 5D05A 1IZCA 1I0DA 2ZADA 2BXYA 4G1KA 2EHHA 1V6XA 2CKSA 3B9DA 3CMFA 3G2GA 2OODA 3F1QA 1C92A 3LM3A 4JYFA 1JL8A 1QW9A 3QV9A 3NQDA 4NRRA 2WK2A 1TPH1 4LEFA 3BMVA 3W53A 4GISA 1B1YA 1QXLA 6A3HA 2DEPA 2C1HA 4GI6A 3L4XA 3GG0A 9XIMA 4ML4A 2PD9A 2Z1SA 4I8DA 1G67A 2NQZA 1C29A 2W27A 1W17A 4BQ2A 3S3GA 4N4PA 3GO2A 2VO5A 3VXGA 3CZEA 3QSTA 1QPQA 4IT1A 1CB7B 2XFRA 1Q6GA 1A50A 4AEOA 2PSNA 3F4CA 2F8QA 1FDJA 3I4EA 3K13A 1TELA 2EG7A 2NQJA 1X1OA 3MQTA 4L80A 3L65A 1AW1A 3HTWA 4OU1A 3TNOA 3II1A 1H1ZA 4WDXA 3WQOA 5CSSA 5D37A 3BSMA 5I78A 1BXBA 3PJTA 4H6EA 2ABBA 2E40A 2ZTJA 3UG3A 4BJHA 1GCYA 2I9EA 2DW6A 3UPBA 3W74A 3A3HA 2ADAA 3SUVA 1TTPA 4Q8MA 4PMDA 2PLKA 6PTDA 1PZ2A 1B2YA 3AC0A 5D2WA 3BLIA 4WLCA 3GG8A 5T8GA 1J93A 4UTWA 3CMJA 4PB3A 3KZPA 3EEZA 4H6KA 3BVJA 4M81A 1VFTA 4O18A 1G4EA 1MXDA 1TZZA 3E3HA 4DBSA 1W9BM 1X7FA 1PIGA 3S2LA 1DL3A 1GVOA 2W0UA 3CPRA 1E4MM 1V3HA 1Q6RA 3TMLA 2HE5A 4Q8PA 2PBGA 4RX0A 2XFFA 4LV4A 4Y96A 3RLUA 4GI8A 1F8IA 3NM3A 3B8IA 3Q58A 4Q8TA 1VFLA 1JQXA 2V30A 4JDBA 1E4NA 5I3IA 1G01A 1C8XA 1SJCA 4LTSA 4C6LA 2E5CA 2FTWA 4PODA 5G2IA 1RJQA 3BLKA 1EPVA 1R2RA 5G2HA 4Z1DA 1TV3A 2O4MA 4OIFA 3UCCA 3M7SA 4YYCA 4NZCA 1I60A 4FSAA 1GVYA 1V77A 1DWJM 4F2UA 1MW1A 3TIMA 3PHAA 4JFVA 2EAWA 4GACA 1FWDC 1OFPA 3PSWA 1GNXA 2E7FA 4W88A 5D9OA 4DO4A 5DCBA 3RITA 3B0UX 4Y9PA 1YQ2A 1ZBVA 3AYTA 1RD5A 4LQ1A 1J79A 4YL2A 2AAMA 4W5UA 2Z29A 4WUIA 1BWVA 2PGRA 2C19A 3GS6A 2PF8A 3SIMA 5JH2A 4OOZA 1SZFA 3FXGA 4MFDA 1H4PA 4K39A 4BHYA 5FF4A 3RJYA 8RUCA 4W87A 3C8NA 3H24A 3M0KA 3RYSA 3NPXA 3W3OA 1E5NA 5F4WA 2W66A 4TX6A 1V79A 4IX0A 1MW0A 3B8VA 1UROA 3VCCA 4DEFA 1J11A 4NUWA 3WNMA 2HEJA 1BF6A 4GBDA 3GVQA 4M3PA 4CNUA 4KIEA 4JY9A 1CT5A 3EPOA 2DZBA 4JGDA 3CH0A 2YW3A 5G1MA 3FNDA 2Y6ZA 2QJJA 3UJFA 1PB0A 3W26A 4ERGA 4YVXA 4IMFA 3LLDA 3O07A 2DSWA 1EX1A 2J6XA 3V0SA 3UG4A 3C61A 3GHTA 1S5MA 3UNTA 4JQ2A 2ZZ1A 4GQ0A 1ZBWA 4PUDA 3EWXA 3QQWA 4U2YA 2H8XA 4O17A 1EBGA 1S3HA 5U4NA 4IISA 4JNZA 1D8CA 3NDOA 3NR0A 1UBSA 3NZ1A 2EPOA 4ES4A 3SUUA 4M6UA 4B3ZA 4MADA 3WJWA 4HZ8A 1IEXA 4EAYA 4QCEA 2HSAA 4GUFA 3TSMA 1G5AA 3BV4A 2DZSA 1V5XA 2G50A 1W1B1 4NNAA 1YYAA 2GPTA 1HL9A 4W89A 3RMEA 1EKOA 3CMGA 3KFTA 1AW2A 1NM9A 2VOMA 3QPYA 1TV7A 4UTWC 3T8QA 4HNOA 4ZQPA 4LUIA 3E74A 4LAUA 3WLHA 1KWKA 3CAQA 2IPFA 4IJCA 3S8HA 1WE5A 5K7JA 1E43A 4LB4A 4IIBA 1JDDA 1V0MA 4XSMA 2PDNA 3ZWTA 4DPPA 3ME3A 3NOEA 1VQTA 3NQCA 4XVEA 