2J9YA

Tryptophan synthase q114n mutant in complex with compound ii
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
266
structure length
251
Chain Sequence
ERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLSHHLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKIIEKNLASPKQMLAELRSFVSAMKAASR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Betaq114N and Betat110V Mutations Reveal a Critically Important Role of the Substrate Alpha-Carboxylate Site in the Reaction Specificity of Tryptophan Synthase.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Lyase
molecule keywords TRYPTOPHAN SYNTHASE ALPHA CHAIN
total genus 92
structure length 251
sequence length 266
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 2006-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2j9yA00
1P0NA 1V7YA 2YX0A 3BV4A 3E9AA 5HMSA 3QSRA 3G1VA 3M6YA 4EWND 1WV2A 3OVPA 4CQ8A 1K03A 2CLEA 4H3DA 3WK3A 3SFKA 5AC8A 2NXIA 3EXTA 4K38A 3NQDA 4RLIA 1IXQA 2ZCGA 2Y89A 1ZAHA 1F05A 1GVQA 3L21A 1TJRA 5J5DA 1CX9A 5CZ0A 5AB3A 5G1TA 3T78A 2FB2A 4JTGA 1KM2A 3PBVA 2HSAA 5L9FA 4O12A 1LM1A 4DPPA 4D2JA 1T99A 4NT0A 3W7IA 1KLZA 4RR4A 4UTTA 1TTIA 4UR7A 3HPXA 3N2XA 1PE1A 5FF2A 3DFTA 1BEUA 1OFQA 3MUXA 1WOBA 1RPXA 3W72A 3H54A 3P84A 4N9DA 2VFHA 3CPRA 4LU0A 5GVJA 2RFGA 1Y0EA 3RNDA 1K7EA 3TV8A 3WJSA 5D32A 2FTPA 4EF9A 1XUUA 2C13A 1BTMA 5AHLA 1ICPA 1AW5A 2PRLA 4XBKA 4Y90A 1K8ZA 3BVJA 3DENA 3P8IA 3S5NA 1KTNA 1TPVA 4Y96A 1QNVA 2KZHA 1C29A 3TCEA 2H3DA 3TE9A 1MSSA 2E5DA 3E12A 4M6VA 2CZFA 4NXSA 5I3GA 3M0ZA 3NQAA 2QCCA 4UMCA 4HNTA 3P80A 6TIMA 3UZJA 3SGUA 1RQEA 4P2VA 5E93A 4JS3A 2C15A 3CEPA 1TYGA 2FFCA 2TPSA 3MHFA 3NPUA 5K9XA 3NPWA 4WOQA 4IMCA 1BWLA 2QJGA 3TJLA 3IIZA 3THQA 1LBFA 2QEZA 3FA5A 4NJGA 2R14A 2BZNA 4UC5A 4A2RA 5EBUA 4LW7A 4CQAA 3EX6A 5LGZA 4DO6A 1OX4A 1XBYA 2P1FA 4M6PA 5SWUA 3CM4A 2G95A 2NV1A 4FNPA 4YLWA 2WNZA 3EWZA 3HMJG 1P0KA 3W86A 1QMLA 2RDWA 2XN1A 4XTIA 3L0GA 1I2QA 1OX5A 2DJXA 4DPQA 1O95A 2DZWA 5AHEA 3VNDA 5KTLA 4O50A 3PUDA 3B0UX 3UY7A 4K7VA 1LTDA 2JKPA 2BXVA 4FNQA 2QCMA 4UR8A 3ABSA 3C61A 2ZTJA 4IX2A 3DAQA 1KFEA 3SJ3A 5KZDA 5C54A 1ZAJA 4PEKA 1H50A 5D03A 4LUJA 2TSYA 2OJPA 1OHLA 1EWDA 4IMFA 3LV6A 2G97A 5FI8A 3L66A 1GT8A 1P1XA 3W7MA 1R2RA 4PFMA 4X2RA 2V2DA 5CZSA 3PUEA 4KFNA 5DELA 3IGSA 1AW2A 1H7PA 3QMRA 1JCYA 3O6YX 3TMLA 3UWUA 1GVFA 2ZRUA 3N3MA 3M5VA 1AG1O 4LNYA 4AB4A 3KX6A 4MZYA 3L67A 4HIBA 4HNNA 2ZFAA 3PG8A 3G3MA 1YDVA 1DBTA 5DCBA 1UJPA 1N7KA 2X1RA 3VKJA 3W7EA 2GUUA 4HNVA 4WQ6A 1Z41A 3O16A 4N6EA 1OX4B 3G1HA 5AC7A 3SGZA 1QO5A 3CIWA 3FKKA 3UWVA 3C2OA 1I4NA 2YDAA 5FF3A 2QF7A 4EF8A 2Y70A 3BG9A 3A24A 2AQWA 4UFHA 1JQXA 3TU9A 3THAA 2W6RA 1K3UA 3S1VA 3N19B 4E38A 4M7SA 5U4NA 1DL3A 3S5YA 1TTPA 4WJEA 4ZQOA 5A5WA 2C1HA 1XKYA 4ADSA 4UFKA 2BLEA 2A5HA 1ICQA 2YPIA 4GBUA 3GZ3A 4ZQMA 4O18A 2A2IA 4TU1A 1EIXA 1EUAA 3N73A 2J24A 3W7NA 3UD6A 4O1CA 3G3DA 3HG5A 1Q6RA 2GJLA 3DBPA 3GNNA 3NM1A 5HULA 3IVSA 3L0KA 3S5OA 1SQ7A 3P74A 2J6XA 1JCJA 3MP3A 4K8HA 2ZA3A 3LBCA 1TPH1 1XI3A 2ISSA 2X1TA 1F73A 5FEZA 2YZRA 1H1ZA 2R91A 1KV8A 3EX2A 5AHNA 4LWWA 3IGXA 4PL2A 1A53A 4MFEA 2JKEA 5TBOA 2NXGA 4AAJA 1L6YA 2ATMA 5G5IA 5G1YA 2JKAA 1XC4A 4FX6M 1YTEA 4HKPA 5TQLA 3P61A 5H91A 4N9EA 4FXRA 3O6CA 2CU0A 1G4EA 5CSSA 3TUUA 1JUEA 1JCNA 3UPBA 3M16A 2ZZ7A 1QPNA 2NWSA 1OF6A 3R2GA 4M6QA 3PSWA 4MZ1A 5F4SA 2Y62A 3IVUA 3C2VA 3AO0A 5F2LA 1QOQA 3LHYA 2ZDRA 3NNTA 1MEHA 3NR0A 1OFAA 3NGJA 3P60A 5D2VA 3STCA 2ZRZA 2YGYA 3C2RA 3QMSA 3T44A 1OFRA 5D02A 5BW6A 2YSWA 3S42A 2BWGA 1LLZA 2A0NA 2FPYA 4I7WA 1Q45A 1VR6A 5U7SA 3W2JA 1FDYA 5KZMA 4NU7A 4Z1BA 3PBYA 1I2RA 4BWLC 2QJHA 3OVRA 1VRDA 4UTIA 4BF9A 1TIMA 4O1AA 2WSYA 3DKLA 3B4UA 1H51A 4KKXA 2ZA2A 4XTDA 4RV8A 1ONRA 1DOSA 5AFDA 3E49A 4QISA 5D30A 2H8ZA 4OV9A 1RV8A 1K7XA 3DHFA 4UXDA 3G24A 1J5TA 3BLIA 1S3HA 3KAOA 4O14A 3SI9A 2E6DA 4MLJA 3MYPA 3U6WA 1W5NA 4XQ6A 3CHVA 1SZEA 3LCIA 2EAWA 1H1YA 4PL1A 3W1UA 4JX6A 2RKXA 3GDKA 3MYOA 2E5CA 3BW4A 3LTSA 4O52A 4BI5A 1YLVA 1I2PA 3L0NA 3N9RA 3NOEA 3KRSA 4ZQPA 5LNRA 3SY5A 4BWLA 3QFEA 3LBMA 4AHPA 3JS3A 1YPFA 3LTYA 4S1FA 1KM3A 1NSJA 1W8SA 2X30A 5AYYA 4RXGA 2OMAA 1Q6QA 4Z08A 4UTKA 5E0KA 1OFEA 2OT1A 1OYBA 1ADOA 4MPQA 5ABTA 2YW4A 3TA6A 3CIXA 4EVZA 5KZEA 5BMWA 1F76A 5LGXA 4UUIA 3NQ2A 4IPIA 4UTWC 1EWEA 3T55A 5K9CA 3MI6A 5DY2A 3F4WA 3TH6A 2DU2A 3W7JA 1TRIA 4JDYA 1GVOA 3P67A 2CLKA 5HR6A 4JY8A 4A2SA 3GKFA 3A5VA 4UTUA 3W7RA 3NVTA 4LVAA 4RXFA 2RDTA 1XBXA 3NQVA 4JTSA 3KXQA 3S5ZA 2NV2A 4CLMA 3WJXA 3LCHA 1VYPX 2G96A 3H53A 4ZL1A 3GXPA 5CGQA 4HSNA 4KWWA 2CZDA 2VKZG 2B7NA 2X16A 1QPOA 2A6NA 3HG3A 4TMBA 1GJPA 3I7RA 4WUIA 5EY5A 3L68A 1ZJIA 4BK9A 2A7PA 4AF0A 3W6YA 4OT7A 1WQ5A 2CZEA 1FWRA 3BG3A 3NYZA 3NZ1A 1M7PA 2NX3A 1H63A 2ZQ0A 4X9SA 1E51A 3IIXA 5KINA 1L9WA 2IQTA 4QNWA 2ZZ1A 2DZUA 3TC6A 1TPUA 4DBDA 5K4XA 1WYIA 1SPQA 2VEMA 2QAFA 5LHEA 3YPIA 2Y85A 1SU5A 1XBZA 3NM3A 3L5AA 4YL2A 5G2HA 4LUIA 3G8RA 4HSOA 2F84A 4MOZA 5HNRA 5D38A 1R30A 2VELA 1NVMA 2ISWA 2GQAA 3NQEA 5HWMA 2JGQA 4NJHA 1UASA 1AMKA 3MHUA 3ZS4A 1QOPA 6ALDA 1G6CA 4FEZA 2EF9A 4HNUA 1BKSA 1B3OA 4ZZ9A 2V2CA 3EX1A 1KW1A 3ZWTA 2QCEA 3MBDA 1T0OA 3HJZA 2QR6A 3W1QA 