2J9YA

Tryptophan synthase q114n mutant in complex with compound ii
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
266
structure length
251
Chain Sequence
ERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLSHHLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKIIEKNLASPKQMLAELRSFVSAMKAASR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPTOPHAN SYNTHASE ALPHA CHAIN
publication title Betaq114N and Betat110V Mutations Reveal a Critically Important Role of the Substrate Alpha-Carboxylate Site in the Reaction Specificity of Tryptophan Synthase.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Lyase
total genus 92
structure length 251
sequence length 266
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 2006-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2j9yA00
3RFAA 3W1MA 2F84A 5HWNA 4N6FA 3W70A 3G1HA 5DXYA 2ZZ6A 3LB0A 1LOQA 4O12A 1I8JA 1VCFA 5CPMA 1FY6A 2Q8ZA 1FWRA 3E9AA 3TDFA 3TCEA 3B03A 2GQ9A 2GQAA 4P2VA 3WJSA 1K8YA 1WDWA 4ZMGA 4FB7A 1XDMA 1HO1A 2R8WA 4Z0SA 5D38A 4IUOA 2A4AA 1CI1A 2HMCA 2P0OA 4GE8A 4O52A 1NF0A 1WOAA 1K03A 1H50A 4LVBA 4ADSA 3KFTA 3MP5A 1UASA 5CSRA 4I7WA 5KINA 1KV8A 3BGGA 1VCGA 3UXAA 1GVQA 2A5HA 4Z1DA 1JUBA 2WSRA 1YDNA 3W2UA 3GKFA 5EBUA 4PCFA 3S9YA 1OVDA 4HPXA 4FEZA 4FX8A 4BFAA 2CWNA 3V75A 3G1AA 5LZLA 1TPH1 4JGDA 3SJ3A 5C5YA 3EX6A 1W37A 2V81A 1OFBA 2CZEA 1Z42A 1JCMP 3EWWA 3HPXA 1WBJA 4QJ1A 3GB6A 3GNDA 3PG8A 4WY0A 4M6QA 3LDVA 4IMCA 3HG2A 3TROA 3NPWA 3HPZA 4LC6A 1GYLA 3DFTA 1TYGA 1LROA 3GNNA 3NG3A 1H51A 2WOQA 4Z0JA 2ZFAA 3QQ1A 3R13A 1Q45A 3W7HA 4MLJA 1NEYA 3G18A 4IWWA 3Q37A 3KX6A 4K7VA 1OG0A 5KZEA 4EF8A 4UNKA 5F2GA 3O05A 3S1VA 1PVNA 3W1RA 5FEWA 1R46A 4AWSA 3W7EA 1TSIA 4YL2A 1P4CA 3MUXA 3W73A 4LRSA 4O13A 1JCYA 3IIVA 4UXDA 4X9SA 5AHIA 3LXBA 4IOTA 2BSLA 1ZJIA 3MHGA 1OX4A 1KTCA 3L5LA 4M7TA 3W7JA 4N4QA 4JR5A 1V7YA 3CQ0A 1JUEA 3CEPA 3PWAA 3MW7A 4JY8A 4ORIA 4I7UA 3LRLA 5D2YA 4ZQOA 4JTJA 2QJHA 4N02A 3NQVA 5TQLA 1DVJA 5CSSA 2GOUA 4GXMA 4RK8A 3W88A 3D0CA 3NQEA 2FQIA 1KM2A 2X1SA 2CLOA 4KWWA 3TSBA 4PA8A 2JK2A 1SUXA 2NUWA 3HIJA 2O7SA 3TC6A 3OHIA 2ZA3A 3UY7A 1ZALA 1TCDA 3O1NA 3L66A 3TK7A 1HFBA 2Z0IA 5F1VA 4JTGA 3PUDA 4JDBA 4S1FA 5F4WA 2DZPA 1GVSA 1PHQA 5TIMA 1RQEA 5AC8A 2WKJA 3QJAA 4U28A 3PY2A 5D33A 3MBFA 4RZ5A 3UWQA 1WXJA 4LUJA 3EKZA 1W56A 4FNSA 1FWNA 2TYSA 5I3FA 3OG3A 2CLEA 5G4EA 1QPQA 2Y7FA 3SW6A 2NUYA 3CWOX 5AHNA 5AC6A 1S5TA 4QM1A 1ME9A 2VEPA 3N3MA 3W7OA 4JS3A 5K4XA 2Z1BA 5D32A 3TFXA 5D2WA 3C2VA 1SO4A 5AYYA 1GQNA 3AO0A 3BG3A 1P5BA 2VOMA 1X6UA 1QFEA 3FYPA 4OGZA 5ABTA 2A6NA 5K4ZA 5BOOA 1OK4A 2QCEA 1NFBA 4AEOA 3CT7A 3HB9A 2ZZ5A 4Z1CA 4ADUA 4CNOA 4LY8A 4IPIA 1GZGA 2DZVA 2QAFA 3L0KA 2J24A 3PBUA 4GUGA 4DPPA 1L2UA 1FWWA 1XDLA 3R89A 3NOEA 1YTKA 4UTTA 2Y70A 1FUYA 5HQEA 4BI5A 1KLYA 1JQXA 5FESA 4DO6A 3B05A 1OF6A 2C0AA 2HTMA 4KFNA 5FF0A 8TIMA 4QNWA 1GT8A 3S5NA 1V5XA 3TW7A 3BW3A 5D37A 3C2FA 4TU1A 3QW4B 1B4EA 1TPVA 4QAIA 2NLIA 1LLZA 5C6MA 3DBPA 3L5AA 3MBDA 1OFDA 5EY5A 4POCA 3B8DA 1TPWA 2Y61A 3M0ZA 2J9YA 4UTMA 2KZHA 3A24A 1QO2A 4QITA 4MUZA 4O19A 3NNTA 3VFLA 3QPZA 3CC1A 4JEQA 4FNPA 2CLKA 4UTLA 1VLWA 2VFHA 3NR0A 5K2ZA 2E77A 2RHGA 1TV8A 5K9XA 2RFGA 2AAMA 1O4UA 3QM3A 2NXHA 3V1PA 3GDMA 2TRSA 3N2XA 3M7WA 4KKXA 2ABAA 3FLUA 1VS1A 3LTYA 2FJKA 5LKYA 5EYWA 4O18A 1OJXA 1AG1O 4GUHA 1YADA 3TJLA 4GBUA 4JYEA 3UQNA 2A6LA 4NNAA 2AGKA 2V30A 5AHMA 4A2SA 3ZFHA 1AW1A 5EMUA 1VGAA 4NJIA 4LV4A 2RKXA 1KW1A 2UV8G 4E2BA 3TR2A 4N9CA 1C29A 3UPWA 1FCUA 4O1AA 1PIIA 2B4GA 2VEKA 1JCNA 1OFAA 2BTMA 4O4VA 5KSWA 4UFKA 3MYPA 5FF4A 4G1KA 5FI8A 4KFPA 3LLFA 3H53A 2YYTA 2CZFA 3LHVA 5EPDA 1EP3A 4TX9A 2YW4A 3NPVA 2XN1A 1TPEA 3W22A 3GAYA 1XFBA 2QR6A 3NQCA 4AXKA 4NJHA 1X1ZA 3DFOA 3W7IA 1ME7A 4LTSA 1PS9A 3C0JA 3MHFA 1M7PA 1RZMA 2QUUA 1L6YA 4Z1AA 3H54A 1SO5A 4WY0F 3DI1A 3STGA 3C56A 4LS0A 3F4WA 2TMDA 4OQVA 4XTIA 1TREA 1GVFA 3SR7A 1GTEA 3S6DA 3SSJA 1JUKA 1XCFA 2V5LA 2G97A 3S1WA 1EP2A 2X1RA 1EX5A 3A23A 5K7JA 3BGJA 5G2WA 1TB3A 3G8EA 4UTTC 2B0MA 3QMRA 1OHLA 3FS2A 1W5QA 3LOTA 2V2HA 1QPOA 1SO6A 1KTNA 4AHQA 3O16A 4MY1A 1BTMA 3O6YX 3S0CA 1SSDA 3VKJA 2V9DA 1X8FA 1VYSX 3FEMA 2Y63A 3R2GA 1TTIA 5SWUA 1KM6A 3EX3A 1KFBA 4MJMA 5LNSA 4MKNA 1B57A 3LRMA 5CG7A 5HUPA 3W87A 4JYDA 4UTHA 5L6UA 3EWZA 5AOUA 1NSJA 4NVTA 3ZR4A 3NM1A 5KZDA 2A7PA 4IGHA 2JKEA 1I4NA 2DP3A 2E6YA 3HG3A 4IQLA 3IGXA 1FCQA 4CQ9A 3R5EA 4QQ3A 5DCEA 4DBEA 3N34A 2OT0A 3GK0A 3LLDA 1JCLA 3F03K 3W2NA 1LZOA 2VC6A 1R2SA 3F4NA 4RR4A 4RJEA 3HO8A 4JD4A 2VFIA 4JDYA 2CLHA 2RDUA 3LI1A 1G4EA 4UTKA 2TSYA 4N6EA 3TV8A 3TFCA 3WK2A 1YTEA 2YXGA 3QSRA 3P81A 1KBIA 2PE4A 3NQ6A 1VQTA 4YMZA 3KVMA 4TR9A 5BRBA 4PFMA 4TO8A 3M44A 2FPVA 4OWGA 5CZSA 3TXZA 1QMLA 3NEVA 1FDYA 4UIOA 4FIRA 4JX6A 5CZJA 2ATMA 4IMFA 4ONVA 1O94A 3G8RA 4N2YA 4WXZA 5FEPA 2NZLA 1EB3A 3KAOA 3FYOA 4QISA 1DJNA 4R53A 2Q8LA 5I3KA 2ZDRA 4MZYA 1SQ7A 3UZ5A 7TIMA 4IMDA 3MO7A 3G0XA 1PL9A 3M5YA 3W7CA 3RU6A 4RCXA 3C6CA 4UTUA 2ZTKA 1W0MA 3LCLA 