2DZUA 4AG0A 2ZX7A 1VKFA 3P3BA 4HA1A 1PTDA 3S9YA 2BOFX 4GNJA 5KZMA 3U8GA 4Q3MA 2DW7A 2RDTA 1TTQA 4CCCA 3LV6A 4ERIA 1J18A 3C5QA 2E0PA 1X98A 4XAYA 3GU9A 4NAEA 3H70A 2RKXA 4OQVA 2TPSA 1B3ZA 3K1DA 4QJ3B 1E4IA 2VC6A 5ABHA 1H60A 3WLIA 2QV5A 1LT7A 1KM3A 4MWAE 3P80A 1HVXA 4QSHA 2NQHA 2EG8A 2QKFA 4YWIA 4IZGA 2GGHA 1EO5A 3VM7A 3QTPA 3TSDA 5A2BA 3RCYA 3MUY1 1A5CA 3A4JA 3EYPA 1DBTA 1KV8A 4HK7A 5BCAA 4ASTA 1XSIA 2I5QA 3VAVA 3MKKA 4TO8A 3NVDA 4Y9NA 3NSMA 3Q37A 2X09A 3N11A 1XHGA 3G0SA 3N12A 4AZCA 3FY1A 1RJPA 4DYKA 3TW7A 4ZOCA 2ACQA 4J7RA 3EXSA 4BI6A 4N0RA 3E0WA 3WSUA 1XLLA 4MAZA 1CLVA 1LLOA 1BVNP 5CEWA 5I5RA 2Z2BA 1JRBA 2QS8A 1HFBA 1RHCA 1XIBA 3KVKA 4WDTA 2PFHA 4H83A 8TIMA 4MUZA 3LCIA 1NDVA 3SECA 1ECQA 3OBKA 2WNZA 4GLEA 2DVXA 3DBNA 3GB6A 3VFLA 1T41A 4XKYA 2ZZ2A 4AD4A 2PZNA 1WA3A 4U28A 1XLHA 1XIFA 4UQEA 5EBAA 3VKCA 4FLOA 2GFTA 3ZJ7A 5AYXA 1V0NA 3S47A 5D9PA 2PP3A 4UQAA 1GQKA 4ZB2A 2X42A 5JMUA 3LG3A 3P67A 1BHGA 1W32A 3DHUA 3NO1A 4PE8A 2FPVA 1UZDA 1E1EA 3AI0A 1CB2A 1GQLA 1LOQA 3QBUA 2WZIA 3O6DA 5E70A 3OBEA 2HJPA 1TG7A 4UIOA 1MYRA 3R43A 3URAA 2YXOA 5CPNA 2REQA 2ZRXA 5C2CA 2EXOA 4WDWA 4FALA 4J4KA 3TOPA 3WBXA 1BYBA 4NG3A 3SJ3A 4HZ7A 4QEEA 4AIEA 2WHMA 2I14A 3N34A 3VNZA 1FWNA 3P7YA 3O6YX 1BFNA 1PKYA 4HMEA 2WSRA 4XZLX 4UBPC 3GH4A 4FF7A 4WXYA 2ATMA 3BLFA 3EWZA 3RMJA 4Q4RA 1PZ0A 1FCQA 1JUKA 3RR1A 3BH4A 1ZAHA 4E2VA 3TAOA 5G4EA 1Z89A 4ILSA 1LRTA 1FP9A 5FL1A 4LAMA 4AVNA 2A3BA 2E09A 4S3FA 3LXBA 4OBSA 4YPJA 3NURA 4HTBA 4BF5A 3DGBA 3SW6A 5FJOA 5LA2A 2JQXA 2EEXA 3W01A 4NT0A 2V3EA 1A53A 3B8WA 4J40A 4DF1A 1KM4A 4L4OA 2FQIA 1W5QA 3WDHA 3TTYA 4RK8A 4BQ3A 3DOPA 3TQVA 5I0DA 1YPIA 1EIBA 1NAL1 3SCRA 2YCKX 4KEMA 1CTNA 1Y5WA 2R1NA 3BW3A 7TIMA 4LC8A 4MJZA 3N9SA 1C9DA 2QUTA 3THDA 1OX6A 5XINA 3QV8A 1LQ0A 3HGJA 5KZEA 2QF7A 3E2VA 4AMCA 1DWFM 2Z0IA 3BG9A 1AQHA 3DESA 4XZIA 4AIOA 2H90A 1QBBA 3ZJ6A 2X16A 3SAZA 3MS8A 2XIJA 1RH9A 4HNVA 2VD8A 4HP5A 4A3RA 4DJED 3THQA 1MEIA 3LGDA 4KPLA 3MUCA 1ICPA 3W7GA 5A5WA 2YFOA 2PZ0A 3B97A 2DP3A 3HQOA 2OYLA 4CQCA 2I5GA 2TSYA 4K8GA 3DUGA 4DNHA 1M7JA 3C56A 2D0GA 4ZR8A 1F3WA 2DT1A 3TUUA 3V3WA 1TA3A 2WM0A 3IJLA 1SMAA 3V36A 3T40A 3A47A 3JU2A 2I1OA 3NOYA 1P1XA 4P7RA 3HGSA 3CS2A 1U5HA 4JN8A 4HHLA 2DY3A 4QTGA 4O11A 5DRCA 3TJ4A 4J9JA 3CPGA 3EA3A 4RV3A 2FFCA 1Q63A 4MLJA 1GVIA 4KRTA 1L6FA 3WH6A 4JX4A 4LX4A 4A4AA 2AGKA 2PPGA 3QLLA 4K7YA 1JNDA 1O5QA 1XISA 