1SW0A 1FUYA 1PCWA 1KM5A 3QW3A 4WXZA 1H7RA 4R53A 1QCWA 3UXDA 1VS1A 3R12A 3MI3A 3C0JA 2WO5A 5D37A 4ADUA 3DZ1A 4NXKA 4FIRA 4WX2A 1HL2A 1MEWA 4I7UA 1YXDA 4IWWA 2Q3RA 4N9CA 1IXNA 1ME7A 1KV5A 1W3TA 3W88A 4LV9A 1GTEA 3DKJA 1PHWA 3LCFA 1PS9A 4YWIA 3TJXA 3A21A 2NUXA 3KVJA 2VXNA 3F1QA 5LZLA 4FNRA 1W54A 1VGAA 3CQ0A 3ZFHA 4JTJA 3I7SA 4U28A 2RHGA 4X3ZA 1W5QA 3TMQA 1JRCA 1GG1A 4A21A 4O0ZA 3GDTA 1WA3A 3W2LA 2ZRVA 4H6KA 3LB0A 1DVJA 3BGJA 1QWGA 1B9BA 4CQ9A 4UNLA 1G69A 2A7NA 4JGDA 3NO5A 5K2ZA 2X1SA 1MZHA 3LCGA 3WK2A 3W74A 4XWUA 4HT3A 2P10A 3F4NA 4MUZA 4PODA 2VFGA 4IXHA 1SSDA 3LLFA 1F5ZA 4QITA 4JTIA 2XN0A 4IPJA 3PG9A 4CCDA 1YADA 1XUZA 5G4WA 4LVDA 5DN1A 3DGRA 4UFJA 4MKNA 4ZVJA 5DXYA 3HG4A 3GNDA 1K8XA 2QCDB 4LOCA 3G8EA 3W1TA 1AW1A 3A5FA 1VPXA 4JIQA 3RK8A 1H5YA 2E6YA 3O8AA 2CLHA 3OEXA 3MBFA 3BW2A 4Y9AA 4O11A 2ABAA 4OGZA 1X8FA 3LGEA 1IIHA 3NQMA 3E0IA 3VI2A 3R13A 1QPQA 1QDSA 2JBMA 3KRZA 3TQ0A 2DORA 4WY0A 4QNEA 1LRTA 1S5WA 2V2HA 4H4IA 2E6AA 3P82A 2QCLA 1QAPA 3M43A 3G1DA 4ZQRA 3LTPA 4AHOA 2VFDA 3PULA 3LXCA 1JR1A 1J2WA 2JGYA 3M1ZA 3TXVA 2QCHA 2VEIA 4NNBA 3GAKA 5F1UA 4O15A 4N2YA 4RK8A 1FQ0A 3LRMA 4LT9A 4JTHA 1X1OA 4O17A 5AYZA 3B0VC 3KVLA 1G7UA 5IBXA 3QM3A 5D2YA 2NX1A 3LXBA 1W3IA 4UFMA 3EKZA 3G22A 4TIMA 3W2MA 1QR7A 1FX6A 5AHIA 2WQPA 4P61A 3TIMA 1TTJA 4IMEA 5FESA 3KRUA 1A5AA 3G1SA 4LVGA 1U83A 2VFIA 3O06A 3W7QA 1G7VA 2I9EA 1TMHA 3PVFA 3WJWA 4XKYB 5HWNA 2DZSA 1RD5A 1LOSA 2VFEA 3I6RA 1KFLA 1GYLA 1HO1A 1VZWA 3WK0A 3VFLA 2EGZA 2QUVA 4LVBA 3G0UA 2YW3A 1HFBA 1H62A 1OYCA 4O54A 5CPLA 1S5TA 2J9XA 1W5PA 3GDRA 5D09A 3RMJA 5H2ZA 3MP5A 5LHFA 4WY0F 5AN7A 2NZLA 3NL5A 1IIGA 4ORMA 1W37A 4LVFA 2NX9A 2B0MA 2PCQA 2G5WA 2QJIA 3RLVA 5DCEA 1PIIA 1TREA 1OK4A 4LRTA 3IGUA 4KFPA 1SO3A 2CFFA 1Q6OA 3W7GA 5I3KA 1H7NA 1EPXA 1RQHA 3TDFA 3STEA 5K9DA 1TPEA 2TMDA 1O5KA 1ZENA 4TMCA 1JJKA 3GIYA 1YYAA 3W85A 2W79A 1VLWA 3QYQA 1ML1A 3FS2A 3S8HA 3W1PA 3RLUA 3LRKA 1KFKA 1JCLA 2Y7DA 3GX9A 1XBVA 1XFBA 4AVFA 4GUIA 5F1VA 5CKSA 4FIQA 1WXJA 3BK0A 1R46A 4QSHA 2Y61A 1TPFA 4MLRA 5IM51 4IUOA 3KVMA 2HMCA 4AHQA 3FYPA 3R5EA 3FEMA 5CG7A 2Y6ZA 3S6DA 1W3NA 1FXQA 3LERA 4EIVA 5BNKA 2LLEA 3EWBX 4N4QA 3ZWSA 5EL1A 2YFOA 1W31A 3OG3A 3QQ1A 3W76A 1PL9A 2PC4A 4NJKA 4UMAA 3CEUA 3NDOA 3LHZA 2YYUA 3T7VA 3HGRA 1QFEA 4YCPA 3QQ0A 4YXGA 1DV7A 1GZGA 2Y63A 4E0CA 3STFA 1KTBA 4QQ3A 3STGA 1J4EA 3M5XA 4Z1DA 4L4MA 4O1BA 1JVNA 2CW6A 3A9IA 2NUWA 4MVAA 4UTTC 3W7DA 3M5YA 1FWTA 2WNNA 1Z44A 1YTKA 1FWSA 4ZMGA 2E09A 3IVTA 1OVDA 3I65A 4PCFA 2J27A 4M19A 2GVLA 3B06A 3QMTA 5E1QA 4UTWA 4MFDA 1IF2A 1GG0A 2FB3A 3IRDA 3PUOA 2R94A 3CWOX 3LHTA 3RU6A 3W9ZA 5IBXC 2QCNA 1GWJA 5G2IA 1SO5A 4UTJA 3ABQA 3UNDA 1PCKA 4Z0JA 4ICNA 2DP3A 1KTCA 3NQGA 5CSRA 1SZFA 4DF1A 2HS8A 3DHDA 4NZJA 3QC3A 3V1PA 1JCXA 4UTHA 3W1LA 3DFOA 4FB7A 4GUGA 2H6RA 2BSLA 3W84A 3NQCA 4XZ9A 3BPWA 1FWWA 2PRHA 3C2FA 3WK1A 1O94A 4NJIA 4BR1A 1W56A 3PAJA 3HIJA 5FEWA 3HBLA 4O16A 5FF0A 2HS6A 4POCA 5C6MA 4RZ6A 4IGHA 2Z6IA 4K8EA 3NQ6A 2D73A 1W1ZA 3NQFA 5F2IA 1Z48A 1DKWA 3C56A 3R8RA 3OIXA 4Q33A 3UWWA 4GUJA 1K8YA 2AAMA 3LRLA 4N9BA 1TPB1 3G1AA 1PHQA 1FDJA 1D3HA 1FDZA 3OVQA 4MJZA 3PM6A 3VCRA 2FJKA 2ALDA 1C8VA 4HPJA 1WBHA 3EWWA 4DF2A 4UTMA 1ZFJA 7TIMA 2YCEA 2C0AA 2DZVA 4OU1A 3PWAA 1ALDA 2B7QA 4JYDA 4K6AA 4K7YA 2B7PA 4A3UA 5I3IA 3LHVA 1VHCA 5MHBA 1OFBA 3GKAA 4ORIA 1CW2A 1WBJA 3LCWA 3P5ZA 3W7LA 4RZ4A 1EA0A 1F74A 3NA8A 1TV8A 3PC0A 4YMZA 2GQ8A 4DF0A 4LTSA 2CLFA 4AH7A 3L5LA 1G4TA 3UYCA 3SR7A 3FJLA 4FO4A 4S2CA 2PRMA 1O60A 4NX0A 1SZGA 1X6UA 3HGOA 1EP2A 3TK7A 4L4LA 3LXAA 5LNSA 3B03A 1K7FA 2Y7EA 3CU2A 1EX5A 4E2BA 3O6DA 4UNKA 3P62A 5T26A 1ZY9A 4O0KA 1LBMA 4BFAA 1EP1A 3TW6A 1X1ZA 5DLCA 3ABRA 4PA8A 1PV8A 2GPTA 1A5SA 1O4UA 4IOTA 5D33A 4JTEA 1N55A 1TQXA 1EB3A 3KHJA 2PE4A 3P81A 3ANYA 4MY8A 3GAYA 3BGGA 2V8ZA 3UZ5A 5DY3A 3QPZA 1H60A 3G0XA 4WD0A 1GOXA 3BLEA 1M7OA 3UQNA 3U2OA 3HGJA 3MMTA 1VC4A 3DH7A 2CLIA 4JX5A 1KA9F 2AGKA 1I8JA 2QCFA 3KOFA 3LI0A 3M41A 1VJIA 3PR2A 3QRHA 4ADTA 2NUYA 5F2GA 4NNAA 4C1KA 4WXYA 1OX6A 3EX4A 1NEYA 1KBIA 5HINA 1YXCA 4K36A 4M5PA 1TQJA 5FEXA 3EXRA 4FHAA 1YDOA 4IQLA 2OX1A 2X2GA 1UUMA 3NXFA 5KSWA 1KM0A 3VE9A 1OK6A 1XDLA 5I3JA 2C19A 2J9ZA 2R8WA 3GYEA 4MYXA 1LCOA 2A1YA 4FNSA 4I9AA 2Y88A 2Z0IA 4AF0B 3TNOA 3UWZA 1R2TA 3UWQA 1F6KA 1LROA 3UY8A 3W83A 3S1UA 3W75A 3G1FA 3HO8A 2DZTA 3N9SA 3NPVA 2A7RA 3ELFA 1OYAA 2NWRA 5FF7A 5K3VA 4PH6A 3L65A 2CZ5A 3L2IA 4TR9A 1G67A 1TPC1 3C4UA 1VCGA 2O7QA 3LOTA 2A6LA 5DBUA 4JYFA 4JICA 3DFPA 4FXSA 2I1OA 1SW7A 2C3ZA 3MO7A 4OWGA 5AYXA 3MW7A 4FX8A 2HTMA 3SW6A 1BWKA 1EEPA 1DORA 5K4ZA 1KFJA 2CLOA 1ME8A 3DFQA 2ZZ5A 2V82A 1MEIA 2NXHA 1H7XA 3O15A 4OE7A 2ZTKA 5EPDA 3IIPA 2WPBA 3P7YA 1SO4A 2GVJA 1D3GA 4DBEA 1FCVA 1FCQA 2PURA 5HJLA 2JK2A 3GXTA 3TW7A 3HF3A 2EKCA 3MI2A 3O63A 4UIOA 1X7FA 4RKAA 4BI7A 2ABBA 1MXSA 4G1KA 3USBA 5LSMA 2CWNA 5BRBA 5TIMA 3TQKA 5I3HA 4IJBA 2V30A 1VH7A 4Z1AA 4JTKA 3W1AA 3LLDA 1KFBA 3IEBA 2H3BA 3FOKA 4PTNA 3W73A 3B04A 2VOMA 4CNOA 2DJLA 1RVGA 2ATSA 1G4SA 1FWNA 4GJ1A 3QZEA 1U5JA 1TPDA 4MYAA 5C55A 5K7JA 4FNUA 1OABA 2QCDA 4EOUA 2ZYFA 3BARA 1R47A 1WAUA 3C8FA 1YTDA 3F03K 1P5BA 2OT0A 4JXCA 1IGSA 2FIQA 2X1UA 1RR2A 