3LCFA 1P0KA 3L9CA 4OE7A 3SY5A 4TMCA 4ALDA 4JTKA 1SFLA 1A5BA 4EOUA 4N9BA 3K30A 3M43A 4XWUA 5D05A 4O53A 2W0UA 1OX6A 4M7SA 3HBLA 3LBCA 2DORA 3W7LA 1H7XA 3GDTA 2NUXA 2VXNA 4NQ1A 1LBFA 4X3ZA 1GWJA 1ZAIA 3UZJA 4GUFA 3UWVA 3W7KA 3IEBA 3THAA 3DKJA 4AWUA 1VC4A 3UPBA 2X2GA 2ZRXA 3G1VA 1TPDA 1XBXA 3M47A 2CW6A 5F4SA 1U5JA 3IRDA 1RVGA 4NZJA 3O15A 3W6YA 3L0GA 3N73A 3ZS4A 2G96A 4DO5A 3CWNA 2X1UA 5LHFA 4XKYB 2ZA2A 2QCDA 3L0NA 3TH6A 3RK8A 2V2CA 3L65A 2FPTA 1O95A 1ZAHA 1TO3A 1TQJA 2PRLA 2E5BA 3UWYA 1K7EA 4MPQA 2J88A 4W9TA 1ZHAA 2FFCA 4O16A 2YPIA 3GX9A 4UC5A 2WNZA 4X22A 5GVJA 4HN4A 1EUNA 3TC7A 3PF3A 3BK0A 2YR1A 4RV8A 3QSTA 3G1XA 2XFWA 1LRNA 3ABOA 1MZHA 3PULA 4PC8A 5AB3A 3TSDA 1G4PA 3W7RA 3LV6A 1PCWA 2HS8A 1QAPA 3OA3A 4R33A 5HWJA 4DO4A 5E93A 4RZ4A 2EPHA 3B06A 3G3DA 4UFHA 2FB3A 4H4IA 5BMWA 4CNNA 5BW6A 1NVMA 2V2DA 2EF9A 3W7QA 1THFD 4K8EA 3A5VA 3JR2A 3NGJA 1HL2A 3A5FA 3LCXA 4WUIA 3E96A 2ZZ1A 4AAJA 4D2JA 3DI0A 1L6SA 2HS6A 1Q3NA 4L4MA 4RKAA 3O6DA 1W8SA 1ONRA 3GZ3A 1K3UA 4A2RA 2NX9A 4CCEA 3HGSA 2GJNA 3FJ6A 1RR2A 2FDSA 3QQ0A 1JQVA 4KFOA 4HIBA 1AW2A 1SSGA 1O60A 2ZZ3A 5DLCA 1VJIA 4N9EA 4A3UA 3UWUA 2ZYFA 2FLIA 2RDTA 1FX6A 3P61A 3DU0A 4GC4A 2Y85A 5EKYA 4ZVJA 3VI2A 3I7QA 1DL3A 4LOCA 1F6KA 4YLWA 5G2HA 1XBYA 4Y96A 1RQHA 5A5WA 3S5YA 1Q6QA 3FA5A 4NU7A 1G7VA 1IGSA 2A21A 3TQVA 1D3GA 3W83A 3IIOA 3FKRA 4HPJA 3O63A 3IIXA 1L6WA 5D2XA 1MEWA 5F2IA 4E2DA 3CIXA 3GAKA 4O54A 5TBOA 4K37A 3EX4A 3DZ1A 5D30A 1XXXA 2QCFA 3WJYA 4RX0A 4ZQRA 1TJPA 4DF0A 3NL3A 3PVFA 3SI9A 2C16A 1IIGA 2GVGA 4UTIA 2VFGA 3VE9A 5AYXA 4PL1A 2GVLA 1ICQA 3LV5A 2QCGA 2E6DA 4LVAA 5CZ0A 4MZ1A 3STEA 1VR6A 3W74A 2DZSA 3SZ8A 5KITA 1FDZA 3CHVA 1DORA 3G1YA 2QCCA 1HO4A 3QC3A 2W6RA 3IVSA 2I14A 4Y90A 1I2OA 1W3NA 1KLZA 3GR8A 4ORMA 1UJPA 3ATZA 4I9AA 4CQ8A 3EXTA 2W79A 3DAQA 1SFJA 1PCKA 5D02A 3CU2A 3NL6A 3LRKA 5G5IA 1JULA 4C1LA 1SZFA 4JTLA 4WJEA 3H55A 2QCLA 3DGRA 3NA8A 4AF0B 1A5AA 5H91A 1W54A 3EX2A 3A21A 4EIVA 1FXQA 1JVNA 1FXPA 3EXRA 5I3GA 2FPYA 1S5WA 3OBKA 3W1UA 1VYPX 4YCOA 4IPJA 2YYUA 3LXCA 4I7VA 2CLFA 3KVKA 3WJWA 5DBTA 3TE9A 3UY8A 1ZNNA 4CLMA 3MJYA 6ALDA 3M6YA 3BG5A 1G4TA 3IVTA 5DY2A 3W3OA 4UR8A 3LGEA 5HWMA 4YWIA 1H7PA 2ZZ7A 1VLIA 5MHBA 3MMTA 3MYOA 4JNMA 3UD6A 2ZRZA 3IGSA 2E5CA 4O17A 1QNVA 1EWEA 2DJXA 5BMXA 1MO0A 2QUTA 1TV5A 3CEUA 1H63A 2NX1A 4UR7A 2RDWA 1H7NA 2DZXA 4HNTA 1H61A 1ML1A 3NQ7A 1JCJA 1T96A 1DQXA 2PRHA 2FTPA 2C13A 4FIQA 3N9SA 4B5NA 2X16A 5CPNA 3W2KA 1ME8A 1A53A 3QMSA 3LHUA 1N7KA 4HHPA 3CIWA 2QAPA 2WSYA 2F7FA 4JTEA 1QPRA 3LBMA 3NO5A 3DFPA 4O0KA 3W7NA 1W31A 3NM3A 4GUJA 2C3ZA 1MEIA 1SU5A 2WNQA 3WJXA 3FJLA 1I2QA 3EXSA 3PS7A 3LM7A 4IMGA 1A50A 3M41A 4S2BA 4XBKA 1WOBA 1H5YA 4NNCA 2ISSA 5AHEA 4Z08A 1KM3A 1E51A 4CQAA 3M16A 4LV9A 3W2LA 4EWND 1B4KA 1TV7A 4P61A 2NXIA 2RH9A 3W7MA 4MYAA 1YPFA 2E68A 1DKWA 1YXCA 4CNPA 1YLVA 3LCIA 2YDAA 4IXHA 1G7UA 1YYAA 3P60A 5D2VA 1BKSA 2WNNA 3QF0A 3ATYA 3G3MA 4GFSA 2HSAA 2YW3A 2ZBTA 4XQ6A 3PC0A 3WFAA 1VRDA 4JTUA 3RLVA 4HSOA 4BI7A 1EPXA 1OFRA 4ZQMA 1J5TA 4BK9A 4IMEA 5D03A 2J9XA 1UUOA 3W1AA 1GYNA 3B0VC 2YZRA 3O8AA 3PBWA 1VHCA 4JTFA 2LLEA 3NQ2A 5LSMA 1Q6OA 5HNRA 4YCPA 1OX5A 3P84A 3KRZA 5C54A 2R94A 3NZRA 3QW3A 3W1QA 3L68A 1QDSA 1XKYA 4WZHA 4HNNA 5CKSA 2FB2A 3QYQA 1TPB1 4AH7A 5F2LA 3UXDA 3P82A 3BLEA 1BEUA 3NYZA 3QFEA 3C8FA 3QPYA 1YDVA 3LI0A 3IGUA 1T99A 4PTNA 1I2PA 4MVAA 3W76A 1P1XA 3GDLA 2V8ZA 4LWWA 4DF1A 2YGYA 2E09A 2DZTA 1JJKA 4DELA 4UTWA 4OV9A 3FKKA 4FO4A 3P67A 3E0IA 5IBXC 1YDOA 5I3HA 3LTPA 3QZEA 3HG4A 2GJLA 1OYCA 4GJ1A 4UMBA 5C55A 4NX5A 3P8JA 4FNUA 1ZENA 3DFNA 3E02A 4AB4A 3LX9A 4MY9A 4O57A 4LT9A 4NZFA 3TQKA 1I2RA 2Z2UA 3N9RA 3KVJA 4FNTA 5HINA 2EHHA 4QNEA 5U4NA 5I3JA 1HUVA 1TMHA 1ZAJA 1EEPA 1K7XA 4XZ9A 4N4PA 1WAUA 3S8HA 4JTTA 3PUEA 3VNDA 1K02A 4O1DA 5KZMA 1R2RA 1SPQA 2CFFA 4R34A 4LVFA 4NX0A 2WV8A 5KMYA 4MYXA 3GXTA 1KV5A 4RXFA 3N19B 3W1NA 2ZCGA 1FDJA 3QH2A 4MFEA 3NQDA 3T7VA 3DXIA 2VKZG 3NXFA 5HR6A 2J27A 1VYRA 1W3TA 1SZGA 2JKPA 4IX0A 2CZDA 3U2OA 1TTJA 2A2IA 3EKLA 3GIYA 1A5CA 1O5XA 4H6KA 2QCDB 2BWGA 3NVTA 2QDGA 3C3NA 4WXYA 4CCDA 1Z41A 4IX2A 3STFA 3NDOA 3HGOA 1EP1A 4X2RA 2C19A 1R30A 1LP6A 2BX7A 4E0CA 3DHFA 3L5MA 1UUMA 1FWSA 1AMKA 5AN7A 4A22A 4DQWA 2J6XA 1OFEA 2PRMA 4AHOA 1LRQA 1TRIA 1H7RA 4PODA 4A29A 2YFOA 3TA6A 1G67A 2CLMA 1GJPA 2A1YA 2CZ5A 3ELFA 3TIMA 2BLEA 2B7PA 3ABQA 3LHTA 4NXKA 4Y8FA 1DHPA 3E12A 1X7FA 4FHAA 4O1BA 4OBTA 5LNVA 1I2NA 4HNUA 4FX6M 4WX2A 4O11A 5DN1A 4WY0B 3NPXA 3NL2A 3W84A 3CLMA 3UWZA 5G1TA 1MEHA 1TIMA 1QR7A 3CM4A 1P0NA 1AW5A 1PV8A 5DXXA 3CPRA 4NJKA 1G69A 3INPA 2I1OA 1Q6LA 1FWTA 3IVUA 4M19A 5D2TA 1LCOA 1UBSA 3RNDA 3JRKA 5A8GA 3ABSA 2ZRYA 2E1DA 4MJZA 3BVJA 2V5BA 4XUGA 3MI6A 4JTSA 4C1KA 1QWGA 1I45A 1B3OA 5FEZA 4UTWC 1LM1A 3WK0A 1R2TA 3R8RA 4HSNA 1W5NA 3S5OA 1XBVA 3G22A 4K8HA 3T44A 2IQTA 2ZRWA 1OX4B 3C2RA 3LERA 1M6JA 2QEZA 1KFJA 2DU2A 2NX3A 3PBVA 4UNLA 1D9EA 3GDRA 3GLCA 3CTLA 3PAJA 3T55A 4LS2A 2E6AA 4K7YA 1C8VA 2VELA 1DOSA 2ABBA 2VEIA 2NV2A 