4AVFA 1R30A 1JCJA 1A5NC 2AL2A 4S3EA 3WLKX 3RFAA 1I2RA 4GC4A 4IXXA 4H6RA 3AMKA 1V6TA 3CHEA 4L1WA 1XRTA 1V6UA 2CLMA 1QASA 1QFEA 1B3OA 2Z7KA 2QF8A 2PTDA 2VDIA 3VKDA 3ES7A 5CG0A 3VDGA 1E3XA 5HA7A 5J04A 1OY0A 1QI5A 2GWNA 2PGEA 5LNUA 2GJRA 2OZ3A 1R87A 2E67A 1TUXA 2GQ3A 3H2MA 2ZWYA 2G3FA 2V2CA 4AD5A 2D2OA 5GNXA 3TXVA 3HMCA 1ONRA 7A3HA 1PXGA 3CLWA 1PSCA 1XYZA 3MP5A 4LXFA 1OABA 6XIAA 4DHGA 3W7OA 4O28A 2ALDA 4O1CA 4UTUA 1WXZA 2VZUA 1JNEA 2IKJA 4YTSA 1K9DA 3MHGA 3MMTA 1SO5A 1XYCA 2Q6ZA 4PMVA 1G1YA 2OWXA 3EOEA 5AZ1A 3IPWA 4N02A 3APYA 4WJXA 3DXIA 1GUVA 2XN0A 3KBVA 3O7UA 5ECUA 3LGGA 4RXGA 4R34A 1A5BA 1QNSA 3UZYA 2D20A 1XBVA 2G8ZA 4UOJA 3R8GA 1VPYA 2WLYA 2BGSA 3M0ZA 1CZ1A 1BTCA 1J0HA 1OFBA 1TRIA 4HOWA 3TWBA 2XIQA 3KRZA 1DQUA 3GVWA 4NAEB 4JTLA 2X0SA 3M0MA 1U30A 1W1IE 5E9AA 1SW0A 3DHFA 3EPMA 3QY7A 1XBZA 1QI3A 2QHAA 5FI8A 1M3UA 3D0CA 2EKGA 1X6UA 5JIWA 3FJLA 4Z08A 2TODA 1VBGA 4H6QA 1DPMA 1XLFA 3VGBA 1IYXA 3OLEA 3L4ZA 4S3BA 1B57A 1LL6A 5DBTA 1G7VA 3N3MA 2FZBA 3ATZA 3ANYA 2CLOA 3TCEA 2MNRA 4Q8WA 1JYNA 3MSRA 3VGEA 2QR6A 4AC1X 1U33A 2FVMA 4GMEA 4IIGA 3SGZA 4HPJA 3QZ6A 4PFHA 2JKPA 4YIWA 1PYMA 4S2CA 3GAKA 2NUWA 4JD4A 4A8LA 4ZGYA 3KUMA 3LRKA 4HTYA 2IQTA 4BKNA 4QJ1A 3UWVA 4MFEA 1OYCA 3GXMA 4PCFA 1JDAA 3TFCA 2FJKA 4J3SA 3MO4A 2P50A 2PB1A 3VZYA 1W5MA 4MHBA 4RCXA 3W7NA 1K3UA 1QO5A 3EA1A 4WGHA 1ZP4A 5REQA 1FWWA 1GK8A 5MHBA 4WOQA 4LC6A 2GVYA 4CCZA 3RPDA 3NEHA 4RNJA 1SJDA 3LTYA 4XKYB 4ML9A 2B7NA 2J75A 3GG7A 1XLAA 2QCHA 1GHRA 4DLFA 3VKAA 3ZJ8A 1E71M 2RJGA 5AHNA 2P76A 3G1AA 1F3TA 3PG9A 2PMQA 4ECLA 3OODA 2V5DA 3UWUA 4N4QA 4NXKA 2ATSA 4TVUA 2RGLA 1T8XA 4XAZA 2B31A 2R94A 4MWAD 4IFKA 4JL1A 2Y1HA 4HSNA 4J1OA 2X8RA 3C0QA 5C9WA 1ESWA 2ZWZA 1M7PA 4Z0SA 3BLOA 4ATLA 4US5D 4AX6A 2FZ8A 3U2CA 4OJYA 4A8RA 1T5AA 4MOZA 4HYRA 1PX8A 1PBGA 1WCGA 3GNNA 4OGZA 4R53A 4V15A 1ZSXA 3ZYZA 3HPXA 2WQPA 3RG6A 2G4FA 3L21A 1GKQA 1LWIA 1YXDA 1AD1A 2IUZA 1GKPA 4NSBA 1V0KA 4MLRA 2VNCA 2VI0A 5HNTA 2DV0A 1DVJA 3L7RA 3SCUA 1J01A 4MIMA 4EF9A 3TQPA 3XINA 1AW5A 3K8KA 1VR6A 2FMNA 2XIIA 1DWGM 2DJXA 4EX4A 3URNA 2V5JA 1R86A 1HKWA 3WUBA 2YCEA 2DSUA 3UG8A 1UZHA 3MZNA 5TBOA 3W81A 2XM1A 3W73A 1WYIA 2ONEA 2JGYA 1F2JA 1MXGA 3G6MA 1MUCA 1QI0A 4JXCA 5C2GA 1M03A 3MDUA 4C90A 2A5HA 2F2KA 3M0XA 3R0DA 1W9DM 5I24A 3AMGA 2NVCA 3VD7A 2QYGA 1S2CA 1BSLA 3QSRA 1NWRA 5C54A 1EYEA 1MDRA 5AZ0A 4QDMA 4MNMA 2CLPA 5J5DA 