1H7WA 1W5OA 4JDBA 1XDMA 2OCZA 1JUBA 4DO4A 3Q2DA 1SUXA 2VC6A 3TFXA 2C6QA 2NLIA 3PB0A 4GXMA 5AC6A 4AMAA 2J88A 3JRKA 4WZHA 3M5ZA 4N6FA 3DI1A 3TSMA 3NL3A 1T8XA 2VENA 4U4MA 1I2NA 2QCGA 3W3OA 3W22A 3TFCA 2W0UA 1XL9A 1EP3A 4LRSA 3GLCA 2ZRWA 3GDLA 3U8GA 1ZAIA 2FPTA 3IV3A 1JQVA 4C1LA 4A29A 1HO4A 4JNMA 1DJNA 1A5CA 1UUOA 1TV5A 3GR8A 3W7CA 4K37A 3TQVA 3GDMA 1DJQA 3M44A 4O4VA 1ICSA 4DQWA 2ZBTA 4Q32A 1LOLA 1TPWA 5LNUA 2CLMA 1O5XA 2H90A 3O05A 4IX0A 5HWJA 2QUTA 4ZQNA 3LHWA 3NG3A 3EX3A 1H7OA 2WSQA 3ATYA 3W71A 2C16A 3CWNA 3H55A 3RF9A 4N02A 4LY8A 5HUOA 1TTQA 3TX9A 2GJNA 4LS0A 3DFNA 3LCLA 2Y7FA 5HQEA 2Z6JA 1W5MA 4NZFA 3TAKA 2VEPA 2Y7GA 3IIOA 1C9DA 3K30A 4PC8A 5HR7A 1W0MA 3W7KA 1I45A 3T4CA 3FLUA 3UPWA 3CB8A 3A23A 2P0OA 5D2XA 2GOUA 2YYTA 4Z1CA 1HTIA 1LOQA 4FX7A 3UWYA 5DXXA 3PBWA 4UMBA 2CLLA 1TB3A 1OFDA 1UCWA 3DFSA 4Q4KA 3W23A 1SW3A 4B5NA 3Q94A 3B05A 1GPWA 4CCEA 2TYSA 3P5YA 5DBTA 3G0SA 2ZZ6A 2A4AA 2E68A 1VQTA 3S1WA 1LLWA 4DEFA 4K39A 2ZRXA 4O28A 1F7BA 1THFD 4GNJA 3MJYA 4CNPA 1NFBA 3TSDA 1GVRA 3CTLA 3GB6A 4JD4A 4JR5A 3JR2A 5C2XA 1XM3A 3VE7A 3NQ7A 3EB2A 3IIVA 5F4XA 3A22A 4NNCA 1F6PA 3TKFA 1WDWA 3NL6A 1TV7A 2J9YA 4GE8A 3RFAA 4AXKA 2A85A 2XFWA 3NQ8A 4JTLA 1NF7A 4O8RA 3SSJA 4YCOA 4BI6A 4DXVA 1CI1A 1PVNA 3TAOA 2FDSA 2GQ9A 3LCXA 5EKYA 2Z2UA 3W7HA 4O57A 1FCUA 1YXYA 3QSTA 1D9EA 1JCMP 3FIGA 2RDUA 5BOOA 3UXAA 1OJXA 1RZMA 4LV4A 3DXIA 4O1DA 3BW3A 3NL2A 3I7QA 5G4EA 3EEGA 4XUGA 3WJZA 4ALDA 3EWYA 1GQNA 2Q3OA 1HUVA 1V5XA 1UB3A 3ATZA 3P8JA 2ZZ3A 4W9TA 3AJXA 4CCCA 3TR2A 1TRDA 3NAVA 4AEOA 4JN6A 4OBTA 1LBLA 4OHQA 1LDCA 1N8FA 3WJYA 3I68A 2WSRA 4GC4A 1TJPA 2B7OA 4NUWA 1QPRA 1FXPA 3KFTA 4LC8A 1VLIA 4AWSA 5CZTA 2XN2A 1ZHAA 5CPMA 3BLFA 1JUKA 2E5BA 4GWEA 2FPVA 3ZR4A 2QKFA 3N14A 2VEKA 1TCDA 5CZJA 1NF0A 1UBSA 4ZQCA 3S9YA 5L6UA 5EYWA 3GXNA 3W2KA 1WOAA 3C6CA 1IXOA 3HQ1A 3EWUA 1SZNA 4RZ5A 4UTLA 2ZRYA 4JYEA 3WFAA 5D2TA 2DZPA 1B57A 1KFCA 1OG0A 2FLIA 1QO2A 2Z1BA 2E77A 2V9DA 5CPOA 1AK5A 4JTUA 2DZXA 1A5BA 4RCXA 4N4PA 2FQIA 3HG2A 1FBAA 1SO6A 1OFOA 3NEVA 2QDGA 3QJAA 3E02A 4HPXA 1LZOA 5FEPA 1VCVA 3PY2A 5C5YA 3CC1A 3W1MA 5F2MA 4AWTA 3C2EA 3FJ6A 4AWUA 1Z42A 5D05A 1LRNA 4XKYA 2H8XA 4NQ1A 3W87A 3EWXA 4ONVA 1SFJA 2Q8ZA 5DCDA 4WOZA 2VFFA 3W07A 1FY6A 1ZALA 3DU0A 1B4KA 1MO0A 5A8GA 2ZA1A 1GTHA 3FKRA 4M7TA 3E96A 1NAL1 1OFPA 1KM4A 3L9CA 3QEZA 4GUHA 1P4CA 4MY1A 4TO8A 3TSBA 3LHUA 1Q3NA 3OA3A 3FFSA 4NVTA 4MIMA 5G2WA 1VHNA 4QJ1A 1XCFA 5J5RA 2UV8G 4O4WA 3TROA 1VCFA 3L5MA 4QM1A 4UFIA 4NJJA 5LNWA 4X22A 3O07A 2YFNA 2V5BA 4FNTA 3G1XA 3NPXA 3QF0A 4TX9A 2WNQA 3PS7A 3Q37A 3SECA 3S0CA 4IMDA 2WV8A 2V81A 3CLMA 2QAPA 8TIMA 1LP6A 3BG5A 3PSVA 1LORA 4HHPA 4O19A 3CT7A 4A22A 2GVGA 1JRBA 5EMUA 3N2MA 1LRQA 3LDVA 3S1XA 2V5LA 5BMXA 2I14A 1LYXA 1AL7A 2QDHA 2C18A 4Y8FA 2ISVA 4MY9A 5CPNA 1A50A 1FCBA 4IMGA 3INPA 3G18A 3W1NA 1M6JA 5EA9A 4R34A 1GYNA 2A21A 2QUUA 1SFLA 1OF8A 5KMYA 2YXGA 4MZ8A 3HB9A 3LV5A 3SIZA 5HUPA 1L6WA 3M47A 4GUFA 1B4EA 1DQXA 3EXSA 4I7VA 5LKYA 1DQWA 4LS1A 3T40A 1KBJA 3LX9A 3D0CA 1K02A 4FF7A 3N34A 5AHMA 4OQVA 5AHFA 3DI0A 3O1NA 4KWVA 3PB2A 3BO9A 4HN4A 3QPYA 1ZNNA 4E2DA 1R2SA 3HPZA 3LM7A 1L2UA 4JY9A 2BTMA 1T96A 4JTTA 2YR1A 4O53A 2E1DA 3W2NA 2C14A 2RH9A 4GFSA 5AOUA 1TO3A 3ABOA 4O10A 2EHHA 3NZRA 4JEQA 1YDNA 3M7WA 4DO5A 3MHGA 3B0PA 4QIUA 1EUNA 3HGSA 4RX0A 2V0TA 5FF4A 4Y6GA 3W7OA 1I2OA 1KM6A 1VYRA 4RJEA 1SSGA 3EKLA 3W1XA 3W1RA 1ZCOA 3KVKA 4CNNA 2Q8LA 4XBSA 2ZZ2A 1KM1A 2B4GA 1RQBA 4GRSA 1ME9A 3B8DA 1SR9A 1G4PA 4NX5A 5KITA 1KLYA 4IXXA 2WKJA 3OHIA 2WOQA 3PF3A 1AL8A 2EPHA 5D04C 3HOJA 3W2UA 1VYSX 4WY0B 1HG3A 2WJZA 3TXZA 4UFLA 4R33A 3M9YA 1Q6LA 3OBKA 3QH2A 1F2JA 3HPSA 3MWAA 3G1YA 4ML9A 5D2WA 3MP4A 4UCGA 1GEQA 2TRSA 1DHPA 2F7FA 1XXXA 5I3FA 4JX4A 1H61A 1GVSA 1YPIA 5LNVA 5F4WA 2ZZ4A 1IXPA 3R89A 2OZ0A 4DELA 3GR7A 2BX7A 3C3NA 1S5VA 4MJMA 3GK0A 3LI1A 4R7JA 3SZ8A 1JULA 3Q58A 3V75A 4JTFA 3C52A 3FYOA 1WX0A 4Z0SA 3GVGA 3PBUA 3QW4B 3W70A 3W7PA 4QAIA 4S2BA 1TSIA 4J9JA 4LS2A 4KFOA 4LC6A 2O7SA 1L6SA 3TC7A 4OV4A 2E6FA 4JIPA 4O13A 1M5WA
chains in the Genus database with same CATH superfamily
3LPFA 1ZL1A 1NDVA 3BH4A 1V7YA 2YX0A 4AZCB 3GQYA 3BV4A 3E9AA 1P6WA 1TWIA 1UWSA 3SCSA 1XR2A 1RVKA 3LG3A 1K03A 2IKIA 3F4CA 1SMDA 4KIEA 2ZXQA 3K8LA 2XWDA 4ACZA 5A8MA 5AC8A 4K38A 4V27A 4RLIA 1CXKA 3B40A 4MWAA 1ZAHA 3MV11 1GVQA 3E2QA 3ARVA 3IS4A 4HYWA 5CZ0A 5AB3A 5G1TA 2FB2A 3UPMA 4NY2A 5EBAA 2O0TA 2HSAA 1LM1A 4DPPA 4NT0A 1BSIA 3DGBA 2OEJA 4RR4A 4EPDC 4UR7A 3SRKA 5JBDA 1UZHA 3N2XA 4QCFA 1XINA 3W72A 3THUA 3V36A 4E2VA 1HN1A 3G6MA 4JQ3A 2VP8A 5GVJA 2PB1A 1S2TA 4TVCA 3WJSA 2VMFA 2VURA 4EF9A 3MO4A 3PP7A 4ZXOA 1FWFC 1BTMA 5T8GA 4XZHA 1ICPA 4XBKA 1K8ZA 3P8IA 3KLLA 5HXMA 1CGXA 1VEPA 4H6RA 4HMNA 3TE9A 5XINA 1DTUA 5FD0A 2G3IA 3APTA 4NXSA 5I3GA 4B4FA 3M0ZA 3GG1A 1A5OC 3OBAA 2QCCA 4HNTA 2J77A 3NSMA 1J96A 4WJ8A 3UZJA 4DX3A 3SIMA 3F5LA 1TYGA 3AXXA 4IMCA 1HW6A 3TJLA 1W17A 1LQ0A 1JFXA 3IIZA 3FA5A 4NJGA 2J7HA 1IEQA 4UC5A 4IL2A 5AYBA 3PWIA 2CHRA 3KOYA 2Z7GA 1GHSA 4M6PA 1EC9A 3UXKA 3MQTA 3SEPA 1TX0A 4JIEA 2PF8A 4F2UA 4YLWA 4Y2WA 3EPMA 3C3UA 4RNIA 1K9DA 3W86A 3HFTA 1OZMA 4XTIA 1XLBA 3L0GA 2PDYA 2BY1A 2DJXA 4DPQA 