1JRCA 3P62A 1AL7A 2QJIA 3ABRA 3TUUA 3TX9A 1XUZA 4BWLC 5CGQA 2ISWA 4Q32A 4IJBA 4ML9A 2CU0A 1F2JA 3BO9A 3W72A 3GXNA 3DH7A 4O0ZA 5KTLA 3BLIA 4NJGA 1F5ZA 2CLLA 3BW4A 3NPUA 3LCGA 5FF2A 4JX4A 1OF8A 1Z48A 1SW3A 2OMAA 2CLIA 1B9BA 3M1ZA 1DJQA 5AC7A 3LCHA 4NUWA 3UWWA 1F05A 4FX7A 3HOJA 3W7GA 3KRSA 3BLFA 3M9YA 5DBUA 2VFDA 1F73A 3EWXA 3OVPA 3I68A 1RQBA 1GEQA 5DCBA 2O7QA 1FCVA 4O14A 1H7WA 2A7NA 4OHQA 1TPFA 1KA9F 1H60A 4UFJA 3Q2DA 2Y7DA 2A0NA 3GKAA 3P7YA 3R12A 2DJLA 3NQGA 3NZ1A 1F76A 1Z44A 3DHDA 1HG3A 5LNUA 1ZCOA 3PSVA 3P5YA 1H1YA 2Y7GA 2R91A 4OV4A 5LHEA 1OYBA 3W85A 3T78A 3S1XA 5K9DA 3BV4A 1GTHA 5FF7A 3VCRA 2ZRVA 4FNRA 3B04A 4AHPA 3WK1A 1XM3A 4MIMA 4HT3A 3KVLA 2BZNA 3SFKA 4DF2A 2C14A 4NXSA 1ZY9A 1F7BA 4QSHA 1LBMA 1AL8A 1QOPA 2B7OA 1VPXA 4LVGA 1UB3A 2V0TA 4Z1BA 2ZA1A 5AYZA 1MXSA 5HMSA 4NNBA 1QPNA 1XL9A 2ZQ0A 1GG1A 2GUUA 5DCDA 3W75A 3PR2A 5E0KA 1HTIA 3Q94A 3TKFA 3NQFA 4K38A 2EGZA 3KOFA 4M6VA 1EA0A 3RLUA 3W1XA 3P8IA 3P5ZA 3PB0A 4S2CA 1FBAA 1JR1A 3N2MA 2V82A 4CCCA 1EIXA 3KRUA 4O50A 4JYFA 3LHZA 4O28A 4XKYA 3C61A 2C18A 1TQXA 3C4UA 1WV2A 4LRTA 2WJZA 2ZRUA 5K3VA 3GVGA 3OVQA 2E5DA 3PM6A 3I65A 1LOLA 3IV3A 2GVJA 5LNRA 3G1SA 5E1QA 1JRBA 3HJZA 2R14A 1YXYA 4OT7A 2QJGA 3ZWTA 1IIHA 2XN0A 5D04C 1UCWA 4M6PA 2TPSA 4FNQA 3NL5A 2G5WA 2JGQA 1MSSA 2OT1A 2B7QA 1IXQA 5F1UA 1DV7A 1W5OA 5AHFA 1JCXA 3Q58A 1VH7A 3OVRA 3W86A 4RXGA 3FOKA 4JIQA 4UFIA 3WK3A 3U6WA 4ZQNA 5J5RA 3F1QA 1CW2A 4NJJA 4N9DA 5LNWA 5LGZA 3DENA 3JS3A 3QRHA 3LXAA 6TIMA 2OJPA 3ANYA 2ISVA 3MP3A 2Z6IA 1IXNA 1KBJA 1W3IA 2QKFA 4GUIA 3BARA 1J4EA 4MY8A 4O8RA 5IBXA 3TNOA 4RZ6A 2A85A 2H6RA 2QF7A 1KM5A 1OFOA 1TJRA 3N14A 2EAWA 2JGYA 3HMJG 1GPWA 4JY9A 4A21A 3IIPA 3A9IA 1G6CA 2C1HA 2WPBA 1VHNA 2NWRA 4WOZA 2QCNA 3GR7A 2PC4A 3S42A 3EB2A 2C6QA 4FXSA 1EWDA 2VENA 3C52A 3TU9A 4LUIA 1LLWA 1KM0A 3NQMA 3TAKA 1PHWA 3MI2A 2P1FA 1ADOA 1OABA 1RD5A 4MFDA 1XC4A 3U8GA 1C9DA 4ADTA 3W1LA 2JKAA 3PUOA 1LDCA 3I7SA 5EA9A 3SGZA 2A7RA 1LOSA 1Q6RA 1WYIA 4UUIA 4DPQA 1M7OA 2VEMA 1G4SA 5AHLA 1OFPA 1LYXA 3YPIA 3NQ8A 5HULA 1J2WA 3HGJA 5G4WA 2QCMA 3TXVA 3BW2A 4HKPA 3I6RA 2Z6JA 2Q3RA 4UFLA 5LGXA 1DQWA 2Q3OA 1ZFJA 4J9JA 1TTPA 2Y62A 4JN6A 1YTDA 5IM51 3LHWA 5G2IA 4UMAA 2OX1A 3TAOA 2I9EA 3G1FA 3G0SA 4FF7A 3C2EA 3RMJA 3W2JA 5HR7A 3QMTA 4MOZA 2VFFA 1KFEA 3SIZA 3E49A 4JX5A 5F4XA 1QO5A 3MHUA 3W7DA 1FCBA 3W7PA 3P80A 4Q33A 3S1UA 2WQPA 1WA3A 1W5MA 4IXXA 3TJXA 4JTIA 4RLIA 3WJZA 4Y9AA 1LRTA 3MWAA 4Y6GA 2X1TA 2Y88A 4ZQCA 3W23A 1EUAA 4WOQA 4BI6A 3RF9A 5FEXA 1L9WA 3QEZA 1IXOA 1XBZA 3B0PA 1SZEA 4GNJA 1ALDA 1O5KA 4EF9A 4JIPA 1SZNA 1GVRA 1FQ0A 3USBA 1OYAA 1PE1A 1AK5A 4ICNA 4AF0A 1WX0A 2Y6ZA 2H8XA 4NT0A 5BNKA 4LNYA 3MP4A 2QCHA 2C15A 1YPIA 5DY3A 5H2ZA 1BWLA 1LORA 1SW7A 2NWSA 2ALDA 3T40A 4WD0A 2FIQA 3EEGA 1RV8A 4JICA 2OZ0A 4DEFA 2G95A 3BPWA 4AMAA 3GDKA 3CB8A 1GG0A 1KFCA 4U4MA 1S3HA 3PG9A 2E6FA 1F74A 4AWTA 3G0UA 4PH6A 1XI3A 3DFQA 4ZZ9A 1GVOA 1T8XA 2ZZ4A 4GRSA 3DKLA 3P74A 2H8ZA 3SECA 5L9FA 3W9ZA 5I3IA 3LCWA 2GQ8A 5F2MA 3W07A 2YSWA 1WBHA 4K39A 1D3HA 2Y7EA 4PEKA 1W5PA 3HG5A 3EX1A 2H90A 3HQ1A 5J5DA 2NXGA 4UFMA 3W2MA 3KHJA 1K8XA 1CX9A 3OIXA 5EL1A 4YXGA 5U7SA 2WO5A 2P10A 1TRDA 4OU1A 1N8FA 1F6PA 1H1ZA 3TMQA 1KM1A 1DBTA 1H62A 2D73A 5DELA 4BWLA 3STCA 5CPLA 5K9CA 1K8ZA 1SW0A 1KFKA 3NAVA 3TW6A 3LTSA 3BG9A 4K36A 1KM4A 2WSQA 4LW7A 4O10A 4WQ6A 3PBYA 2DZUA 5G1YA 3M5XA 3B4UA 3W1TA 3L2IA 3TQ0A 1ICSA 4AVFA 4JTHA 2AQWA 4TMBA 2DZWA 3UNDA 2Y89A 4LVDA 1A5SA 1XUUA 2B7NA 2XN2A 1OFQA 2VFEA 1QCWA 5D09A 4PL2A 2X30A 3W1PA 3THQA 4H3DA 2PCQA 3DFSA 5T26A 1KTBA 1R47A 1KFLA 3HF3A 4R7JA 1N55A 3TMLA 3OEXA 3PB2A 4BR1A 5HJLA 1BWKA 3W71A 1ICPA 3LHYA 4O4WA 1K7FA 1W1ZA 4BF9A 1YXDA 3A22A 3GXPA 1U83A 1RPXA 2BXVA 1VZWA 2ZZ2A 3HPSA 1S5VA 3EWBX 1WQ5A 3NQAA 3UYCA 1LTDA 3PSWA 4L4LA 3B0UX 1H7OA 1T0OA 1TPUA 2YX0A 1OK6A 4K6AA 3M5VA 1IXPA 2J9ZA 2GPTA 3G24A 5CZTA 4O15A 4E38A 3C2OA 1TTQA 5FF3A 5CPOA 3TSMA 1X1OA 1SO3A 2YFNA 3O06A 1VCVA 1IF2A 1TPC1 2H3BA 2H3DA 4DXVA 4ZL1A 3I7RA 3O07A 4ZQPA 3T4CA 2ZTJA 4LS1A 4LU0A 3EWUA 2ATSA 3MI3A 3L67A 4GWEA 2YCEA 3SGUA 3VE7A 4EVZA 3HGRA 4TIMA 2QDHA 3IIZA 4MZ8A 1LBLA 3G1DA 3L21A 1NAL1 4MLRA 4FXRA 5AFDA 5C2XA 4KWVA 2QUVA 3EWYA 3GYEA 4M5PA 1SR9A 1M5WA 1GOXA 1QOQA 3FFSA 5HUOA 3AJXA 4LC8A 4UCGA 2EKCA 2JBMA 4UTJA 4XTDA 2NV1A 1NF7A 3FIGA 4XBSA 2PURA 4HNVA 4UMCA 3KXQA 4JXCA 4QIUA 3S5ZA 3ZWSA 3O6CA 4Q4KA 2OCZA 3M5ZA 4DBDA 1Y0EA 4O1CA
chains in the Genus database with same CATH superfamily