3KM8A 1HUVA 3RPMA 1RZMA 1XX1A 4UCGA 2Z6IA 1U1HA 1CGUA 4UC5A 3STFA 3E2QA 1FCUA 1EYWA 2A3AA 3CZLA 1Z8AA 3HJZA 3PNUA 4DZIA 1KR0A 3THUA 3NTYA 2WWCA 2VEGA 4KQNA 3EAUA 2GLKA 3MJYA 1JJKA 2V3DA 3KP1A 3OPSA 1E1CA 4GHRA 3LDVA 3S2NA 4HD5A 4K38A 3V18A 1DKWA 2JFEX 1SR9A 3TZNA 5CZKA 4FX8A 3P0XA 3B9OA 1KGUA 4TX8A 5HNRA 4HMDA 1JPMA 2OX1A 3MANA 1EBHA 3DHPA 4LU0A 4DUOA 4K1GA 1W9PA 2NWRA 3LZ5A 3WUFA 3INPA 3W2MA 1SFLA 1R9XA 3N6QA 2VMFA 2HQAA 3TC7A 1IE7C 4PMXA 3ZVHA 2C14A 1YMYA 3O6AA 4O19A 3CHVA 3WFAA 1LL4A 3CB3A 1TO3A 4AZGA 3ARTA 4DWSA 3S2JA 1KA9F 4GKLA 2WB5A 2VEMA 2XIBA 3KP0A 1BEUA 4W8BA 3CBWA 2CHNA 4RZ4A 2GUYA 2PP0A 4IPNB 1LROA 3O06A 3WEMA 4DUWA 1Q4NX 4H8VA 1P43A 4O54A 4TTUA 3GDMA 3GNRA 3H12A 3LS9A 4KWVA 4GO8A 3FW6A 3E49A 4L9XA 5HINA 1NWSA 4PRTA 3I4KA 1A4LA 1QK0A 1NQKA 3CZKA 1DWAM 1J2BA 3B9AA 3SUTA 1ZL1A 4BI5A 1KRAC 5C7VA 2R91A 4PMNA 3UR2A 1BYAA 1JDCA 1U1JA 1ADSA 2ZZ5A 3DG6A 4CD6A 3P93A 4XD3A 3TH6A 2GGEA 2AQVA 1WZLA 3BTNA 3NL2A 3OVRA 3S1WA 4RXFA 2WHKA 3WZ0E 1ONWA 4BCEA 7ODCA 1WX0A 2X40A 5M1TA 3RLVA 4DI8A 2BASA 2V67A 4O8AA 5F4SA 1EJVC 1V4YA 1US0A 6TAAA 3A12A 4GVGA 1JZ5A 2J62A 3W7LA 3EX3A 5AFDA 3TV8A 1LT8A 3GZAA 1FP8A 4H2HA 2V5CA 1AFSA 1EGZA 4E3TA 4UQCA 2VFHA 3H6OA 3WD4A 2CYGA 4Z2GA 3MBDA 2W61A 2RHGA 4FLSA 4ORIA 4DZAA 1OX4A 1GOKA 1H5VA 3TCSA 2DSZA 5FA5A 2P3EA 1UWAA 1OB0A 2VCAA 4LRSA 2ZE0A 1ML1A 3KXQA 3DFNA 3ELFA 3CV2A 1DJHA 3CNYA 1ZBKA 4JKMA 1SQ7A 3KRSA 3JUGA 5CZTA 2ABAA 3QTGA 3CYVA 2DSVA 1BKSA 5I00A 1P6BA 2AMXA 3GDRA 4NYYA 2NV9A 1KLZA 3OOQA 1EP3A 1RVKA 1UMLA 3MT1A 1Q6LA 2IPGA 1HIZA 3NG3A 5RUBA 2J7CA 3B05A 3W1RA 4S2BA 2CERA 2V68A 5FJRA 3NEVA 4P7OA 5FJIA 2VUYA 1BRLA 5BRQA 3TW9A 1J6OA 4NI8A 5DY3A 2HNHA 5CPMA 4IH3A 2AGTA 4KBXA 2WLZA 4M7TA 4GI9A 2FJUB 4AZ6A 1IXOA 1ZP3A 3NL3A 4GJ1A 3LU2A 1LTDA 5IFPA 2QDEA 1OHLA 3VVGA 2GSHA 1R9ZA 2EKCA 4NQ1A 2X30A 4ZQNA 5GPRA 1J0JA 2G96A 4W85A 2G4JA 4QGCA 4BR1A 4HNCA 2ZXBA 4DWSC 2PDKA 3CL6A 3KTCA 3WNKA 1RPKA 4FX6M 1BG9A 2VP8A 4JTRA 2WANA 5HQMA 4GZ7A 3I7RA 4ZB0A 4M82A 5DXXA 5LHEA 1RCQA 1QAPA 2F2HA 4KFPA 3HQNA 2QPSA 2E28A 4OKDA 4JS3A 3NQ8A 5EFDA 3ABQA 1Q7MA 5REQB 3LNPA 3W37A 1M53A 4QQUA 1L6SA 2WCAA 1ADOA 1KV5A 4W9TA 5AC8A 3VCRA 1JZ2A 1XIGA 2J79A 2BB0A 2UBPC 5B7ZA 1CENA 3IGHX 3W2JA 4QISA 3SGGA 2ZCGA 3BSHA 5BYWA 2NX3A 1F05A 4GQBA 3KLKA 4E4PA 3MUAA 1W56A 4JCMA 6XIMA 1RCXB 4FP1A 1YW1A 1XFCA 3QGKC 2PU1A 4JN6A 3P62A 