2X42A 5AHEA 1CIUA 3THCA 3PUDA 2RUSA 4DZAA 2JKPA 5C9WA 2J7BA 2QCMA 4A8RA 2HZGA 3C61A 3T0CA 3JUGA 2EXOA 5C54A 4PUKA 2XIJA 4PEKA 5EMYA 1K77A 4LUJA 1HVQA 2VGBA 4HK5A 1OHLA 1EO7A 1W9DM 3ITOA 2MANA 4DJEA 1US0A 4PFMA 1OC5A 4X2RA 2X0YA 1XRSA 1AW2A 3G1RA 3GWQA 4V1XA 4R9OA 1XYFA 4Z42C 1MNZA 2ZRUA 4C6NA 1KWKA 2E3ZA 1RSCA 3TQPA 2GZXA 4LNYA 3H2FA 4L61A 3M6DA 2PCEA 5DX7A 4HNNA 2ZFAA 3PG8A 1F07A 1W9PA 4NAFB 3Q45A 1N7KA 4QQUA 4WQ6A 3AUOA 3IJ8A 3BUVA 3CQJA 5LIUX 3C2OA 1UOKA 8XIAA 4NHVA 1CCWB 3A24A 4UFHA 4S3EA 1WKYA 1GHRA 3N19B 1JNDA 1KD0A 2FZMA 4S23A 3N6JA 5D9PA 3WF4A 3WQVA 3S5YA 1TTPA 4WJEA 5CCZA 1XKYA 3MVTA 1ICQA 4GBUA 3UW6A 3GZ3A 3K5XA 4O18A 1BYDA 3FEQA 2YOCA 4JHMA 4TU1A 3N73A 2J24A 4LY4A 3W7NA 3OYXA 4O1CA 3HU7A 2FDMA 2VM8A 2FZBA 2UY3A 3U5UA 3L0KA 3S5OA 2J6XA 3A13A 1QW9A 1NDZA 3KUMA 4ML4A 4HBKA 3WF2A 3QVQA 1HX0A 1TPH1 1XI3A 1FKWA 4JTAA 3RO6A 3OLIA 1N2VA 3S9ZA 4PL2A 4OUEA 2QNEA 3QFWA 3LK6A 2X8RA 4DWSB 3N04A 2NXGA 1PX3A 5KEZA 2VQUA 1HZYA 3SCUA 4IISA 1YMYA 1ZQ5A 3MMDA 2BGQA 4GYKA 1G4EA 4GQ0A 1RJRA 3ZOAA 2NWSA 1OF6A 3R2GA 2W62A 3FNDA 2Y62A 1UQYA 1QOQA 1PIFA 2ZDRA 7PTDA 2EPLX 3WMLA 3VIGA 4JTRA 3BL3A 4A35A 2YGYA 5D02A 4XSLA 3AYVA 2HBXA 1V4YA 1Q45A 1TA3B 5U7SA 3OYZA 1XPGA 4KS0A 1J10A 4NU7A 4Z1BA 1IEVA 4Q4SA 1I2RA 4BWLC 4DWDA 1VRDA 4JFWA 3BDKA 3OOQA 4EXBA 3ZT5A 1JF5A 1JFHA 3JZEA 4XTDA 4RV8A 4AYSA 3GXMA 4RDVA 5D30A 3E2RA 3UESA 3AXHA 3WBXA 4O14A 1G01A 3SI9A 2E6DA 4B3ZA 4D9PA 1H0GA 3MYPA 4XQ6A 2R1MA 2PWHA 3LN3A 4PL1A 4A4AA 1VPYA 3GDKA 5HMEA 4PTDA 2E5CA 3NDZA 4LBUA 5M03A 2JF6A 1A49A 3DEQA 1JNEA 3N9RA 3NOEA 2WMIA 1MYRA 3QFEA 2VTFA 4AHPA 4S1FA 1H49A 2VX5A 3H2AA 5AYYA 4HZ7A 4Z08A 5A6MA 4S3GA 3F4DA 4MPQA 1ADOA 3VKAA 3DOPA 4L6DA 2YW4A 5KZEA 4HA0A 4IPIA 4BKNA 2P8BA 3RLGA 5K9CA 3TH6A 4ICCX 1V3KA 2DDXA 3PPCA 5HQMA 2CLKA 3A5VA 4UTUA 3BSMA 2PBOA 4LVAA 1XBXA 2VWSA 3KXQA 4CLMA 2NV2A 1BYAA 1HJWA 2J75A 2OWXA 3K4AA 2CZDA 2WXDM 5A8QA 3DFHA 4B91A 4BY3A 1GJPA 3UG3A 4PCSA 1ZJIA 1D8WA 4BK9A 3OJGA 2WKLA 4AF0A 1KCZA 3RILA 2CZEA 4KH2A 3CYVA 2ZQ0A 4X9SA 2OB3A 1Y8BA 3IIXA 6XIMA 1L9WA 1VFMA 4QNWA 1KGWA 2DZUA 4Z2IA 1WYIA 1MRQA 3IUHA 1LT8A 3WDPP 3U0HA 3YPIA 4D6CA 2Y85A 1SU5A 5A2AA 3SCVA 2Z1WA 1QI2A 7REQA 2QXWA 2GJPA 1HL9A 4RV3A 2F84A 1CGUA 3TTEA 3MWCA 2OO6A 5HWMA 4KEVA 2JGQA 5BU6A 2QYGA 1AMKA 4UQEA 2DIJA 1QOPA 4DM2A 3CHDA 4FEZA 4KESA 3AIWA 4JL1A 1F4AA 3WNMA 2V2CA 3EX1A 3W6LA 2EPOA 4ZTXA 3WNPA 2W3ZA 3B8SA 3HJZA 1SW0A 1HKKA 3VMNA 4W89A 4JTCA 1PCWA 4WXZA 3PZOA 5G1MA 3N4EA 2ZE3A 3RCMA 1RCQA 3I3BA 4WJXA 3OZPA 3W27A 1VS1A 2QQ6A 3D5HA 3QGAC 4DYJA 1Q5MA 2PGWA 3MI3A 4KQNA 4DZ5A 1NM9A 4CUCA 1YPXA 3H4GA 3NCOA 2OFJA 2Q3RA 2CWXA 1IXNA 3N11A 1KV5A 5BOEA 3B9OA 4LV9A 5C9UA 1E6SM 3BURA 3TJXA 3C2YA 2NUXA 3IAQA 5HOSA 4MDOA 4UCFA 2EKGA 4FNRA 1VGAA 1JCTA 3BMXA 1NU5A 4JTJA 2PMQA 1OGBA 4U28A 3RPMA 4ZO9A 2OR2A 1GG1A 2YA2A 4O0ZA 3LB0A 2OZ8A 3BGJA 2BP1A 4CQ9A 2A7NA 3NO5A 5K2ZA 3AU6A 5HNNA 1SJCA 1V6UA 3A4XA 3R10A 4IXHA 3SADA 1SSDA 1E72M 2QV4A 3LLFA 4QITA 2XN0A 3IGHX 4AX6A 1QJWA 1XD1A 1TV3A 4LQ1A 3GG7A 1EDTA 2FZ8A 3G8EA 3VMOA 4U10A 3A5FA 1VPXA 2E6YA 4FLQA 1WE5A 1GJUA 3CL6A 3KP1A 3WDRA 2J62A 2P0IA 3NQMA 1PO9A 1P0BA 1QPQA 2JBMA 2PBGA 3KRZA 5JMUA 2DORA 1GKPA 2AGTA 3URAA 1S5WA 3A4JA 4IQEA 2XIBA 3D46A 1JF6A 1J2WA 1GOKA 2YXXA 1J5SA 3K4DA 1J0HA 3UT0A 1XPYA 4F0LA 5F1UA 4N2YA 3RITA 5XIAA 1O1HA 1FQ0A 4PYSA 4JTHA 3NURA 1G7UA 3VD3A 1X6NA 4GO8A 1UP0A 1TJ2A 1GKRA 1RPKA 1V0KA 4UFMA 4ACYA 3EKZA 1K4GA 1S39A 1BGGA 1QR7A 1S1RA 2PDHA 2AAAA 2TODA 3G2GA 3AS0A 1FX6A 1TFVA 4GYJA 1TTJA 4IMEA 2AQVA 4U5KA 2OYMA 3KRUA 3ANVA 1POJA 5M17A 1LL6A 4WSHA 1AVAA 4IPPA 4NP7A 3KWSA 4XKYB 1RD5A 5C70A 2ZUNA 2EG6A 1KFLA 1VZWA 2EGZA 2QUVA 4LVBA 1OBAA 4ACZB 1OYCA 3V4BA 2VZOA 1S5TA 2J9XA 2IPGA 2OKTA 1D7KA 4IG2A 2W5FA 2NZLA 4V28A 1J01A 3LSBA 4DRSA 4H8UA 4LCQA 2R82A 3IJLA 2B0MA 3LS9A 3ZT6A 1CXHA 4LCSA 3I4KA 1TREA 1OK4A 1OWQA 4KFPA 2VL4A 1Q6OA 3UA3A 1TELA 5J8LA 1W3JA 3STEA 2TMDA 4TMCA 4DWSD 1BQCA 3IJIA 1EJWC 4JBRA 3W85A 3H2OA 3KLKA 1ML1A 2DW6A 2WCAA 1B0IA 1KFKA 2VWTA 1XBVA 1XFBA 4AVFA 3CV2A 1R85A 4D6GA 3IJ7A 5JU6A 1WXJA 5HK4A 3AROA 2WHKA 3VINA 1OD0A 1R46A 1TPFA 5IM51 3O2LA 1PKMA 4IP7A 1BPLB 5FJRA 1GEHA 4REQA 5CG7A 2AKMA 2BVDA 2G3NA 3LERA 4EIVA 3AIUA 3B0YA 4FK9A 3AMLA 1REQB 3T05A 1KXVA 4NJKA 4UMAA 3CEUA 3NDOA 2YYUA 3T7VA 2IPFA 3CLWA 3BLPX 4QR6A 3QQ0A 2ACQA 5CSYA 3AJ7A 5A6TC 3BE7A 3K46A 2KAUC 3N15A 1GK8A 2WNWA 1W3LA 3OLDA 3PJUA 2CCRA 4XZBA 4WDTA 3AHXA 4ZB5A 1TVPA 3W7DA 2J78A 5A6KA 1JDFA 1HJXA 5FKYA 3WO8A 9XIAA 2E09A 3H22A 3R0KA 1OVDA 1S5MA 4DUWA 2X05A 4PCFA 1XYMA 4NZCA 4U3CA 4E8DA 4MFDA 2WZHA 4B16A 1U1JA 1L6GA 2QCNA 2BB0A 5G2IA 1CLKA 3IJ6A 4GK8A 1W9XA 3ES7A 4DJDA 1ISXA 2E9MA 4XIMA 4LCRA 4Z0JA 1CXIA 1KTCA 3UVIA 4HZ8A 4WVXA 3DHDA 3GG8A 3LQGA 5JBFA 3RAOA 3DFOA 5PTDA 3NQCA 2D3LA 4W5UA 2BOFX 5RUBA 4CNTA 4LUTA 3WK1A 1O94A 2OWWA 1CLVA 2OX4A 3M64A 3AUJA 3MV01 3HIJA 3PAJA 3HBLA 3WG6A 1HT6A 5FF0A 3QY8A 5C6MA 2O4MA 1ONXA 1UH3A 2PLCA 5F2IA 1Z48A 1DKWA 4PUNA 2GK1B 3OZMA 2XU2A 3R8RA 1ECQA 4IIBA 3V1HA 4FR6A 1MQPA 2AAMA 3LRLA 4N9BA 4P5UA 4E6MA 3CNYA 1PHQA 4F4RA 4P7QA 4P8UA 3LSCA 4RW3A 4MAZA 4MJZA 5BU9A 2FJKA 