3XISA 4AEFA 3LUTA 3G1HA 1X7IA 4O12A 1I8JA 3RN6A 1XG4A 3CAVA 1VCFA 4Y2WA 5CPMA 4GKLA 3D47A 1CXLA 3B9NA 3BCFA 3TCEA 1A0DA 1BQGA 3IUDA 3AHTA 1WDWA 4FB7A 3TJIA 2R8WA 4Z0SA 4QDMA 1HW6A 2HMCA 1E73M 2P0OA 2O9PA 1EYEA 1JYNA 1NF0A 4C6NA 3UJ2A 2CPUA 3G77A 1EXBA 5CSRA 4I7WA 3H2CA 3BGGA 1XSKA 2OSXA 2A5HA 4Z1DA 1NFPA 3GKFA 4PCFA 4KGJA 1OVDA 4HPXA 1TR9A 4BFAA 5ABGA 3UW6A 4E8GA 4XX6A 3SJ3A 1E56A 4PMRA 1WBJA 3GB6A 2XIQA 3AMDA 2QGYA 4WY0A 3MUAA 2XDFA 4M6QA 2BGSA 1A3HA 3U4AA 2OPJA 3STPA 3FSUA 3TROA 2OGJA 4ES4A 3GNNA 3DFYA 1H51A 2Q01A 2DEPA 2QNEA 4Z0JA 1E9ZB 3S6TA 3R13A 3W7HA 4J40A 2WM0A 1C8YA 2QV5A 3N9KA 1PPIA 1J93A 1UD8A 4C6DA 1U30A 3DUGA 3W1RA 1U1JA 5FEWA 4PBGA 5E6YA 4LEFA 4Y9OA 1XIIA 3S2LA 1GZJA 2PDQA 3SCPA 1P4CA 4NAFA 4NSBA 2VCAA 3MUXA 4LRSA 3REQA 1ECEA 4IOTA 2BSLA 1V0NA 2PDUA 2F2HA 2W27A 4N4QA 3T42A 1H09A 4GY0A 3VOHA 1XIFA 1B2YA 3MW7A 3MY9A 2WCSA 3KOWA 3OGVA 1NU5A 2Z1WA 5TQLA 4I9JA 3IJQA 2VWSA 4L65A 4ZR8A 3W88A 3NQEA 3TCSA 3GYCA 2V3FA 5EMLA 2CLOA 4PB4A 1CTNA 1KO0A 2KAUC 3OP2A 4IFKB 2BS9A 4H41A 4G7FA 3NTYA 1SVDA 4JKMA 1TCDA 3O1NA 1KWKA 3VX0A 3UU0A 4GZ7A 3I4EA 1HFBA 1FFQA 5F1VA 3FA3A 4KCTA 2DZPA 3QOKA 1RQEA 1L8PA 4CVWA 4FLSA 4RZ5A 3IJDA 1FHUA 4LUJA 4FNSA 1FWNA 2TYSA 3OG3A 2CLEA 2VRQA 4B15A 3RUBL 5D32A 3OBAA 4A8NA 1B9ZA 4Q6JA 1GQNA 3PZIA 2EPNA 1X6UA 1QFEA 4K68A 3TR9A 5FL1A 1OK4A 3I10A 2QCEA 3CT7A 1W1VA 2Z4GA 4CNOA 4LY8A 4IPIA 1XFCA 1KBBA 4BQ5A 4CN1A 3PPGA 2EG6A 1D7FA 1GZGA 3L0KA 4HU0A 2J24A 1GUVA 1JDDA 3ZR5A 4DPPA 4HA3A 4W7WA 2Y70A 4CVUA 4L6DA 3CQJA 3UXLA 2DFAA 2ESCA 1KLYA 5FESA 4DO6A 3B05A 4L1WA 1SMAA 2A79A 2C0AA 2HTMA 3F5LA 4DM1A 2O56A 3AICA 2VR4A 2AKZA 1PKYA 1ZCCA 3BLPX 3DYPA 5D37A 4HPNA 3QW4B 2ISDA 4QAIA 3MDUA 1MW0A 3DBPA 3L5AA 3MTWA 1KXTA 1TPWA 4R7WA 2J9YA 1ZJBA 2V38A 2KZHA 3A24A 1QO2A 4QITA 3WLSA 3BGAA 2W67A 1QI5A 2R1KA 3LNMA 3LA4A 1ZJAA 1EBGA 1RY0A 3KBVA 1HF6A 2O9TA 5K2ZA 2DT2A 3AHXA 3FX4A 3M46A 3QM3A 5ABFB 4MWAE 1ITQA 3N2XA 4KKXA 3B9DA 1UW9A 1W1PA 3FLUA 1VS1A 3LTYA 1ZBVA 3TVAA 5LKYA 4D1IA 4O18A 1EC7A 2C0HA 3TJLA 3PWGA 2AL1A 1VBJA 1AW1A 4P7NA 1MNZA 4ASTA 3VUSA 1KW1A 1Z3NA 3ZT7A 3KL5A 3GHSA 4E2BA 4QGCA 5E0CA 2CERA 5A94A 4ERAA 2DQWA 5A6LA 5KSWA 1OCBA 4QRNA 3UA3A 3HPFA 4KFPA 1JAKA 2PFHA 1B3ZA 4BY3A 1UA7A 2VRJA 4JFTA 2X8RA 3W22A 3BJTA 3GAYA 4W8BA 3QR0A 3KOZA 4AXKA 4AFYA 3C0JA 3MHFA 5FKYA 1UKTA 3BWWA 2WWDA 3RXZA 1RZMA 3OW1A 4AY8A 3IJIA 2SFPA 3C56A 1V02A 1HJUA 4JQ1A 2TMDA 4RPPA 1TREA 3SY1A 1GVFA 3R8HA 4PCTA 2H9AA 4GPNA 4LBRA 4DYEA 3SSJA 2ZIDA 3PFMA 2G97A 4LF1A 5G2WA 4ATLA 3PJTA 3QMRA 3WLQA 1PJ9A 2XIOA 1QPOA 1POJA 4HHHA 4AHQA 3GVRA 1K70A 2YLAA 5C9ZA 3DEQA 3S0CA 5DF0A 4QEHA 1SSDA 3LZ5A 3WMLA 3FEMA 1TTIA 1KM6A 3QZ6A 5D8ZA 4MJMA 1B57A 1R85A 4M51A 1H41A 4AIUA 3WLJA 4UOQA 3KDNA 4IGHA 2W62A 2JKEA 5XINA 1I4NA 4EP8C 5E9XA 1FCQA 4FSAA 4HPHA 5PTDA 1OCJA 4DBEA 2PZ0A 4NRRA 3G5EA 3APYA 1LZOA 4Q8TA 5A69A 5T9CE 2VC6A 3WL0A 4JD4A 2X42A 1ZRQA 3LI1A 1G4EA 4UTKA 1EJTC 1R3RA 5GNZA 5C9XA 3TFCA 1ZL1A 1TWSA 1VFLA 3JU2A 4DJED 1QNSA 2PEVA 1B3YA 3H2MA 1PTGA 2OQHA 4PFMA 2PI6A 3N2OA 1GOIA 3APTA 1OT1A 2D24A 5HATA 4FIRA 2QXWA 5CZJA 2ATMA 3MV11 3ZO9A 4QISA 2PDYA 2C71A 1DJNA 1GNXA 1UWAA 2ZDRA 3W53A 2I5GA 1Y7VA 2PP3A 5BXSA 3MO7A 1JD9A 1PL9A 3M5YA 1T5AA 2ZTKA 4F9JA 2Y5JA 2CKRA 1P0KA 4OE7A 1A5BA 4EOUA 4DBWA 3K30A 1R9XA 4XWUA 1FOBA 5CQ1A 2OEJA 3BV7A 1OX6A 4M7SA 1SM9A 2DORA 4Q4QA 1H7XA 3GDTA 2NUXA 1UWTA 1RHCA 4NQ1A 2QVHA 2HE5A 1LBFA 5AKQA 1RAKA 1GWJA 3ALGA 4JTRA 4GUFA 1AJZA 3W7KA 3HMCA 3ZVIA 4AWUA 1B3XA 5DRCA 2X2GA 1BKHA 3G1VA 3FJ4A 1TPDA 1HVQA 3M47A 4LBUA 3VNLA 3ARZA 2JE8A 3W6YA 4L80A 5AC5A 5D4YA 2X1UA 3LYEA 2Y2WA 3GDBA 5FJUA 4DJEA 1P0DA 4B3LA 5HNNA 2BOGX 2ZXAA 2FFCA 4QS5A 1HJXA 2Y1HA 5GVJA 2J7HA 4Z17A 3MC5A 3WZ0E 1AUSL 1EUNA 2GQ3A 3PF3A 4QG8A 5IRPA 1CLKA 4KRTA 2YR1A 4E3TA 2PDFA 1TV3A 3G1XA 3JZUA 3AU2A 4NI3A 4PC8A 3W7RA 3LV6A 1PCWA 2HS8A 5AC4A 4AX6A 4UOZA 1QAPA 4BF7A 5E93A 1LL7A 4RZ4A 3WELA 2EPHA 2PA6A 3G3DA 1PYMA 4CNNA 5BW6A 3MANA 4GVFA 3WLPA 3AROA 3NGJA 1K9TA 3A5FA 4WUIA 3KL0A 1L6SA 1K9DA 3O6DA 1W8SA 2OWXA 1ONRA 3GTIA 2INEA 4ROQA 2NX9A 2PTYA 2GJNA 1KNWA 1RY8A 4HIBA 1V93A 3RPTA 3VYLA 2ZYFA 1K6WA 3ZYZA 2RDTA 4KEMA 1FX6A 2YBTA 4P5UA 1L0PA 4PULA 4PTMA 4ZVJA 3VI2A 3WDQA 4ZENA 3COTA 5G2HA 4W7VA 2XFFA 2WM1A 1BWVA 2ZVIA 3K8LA 4F9DA 3SRKA 4NU7A 3SADA 1G7VA 1QHOA 3KEHA 3QY8A 1E3ZA 3TQVA 4A3QA 3AZSA 1F4HA 4S39A 1GHRA 3FKRA 4MTVA 5LA2A 4HPJA 3ANVA 3IIXA 1O12A 4E2DA 4KEVA 4O54A 3ITOA 5TBOA 3EDDA 1CDGA 3DZ1A 4X9YA 4U5KA 4B5UA 2O55A 2GVGA 1XLEA 9XIMA 2VFGA 4M3PA 4U2YA 2BGNE 3LV5A 3NIYA 2Y5SA 5CZ0A 3TYDA 3W74A 3DFHA 1S2AA 3G1YA 2NVDA 5HQLA 3L2LA 3SB0A 2Z2AA 4IG2A 4K3ZA 4ORMA 3EOLA 4LUSB 3EXTA 5EMKA 4DJEC 3Q45A 1PCKA 3RM9A 2PTZA 3H7RA 3BC9A 4C1LA 1SZFA 4IMAA 4WJEA 2QCLA 3DGRA 1A5AA 4NILA 1C7TA 5H91A 1P7TB 3RLHA 3VIKA 1AQMA 2FH8A 1E6RA 5BU9A 2V68A 1X6LA 2IPFA 4V28A 4YVPA 1VBHA 1VYPX 3I6EA 1DWGM 4LAOA 2CLFA 3KVKA 2EPLX 6ALDA 5A6AA 4HZ8A 2Z7KA 1NWTA 4YWIA 1VLIA 2CHRA 5GJMA 4JPGA 3OZYA 2E5CA 2QJMA 3APGA 4OFCA 1MO0A 2YBUA 2NX1A 1Q5MA 2ZWZA 2RDWA 2DZXA 4HNTA 1H61A 2FTPA 5EFDA 3N9SA 2XYLA 1MDLA 3M0IA 5CPNA 2OVLA 2CXGA 5E70A 1ME8A 3ARRA 4YYCA 4D72A 1N7KA 2WSYA 4I9TA 2F7FA 4IP7A 1QBAA 2WVVA 3NO5A 4O0KA 1W31A 2VD9A 4GUJA 2HCVA 1SU5A 3WJXA 4MAZA 1J0KA 3PS7A 4IMGA 5AHEA 4NNCA 2ISSA 1UR1A 3E2RA 4CQAA 3A3XA 4LV9A 1B4KA 1E43A 3W7MA 1RALA 4Q7BA 1UD3A 1YXCA 4CNPA 4GYKA 3K2GA 4LUTB 4IXHA 2R24A 5D2VA 1S5MA 4GFSA 1QK0A 2CEQA 2YW3A 2ZBTA 3S3GA 