3R0UA 5AYZA 2Z25A 1E6QM 4F9DA 3L9CA 1EOMA 1IWAA 4Y9MA 3LRLA 1GVQA 4AF0B 1YE4A 3E6EA 1RQBA 4IFKB 1DQXA 1W2VA 4X9YA 5K4ZA 3AUOA 1ZB5A 4HQVA 3ZLGA 3LHYA 1VCFA 4YLWA 3WEZA 4AFYA 4MJ2A 1TCDA 1GOQA 4YVVA 2QULA 2IPJA 4ZZ9A 4O10A 4HK5A 1H7WA 2W5FA 1U1UA 3PZGA 2WVVA 2ZDRA 3S42A 5AVNA 4PFMA 4QROA 5HNNA 2OEKA 3ORWA 3QQ1A 2IKGA 1OQFA 1ENUA 4H9ZA 4N6EA 4DBWA 1YHTA 4ZFCA 4PN2A 3VD5A 2BNJA 4AIUA 1A49A 5CGMA 3ARZA 3SN4A 4F66A 2UZ9A 4NJGA 1HKMA 3OJGA 3GXNA 4QE1A 4YJ5A 3B0VC 5HUOA 1XRVA 4W4QA 2QLYA 5GVJA 4AHOA 1TIMA 4FXJA 2YBTA 4A35A 1FWEC 5I3KA 2D2JA 4GQRA 3LPPA 5LIUX 3VGHA 3RM4A 1HJWA 1EDQA 4CD5A 3KVLA 5H2ZA 1PDYA 5I07A 3TA9A 3VA8A 2YDRA 2B81A 3KOYA 1NARA 2BMBA 2R1LA 3STEA 1V51A 1ZS2A 1N82A 1TX2A 4U10A 3H22A 1H7OA 3RHGA 4ENLA 4A29A 1PKNA 4TMBA 3NQFA 1UD4A 2VRQA 3SQLA 4OFCA 1C8VA 3B40A 4I7UA 3W84A 3QR0A 4P61A 4PCNA 4AYGA 4DPQA 1DTUA 2WHLA 3QFEA 3FLUA 3M07A 3M44A 1KFWA 1RALA 3LBOA 4D6JA 4KMQA 1QUMA 1M01A 4C6EA 4UTLA 1HJUA 2VOTA 4B4HA 3IK2A 1Y5VA 2FLIA 3IK4A 4QR6A 3EOUA 1E1CB 1WZAA 5DXYA 3IV3A 5CBIA 4OUIA 4GNVA 3V7PA 1MFVA 3OLGA 4UTHA 3SADA 4YXGA 4HOZA 5F2LA 2HS6A 4JTFA 4EPEC 5H6HA 4DBEA 3DERA 3BAWA 4C6IA 1REQA 2QCLA 3FDKA 3UCDA 4US6A 4HCHA 4RZ5A 1OCQA 1VYSX 5DMLA 5FIPA 3N18A 1KBKA 1OINA 3QYSA 4GINA 5L9FA 2E4TA 1Q6DA 4RE2A 3W76A 3QV7A 3GXTA 4DQWA 5BXPA 2DZXA 1SZNA 2Q3RA 4XUYA 3UZXA 3M0HA 2QCNA 1IIGA 4NASA 3GUGA 2Z1XA 3CWNA 4LOCA 1E6RA 2ICSA 1B3YA 5CSRA 3DC0A 4HU3A 1UA3A 3S5SA 4XO7A 3AWOA 1FWFC 5H8UA 4K1WA 3I10A 2CETA 1MDLA 2P10A 3KEHA 5PTDA 1CYGA 5HBFA 2CHOA 3D46A 3FDGA 4NJIA 4PMOA 2Z2AA 2VZSA 3WBWA 4LS0A 8A3HA 5I06A 1RD6A 4E4FA 1Y7VA 4P8XA 1LORA 2PAJA 2CBVA 1H1NA 3ZT5A 1ZLPA 3QFWA 1S1PA 1VP5A 5D02A 3HIJA 2FZ9A 2D3LA 3AU2A 1HVQA 1W91A 2A7NA 4HT3A 1FXPA 4XIMA 3SM0A 5C9XA 4O57A 5C9RA 2BVDA 3W7CA 4Q7IA 1MRAA 4QHRA 2ISFA 4CNPA 2VX5A 4GUHA 4GWEA 3GC5A 1W3HA 4GY7A 1N7KA 4L6OA 4GXMA 3UWYA 4FA3A 1LLWA 1XLEA 3OU8A 4DNMA 4X2RA 1OF8A 2V9DA 3FX4A 1JRCA 5AHLA 5JXQA 4JQAA 3CB8A 2J88A 4E38A 4KRUA 5CGQA 3CTLA 2W4XA 2JKAA 4HPHA 5KETA 1FY6A 1TVLA 3N4AA 3FYOA 3TYCA 4ZXLA 1ME9A 3O1NA 3IJIA 3UCQA 2FFIA 1XIJA 1NFGA 1OX4B 5LNVA 2AAAA 1XLMA 4FXRA 2ZE3A 3NXFA 4LAKA 3DKJA 3UQNA 1GOMA 2DZPA 3S5ZA 1E51A 1ZU8A 5LZLA 4LYPA 1NP0A 4UR7A 4Q6JA 4ACYA 3WLQA 2ZVRA 3T0CA 4H41A 3NSXA 4IIDA 2NZLA 4ONVA 2Y2WA 3CUXA 1J6PA 1EZWA 4IUGA 3WNOA 3KX6A 3WQPA 1E1FA 4TXEA 3EKGA 2OLSA 1M7XA 