2ALDA 1B9ZA 4DF2A 1XJBA 7TIMA 1WCGA 4XZMX 1M9HA 4W8BA 1A5UA 3GH5A 4K6AA 1B3WA 4K7YA 5T91A 1RY8A 1O66A 1KNWA 1HKWA 3CMFA 4AZHA 4LB4A 1DWJM 2YBVA 4L6HA 3GKAA 3R0DA 2WJDA 3VX0A 1TV8A 3PC0A 4YMZA 4ZGYA 3LENA 1NFPA 1G4TA 1W9VA 3QXBA 4IUGA 4GYPC 3T1GA 3SR7A 3WENA 3EDFA 3M0KA 2PRMA 4PFHA 3RPDA 4OIFA 1X6UA 4QX4A 4HPHA 3CIVA 3LXAA 2QGHA 3B03A 1AZ2A 2C1IA 2GL5A 3CU2A 4FXFA 1PJ9A 4UNKA 2OSWA 2VRQA 4XB3A 1C90A 2I7GA 4F2TA 2WPGA 3C0QA 2GPTA 3N12A 4IOTA 5A95A 1UIPA 1N55A 5FJOA 4MHBA 3P81A 4D6HA 4F40A 1H60A 3G0XA 3REQB 4AZCA 1R8LA 1E1CA 2VX6A 3CHCA 3U2OA 3HGJA 3W25A 4INFA 3OIHA 1TX2A 3DH7A 2C71A 1DE6A 4JX5A 4IFKB 1V51A 3ITGA 2GUYA 3KOFA 2YXOA 3TVAA 3ZR6A 4ADTA 5F2GA 4ATLA 3WUFA 4WXYA 4MNJA 4PTXA 4Z2JA 1KBIA 2Z24A 1YXCA 2EG7A 1Z69A 1YIXA 1KM0A 1OK6A 1SJAA 3CQKA 1PDYA 1UWUA 2J9ZA 3GYEA 1LCOA 2A1YA 2Z0IA 1R9YA 1XIHA 3S2JA 1F6KA 3S1UA 5CH9A 2WMGA 5I78A 3HO8A 3OPSA 5CAHA 2NWRA 5DQPA 4PH6A 3L65A 5LIKX 4IGMA 4ZOEA 4RE4A 3C4UA 1VCGA 1X98A 3QTGA 4DBWA 5DBUA 4J4KA 4JICA 1UBPC 3DFPA 4LAMA 4IIEA 6XIAA 3MO7A 1YBQB 5AYXA 2YCKX 3CZGA 5F7UA 2HTMA 3KP0A 1I75A 3VNKA 3H2MA 1KFJA 1EGVA 1ME8A 2BVTA 5LIWX 3VU2A 4ROPA 4ZO7A 4Y9PA 3UNTA 1POKA 2XH4A 2GWNA 3O15A 2H9AB 2WPBA 3QV9A 2DQXA 4DBEA 3SDOA 1EXBA 2PURA 3HF3A 3QOMA 4I9TA 5A6AA 3OLEA 2PGEA 4IH3A 1MXSA 2ZUSA 5BRBA 5TIMA 1UR1A 2FGZA 4H00A 5I3HA 3ZXWA 1NOFA 2DT1A 4L9XA 1KFBA 1LJYA 3IEBA 3VKDA 1W3HA 1R3WA 1HKMA 4E8GA 3FOKA 3HMCA 4GVFA 4H83A 5E70A 4US6A 1RVGA 1G4SA 4GJ1A 3NXLA 1TPDA 4AX7A 2PDKA 3DECA 4FNUA 3PZNA 1RXOB 4M0XA 3IK4A 4WRHA 4GQQA 1YTDA 3F03K 1P5BA 2PDMA 1W1YA 1Y5XA 4R88A 2X1UA 1RR2A 3GHTA 1JUBA 4GYPA 2PDCA 1RP9A 2NLIA 1TA3A 3TTSA 2J88A 3T2OA 1T8XA 1UR0A 3V7PA 1CECA 1MW2A 6TAAA 1OIMA 1VD6A 3GXDA 3VC5A 4H19A 3TCSA 4C7GA 5DEZA 3W02A 1AQFA 2E0PA 2FHBA 3ARYA 2FPTA 3IV3A 5DANA 1BF6A 4A29A 4B5XA 2PGRA 1DJNA 1B90A 1A5CA 3GR8A 3UJ2A 1EJUC 1BFNA 2Z2BA 3M44A 4O4VA 1JPMA 3O0FA 4DQWA 5E0FA 1BYBA 1LOLA 5LNUA 4JQ2A 4IX0A 4B90A 2QUTA 1E1FA 5FA5A 3LHWA 3NG3A 4PMJA 3QY7A 3ATYA 4ZE5A 1H3GA 2C16A 3SN4A 1U22A 3CWNA 2R6OA 4LBRA 5FL1A 5BWFA 4LY8A 5HUOA 4L64A 1FP9A 3TX9A 5C9RA 3GVWA 3PTQA 3BLLA 1PAMA 5HQEA 1XYZA 1WUEA 4JPGA 4NZFA 3TAKA 2VEPA 2Y7GA 1QK2A 1C9DA 1GONA 5HR7A 1FWBC 4LUTB 2GOUA 4Q4RA 4Z1CA 4JFTA 4TV6A 2IQDA 1OFDA 1VFOA 3DFSA 3W23A 1SW3A 3STPA 4IICA 5ABFB 3HJEA 3Q94A 1GQIA 3B05A 5DBTA 3G0SA 3M0MA 3RUBL 2E68A 1VQTA 4DEFA 5I07A 1Q6EA 4A3QA 1SGJA 4GNJA 5B7YA 3GBDA 3OGVA 1QVBA 1NFBA 4GXWA 3CTLA 4H01A 3MUCA 3ZR5A 4AIBA 3WUBA 3IIVA 2OTDA 1PKYA 3ITYA 4ICMA 3ITTA 4JN7A 2XFWA 3SSJA 1CXLA 4S3CA 4BI6A 1Q4NX 5CXPA 3R25A 4EPKA 1V0LA 1E0VA 3TYAA 1GVIA 1XLFA 3WBWA 1D9EA 5H6HA 3UXAA 1RZMA 4LV4A 3DXIA 4O1DA 2E1WA 3NL2A 4ZFMA 1RJQA 3EEGA 3C8NA 4XUGA 3WJZA 3ARSA 1V5XA 3UR5A 1N8IA 3ATZA 3VD4A 3P8JA 3UG5A 1ITUA 3IWPA 4IQJA 4CCCA 1HJUA 3TR2A 1TJ1A 1A5NC 1Y5WA 4IF2A 4AEOA 4JN6A 4OBTA 1LBLA 3WJYA 3N3TA 4L4OA 1LL7A 2TAAA 2DSUA 2FZ9A 4D8AA 3ZLHA 3B8VA 5CZTA 1RBOB 3V35A 1BWVA 1JUKA 4AMCA 1KBBA 1XLHA 2AMXA 3N14A 4PMXA 1NF0A 2Z1VA 3G6LA 4ZQCA 5L6UA 5EYWA 3U5YA 1ISVA 1B2YA 3EWUA 3HQ1A 2PFHA 4GGBA 1SZNA 2VR2A 4RZ5A 4EACA 2R9RA 3E0WA 1V6WA 3WFAA 2ZXDA 1OG0A 1ZU8A 4B5UA 4I8YA 2W91A 5CAKA 4X63A 1UWTA 4HZ6A 1AK5A 4JTUA 4D6EA 5M1TA 4N4PA 1EOKA 1JAEA 1F6YA 3GNXA 4NYYA 1Q66A 3NEVA 2QDGA 3E02A 3AALA 4AZ5A 3OO2A 4PUUA 3HFYA 4WSKA 4XKYA 4NQ1A 4M29A 2NVCA 1EJVC 1SFJA 2Q8ZA 1ZALA 4A3HA 4D8LA 4UB9A 1B4KA 5A8GA 5BOFA 2ZA1A 3QR3A 4QJ4B 3AWOA 1NAL1 1OFPA 3IARA 1KM4A 3L9CA 3RXZA 1DP0A 3C5QA 1OSEA 3QGKC 3FFSA 4NVTA 1LQ2A 4IP5A 1VHNA 4O4WA 3L5MA 2Z7KA 1J0KA 2VD8A 4UFIA 4Q4MA 2DH3A 1FWJC 1YRRA 3S9IA 3ECQA 3O07A 3BC9A 1PB0A 2YA0A 1UKQA 3HV9A 3PS7A 1UZ1A 3S0CA 4IMDA 1ZS2A 2QAPA 1XLCA 3IUDA 8TIMA 2DT0A 3BG5A 1Y5VA 1TWWA 1X7IA 2ZXBA 4ILSA 1JRBA 4O0QA 3N2MA 5EMUA 1LRQA 3LDVA 2PTZA 3CUXA 3EOEA 1R3VA 1LYXA 4CN6A 3TYZA 1AL7A 4Y8FA 3GUGA 4HNLA 1MXGA 2F6UA 1A50A 3INPA 3G18A 1M6JA 4R34A 1LT7A 1BVZA 1U5HA 3FAXA 2YXGA 4MZ8A 5J04A 3HB9A 3SIZA 4NZ4A 5M3WA 4AEFA 4AQLA 4M82A 4KWSA 1UIOA 1DWAM 3WQ6A 2WZTA 4E8CA 3D0CA 2A79A 4OBSA 3N34A 3NUKA 5MKGB 3PB2A 3TC3A 3BO9A 1MDRA 3QPYA 3M7SA 4GZJA 3XIMA 3CTTA 4HU0A 4JY9A 4L6OA 1UKTA 5D8ZA 4GY7A 3BJTA 4GFSA 5AOUA 1LF1A 1CBGA 2I5QA 4LFYA 3B0PA 4QIUA 3HGSA 2V0TA 3WUEA 2XVGA 3PZTA 3W7OA 4GG9A 1VYRA 1SSGA 3VDGA 1M65A 3W1XA 1ZCOA 2AOSA 4XBSA 3ABXA 1KM1A 4CU7A 1RQBA 2PDIA 4GRSA 3CAVA 3B8DA 5C8BB 5EMKA 5KITA 4IXXA 1QT1A 2WKJA 3OHIA 1XH2A 2P5NA 2BVYA 3A3HA 3GH7A 4Q8TA 2XIIA 3TTQA 5D04C 3AIBA 1JGIA 1T40A 1VYSX 1HG3A 3VC6A 2NQJA 4UFLA 1EO5A 2WMIB 3M9YA 3GU1A 2EO7A 2QDEA 3OBKA 3PPFA 4UWMA 2AQOA 4YNGA 5TF0A 3TYEA 3L2LA 4JX4A 2QUMA 4IHCA 1H61A 1GVSA 5LNVA 2YL6A 2ZZ4A 3GR7A 2BX7A 4MJMA 2J4GA 2PWVA 2AMGA 3SZ8A 5EU9A 3Q58A 1A4MA 3DCPA 1EKOA 2OLSA 3CL7A 1VRXA 1OC7A 1ADSA 5AVNA 2D0GA 3W7PA 4EANA 4S2BA 4LC6A 1IT0A 4AZ7A 4O13A 1M5WA 1WNOA 1V3HA 5HMSA 4AZIA 3QSRA 2WZIA 3BOFA 3KOZA 3J7HA 5H8MA 2NXIA 4LAZA 4Q8UA 3VNZA 3NQDA 2GOKA 1IXQA 5A3HA 3VTRA 4L9YA 3L4XA 1TJRA 1CX9A 4HA1A 1UH4A 3T78A 3L4YA 3WDJA 1OCNA 4O12A 1PX4A 3W7IA 1KLZA 2O9RA 3HPXA 1EOMA 1XFCA 3CH9A 3I3EA 3MUXA 1RPXA 3UZWA 1EH9A 4JTQA 4TX8A 