3PC0A 3WFAA 1OY0A 1VRDA 4NF7A 3PANA 1D8WA 1O5RA 3C2YA 4C6QA 5A6KA 1NM9A 2J9XA 1GYNA 3B0VC 3WLTA 1EJRC 5KZ6A 3CV6A 2LLEA 1FTXA 1KRBC 5IFPA 4AVNA 3GG0A 3WD3A 4X0VA 4X0NA 3QW3A 1I9CB 2FB2A 4GNKB 3EPOA 1F4AA 2ZUTA 1I6NA 3P82A 1TWZA 3BLEA 3QFEA 4ATWA 3C8FA 1YDVA 3LI0A 2OG9A 1EJUC 1JYXA 2W61A 1BXBA 3W76A 5GQBA 3WDHA 4A8RA 4KF1A 2YGYA 2PPGA 3GO2A 1S3TC 3VPLA 5IBXC 2VUYA 2WCAA 4MPKA 1J79A 5I3HA 1L6FA 2PUZA 3V5CA 4A8LA 1RH9A 1T41A 1M9HA 4UMBA 2DSUA 3VX1A 5C55A 2E28A 4FNUA 1O7AA 4DWSD 1OC7A 4MY9A 4O0QA 1A5MC 3KVJA 4C6JA 1TMHA 1ZAJA 3TZFA 1EEPA 1TE1A 4N4PA 2DZAA 3FW6A 3UZXA 3S8HA 4OZOA 3N04A 1Q6EA 2WAGA 3SN0A 3PUEA 1WXZA 3UGVA 4ZO8A 2WV8A 1XS2A 5KMYA 2P50A 3RM8A 2WKLA 3N19B 3W1NA 1RA0A 3EB4A 4MFEA 1OQFA 2RGMA 4P7OA 4TX8A 5HR6A 2J27A 4PR4A 2VDGA 1MDRA 5AZ1A 1SZGA 5CBBA 1RXOB 2BV9A 3B97A 2EEXA 1QOXA 1TTJA 7ENLA 3IRSA 4JNYA 3EKLA 3W26A 1O5XA 1XLGA 1QT1A 3LSCA 1N82A 2BWGA 3NVTA 1H1NA 3C3NA 2Z1SA 4IL2A 4AISA 3HGOA 1CT5A 1KKOA 3CL6A 1BSLA 1ADDA 3EMQA 3DHFA 1FWSA 1AMKA 3GW3A 4I6VA 3PTMA 3QTGA 1LRQA 1TRIA 4RW5A 1W2VA 3ZR6A 2YFOA 1GJPA 2HDJA 3GRIA 3LM3A 1TV4A 5GNYA 3LHTA 4DWSA 4EXAA 2WZEA 4XAZA 4R85A 5CEWA 1I2NA 2NT1A 4HNUA 4O11A 5DN1A 4ZOCA 3ES8A 3CLMA 1Y5WA 1C8XA 1ITXA 1XIBA 3R94A 3CM4A 3NDYA 3RPMA 5LIUX 4Q8UA 5HXMA 4G8TA 4DX3A 4MG4A 5A3HA 4NJKA 1VJZA 3M0VA 4HP5A 5HPCA 2ZUWA 1Q6LA 3WQPA 4EPEC 3H7VA 3IVUA 3NURA 4EACA 5HPOA 1LCOA 5A8GA 2XU2A 3ZT6A 2E1DA 4MJZA 2V5BA 4MMWA 3N11A 3KS6A 1NDYA 3VOJA 4LFYA 4IF2A 1LM1A 1R2TA 3QN3A 3S5OA 4ENLA 2ZRWA 5E6ZA 1KFJA 2WK2A 3PBVA 2GGJA 3MKCA 4HMEA 3VD9A 3PAJA 2VHLA 1C8VA 4JKLA 1DOSA 2NV2A 3M7SA 4PMDA 2DT0A 1AL7A 3ABRA 4UQEA 1UMYA 1A49A 3TX9A 4BWLC 1EF3A 4US6A 1LF1A 3AUOA 2QULA 1QI4A 1ENUA 4D6JA 3LEPA 1L2QA 3CMJA 4GKTA 1IT7A 1VFOA 1HJVA 1GGOA 1ISYA 4CD5A 3AHZA 5HQMA 4A3HA 2DDXA 3NJ3A 1Z48A 2OMAA 1DJQA 4CU7A 5AC7A 4FX7A 2ZXQA 3HOJA 4LF2A 3W7GA 3KRSA 3BLFA 2OZTA 3CV7A 2VQUA 4I6KA 2FTYA 4TXEA 5FACA 1GEQA 4IG2B 3VGGA 4GGBA 3GNOA 4F2UA 1UD5A 1TPFA 4FI4A 1I60A 1TR1A 2Y7DA 2W4XA 3NZ1A 3DHDA 3CZ8A 3P5YA 3IS4A 4OV4A 3W85A 3IJ7A 1HKIA 2BHUA 3BV4A 1GTHA 4DUVA 3ZIZA 4KERA 2ZRVA 4FNRA 3TJ4A 4AHPA 1XM3A 3EMCA 4HT3A 3SM0A 3PZVA 2C14A 1I1XA 4DWSC 1MMFA 1AL8A 4GO9A 3TN5A 4Z1BA 5AYZA 4M29A 1MXSA 1CXEA 4GCAA 4F2BA 4HZMA 1GG1A 5DCDA 3CUXA 1SJBA 4GA8A 3SCVA 4K38A 2O9RA 4M6VA 3RLUA 2J74A 2DQXA 1IT8A 1HKJA 3PB0A 5JMUA 2CKSA 4WSJA 4BQ3A 4JIIX 1ITUA 1TWIA 1JDCA 1WKFA 2ZWYA 2C8NA 1WV2A 4IGMA 4LRTA 4JEJA 3U5UA 4GXPA 3OVQA 2D0HA 1E0VA 4LNCA 1YKWA 1JNEA 3PM6A 2ZKMX 3IV3A 2GWGA 2L5HA 5E1QA 2RJHA 3N4EA 4FOJA 3VIOA 2Q02A 5D04C 1UCWA 3L4VA 5EMYA 4HYWA 1UIPA 2J6VA 3SN1A 3Q58A 4BZYA 3OVRA 3FOKA 2QDDA 1AH0A 4U3CA 1CW2A 1JCTA 4GFIA 3DENA 3QRHA 4PB5A 4LB3A 1QNRA 2Z6IA 1IXNA 1KBJA 1HKWA 1W3IA 1PB0A 1J4EA 4RZ6A 1QATA 1EZ2A 3HV9A 2QF7A 5I0DA 1KRMA 4PUMA 3NZGA 3RITA 4L4OA 2DW7A 2CESA 4J28A 2WPBA 1XLJA 3ARSA 2JIWA 4GQRA 4I90A 4PMYA 2VENA 2OODA 4Q4OA 3TAKA 1Y8BA 3C86A 2HXTA 4DZIA 3OQ8A 1RD5A 4HVXA 2JKAA 1R7OA 2WJEA 1JI2A 2XSAA 3CH9A 5EA9A 3ARQA 4OBSA 3I3DA 4TOQA 2PC8A 3M0KA 3T08A 1Q6RA 2Q6ZA 1GVEA 2PU1A 4PMJA 1M7OA 2VEMA 3QY7A 1CGWA 1LYXA 3YPIA 3ID7A 1E1EA 3WQ5A 2ZE0A 3VMNA 3HGJA 4GYJA 4EX4A 1MW3A 2QCMA 1KRAC 4HKPA 2Z6JA 5LA0A 1TE6A 2YDQA 2GVEA 3SJNA 1X96A 2PDBA 1H4PA 4UFLA 4RNFA 1DQWA 1ZFJA 1R86A 3CWHA 3BQ5A 1FWBC 3LHWA 4HMCA 1NDVA 5G2IA 4UMAA 3GXMA 3KZSA 4FXFA 4R9OA 4EXBA 4PUNA 3G1FA 1V6UA 4FF7A 3VGEA 3KTXA 3QOMA 1CXKA 3SSZA 1FKWA 1R0MA 1FCBA 2BBFA 3P80A 4Q33A 3S1UA 3CPUA 2J8TA 1QHZA 1FWHC 3PFRA 4JTIA 1PDZA 3SUVA 1FHLA 3AFBA 3CIVA 4Y6GA 3ZZ1A 3W27A 1RPKA 4WOQA 3THDA 3RF9A 1F61A 2AMGA 1Q63A 3B0PA 4ERGA 3VKBA 1ALDA 2WPGA 1O5KA 4JIPA 1SZNA 3BOXA 2A3EA 3USBA 4HGXA 1H0GA 2FHFA 3KUMA 4AF0A 5BNKA 2IKJA 5ABHA 2MUCA 3MP4A 4QAWA 3WMBA 2QCHA 1YPIA 5H2ZA 1LORA 3T40A 3MMDA 3XIMA 1RV8A 1W9XA 3KTCA 3E2VA 2VZTA 1ZBCA 3GDKA 3CB8A 3WQ4A 1W1TA 3PG9A 3WD1A 1F74A 3G0UA 3DFQA 2PZNA 3KTSA 2R1LA 4TV5A 5I00A 2ZZ4A 3DGBA 3UCCA 4GRSA 2DUAA 1A5OC 5JU6A 2PMQA 3PK7A 2H8ZA 3LBOA 3VNZA 2PDWA 3EA3A 1BFNA 5I3IA 5CJMA 3JW7A 5AVHA 3VILA 1BD0A 1KBKA 4M0XA 3DBNA 1Q8AA 4HQVA 3SQSA 1CB7B 1F8MA 3K13A 4UFMA 1BF2A 4TUFA 1GOKA 3BSGA 1YPXA 4RE3A 3U9IA 5U7SA 3WNKA 1TRDA 2HBXA 4C1NB 1FP8A 1E5NA 4E3VA 1TA3A 4GQQA 4IIGA 1H62A 2D73A 1GEHA 4LYPA 4D9PA 5KETA 3L4UA 1KM4A 4RNJA 2WSQA 3AQUA 1MVYA 4O10A 3FVMA 4HOXA 1NWSA 5G1YA 3UR2A 3TQ0A 1ICSA 5D9PA 1ZP3A 4RPQA 1G0CA 2BVWA 5G4HC 2VR5A 2Y89A 4HSHA 4LVDA 4R7OA 3HV8A 4Z2KA 2PDIA 3W25A 4EK7A 4PL2A 5BXRA 3B8SA 3THQA 2QYGA 1R47A 2PWDA 1HX0A 3OEXA 3PB2A 3CT2A 1BWKA 1ICPA 3LHYA 5A8OA 3O0KA 2WMGA 1K7FA 3GNRA 1W1ZA 4BF9A 1YXDA 3A22A 1U83A 2BXVA 5E5CA 4L4LA 1H7OA 4NASA 4K6AA 1UP2A 1TIWA 3M5VA 2BVYA 2J9ZA 1PXGA 2GPTA 1Z8AA 4PUUA 4L9ZA 4RDZA 5FF3A 5C8BB 1V6YA 3TSMA 3WL1A 1YMYA 3ZJKA 1X1OA 1UROA 1MUMA 2DGAA 3O06A 4J35A 1IF2A 3VC6A 4DXVA 4ZL1A 1TWWA 3T0AA 4ZQPA 3TTEA 5I6SA 2ZTJA 4LS1A 1VP5A 3E38A 4RDVA 3E74A 3CO8A 4NY2A 3QTPA 3WENA 