4OV4A 4WZHA 2X7VA 4K37A 4X3ZA 1K1DA 3C86A 2DUAA 1X97A 2WJZA 4LWWA 2OB3A 1OX5A 2J47A 4Q32A 1PYFA 1NF0A 3PZTA 5BROA 3HM7A 3FA5A 2E9MA 5LXEA 2BX7A 1DXEA 1EEPA 1EOKA 2PCEA 3IIZA 4X0NA 4A3YA 1RPXA 2RH9A 4RDWA 4RNIA 4I5UA 1BRLB 2C3ZA 3FSUA 3IVUA 3LY0A 2OO0A 2C8NA 1KR1A 4NXSA 2OGYA 1QATA 3KBSA 1V7AA 1C91A 2YJQA 5BMWA 5CBBA 3MJMA 4MJMA 1DIOA 3PSVA 3HMJG 3PBMA 3IS4A 5CSUA 2CC0A 3W1PA 5A95A 4WQ6A 5CKSA 1FWBC 3ZMRA 1AD4A 1DJGA 1KCLA 3UEQA 1IEVA 3U0HA 3W2KA 2G3JA 2V3GA 3EMCA 1HG3A 2O0TA 4IXHA 4AZ5A 2NXHA 4BEQA 1C9WA 1KO0A 3EX4A 2FVKA 4L9YA 1UUQA 3AZRA 2P3ZA 3B04A 4HA4A 1VCVA 1X6LA 3MV01 2VTFA 4XZHA 3PZUA 3A64A 4UQBA 4MB5A 5IOBA 2OEMA 1W5NA 4JY8A 2WC7A 2VYOA 1CLXA 1H41A 2ZTKA 3V0TA 1JGMA 1QNPA 2QW5A 4NZ5A 3VC6A 1V3MA 1GVEA 1LDCA 5HWMA 1UJQA 1KKOA 3PC0A 4XAGA 3C2OA 3SY1A 1EF2A 1KM5A 5G1TA 3KCJA 5LA0A 1TMHA 1DXFA 3BLDA 4Z2HA 1ADDA 3C0SA 4ZCWA 3M9YA 1H3GA 1XF0A 4K36A 5ABFA 2EJ1A 3CHDA 1LJYA 4AAJA 4JNMA 1GOOA 4W5ZA 4IIFA 1G94A 1S1RA 3RM9A 4HSHA 4PC8A 4HOXA 1QTWA 2VRKA 4CQAA 4IUOA 1LBMA 3DFPA 3LCXA 3LM7A 2ZUVA 3CIWA 4CD8A 2WVVB 3U7VA 3GXFA 2PDCA 2VD9A 2YBUA 1Z42A 4CNSA 4HU8A 4YCPA 3DZ1A 4TMCA 5M5DA 1KGXA 4J28A 3P74A 4XISA 2UY2A 5C55A 2NV2A 5D9NA 2OZ0A 2WHJA 1F6YA 3Q65A 3IIPA 2HVMA 2OU4A 1GGOA 1Z6KA 2RJHA 1E73M 1XH2A 2Q09A 2OPJA 4IPLA 3TNBA 2VCBA 5FEXA 2PI6A 1RA5A 4WF7A 1XM3A 4Q7BA 3WUEA 4EPBC 3M0IA 1FWAC 5MF5A 4JCLA 3OTRA 3MCNA 5TNVA 4R88A 2ZYFA 2F84A 4L4MA 3GIYA 4AXNA 4FR1A 3EWYA 1JAKA 1QR7A 2ZRUA 1Z48A 1A0CA 3AS0A 4GY1A 1UKQA 2CZVA 4Y9OA 3GR4A 3GXDA 1GYLA 1EZ2A 2ZXAA 5A8MA 2PGWA 4FIRA 3M6DA 2G37A 2KZHA 3ES8A 4JYEA 4JDYA 2E1WA 1FH8A 9CGTA 1E6NA 4GVFA 1KFCA 4M8UA 3TYEA 1RQEA 5T9CE 3ZZ1A 1Q6QA 3TONA 1B4KA 3CIXA 3MC5A 1WOAA 1B3WA 2GK1A 3UXLA 4PRWA 2J7DA 3DCPA 2VQTA 3G8EA 4N7QA 3NZQA 2VDHA 3S2MA 3LBCA 3LMYA 3LXCA 4GY0A 1QK2A 1TWIA 1AJ0A 1H2JA 1MNZA 2NX1A 4HKPA 3UR5A 4CN1A 3I3BA 3GQYA 2RDWA 2PRMA 4ZO8A 2PTZA 3F4WA 1TWSA 3W28A 1V3IA 2CLHA 1EEXA 3VOIA 2DZWA 1W1ZA 3C52A 1YNQA 3N9RA 1BKHA 3SCWA 2YCJA 5H1WA 2G41A 3WQ6A 1R8LA 3W86A 3T8LA 3WQ8A 4XZWA 1W1PA 3Q45A 5F2GA 3W4RA 1DJZA 3R12A 1DJYA 3MV11 3TC6A 2B7QA 3UA4A 4FLQA 4S3AA 4RW3A 3VNLA 3ARXA 4B90A 3EX2A 3W7IA 4NHVA 2EPNA 4K8EA 3FAWA 3M41A 3W7PA 4IX2A 2PWFA 2XN1A 3S9IA 3AHZA 1JD9A 3MWAA 1SGJA 1YTKA 2A3EA 3HG3A 2QCGA 1VF8A 1K9TA 4J35A 1UR2A 5JBEA 1UR9A 3OW1A 4LUTB 1GOWA 5FSDC 2HS8A 4JFUA 4BQ4A 