3H54A 3P84A 4W85A 4LU0A 3SCRA 1XQKA 4WCJA 1SM9A 1MW3A 1TKKA 1UP2A 2FTPA 3NOYA 1RD6A 4U33A 3VD5A 3FGCB 2B31A 2ASHA 3DENA 3UBPC 3OP2A 3S5NA 1KTNA 1WKEA 4XIAA 3TCEA 2H3DA 4PTWA 1UOZA 2PUZA 2CZFA 4YVPA 4AU0A 1U30A 3NQAA 3WD3A 4FP1A 3R79A 2Y5SA 3WLRA 3EPOA 1EL3A 4AZBA 1RQEA 3ARQA 4JS3A 4NASA 3T8QA 2C15A 4O1FA 3CEPA 3TJIA 3WLOA 3EA3A 4KF1A 2GGEA 1BWLA 3VIKA 4TTGA 2QJGA 1XYBA 2R14A 3WN6A 2BZNA 4A2RA 5EBUA 2VD9A 4CQAA 3EX6A 5LGZA 5A8OA 4TOQA 2BMBA 2VX7A 3PUGA 3HMJG 2XFRA 1QMLA 3O9NA 5FJIA 4X0NA 3WSUA 4I5XA 3P14A 5G4HC 1V8EA 2DZWA 3EKGA 2XG9A 4CD7A 3B0UX 1XC6A 2BXVA 1DJGA 2ICSA 1IV8A 4G56A 4DUOA 3DAQA 2X09A 3SQMA 3SJ3A 1UMYA 5KZDA 2I56A 4LANA 4RPPA 1ZAJA 3W53A 1DJYA 4MSSA 3CPGA 2QMKA 3BJSA 3L66A 1P1XA 3W7MA 1R2RA 2C1GA 1WZLA 3FV9A 3FVMA 1TZ9A 1H7PA 1JCYA 3O6YX 3TMLA 3BCFA 3OVGA 1GVFA 3N3MA 3M5VA 3WF0A 1WP6A 2DVTA 3UGRA 3QN3A 4D71A 4DWSA 2VC5A 4AB4A 3KX6A 4MZYA 3L67A 4HIBA 4URIA 4PCNA 3G3MA 1YDVA 3GTXA 1DBTA 1HL8A 3KBSA 1ELSA 1JL8A 2GUUA 3IANA 4HNVA 2XM2A 1EHAA 2Y8KA 3O16A 4N6EA 1OX4B 1ZPTA 1BAGA 5AC7A 2QJMA 2Y1HA 2GGHA 3CIWA 3AYTA 5CPQA 5FF3A 2AQWA 1JQXA 1DQUA 3S1VA 2V5KA 5GJNA 1PZ2A 4AIOA 4D8ZA 3BAXA 3RRXA 4GJJA 4LBSA 1HXJA 2C1HA 1GGOA 4XUYA 4ADSA 4PE8A 2A5HA 2PLKA 1EFZA 1YKWA 3TN5A 4ZQMA 3I6EA 1ENUA 1EIXA 1U2YA 1DWIM 3DN5A 1R5YA 3B8TA 2VZUA 2V63A 2CESA 2GJLA 3DBPA 3GNNA 4X9YA 2P76A 3LLXA 1PYFA 5H8PA 3KL5A 3MP3A 3FSUA 2ZA3A 4WDXA 4PULA 4UOQA 4CQBA 2PU1A 1XQLA 4CU8A 1I9CB 5I77A 4GZIA 5AHNA 3PZUA 2VGGA 4Q6JA 4K1GA 4RPQA 3LPOA 1A53A 1NP0A 5TBOA 1QUMA 2WYSA 4J3XA 2MNRA 5G1YA 4GI8A 4FX6M 1JG9A 5CC3A 2Z1SA 3O7UA 2QIWA 4HKPA 5TQLA 3AXKA 5FL0A 3P61A 4FXRA 3PZGA 2GFTA 4PSRA 2CU0A 3TUUA 1PKLA 1JCNA 3UPBA 2ZZ7A 4M6QA 2WVTA 1ITQA 3V16A 3PSWA 4CD4A 1UZDA 1E70M 1V02E 5F2LA 2IUZA 1H41A 5FAJA 3NGJA 5LXEA 1TUFA 2ZRZA 3VD7A 4DVOA 5A1AA 1EGZA 4S3KA 2YSWA 3S42A 2BWGA 3GHRA 4OTKA 1ODZA 1LG2A 4LEQA 1BRLB 2DIKA 4GFIA 1VR6A 1IYXA 4MTVA 4XVEA 3W2JA 1E40A 3WQPA 4LUSB 1ISZA 1ZTVA 2WCGA 3O3RA 2DUAA 4FS9A 3IAPA 3B4UA 1DXFA 1KXHA 1H51A 4W4QA 1IT7A 3GXFA 1BKHA 5H8UA 1IE7C 1ONRA 1DOSA 3ITVA 4QISA 2H8ZA 1G94A 3AFBA 3M07A 3G24A 1J5TA 4CKQA 2XPKA 3KAOA 4MLJA 4BQ3A 1JYWA 1W5NA 3CHVA 1SZEA 1H1YA 3WQ8A 2G37A 1C91A 3CMGA 1F3WA 3BW4A 4O52A 3U9IA 4BI5A 1XLKA 3L0NA 3KTXA 3MKKA 3APYA 5DF0A 3ARRA 2WZMA 3FJ4A 1H2JA 3WLKX 4HOWA 5GNZA 3WEMA 4UTFA 3JS3A 3LTYA 4AEEA 3SUTA 3FXYA 1A3XA 2WMFA 1NSJA 2WHJA 3AMKA 2FMOA 3B8WA 3NZGA 2OT1A 1OYBA 3AYRA 3UZXA 2D20A 3TA6A 4EVZA 1F76A 4UUIA 1KCXA 1F3EA 3SFWA 5GPRA 5DY2A 2DU2A 2D2OA 4XD5A 4JDYA 3POCA 5HPCA 4A2SA 3GKFA 1NOWA 4W8AA 3W7RA 3NVTA 1UH2A 3K4WA 1HJSA 1IHIA 4A6GA 3AHZA 1E15A 3GW0A 4JTSA 3S5ZA 3WJXA 1T6MA 1VPQA 1SJBA 2QULA 2C8NA 4GQRA 1BSLA 2VC9A 2FH6A 4H9ZA 2B7NA 2X16A 3CZEA 2A6NA 2YCIX 4TMBA 4XAGA 3VM5A 4FF5A 2GVEA 4WUIA 1OINA 4B5SA 2I9UA 4PUDA 2QF8A 1QTWA 5I5RA 3R11A 3BG3A 3F5KA 3NYZA 1M7PA 1E51A 4GH3A 4J3TA 4JHOA 1QNPA 4R5EA 2VEMA 3TYDA 2NW0A 5REQB 3NM3A 4J3VA 5HAOA 4L9ZA 5G2HA 2PSNA 4KIRA 5I2UA 1V3JA 2OEMA 4HSOA 5I3DA 1W3KA 5I02A 1R30A 1A0CA 2GQAA 1AQ0A 4NJHA 1UASA 5I06A 1PXGA 4OVXA 3BCJA 4JQ1A 3CO8A 2XGBA 1G6CA 4IZGA 2DSWA 4C6DA 5ABGA 2WZEA 4V1YA 1QK0A 3KBWA 3PFRA 2P50A 1A4LA 1T0OA 3LBOA 4OKDA 1UKOA 3VOJA 1A3HA 3QW3A 1KM5A 4H7ZA 2GGIA 1X1NA 1H7RA 3D47A 5C7VA 4UNIA 3LPPA 3VUPA 3UXDA 2QUNA 3PZIA 3H70A 4B5WA 2B81A 3V5CA 5I79A 3CQIA 1E9ZB 3ZVHB 4I7UA 5ENLA 4QDWA 2R1NA 4W88A 4UQCA 1WUFA 1PHWA 3LCFA 4LF1A 1FFQA 2G41A 2QMJA 1TWZA 3I7SA 4DUXA 5A6SA 1JRCA 2YBTA 2GWGA 3GDTA 1TR9A 4H6KA 2ZICA 1QI5A 1DVJA 1V77A 4ERIA 3ICJA 4C1NB 1G69A 3WIJA 1RK5A 1MZHA 4A05A 3W74A 4XWUA 1WZMA 4HT3A 2P10A 5CC7A 4PODA 1AD1A 2VFGA 1ONEA 1GUVA 1JEZA 3BOXA 1OD8A 4LJ3A 3ITCA 1CDGA 2YCLA 1TWDA 2JEPA 2OEKA 3NYDA 4ZVJA 3GNDA 4MDPA 6CGTA 5CBIA 4ZO6A 3W1TA 1AW1A 1MUCA 1H5YA 3CUGA 3HURA 3O8AA 2CLHA 2Q09A 2XSXA 4Y9AA 2ABAA 2XH2A 3ZO9A 1E0TA 4G1NA 4K68A 5DT7A 2H9AA 3E0IA 4W5ZA 3R13A 3RM8A 3GE7A 4WY0A 1ITCA 2FVLA 4PRTA 2RJGA 3EBVA 3M43A 1FH7A 1CB2A 1TVNA 2VFDA 4Z2LA 1JR1A 4NG3A 3M1ZA 3TXVA 1XLIA 3OQ8A 2QCHA 4HA4A 3F7JA 4N7QA 2OODA 2VEIA 3TWBA 3GAKA 2CBIA 3H26A 3WKZA 1M68A 3ISIX 4M56A 4S3DA 1RP8A 3VXGA 1M41A 1HVXA 5IBXA 4J28A 3QV7A 1NWRA 3RPTA 1VBJA 1W1B1 2DSKA 4F8XA 4UQDA 1EX1A 5E9AA 2OQHA 4C6EA 2G8ZA 4IIFA 1JZ7A 4D6DA 4YHGA 3G1SA 2VFIA 3W7QA 4AD2A 5E5CA 5HPOA 4LYPA 1Z3NA 4E4PA 3WLLA 1HO1A 1JPDX 1A5MC 1W2VA 3H7UA 2CYGA 2VVNA 3WK0A 3GU9A 2OGJA 3G0UA 4WK9A 1H62A 4O54A 1XV8A 4CD5A 1MQQA 2FH8A 1W5PA 3MP5A 5LHFA 1JGMA 1T41A 4IFOA 2PCQA 1YE4A 2QJIA 2QVNA 5DCEA 3RLVA 3RJXA 1F61A 2NT0A 1W1A1 3W7GA 2FZNA 1EPXA 3W26A 5EGRA 3WX7A 3GHUA 4Q7BA 3A9BA 1ZENA 3QZAA 3GIYA 4F0RA 3FAWA 3QYQA 1Q4WA 3FS2A 3QR0A 2BXZA 1TZ7A 3RLUA 1UA3A 2Y7DA 4LAOA 3GX9A 1Q7MA 1XIEA 2BY3A 2JFEX 1K9EA 4GUIA 5F1VA 5CKSA 2JE8A 1UD8A 3BK0A 1YQ2A 3FN9A 5FSEC 2Y61A 4GC3A 3UG8A 3R5EA 3Q4DA 1IR1A 1FXQA 3H4XA 2LLEA 3EOUA 1FVPA 1ISWA 4YYCA 1V0NA 3SCQA 3ZWSA 5ABEA 2UY4A 4WHBA 1GZJA 4YCPA 1DYSA 1SZRA 4YXGA 4E0CA 3STFA 3STGA 3GFXA 1VF8A 4L4MA 2PD9A 2W27A 3CGTA 1EJSC 3E0FA 3MT1A 2OZ3A 4O1BA 4KRTA 2CW6A 2VZVA 4UTTC 1FWTA 2WNNA 3ERPA 8XIMA 3GUWA 2MUCA 1O5QA 4OFCA 1MNSA 