4PCSA 3HGRA 4TIMA 2J7FA 3RAOA 2QDHA 4MZ8A 3G1DA 4MLRA 1BRLA 4E6MA 2INZA 3LPGA 2QUVA 3MV01 3RIKA 3GYEA 4M5PA 3QZAA 3S5SA 1IE7C 3E2QA 4UCGA 2EKCA 4UTJA 1ISWA 4J3TA 5HOSA 3T9PA 1NF7A 4GVHA 5DX7A 1JPHA 4HNVA 3RO6A 3S5ZA 3F2DA 3O6CA 1JPKA 2WJFA 3THUA 4S3GA 4O1CA 4A6GA 3WLOA 4OKDA 2WWCA 4C6IA 1AZ1A 3RFAA 1IEVA 3W1MA 5HWNA 2GWNA 4YTUA 3W70A 1E9YB 5DXYA 4J3SA 1LOQA 1B1YA 3NXLA 5HJYA 1FY6A 2VYOA 4GI4A 8CGTA 4LUYA 3WJSA 3ZLHA 4HB7A 3H2FA 3S1GA 4ZMGA 4AW7A 3EA2A 5BRPA 2A4AA 1CI1A 3NEHA 2YKKA 1KKRA 3ORWA 1F3WA 4GE8A 3AC0A 4H8HA 3UESA 1K03A 1V02E 3WCZA 3KFTA 1RP9A 3T0DA 3D3FA 4W93A 1LJYA 1QI0A 4D6FA 3G6MA 1DJIA 2WSRA 3A13A 3CUFA 2GDVA 2G3JA 2G3FA 5ECUA 1OG6A 1UP3A 3FVDA 4FXJA 4B5XA 2CWNA 3V75A 3H26A 3G1AA 4JGDA 4NZ4A 1W37A 2YL8A 3CQHA 2V81A 1OFBA 3W0KA 2CZEA 1Z42A 3EWWA 3GNDA 1JF6A 5EB8A 4Q4RA 3LDVA 3RX4A 1TUFA 3NPWA 4LC6A 2WZTA 1GYLA 3FK4A 3NUKA 3GIQA 2FKPA 4Y8EA 5CC5A 5A8QA 2ZFAA 3D6NA 4XSMA 4H9VA 4MLJA 3VD5A 4IWWA 2WSPA 1OG0A 5KZEA 4EF8A 4UQDA 3ONBA 4CKQA 2EKGA 4F3HA 3TP4A 1C9WA 2OSYA 4IIDA 1W3KA 3IWPA 5AHIA 4CQCA 1VEMA 1RCXB 1KTCA 3L5LA 2FZ8A 3GTFA 3SEPA 1UZDA 2REQA 4WLCA 2HZGA 1E0UA 1JUEA 3CEPA 1UA3A 1FWGC 4HD5A 1PX8A 4E8DA 5D2YA 3MUZ1 4JTJA 3A12A 4N02A 2WKGA 1HQTA 2PDPA 1H11A 2GOUA 2J7GA 3D0CA 4LPCA 1DWHM 1DEDA 4AUBA 1J5SA 4YS1A 2JK2A 1SUXA 2O7SA 4FLRA 2FJUB 3OHIA 1AA1B 2ZA3A 4MB3A 4E8CA 3L66A 4I5RA 5F4WA 3WH8A 4JDBA 3SBFA 3CJPA 2JIEA 5AC8A 4C6CA 4RL3A 2WKJA 4CD7A 4HU4A 1XYFA 1UC5A 3QJAA 3PY2A 5D33A 1TVLA 3MBFA 2B31A 3VDCA 2W3ZA 4PMZA 4HZ7A 3EKZA 3IV8A 1W56A 3PNZA 2EBNA 1F6YA 1QPQA 3SW6A 5AHNA 1OB0A 2VEPA 4DVOA 3W7OA 5I23A 3WQ8A 1PTAA 4ACYA 1Q6DA 4AD3A 1CZ1A 4IGSA 2XGBA 1Q13A 2ZUSA 3BG3A 1P5BA 2XGZA 1Q6FA 1HL8A 2OFJA 4MNMA 4AC7C 4CN6A 1UMLA 4QE4A 2A6NA 1CBGA 4CNTA 1QNPA 3OLDA 4AD0A 4S38A 3BAYA 4FAMA 4UQBA 2CZVA 2DZVA 2QAFA 3R58A 4HYRA 3WLRA 1SFSA 1XDLA 1R38A 1YTKA 2R9RA 2EG7A 2ZC8A 1FUYA 4CQDA 4IFRA 5HQEA 3WUFA 4BI5A 4K2SA 1G94A 4JTQA 4KFNA 2PDGA 4DI9A 2Z25A 2PCEA 3OQEA 4S3BA 1GT8A 3SUUA 3S5NA 3TW7A 4TU1A 5LIWX 4QEEA 2XM2A 3MBDA 4POCA 3B8DA 3S2CA 5I78A 1DJZA 3WNLA 1XV8A 4EKJA 2XFYA 1NDWA 1JDAA 3QPZA 1XIMA 2CLKA 1UQYA 4UTLA 4LAMA 3UVAA 2VFHA 1TA3B 3NR0A 1QUMA 1TV8A 5CBIA 3RILA 1BGGA 3FGCB 2ISFA 2AAMA 1O4UA 2Z27A 3V1PA 1E6NA 3HFYA 2TRSA 3M7WA 4H04A 4WK9A 1XWYA 1OCQA 1EC9A 1W9BM 1AG1O 1Z32X 4MB1A 1KBLA 4GUHA 3SGGA 4JHZA 3KM8A 1OIMA 1GVIA 4CGTA 4JYEA 2A6LA 4NNAA 4A2SA 3ZFHA 3VU2A 1EJXC 1UWSA 4BS0A 2AKMA 4Q8QA 3IJ8A 2UV8G 1WZMA 5I79A 3H23A 4N9CA 2BVTA 4TVDA 1FCUA 1PIIA 2QS8A 2B4GA 1JCNA 1OFAA 4HK7A 2ALRA 1P6WA 5FI8A 3RJXA 1WO2A 3VD7A 1CENA 1M65A 3LHVA 3H4XA 1EP3A 1ZGDA 3NPVA 3E0LA 1O66A 2QR6A 5CPQA 3W82A 4NJHA 5A95A 1X1ZA 4XVDA 3T8LA 3L4XA 4LTSA 2OQLA 2VX5A 4NYYA 2OEKA 4F0RA 2VCCA 4XKMA 4PRTA 2YCKX 3AJ7A 4UBPC 2QUUA 2PDKA 4L9YA 3OPSA 4DWDA 4QLKA 3AHYA 5C2GA 4C7GA 4OQVA 3B0YA 4Q8NA 5H6HA 1R3TA 4DXXA 1OC6A 4GNVA 3V3WA 4AMCA 2X1RA 1EX5A 3A23A 3BGJA 1JFHA 5AECA 2PDLA 3WLHA 1W5QA 3EOOA 2V3EA 2HRWA 3HURA 4S23A 3VZYA 1OGGA 3O16A 4FK9A 1BTMA 1E4LA 1SJDA 3ARWA 3B8WA 2Z28A 3SURA 2Y63A 1KFBA 3L4TA 2HV5A 3LRMA 5CG7A 2NQ9A 4NVTA 3ZR4A 4R27A 5KZDA 2A7PA 1IGWA 4RNHA 1PX3A 2JEPA 3IGXA 3MUCA 4S3EA 3UJRA 4G1NA 5FJRA 4PUEA 4PZVA 1DWJM 4YYFA 1RBLA 3GK0A 3PZOA 3LLDA 3HTWA 3UXIA 3SUTA 4D71A 3WD4A 3CAWA 3F4NA 4M24A 4JDYA 1UOKA 2TSYA 3UEQA 4GIEA 2YXGA 3QSRA 3E0VA 2AL2A 3QV6A 2PE4A 2FGLA 3BLOA 3CYVA 1QWKA 2NQHA 2W9MA 5CZSA 3TXZA 5DMMA 3NEVA 1FDYA 3MSYA 5I3DA 3BOLA 1RK5A 4JX6A 3T1GA 4XAYA 4IQJA 3DC8A 5FEPA 1KB3A 1V03A 1RP8A 3KAOA 3FYOA 1TG7A 4AIBA 4MZYA 7TIMA 5DFAA 1Q4NX 2YL9A 3KBWA 3G0XA 1PEZA 5A6BD 3AMCA 3RU6A 4RCXA 1QI2A 4HHLA 1ISZA 1VEPA 3SY5A 6REQA 2VGGA 4ALDA 4GACA 3W6LA 1SFLA 4CU8A 4N9BA 4YTTA 3R0UA 1IZJA 1GOWA 2GK1A 3DECA 3LBCA 1J96A 4MNJA 1OD8A 4M1RA 2E25A 2ZADA 4IJCA 1XBXA 1MRQA 2CW6A 1NP0A 5F4SA 2VURA 3O15A 4P8UA 1XJBA 1XLLA 3L0GA 4S3JA 2XINA 2PTDA 5LHFA 2QHAA 4XKYB 2V3DA 2QCDA 3WBEA 3L0NA 4IL0A 3TH6A 3RK8A 2V2CA 3UWYA 1TO3A 2E5BA 1K7EA 4MPQA 4HHMA 5A8MA 2P53A 4X22A 1R3SA 5MKGA 4QJ4B 2ANUA 1JXKA 3H6OA 1IWPA 1VKFA 4EE9A 3F5JA 1WZAA 4F40A 3MDWA 4C6KA 1D7KA 1C90A 3QKZA 3QSTA 3URAA 1U1HA 3PULA 4DO4A 5A6BA 3K1DA 4UB9A 3ZJ6A 1G01A 5I09A 2FB3A 4H4IA 2V2DA 3WY1A 3JR2A 3FJNA 3E96A 2ZZ1A 3E3HA 3DI0A 3AMLA 1UUQA 4L4MA 1Q3NA 2YZ5A 1P48A 4Z1YA 1GZ1A 1OWQA 3GZ3A 1K3UA 3R6IA 1JYVA 1FWCC 3QQ0A 5IXEA 4QROA 4I5UA 5GNXA 4N9EA 3UWUA 1M53A 3P61A 2NQZA 1UHVA 4QX4A 6XIMA 3GC4A 3PPCA 2Z00A 3WLNA 3CPGA 4XVEA 4K1GA 5J04A 3I7QA 1F6KA 4H8VA 2EJAA 1UKSA 3RR1A 4Y96A 2XUCA 1RQHA 4UZUA 4M56A 1IR1A 3FA5A 4G56A 1W3JA 8XIAA 1XYCA 3BCJA 4ZB2A 3O63A 2FVLA 1MEWA 3A4AA 3TN6A 4ZGYA 3BLKA 3GTNA 4CD4A 4QCEA 4GQGA 2O92A 2F9RA 1M3UA 1HZYA 5C7HA 2QCFA 4WDWA 5FD0A 4DM2A 1QW9A 4FP1A 4WHBA 3PVFA 5I77A 2C16A 4AY7A 4EPDC 5AYXA 1E6ZA 5EU9A 1CXHA 1ZU8A 2P88A 1ICQA 3GWQA 4LVAA 1V79A 3STEA 2FHCA 3R79A 1DORA 3V5OA 4QP0A 4W5ZA 3B0XA 2G3IA 1OINA 4Y90A 1W3NA 3GR8A 1UJPA 