1HX0A 1BPLB 2WZMA 4G5DA 5LGZA 2BZNA 3IVSA 2A7PA 3DBPA 4J27A 3TK7A 4GVHA 4IHCA 2J27A 4ADTA 1PL9A 4I6VA 1L9WA 2OWCA 2HXTA 3QYQA 2BODX 3PAJA 3PZNA 1KB3A 2WMIA 2PDQA 1WOBA 1W3LA 2G3NA 3CQKA 3LCWA 3G0XA 3B8DA 5DY2A 1CGYA 3WELA 4GZIA 4EXAA 4Q33A 2YDAA 1NVMA 1YXYA 4PTVA 3G77A 4EACA 2E9BA 3CT7A 3BAIA 1KM0A 2Y89A 2IPWA 4PTDA 1LLZA 2DFAA 5AKQA 1IWBA 3WF1A 5D32A 3POCA 4LFYA 2Z1BA 2KX9A 3REQA 3TR2A 1TCMA 4JFTA 5DX7A 1J9YA 1XSJA 4X0VA 1XDLA 3R2GA 4AHQA 1U2YA 1WKEA 3W82A 1F07A 3WCZA 4PL2A 3RLHA 2CLEA 3IAPA 4ZO9A 4MY1A 3VOJA 2OSWA 4US5A 3LEPA 3PBYA 2Y5SA 1WV2A 3EWWA 4AUBA 3QV6A 1JXJA 2YX0A 2VWSA 4R27A 1SZRA 2YA1A 3GWQA 1Q2RA 1FCBA 1ZGDA 1GJWA 3GC4A 2OLAA 3PFMA 2VCCA 1UR8A 3H4XA 3GTFA 4C91A 1V6VA 3UG5A 3EXTA 3ITYA 3KLLA 2OYKA 2VL4A 4YWSA 3QR3A 3OZMA 3UA3A 2VUNA 2ZDSA 2DUXA 4IQDA 3WQGA 1TMQA 1UWIA 1MUMA 4ZE5A 4L7ZA 1PO9A 4HK6A 2W63A 3LTSA 3JW7A 2FVLA 3WMCA 4QAIA 2E25A 2WBGA 3A9BA 4GIRA 1Q6CA 4XSLA 1VC4A 4IG2A 4BS0A 3OA5A 4E2DA 3T1GA 3E0VA 5G2WA 2HRWA 5BOOA 4PUMA 2G3IA 3PY2A 4ZODA 3CU2A 3L5AA 1XXXA 3OZYA 4NVTA 1QPOA 4JIHA 3PJXA 3BJSA 1Y8BA 4G7FA 4NZ3A 5D9MA 2YCLB 3RK8A 2BVTA 3BWWA 3M0VA 1JULA 2IQ0A 1SFTA 4GPNA 1XYMA 3VIJA 2OWWA 1Q45A 3GHSA 1NSJA 3JZEA 1ZENA 4MY8A 5LIXX 5H8MA 1TB3A 1K77A 1P6CA 4XBJA 3C6CA 3CHFA 3EB4A 4GYFA 3LUTA 3BAKA 3RGTA 4D8ZA 1VLIA 2QDHA 1NELA 5FESA 3UZJA 4K68A 3W23A 3N17A 3ABXA 1NP2A 3FXYA 5ABFB 3C2YA 1I1XA 1FFQA 5IBXA 3SIZA 5LXXA 3MI3A 4AD0A 3FOKA 1QPKA 3PZMA 2VEFA 3LB0A 3P60A 3F4VA 1S39A 4JIRA 3QZAA 1XGZA 2WJFA 1YDVA 4BQ5A 3BO9A 1H7RA 2WJDA 3VC5A 1XQKA 1QNQA 4NKCA 3W1QA 1PEZA 4PCPA 6REQA 4Q4OA 1E9ZB 3BGGA 4WY0A 3IRDA 3WY1A 3BZGA 1BYDA 3HN3A 4MUPA 5DMYA 3VK5A 2W62A 4Q22A 5D2YA 1P0KA 4ZMGA 4MJ4A 3AXXA 4RZBA 4B16A 2J74A 3LSCA 1UIOA 2A4AA 2QNEA 5AHFA 3T4CA 3L4VA 3NUKA 2DORA 4R9OA 5D30A 2AQWA 3O2LA 3OP2A 3DECA 3AAMA 4AY7A 4JL2A 1XGEA 1LQAA 4ERAA 2BVWA 5A94A 4CGTA 5K9CA 1S2AA 1NQ6A 4YTQA 4ORMA 4Y90A 2PBOA 1NJJA 2X2GA 3APTA 1EP2A 1DHPA 5J8LA 3GW3A 3NZRA 4ZOBA 3ALFA 1J2WA 1J8VA 4JR5A 3VMPA 4I7VA 6TIMA 2WCSA 4GCXA 3L4UA 2J24A 4IF2A 1LOLA 4IMGA 1RBLA 4LRTA 3SEPA 3TX9A 3SBFA 3H4WA 3L4TA 5C6MA 3VD9A 4A3QA 4NX5A 4GZEA 1ZFJA 4LS1A 1ECEA 4JTQA 4G9PA 3R79A 1OZMA 3WMBA 4I9MA 3O9NA 3M47A 2WQDA 1DP0A 2Y8KA 1V03A 2CIPA 3O63A 1XCFA 4CEUC 4U4MA 3RN6A 1YRRA 3ZIZA 4AD1A 1XUUA 3SCOA 2WSPA 4LSBA 1K7XA 3W9ZA 5I77A 4M1BA 2QCFA 4ZOEA 3AO0A 