1D3CA 2POTA 1VENA 5D9MA 1KR0A 4PB3A 3RIKA 3IVTA 4XG1A 2RGMA 4KGJA 3BQ6A 1UR2A 2AL2A 3I65A 4B5TA 5LA1A 2J27A 4PUWA 1ADDA 1UZ4A 3LYEA 5E1QA 3ZJKA 4Q4OA 3E0VA 2FB3A 3PUOA 2VDIA 3LHTA 3W9ZA 3RU6A 4UTJA 1PZ1A 1XICA 2PTXA 3ABQA 5HJYA 4IMAA 4ICNA 1LLOA 4DYKA 2DP3A 5CSRA 4DIAA 4XZLX 5I03A 3PJTA 4NZJA 3V1PA 4ZE4A 2A3CA 3SN1A 2BSLA 3PN8A 1RLCL 3W84A 3RCNA 4XZ9A 3ANUA 1XIGA 2XFFA 1XIIA 1TVLA 1NFGA 3T42A 2WVUA 1W56A 3ZLGA 1CENA 2CXGA 4O16A 3VGDA 2HBVA 4POCA 3OTRA 5ECVA 3AXMA 2ZX6A 4RZ6A 1RY0A 4WDWA 4XZIA 2D73A 1W1ZA 4YIWA 1BG9A 3N1AA 3G5EA 4N0RA 2UBPC 4Q33A 2XSAA 4M1BA 1E43A 3BANA 1V3LA 3SN0A 1OGGA 1FDZA 3SCNA 1DWHM 1OY0A 4C7DA 1CT5A 5I24A 1Z8AA 1BYCA 1C8VA 1WBHA 3EWWA 4Q8QA 4GIEA 2YCEA 1C9WA 3A12A 2C0AA 3GSMA 2BOGX 2B7QA 2PDGA 1R3RA 3B3DA 4JYDA 3OGRA 4E3TA 4G8TA 1M7XA 4DM1A 4A3UA 1DIDA 5I3IA 4EAYA 3LHVA 3ARZA 2WAGA 5CC6A 1B3YA 3NDYA 4RZ4A 1EA0A 3NA8A 4K2SA 1EEXA 4AH7A 5MF5A 4YVVA 3ZQ9A 4C6PA 2EQDA 5LXXA 3UYCA 3WQDA 3I4EA 4FO4A 3BAKA 2V6AA 4S2CA 1O60A 3APGA 3QHOA 4UOZA 3VIOA 4I9JA 5LNSA 2Y7EA 2D2JA 1EX5A 3O6DA 1PTAA 2F61A 1ZBWA 4KCVA 3BOLA 3GS6A 1LBMA 3UR2A 2ACSA 1EP1A 2GK1A 3TW6A 1DIKA 4PA8A 1Q7QA 1O4UA 3RG6A 2XTKA 5D33A 2CKRA 5CJ5A 1TQXA 4IM4A 1EB3A 2WW5A 1QNSA 1E6NA 3ANYA 3LY0A 5REQA 3UZ5A 4G5DA 1XLLA 2YDQA 1KCLA 4M81A 1GOXA 3BLEA 1M7OA 2PDJA 1VC4A 3H2CA 2AGKA 2QCFA 4YYFA 2Y4SA 3M41A 3PR2A 3QRHA 3AS1A 3UU0A 3S2LA 3CAKA 1M1BA 3GYCA 3MDUA 5HINA 1J6OA 1TQJA 3WLNA 3KBMA 3EXRA 5JXQA 5KSWA 5C71A 2A3EA 1AH3A 3M0IA 4MYXA 2FHCA 4HMCA 5KZ6A 1A0EA 2GVYA 4Y9MA 1IZJA 3UWZA 1WXZA 4QJ5B 1R2TA 2F2KA 3UY8A 3W75A 3G1FA 3N9SA 1DJIA 5BRQA 3WELA 5FF7A 5K3VA 3T0AA 2CZ5A 4XKMA 2WM0A 1G67A 3WQCA 3MANA 2XFYA 1XH0A 3LOTA 4FXSA 1SW7A 4OWGA 5BROA 3MW7A 5BXPA 5CEWA 3SW6A 1BWKA 1DORA 2DUXA 2DEPA 2RDXA 3DFQA 3VABA 4L56A 3PTKA 3M0HA 4PMYA 2WLZA 5CLTA 4XZNX 4OE7A 4NIRA 3CUIA 1EYWA 3IIPA 4QE5A 3H12A 4EWJA 4H41A 1D3GA 4QG6A 2WANA 1FCQA 5HJLA 2WSPA 2OVLA 2EKCA 1GOMA 4ERAA 1I0BA 1Y65A 1TWSA 3SM0A 3GVQA 4C6IA 1UWAA 4QLJA 1F4HA 1JDDA 4HK6A 2H3BA 3BAJA 3K13A 3W73A 1MMFA 4JEJA 2GSEA 4CNOA 4TVDA 1TUXA 3T2PA 3VUSA 1W1TA 2DJLA 2BV9A 1FWNA 3DHUA 4MYAA 4HZMA 4CD6A 3U2ZA 1UD5A 2P3EA 1E73M 2ZYFA 2AL2B 2VYOA 4LX4A 3GNPA 4YHEA 2CXEA 2GJRA 4AD5A 3S1GA 4HCLA 3QLDA 1YBQA 1XDMA 2OCZA 3EMZA 1XS2A 1DJXA 3E6EA 4LUYA 4AMAA 1RK6A 3JRKA 3WDQA 3TZFA 2OOGA 2ZOXA 3NO3A 3JU2A 4TXEA 1AQMA 3W3OA 3TFCA 2W0UA 1FHDA 1XGEA 4LRSA 4C6OA 1XYLA 2POZA 3U8GA 3NGFA 4C1LA 2NVDA 4AZGA 3QGVA 3VDCA 1UUOA 9RUBA 1F9CA 3SUUA 2DFAA 3MS8A 3GDMA 2ZVIA 4F0MA 1A3WA 2PGFA 2WCSA 2ZBTA 4DJEC 2FTWA 3ARTA 3SUSA 4S39A 2H90A 4O1EA 3O05A 5A6BD 2PDNA 4X60A 4ZQNA 3URQA 2EJ1A 4PTVA 1H7OA 4CQDA 3W71A 2V67A 4C6FA 4LS0A 1XKJA 3DFNA 4FPSA 2XZ7A 5HNUA 2Z6JA 5CJMA 3SJNA 1MUMA 1W5MA 4HPGA 3K1DA 3VCCA 1W0MA 1I45A 3T4CA 1JZ3A 1OB0A 3UPWA 3V0UA 5D2XA 1EF3A 4S3JA 1HTIA 5TNVA 5DXXA 2CLLA 3E38A 1IR2A 5AKQA 3AISA 1UCWA 3GVRA 2UWFA 2IPJA 2BASA 1R9ZA 4NRSA 2TYSA 1EBHA 3WZ0E 1FOBA 4K39A 1Q2SA 3HQNA 1B5TA 1UHVA 3TSDA 3GB6A 4JD4A 3CBWA 4JR5A 2R24A 1XM3A 4DXXA 3EB2A 4C6KA 1KC7A 3A22A 1GW1A 1F6PA 1GQLA 4LYKA 3NL6A 3RFAA 1R7AA 2A85A 3NQ8A 1NH6A 2JQXA 4LAUA 1TE6A 1CI1A 1PVNA 3TAOA 3VDAA 4S3AA 3H7RA 4JCLA 4EKJA 3N9KA 2GQ9A 2Z2UA 1SMAA 3W7HA 1FCUA 1YXYA 3WQ4A 1VEMA 2RDUA 1OJXA 3NVDA 4PN2A 3SO7A 3I7QA 2QVHA 1XD0A 4DAIA 3PJWA 3KL3A 4P8VA 4LB3A 2ZZ3A 3QLLA 4M3PA 1K9TA 1AODA 2DT3A 4X2PA 4GC4A 3QV6A 3DYMA 1AD4A 1VLIA 4AWSA 2XN2A 4ZODA 3LM3A 2E5BA 2FPVA 4GINA 4GKLA 1UBSA 5HDRA 2IXUA 4R85A 1WOAA 4FZIA 1CXEA 1MW1A 4FOJA 1EJXC 2D2GA 1C7TA 4UTLA 1Q6DA 5D2TA 1B57A 4PBGA 1KFCA 2FLIA 2Z1BA 4BQ4A 2E77A 4G7EB 3WLMA 5ECUA 2BFGA 2YB4A 4GQGA 3FGCA 3I3DA 3HG2A 1GORA 2PS2A 3L12A 1BG4A 1W91A 1OFOA 3DHPA 2DZBA 2CBUA 5FEPA 4ATWA 3EWDA 3PY2A 4AY1A 1RA0A 1ZJAA 3R94A 1GOOA 3FJ6A 4AWUA 2H8XA 4JKKA 4RE2A 4D6IA 5DCDA 4U3AA 4AD0A 1FY6A 1H4PA 1XW8A 4F2BA 5LIYX 1DWGM 3E96A 3QZ6A 5HMFA 1J11A 4FAMA 4R3UA 1ZBCA 4KCTA 1P4CA 3COTA 1Z32X 1R3QA 4QP0A 2VR5A 1NJJA 2X40A 3OA3A 4DNHA 3HV8A 1TG7A 3TROA 1VCFA 2E8YA 1YNQA 1JZ4A 4MG4A 1MW0A 3FDKA 3G1XA 3NPXA 3QF0A 2WNQA 4I9MA 2D3NA 3Q37A 3SECA 2W66A 2WV8A 3CLMA 5HNTA 3PSVA 2XYLA 2DGAA 3CT7A 1J6PA 5DRIA 3S1XA 4P7LA 3UCQA 1FWDC 2RAGA 1FH8A 2I14A 5BMXA 1JZ8A 5JH1A 2ISVA 4MY9A 5CPNA 4PRRA 3ARUA 1FCBA 1DIOA 1GYNA 2QUUA 3VMPA 3D6NA 3WLTA 3RJYA 1L6WA 1J0YA 1WDQA 3IJ9A 5FJJA 3GTHA 4LS1A 1EIBA 1PTDA 2P3ZA 1K02A 3EMCA 4OQVA 3DC0A 3DI0A 1FTXA 4KWVA 2Q6ZA 1BVWA 2YCJA 3P93A 4E2DA 2J8GA 3HPZA 3LM7A 4DYEA 1T96A 4MM1A 4AVOA 2OLAA 2YR1A 2C14A 4GZ7A 4EP8C 3ABOA 1E4NA 3A3WA 3B9EA 3MHGA 4AD3A 2C7FA 1EUNA 1AUSL 3M0YA 4GOAA 3R4IA 4RJEA 3U7VA 3EKLA 1HP5A 4U31A 3EMQA 5E6YA 4ZR8A 2HRWA 3LA4A 1V79A 1YHTA 4GY0A 1ONWA 1ME9A 1ZJBA 1HGYA 2GJXA 3TTYA 1VFTA 7ODCA 2EPHA 4BEUA 2PTYA 4MF4A 2HVNA 5DMNA 2Q01A 4R33A 1R6WA 2BGSA 1W9BM 4H8NA 1XDJA 1F2JA 1H0IA 3G1YA 3WYZA 4HU8A 4F48A 4UCGA 3ZLFA 4F66A 2F7FA 4K8GA 3BMVA 1YPIA 1Q63A 1Z6KA 1IXPA 4DELA 3BXWA 3H24A 4R7JA 3P6LA 1HKIA 1Q6GA 1UJQA 3WF3A 3C52A 4RE0A 3QW4B 1S2UA 3W70A 1TSIA 4J9JA 3S5SA 1L6SA 3TC7A 1JDCA 3URBA 2E6FA 1BXNA 3ONCA 5HMDA 1P0NA 4IG2B 2WHLA 2ZUVA 1RH9A 1J18A 