4CQ8A 3NSXA 2F38A 3PJXA 2W79A 1SFJA 5LA1A 3NL6A 2FGBA 5G5IA 4KPLA 4E5TA 3W24A 3BURA 2X09A 3H55A 2PWHA 3GD6A 4XUYA 1W54A 1W9DM 3EX2A 3A21A 4US5D 1FXQA 2VGIA 1JVNA 1VFTA 5CLWA 3CHEA 3CK5A 4JZ5A 1REQA 1UR3M 3PZMA 2Q71A 3W1UA 4YCOA 1J8VA 1XLFA 2BMBA 1U1UA 2YYUA 1F8IA 3VIJA 3WJWA 5DBTA 4IISA 1IWBA 2FMOA 3M6YA 3SCNA 1A0CA 2G8ZA 3W3OA 4UR8A 3LGEA 2ZZ7A 5MHBA 3Q4DA 1EWEA 3N6JA 1IT0A 4DNHA 3OOQA 1BYCA 3D46A 1JCJA 2C13A 3TTQA 3EZ4A 1J0YA 3V5FA 4PBFA 5C2CA 2D22A 3DN5A 1A53A 3LHUA 5FJOA 2EPMX 4BA0A 3LBMA 1JPIA 3RJYA 3V4BA 1F3TA 1ITCA 2C3ZA 1I2QA 1H0IA 1A50A 2YL5A 1XYMA 3M41A 2ZX9A 3T0CA 3VKAA 3M16A 3PTQA 4NHVA 1HJSA 3W2LA 5LIXX 2NXIA 2IXVA 4KWOA 1HIZA 2DH2A 4MYAA 1YPFA 2E68A 4G6CA 3QHOA 3E1F1 3WKZA 4GINA 4ML4A 1BQCA 4I8DA 1UD2A 3F5KA 1HP4A 1BKSA 4US5A 5IHSA 3L23A 3QF0A 1XISA 3ATYA 2POZA 4CD8A 4JTUA 1KCZA 4U2ZA 4W4QA 1C91A 1E4NA 1EPXA 1T7LA 1CLXA 1TZZA 3L4YA 3QGAC 5HBFA 1O1HA 1P6CA 3SQMA 4Z2GA 2J75A 3VDHA 1VHCA 2QQ6A 3UPMA 4LSBA 3R8GA 4TV6A 1EH9A 5HNRA 1FRBA 4IM4A 4Q4SA 1OX5A 3P84A 3KRZA 2PSNA 5C54A 2YA1A 4V27A 3NZRA 5C9RA 1U22A 1ESWA 4GJIA 4KGLA 3W1QA 1QDSA 4WZHA 4B90A 4JCLA 3QYQA 2OLAA 3QPYA 4X2PA 1KGWA 3IGUA 1T99A 3DG7A 4PTNA 1NJJA 3FAXA 1P1XA 3GDLA 1E6PA 4NAEB 2E09A 1N2VA 1XCWA 4DELA 2VGBA 1E6XM 4OV9A 3RR4A 1EZWA 2E40A 4HJWA 4FO4A 2Q8XA 3P67A 3UCQA 3QZEA 2GJLA 2V5JA 3LQLA 4GJ1A 2GDQA 1WKEA 3WBAA 4C90A 3QY6A 3C0SA 1B31A 1ZENA 3E02A 2VL4A 4B3KA 4AB4A 2BY2A 5DQPA 1V3HA 2BOEX 4ICCX 4H9MA 2Z2UA 1HT6A 1QK2A 4FNTA 5HINA 3K4WA 1WKYA 5I3JA 5BOEA 1HUVA 1PZ2A 4IICA 1WDRA 2PDMA 3TLLA 2WC7A 4XZ9A 2D2HA 2HWGA 4H83A 5ABFA 3PTDA 2VGFA 4JTTA 4MNLA 4KETA 1A5NC 2GK1B 1TWDA 3VNDA 1K02A 5IDZA 2WXDM 1SPQA 1GJWA 4C6PA 2BY1A 3UVIA 3GXTA 1TMQA 2ZCGA 3QH2A 4DJDD 4BHYA 4XB3A 2W5FA 1OEPA 3DXIA 2OO6A 3NXFA 3SY8A 1C92A 1RJRA 3TTYA 3FV9A 2W66A 1PZ3A 3SUWA 4XZMX 1M41A 1S2VA 2I16A 1X1NA 1WDPA 2JF6A 4EXQA 3WQVA 1DWFM 3GG1A 2E3ZA 2QCDB 5I7GA 1I0BA 4NIRA 4ATDA 3LPPA 4IX2A 2DUZA 1JXJA 3CUGA 4QE5A 2RJGA 4JKKA 1VBUA 3FSTA 3L5MA 2PGRA 4E4FA 1UUMA 4DQWA 1DXEA 2PRMA 1BYAA 3HA1A 2ACSA 1TMLA 4P8VA 4Y9MA 3TA6A 4A3YA 4DZHA 2A1YA 3ELFA 3TIMA 2B7PA 4NXKA 2P0IA 2GSEA 1DHPA 3NOYA 3E12A 4FHAA 3BQ6A 4O1BA 2IMRA 4GD0A 4OBTA 3VXGA 2YL6A 4OOZA 1Q65A 3NL2A 1XDJA 2BFGA 3W84A 4IQDA 3OHMB 1WZLA 1MEHA 4GY7A 1TIMA 2V3GA 5DMNA 1P0NA 1HKVA 3VGFA 2G4FA 4GISA 5DXXA 1E70M 3UJFA 1TZ7A 2I1OA 2YLLA 1B0IA 1RVKA 4M19A 4WKHA 3VIIA 1UBSA 3RNDA 4DJDA 5JBFA 3BVJA 4XUGA 1JDEA 2WYSA 3K4AA 3N13A 1S2TA 3B9EA 1YX1A 2UZ9A 5FEZA 3N4FA 1IHIA 1S5NA 1SJCA 2FZBA 3BH4A 1W5NA 4XZBA 1ONXA 1XBVA 3T44A 1E72M 2QW5A 4CEXC 4H9XA 2DSKA 3BSMA 3N17A 1OX4B 4KMQA 3VM5A 3OB8A 3MKVA 3SCQA 1QASA 2RGLA 4UNLA 3GLCA 4HA0A 1CCWB 2VELA 1DIEA 3KE0A 1XH1A 3AS2A 4ICMA 3AYVA 3V16A 4AZ7A 2A3HA 4R5EA 4Z2IA 3GU9A 3WNOA 2ISWA 4Q32A 1ISVA 4AIOA 3G1RA 5GJPA 4KIEA 2QZRA 4RDYA 1TZ9A 3NPUA 3BW4A 4U3AA 4YU1A 4HJFA 4B4FA 2I7GA 4XSLA 3WLKX 4HZ6A 5I24A 4NUWA 1F05A 3B9AA 2QF8A 2CITA 4GX9A 5DBUA 3OVPA 5CBJA 1E4MM 3M0XA 1JZ3A 2GVYA 3B4YA 3W00A 3PBGA 1H7WA 3UA4A 4OHQA 4GVIA 1VENA 2YCLB 4Q8MA 3QV7A 2YOCA 2A0NA 3BJSA 1NARA 1Z44A 1HG3A 2Y7GA 2R91A 1PSCA 5LHEA 5K9DA 5FF7A 4YHGA 4QE1A 2XSBA 3ENLA 3UG4A 3CQIA 3SRDA 1V3KA 1QPKA 4MIMA 1UH4A 2HJPA 3B9OA 5AYIA 4B9ZA 2R1PA 4I5XA 4DF2A 1LQAA 1EBHA 1LBMA 1REQB 1I1WA 3B8VA 1D8CA 1BAGA 1DJHA 3UFYA 2ZX5A 1XL9A 2CC0A 2ZQ0A 3ZOAA 3PR2A 3Q94A 3KOFA 1EA0A 1MFVA 2X0YA 3L2MA 1FBAA 3AU6A 3VDGA 3VOFA 2V82A 2HNHA 1WCGA 4H9YA 2WHJA 4IP5A 3KRUA 4JYFA 3LHZA 3IUHA 2C18A 4P8WA 4XG1A 5K3VA 4ZOEA 4DJDC 2DIKA 1LOLA 4XO6A 4H7VA 2GVJA 5LNRA 3VM7A 1N8WA 3EOEA 1JRBA 3HJZA 5FA5A 5H8UA 4WKFA 3O0FA 2QJGA 1UR4A 3ZWTA 3URNA 1WP6A 2OLHA 4MJ2A 2OWWA 1W5OA 5AHFA 1JCXA 4KRZA 2DW6A 4JIQA 2IQ0A 3AXXA 1IEIA 4ZQNA 4JTAA 1J12A 4GIAA 4B3ZA 3JS3A 3DYOA 2XWDA 3MP3A 4GBDA 2IW0A 1VFFA 3BARA 3UERA 3E6EA 4O8RA 4NZ1A 3TNOA 3W6MA 1EHAA 3BDKA 3KS5A 1KM5A 4LJ3A 3N14A 3VNKA 3QYSA 1G6CA 1VHNA 3VZXA 2Z29A 4UQCA 3KWSA 4PBEA 1VIWA 1O68A 4XIAA 3A4XA 1CYGA 1V6XA 3C52A 4LUIA 3IAPA 1Z69A 3QR3A 1OABA 2V69A 1XC4A 1C9DA 1TX2A 2A7RA 2I9UA 1LOSA 1WUFA 2NLYA 1XIJA 3HJEA 1EXPA 1PWLA 5HULA 1SR0A 3BW2A 3KBJA 3C0QA 3I6RA 3HQNA 2Q3RA 1K4HA 3WDPP 4OECA 4XZNX 4WR3A 2ZUVA 3QFWA 1YNYA 3WNMA 2I17A 4PSRA 1YTDA 2OX1A 4GZJA 3LLXA 2I9EA 3AS1A 3G0SA 3ZM8A 3TTOA 4MOZA 2VFFA 3GBDA 3GY1A 2NQ5A 3E49A 5F4XA 3AXKA 4LYKA 4PEEA 3W7PA 1W5MA 2ON3A 3WLIA 4IXXA 4KCWA 4RLIA 2WHLA 4LUSA 4Y9AA 4HOZA 1XLCA 2Y88A 4BI6A 2DT1A 3QEZA 3VOCA 2CCRA 3UZYA 3IACA 4B2DD 2DVTA 3CZGA 3SCSA 1KFWA 1SZEA 4GNJA 2J7DA 7A3HA 3MSDA 2BHZA 1AK5A 1PAMA 4H8NA 4AD5A 5JH2A 3EBVA 3QV9A 1P7TA 5LIYX 1BWLA 4D6EA 4J7RA 3NFUA 3GSMA 3VCNA 3GC2A 2OZ0A 4PCPA 4BKNA 1CXIA 1JAEA 3V1HA 2YB4A 1OGBA 4IPPA 1KFCA 2ZOXA 1S3HA 2GZXA 4ZODA 3CMGA 1T8XA 3H4WA 2BVDA 1YBQB 2R6OA 3SO7A 4XD6A 2A3LA 4HK6A 5CCZA 1V3IA 3LCWA 2GQ8A 5F2MA 3W07A 2YSWA 1WBHA 2Y7EA 3HG5A 3CZLA 2H90A 2PWFA 1QW8A 3HQ1A 4DBSA 2NXGA 3W2MA 4PUDA 1AJ2A 3N2BA 1YNQA 