1UKPA 2WBKA 2GVEA 4NZFA 3N15A 3WDIA 4AY8A 2Y5JA 1IR1A 4DM1A 4GBUA 5TIMA 5IXEA 3DYPA 4LCSA 3UFYA 1TE6A 2E5BA 3CAKA 5FJTA 4MKSA 1YTEA 4LW7A 1ZY9A 1MWOA 1MFUA 1NOWA 4N9EA 4HNUA 3U5YA 1R3TA 4RJEA 5I6SA 1QNVA 3WIJA 4B5NA 3MY9A 1WB0A 1GHSA 1M65A 3C2VA 1NF7A 3A13A 4UFKA 1H5YA 2V81A 3CUHA 1R85A 2ACSA 4NF7A 3S1VA 2FZNA 3BCFA 1ODZA 3U7BA 5IDIA 3ABZA 4I9AA 4A6GA 3VNIA 3K4AA 3NQGA 3UYIA 1JDEA 2JEQA 2WAGA 1CEOA 2NT1A 2I5IA 3N2TA 5EY5A 4PSPA 1R3YA 5IBXC 3R8RA 3OHMB 5GNZA 3SI9A 3PJWA 1I2PA 2NLYA 4H2CA 3UU0A 3LNMA 3W1LA 4GOAA 1LYXA 1QBAA 4HPGA 1VYPX 3VDHA 1EA9C 1GEQA 2TAAA 3LERA 2XGBA 5BU9A 4EPKA 5I79A 1PTAA 3B4YA 3USBA 2GDUA 1TR1A 4H1ZA 4X9SA 3K30A 3TTQA 3R5EA 3GHRA 2QV4A 4DWSD 1ISYA 4OE7A 1E40A 1UKOA 1BGAA 4AW7A 3SZ8A 1K8XA 2W92A 3BV7A 2ZUNA 4TV6A 1R46A 1TZ7A 1WPCA 1EJWC 2V2DA 4FX7A 4S38A 1OT2A 1XLBA 2XHYA 3QRHA 3OVPA 2PU0A 3N2XA 1WDRA 3SSZA 1WKYA 4O50A 3BW2A 2FZDA 4KERA 4CKQA 5A1AA 1ISVA 4I90A 1E55A 1VIZA 4IWWA 1WBHA 4AZHA 1W37A 1JCYA 3VKJA 4CQ9A 1KQYA 2QGYA 5CZJA 1Q65A 4LUJA 1Q6EA 3L0KA 2Y8UA 4ZBCA 3REQB 1XS2A 1NEYA 4C6OA 4QIUA 3MUXA 1FVPA 2DVUA 3HV9A 1CXHA 3ENLA 3AICA 2DVTA 1FWTA 4I5RA 4QE4A 2V69A 3GX9A 3WH5A 1V6YA 3KHJA 4R7JA 1QDSA 5A6AA 3GE7A 1XKYA 2WCGA 2AKMA 1UD8A 2J66A 2YLAA 1UP3A 2RGMA 3U2OA 3WF2A 4QX4A 3ECQA 1SYTA 1OD0A 4RPQA 4UQDA 1E0XA 4JTCA 1IGSA 3G1YA 4FS9A 4XTDA 2FHFA 4EKJA 4GZJA 1F3XA 3EWDA 3M16A 3F5KA 3QKZA 3VGFA 3OLDA 1S5VA 3M0LA 3GXPA 1W1VA 2O55A 1MXSA 4NYUA 3CQ0A 2YCIX 5DQPA 1KXTA 2B0MA 1EC7A 2CHRA 3GVGA 3OA3A 4QLLA 2Y7DA 3G18A 1W2PA 1PTGA 1EO7A 4H8HA 3TYAA 3QEZA 3KVJA 4GABA 2PWUA 4DELA 4G1NA 4GXWA 3NYZA 4L6HA 1D3HA 3MUZ1 4FO4A 5HATA 1MW2A 4M6VA 5BOFA 1KC7A 3WQ5A 1TWZA 4F4RA 1PHWA 4PRRA 5CJMA 2Z7GA 3BCJA 4F0SA 1P4CA 4LVFA 1QCWA 1KBBA 1Q8AA 1SZGA 1E56A 3C8FA 3C3UA 3CGTA 3WFZA 4CUCA 4IPJA 1HQTA 3VPLA 3W1XA 1UOKA 4GYKA 4QP0A 3T4WA 3GTNA 4PB4A 3LRMA 1US2A 1KM6A 2XH4A 4KWWA 5EBUA 3W7EA 1L6YA 1LWJA 1H62A 4IIHA 4F2TA 2CNCA 3CO8A 2C1GA 4GUIA 1JZ6A 1HKJA 3EPNA 3BANA 5EPDA 3RUBL 3UJEA 3DDMA 3NNTA 1VBUA 4LUYA 5AECA 1Z69A 3E96A 1VJZA 1EUAA 3S46A 3WD1A 4HPXA 1XLIA 1NDZA 2G0WA 8CGTA 1W9VA 3LGEA 3LQGA 3OIHA 4Z0JA 2P1FA 1XCWA 4A05A 3W1MA 1HKKA 1PX3A 2MUCA 4LBRA 3WK1A 2QCEA 4L1GA 1B5TA 3GKAA 4IL2A 4RV8A 4AC7C 3CPUA 2XIOA 4KGLA 3GIPA 3V1HA 3BCDA 4JTSA 3ZFHA 4RKAA 1OZQA 4XD5A 5DCDA 2ON3A 5CC6A 4H4IA 1FWJC 4MYXA 3ARWA 3PPGA 2OXNA 3CQHA