3G1VA 3M6YA 1XRTA 1E5NA 4H3DA 3WBYA 3SFKA 3T09A 4UQBA 1KO0A 3A47A 1XIJA 3DFYA 2ZCGA 2Y89A 2VDGA 1F05A 5J5DA 4F3HA 3BTNA 3VOIA 3MUAA 4HPNA 4JTGA 1FWEC 2ZUMA 4D2JA 4J3ZA 1GVYA 4UTTA 1TTIA 2CNCA 3HQOA 3F2DA 4KPLA 4Q8MA 5FF2A 3DFTA 4US5A 4JCMA 4RE3A 4N9DA 2VFHA 4B4HA 2E9BA 2PDBA 2HJPA 4IIGA 3VDHA 3W24A 4YTUA 3WD0A 4C6CA 1J0IA 1PWMA 5EB8A 3F5JA 3QKEA 1K7EA 4QBXA 3TV8A 2BVWA 5D32A 2OQLA 2C13A 4UQAA 2J8FA 2FYMA 2PRLA 1WDSA 1VEOA 4ZA0A 3BVJA 3R7MA 5I09A 1J2BA 1TPVA 3GTFA 4Y96A 1QNVA 2XHYA 4YWSA 1MSSA 8CGTA 3UF9A 3E12A 1V93A 1BLIA 4M6VA 2DUZA 3C0LA 1B31A 4UMCA 3N2OA 3CJPA 5E93A 3AICA 4ZSTA 2FFCA 2TPSA 3NPUA 1E6QM 3NPWA 4WOQA 3THQA 1GW9A 2W61A 5AZ1A 2PTDA 4B9ZA 2I5GA 1EBGA 1FHVA 3BSHA 4QGCA 1OCJA 2O9TA 1OX4A 1XBYA 5DO8A 1CLXA 4FLRA 2J66A 3CM4A 1UROA 1MXDA 2NV1A 4FNPA 1O1ZA 2WNZA 4H6EA 1U5VA 2XN1A 4GJIA 3TN4A 1OX5A 1W1PA 1XG4A 3CUZA 3VNDA 3R43A 2Y5EA 2QV5A 2J8TA 3KBJA 1X39A 4Q3MA 3UY7A 4K7VA 3NEHA 4UR8A 2E4TA 3UZYA 4IX2A 4JAWA 1KGXA 1H50A 2PC8A 3TYBA 4AZ6A 1V6XA 3AAMA 2OOFA 3LNPA 4IMFA 3EDDA 3LV6A 4H9TA 4ASTA 5FI8A 1GT8A 3BLOA 3BQ5A 4GIYA 4ZTYA 1O12A 2V2DA 5CZSA 4KFNA 4NAEA 3FVDA 4FOUA 3IGSA 3SBFA 3QMRA 5C2CA 4BS0A 2IKGA 1UD2A 1TIWA 3TOYA 1AG1O 5C9ZA 4I6KA 1UC4A 3SURA 2GDUA 3MVIA 4FLSA 2E8ZA 4QROA 2OO0A 4H7CA 4EE9A 2ANUA 2F6XA 5DCBA 1XSIA 1KRAC 5JQ9A 1Z41A 3PTDA 3IACA 3G1HA 3SGZA 1QO5A 5HJXA 3UWVA 1IT8A 3OQEA 2YDAA 3M4HA 4IPLA 5BXRA 4EF8A 1U1HA 3BG9A 3TU9A 1V3MA 3THAA 2W6RA 1K3UA 3CB3A 4REQB 4E38A 4M7SA 1TJ0A 1XX1A 3IRSA 3RRAA 1GCYA 1VJSA 1ZLPA 3CMJA 4UFKA 2BLEA 3OZOA 4KWOA 2FVMA 3L2MA 3HQPA 4QDMA 3WH9A 4HU3A 2A2IA 1EUAA 2Z4GA 1QU4A 1FWGC 5CLWA 2WM1A 2Q71A 3HG5A 1Q6RA 2VC7A 3NM1A 3HM7A 1SQ7A 3L4VA 4XVDA 2OLHA 1KQYA 4K8HA 1SFTA 1S5NA 4JFUA 2ISSA 2X1TA 5FEZA 2VDHA 2J7FA 3EDEA 2YZRA 1H1ZA 4YU1A 2R91A 1KV8A 2ZKMX 3WLJA 3UERA 3CH0A 1JZ5A 5D9NA 4MFEA 2R1KA 1UPMB 1L6YA 3HZ3A 1FWCC 3EDJA 1J93A 2CHNA 1YTEA 2NVAA 2REQB 1QOXA 3V0SA 4N9EA 3O6CA 4JN8A 5DFAA 5CSUA 1UD3A 1JZ2A 4PMRA 3TA9A 2ZX8A 4DLFA 3IVUA 3AO0A 3CQHA 3NNTA 5GJPA 4H2CA 3P60A 3T44A 3QMSA 1Q8JA 1R38A 5BW6A 3U2CA 3H6OA 2A0NA 1S2VA 5BXSA 1UC5A 3VNMA 3LEPA 4K3ZA 1FDYA 7A3HA 5KZMA 1B1YA 3PBYA 3SUVA 2QJHA 3OVRA 2DV0A 4W87A 2WSYA 4GQBA 4AVNA 2ZA2A 3L23A 1W9UA 5AFDA 2BY2A 1U1UA 1X8CA 1R3TA 1RV8A 4OV9A 3GNRA 3DHFA 1S3HA 4DLMA 3TLQA 3BSGA 1UWQA 3N13A 2EAWA 4JX6A 3RDKA 1UR4A 1HP4A 2RKXA 1AZ1A 3MYOA 4DUVA 1E0XA 3FCPA 3MCMA 1Q7ZA 1JXJA 1P0DA 2AL1A 1KRCC 4GPNA 3SY5A 2C79A 3FA4A 1HQTA 3RGTA 2CLPA 3LBMA 4QG9A 1YPFA 1UR8A 3GFYA 2X30A 3VPLA 2VHLA 3VNJA 4QLKA 3MA8A 4UTKA 5E0KA 3QQWA 5ABTA 5BRPA 4DNMA 3DBNA 1E6PA 5BMWA 2JIWA 5I00A 5I0DA 4QEEA 5LGXA 4UTWC 1EWEA 3T55A 3F4WA 1JDEA 3SCPA 1E3XA 1ZSXA 1TRIA 3W7JA 1MWOA 1GVOA 5HR6A 4JY8A 5CJNA 3WQ5A 4JL2A 1W1VA 1EZ2A 3QR1A 3EA2A 4RXFA 2RDTA 1QW7A 3RCYA 1ZBKA 4AUBA 2PWEA 1VYPX 1CYGA 3H53A 4ZL1A 4HHMA 5CGQA 2VKZG 2PLJA 2ZADA 1MZRA 5C2GA 2VGIA 3PZMA 5EY5A 3L68A 1RALA 4Z17A 2A7PA 3VGEA 5CQ1A 2DT2A 4OT7A 1WQ5A 4IPNB 3NZ1A 1GJWA 1H63A 3DYOA 2Y2WA 2BBFA 4JTDA 5KINA 2IQTA 2ZZ1A 3TC6A 1TPUA 5K4XA 1SPQA 2QAFA 3M0VA 3CS2A 1O6IA 4GD0A 3TW9A 2V3DA 4Q22A 1XF0A 1XBZA 3L5AA 4YL2A 4HNOA 4B9YA 3G8RA 2QIIA 3V0TA 2ISWA 1N8WA 2V5JA 3VD9A 1A0DA 2CKSA 4NZ3A 6ALDA 2EF9A 3AS3A 4ZZ9A 5CC5A 3FX4A 2XJ7A 4HHHA 5IFPA 4GX8A 2QCEA 3MBDA 4XO6A 5BXTA 2RGLA 4XD3A 2Y24A 4R53A 2IW0A 1PPIA 3BLDA 1XLAA 3SRFA 1XLEA 3JZUA 3KHDA 2FHFA 3R12A 4PMNA 4ADUA 2VI0A 3ARWA 1YDYA 4FIRA 1GKQA 5DMMA 3W00A 1HL2A 1ZP3A 1YXDA 4IWWA 1DE5A 4YN5A 1IQ8A 4N9CA 2I5IA 3WD4A 5ABHA 3VIPA 2A3HA 3MPGA 4YTQA 4XK2A 4Y8EA 1UPPA 5C7HA 1TE1A 3VIFA 3TR9A 3DKJA 1PS9A 1KWGA 3A21A 3N2CA 4JFVA 2NQHA 2VXNA 4L5ZA 3F1QA 1KRMA 5LZLA 3ZFHA 1UKSA 4A21A 4ERGA 3W2LA 1QWGA 1B9BA 4UNLA 2DH2A 2X1SA 2QPUA 3WK2A 4MUZA 3HTWA 3VKCA 1F5ZA 3Q67A 4LYRA 1E4LA 4JTIA 4IPJA 1J79A 3PG9A 1PIGA 2IXVA 4CCDA 1YADA 3S6OA 1NELA 1XUZA 4XO7A 2VT0A 3KCOA 3DGRA 3MSYA 3A64A 4MKNA 4ZBCA 1B54A 2IQ0A 3W28A 3GTIA 2YIHA 3OEXA 3MMWA 4O11A 4OGZA 4Q4PA 2YB1A 1X8FA 1IIHA 2PP3A 1QDSA 1NY1A 3EGJA 3TQ0A 3GY1A 3ZT7A 2BODX 3DYPA 4PMVA 1CGTA 1LRTA 6REQB 4H4IA 2HK1A 4C6JA 3P82A 2QCLA 4EK7A 4GZEA 1EYEA 4AHOA 3AZTA 1WO2A 3OU8A 2JGYA 3UCDA 4IGNA 1Q13A 2HDJA 4J2MA 2F38A 4Q8VA 5FSDC 4WKAA 5FIPA 4KMQA 3R1ZA 5AYIA 4RK8A 1ZCCA 2VEGA 3B0VC 3G77A 3KVLA 1PYMA 3QM3A 4BQ2A 3VIIA 2NX1A 3LXBA 1ZBVA 3ARXA 3G22A 3GXIA 3BZGA 4UQ9A 5AHIA 4WDUA 3TIMA 3P2VA 2XSBA 1A5AA 1EZWA 4LVGA 1U83A 4Q7NA 1BQGA 2I9EA 1TMHA 2QHAA 4LNCA 3S2NA 1H11A 3B8UA 1FWIC 1AFSA 2VFEA 3KOXA 3P3BA 5IOBA 3VIMA 3CUFA 4J3UA 3VFLA 4OJYA 2ZWZA 2PD5A 2OQYA 3NQBA 1WDRA 3IPWA 4A3YA 5D09A 3RMJA 5H2ZA 1WB0A 1P6BA 3S2MA 1XYCA 3NL5A 3RMEA 1W37A 1B3ZA 3L4WA 4LVFA 2G5WA 1MVYA 2G3FA 3B0XA 3MMUA 3IGUA 1SO3A 3MZNA 5IDIA 2CFFA 1FWAC 2VR4A 2J7EA 5I3KA 1H7NA 1QXLA 1Q6CA 1OM0A 3AI0A 4H04A 1RQHA 5K9DA 3QTPA 1TPEA 3TN3A 1Q6FA 1O5KA 3CHFA 1P6CA 1VLWA 2HNEA 3S8HA 2HQAA 4TVUA 1JCLA 4C5YA 1QI4A 2HNHA 3WDIA 5E6ZA 4DJED 2QT3A 2X2YA 2Z26A 2HMCA 4NI3A 4AHQA 3FEMA 1HGWA 4ZENA 1W3NA 1JAKA 4WKFA 3RO8A 4NKCA 4XISA 1D7FA 4V15A 3EWBX 5IXEA 3UETA 4N4QA 4DWSC 1NTHA 4N42A 1E0UA 3FSTA 3H23A 3DESA 3OG3A 3W76A 4JZ5A