1K8XA 3OIXA 3BICA 4TVUA 1AQHA 1DWIM 3M0MA 2V5CA 4F0LA 4I9MA 3CUHA 2WO5A 2P10A 3P0WA 2OSWA 4OU1A 1N8FA 1F6PA 1ZPTA 2DSZA 3IK2A 2WANA 1C93A 2BB0A 1SW0A 1KFKA 3BG9A 3WQEA 4C5YA 5C70A 4LW7A 4IPLA 4B2DA 1JEZA 2DZUA 5A2BA 3IUIA 1FKXA 3B4UA 3L2IA 4AVFA 5REQB 6ENLA 3OZPA 2AQWA 3UNDA 1A5SA 4LUTA 1V7AA 2VFEA 3VK5A 5D09A 2DV0A 1EGVA 3U4FA 2OYKA 3T2OA 3MUY1 2OYMA 1IWAA 4H3DA 3LGDA 1KTBA 1KQYA 4L4PA 3HF3A 4R7JA 2GSJA 1N55A 3RX3A 3W71A 4F0KA 2C79A 4FZIA 1V0KA 2ZZ2A 3HPSA 4WJ8A 1MZRA 3EWBX 1WQ5A 3NQAA 3S2MA 3UYCA 1LTDA 1AJ0A 4Q8WA 3B0UX 3W29A 1T0OA 1TPUA 1OK6A 5A2CA 1EIBA 5JXQA 4O15A 4E38A 3WG6A 1K4GA 1TTQA 3CUZA 1E9LA 3VC5A 4RNIA 1Z89A 1SMDA 4O1FA 4BJHA 3I7RA 1AFSA 1AD1A 1OCNA 3FYYA 2CWXA 4Q4PA 1R9ZA 1V0LA 3N15A 4XZIA 3MI3A 3L67A 4A3RA 2OYLA 4J27A 3UXKA 2YCEA 3VE7A 2ZUNA 2WMIA 4HCDA 2D3LA 1W9PA 3OLEA 3L21A 1NAL1 4A35A 4H8UA 3OTRA 5C2XA 4UZSA 2OKTA 1AH4A 2OQYA 4QG6A 1Q7MA 5HUOA 2X2YA 3DX5A 4LC8A 3POHA 4IIEA 1OD0A 1JL8A 1U33A 1MUCA 4XTDA 3TTSA 4XBSA 4D6CA 2GUBA 2I5QA 3KLKA 4UMCA 3FCPA 3KXQA 4PMQA 3ZWSA 3EOSA 4GG9A 2OCZA 4WIWA 5CPTA 3TNBA 3FHQA 2PTXA 3FAWA 2F84A 4N6FA 3WX7A 3RMEA 1O6IA 2ZZ6A 3LB0A 2QPXA 1FWRA 2PLJA 3E9AA 4PUJA 1W1B1 1VJSA 4ZOAA 2GQ9A 2GQAA 1W1A1 2OGYA 1DXIA 3S2NA 2WJDA 3VIHA 3GNXA 4DXKA 4KCVA 4J5NA 5E09A 3N18A 4GO8A 2J66A 4O52A 1K9FA 1E1FA 2FYMA 2CNCA 4LVBA 4ADSA 4GX8A 4AD4A 1UASA 3MA8A 4L1GA 2J79A 2G41A 3M0JA 2HEJA 4GQ0A 4JTCA 2X41A 1NFGA 1R87A 1YDNA 3W2UA 5JIWA 3UP8A 2Y0FA 4BF5A 3AS0A 2HISA 4FEZA 3E0FA 1TPH1 5C5YA 3QBUA 1JCMP 4QJ1A 1CEOA 3V35A 1XRTA 3VTRA 4IMCA 3HPZA 4HNOA 4V15A 3DFTA 3EGJA 1TYGA 1R8LA 5JIPA 1LROA 3NG3A 4ACZB 3BSHA 5D9NA 4AG0A 7PTDA 2ZUUA 1HL9A 5B7ZA 1NEYA 3LSBA 3UG8A 1PUDA 1B54A 3Q37A 4K7VA 3TOPA 1R3VA 3J7HA 3TWAA 4GLEA 3S1VA 1E40A 1R46A 2JFEX 4AWSA 2OOFA 3W7EA 1MW2A 5C71A 1TSIA 1ZZMA 3H8AA 3W73A 4O13A 3ZMRA 4UXDA 4GYFA 4X9SA 4BQ2A 2YB1A 4WGHA 1GCYA 3MHGA 4ZB5A 3OIHA 1XINA 1V7YA 3CQ0A 1GQIA 1ONEA 4JY8A 4HTYA 4ZQOA 2E8YA 1X39A 1DVJA 5CSSA 3LENA 1UH2A 4AZ5A 4RK8A 3O6AA 4IQEA 4U10A 2X1SA 4KWWA 2CLPA 3K4DA 3TSBA 1TFVA 2NUWA 2EO7A 1GKRA 1ZB5A 1Q2RA 2WZMA 4HPGA 1X98A 5CPSA 4QHRA 4JTGA 3PUDA 4S1FA 3AISA 2D0FA 1W1IE 1B3VA 1DTNA 2DSWA 1M7JA 1CGYA 1FWAC 1WXJA 3AOFA 2I57A 4ZBCA 3OZOA 4GCXA 3S83A 1BXNA 4YIWA 2NUYA 4I8YA 2E0PA 5AC6A 4QM1A 3A4JA 1XGEA 4JS3A 5K4XA 2Z1BA 1XIGA 3TFXA 5D2WA 4AU0A 1SO4A 5AYYA 4PN2A 3A4WA 4KT2A 2YJQA 1Q4WA 4ZTXA 3FYPA 4OGZA 3R10A 5ABTA 4CQBA 2OKOA 5BOOA 1NFBA 3MUIA 3CLWA 2ZZ5A 4Z1CA 4DYKA 2XVKA 3XINA 2GLKA 2VM8A 3WO8A 4INFA 2NT0A 2Q09A 2O4QA 3PBUA 3CZJA 4UQ9A 1L2UA 3R89A 2IPJA 3NOEA 2VX4A 2DT3A 3BL3A 3AMGA 3GH5A 4UTTA 4B92A 5AYBA 3UGRA 3OGSA 2YCJA 1OF6A 2VI0A 3B8UA 8TIMA 3TEVA 2XM1A 1V5XA 4E2VA 3BW3A 1A80A 4JTDA 3C2FA 3RYSA 3S46A 2F6KA 2E9BA 3CAKA 2XVGA 1LLZA 4LALA 5C6MA 3K8MA 3TA9A 4ZFCA 2J7BA 5I06A 3SUSA 5EY5A 1F9CA 3LG3A 1MNSA 3M0ZA 4UTMA 3BAJA 3TW9A 4OIFA 1GW1A 1P6BA 4H6QA 3SQLA 4MB5A 1P43A 3VFLA 3GTHA 3CC1A 4JEQA 1BVZA 1VLWA 4JFSA 2P3ZA 1UWUA 2UBPC 2RHGA 5HMFA 5CSYA 5FJJA 3AIEA 2XFRA 2NXHA 3CL8A 1LT7A 2ABAA 3MVTA 1V4YA 5KEZA 1ONWA 3VIFA 3BXWA 1ZS2A 1YADA 3AXHA 4JN8A 2HVOA 2PGEA 1PTDA 2EXOA 1CLVA 2V30A 5AHMA 1BVWA 5EMUA 1VGAA 4AWEA 4LV4A 4C7FA 3C5QA 3TR2A 1EGZA 1C29A 2CHOA 5DRIA 3UPWA 3MCOA 3MJMA 3WQCA 5BXTA 2VEKA 1QVBA 4GXWA 5EGRA 2BTMA 1IYXA 4UFKA 3MYPA 4G1KA 3LLFA 2CZFA 4E4PA 5T8GA 4PTVA 1S39A 1YE4A 2YW4A 1TPEA 2BHYA 3HPAA 1EKOA 3LQGA 2VOTA 3NQCA 4Z2JA 3AIRA 1PS9A 3WFLA 2BGQA 4Q8VA 1L6YA 2Z1VA 3LMYA 1J11A 4Z1AA 1SO5A 4ZA0A 4WY0F 1BHGA 3DI1A 3STGA 1JI1A 4LS0A 4F2TA 3DHUA 5BWAA 2BG5A 2EPKX 4XTIA 4D6GA 4JOMA 2ZX8A 7XIMA 1GTEA 2WMIB 5HK4A 2XSXA 3S1WA 1EP2A 5F7UA 3WH5A 3AZRA 1GOMA 5K7JA 4GK8A 4PMNA 1TB3A 3G8EA 2HVNA 3CUIA 4UTTC 1W17A 5CG0A 2B0MA 1OHLA 4IPNB 3FS2A 1UR8A 3U57A 2HE8A 3WLLA 3FY1A 1MXGA 3WYZA 1KXHA 1SZRA 2HROA 4PTWA 2V9DA 4V1YA 1X8FA 3PZUA 3BMXA 4NG3A 3GQYA 3EX3A 1L8NA 3UG5A 5T9BG 4MKNA 4JCMA 1PX4A 4JYDA 1QXLA 3EWZA 2VRKA 1XLKA 4L5ZA 4Q4MA 3F4VA 3OU8A 2DP3A 1EQCA 2WLZA 4IQLA 1FWJC 3GU2A 5M1TA 3ALFA 3VABA 3N34A 2OT0A 1JCLA 1H2JA 3W2NA 3EEZA 2UY3A 3H7UA 3QHNA 3R0KA 4RR4A 4RJEA 3HO8A 3WMSA 2UY2A 2BASA 5M17A 2QMJA 2RDUA 4S3FA 4N6EA 3VNJA 4LCQA 4QG9A 1YTEA 3P93A 3NQ6A 4G7EB 4PMUA 4NL1A 4H01A 4YMZA 5BRBA 4TO8A 3HQPA 2HPIA 2FPVA 4BQ4A 4DB7A 3LY0A 3GXFA 1RBOB 1QMLA 3LN3A 2X0SA 2D2OA 4UIOA 3PZGA 3GS6A 3S9ZA 1XLAA 4IMFA 1XD0A 4N2YA 3OBEA 3RPDA 3UCDA 3F4DA 1TCMA 4DJFD 3KCOA 4R53A 2Q8LA 1XD1A 3UZ5A 1QI3A 4IMDA 2XGIA 4IIBA 3UR5A 3TYCA 1V6TA 4C1NA 3U48A 1J0ZA 2ACQA 3H2OA 3UJEA 3ABZA 3L9CA 3SCRA 4TMCA 1QW7A 1P1MA 3M43A 5D05A 4O53A 5BZAA 2IXUA 2GDUA 3HBLA 1MQQA 1C8QA 4ZO6A 2IPWA 2CYGA 2VXNA 2Y4SA 4LB4A 4X3ZA 1XLDA 4QFUA 1ZAIA 3UZJA 3IEBA 3THAA 1VC4A 2ZRXA 3DYMA 2F61A 3AIBA 1R6WA 4NYUA 1U5JA 3IRDA 1RVGA 3N73A 4DO5A 4GGHA 3CWNA 1E9IA 3N1AA 2VVNA 3TYAA 3L65A 2FPTA 1O95A 1ZAHA 2PRLA 1NQKA 2B81A 1DP0A 4FLOA 1CB2A 2YPIA 3U2CA 3GX9A 4UC5A 4HN4A 4CU6A 1YQ2A 3BK0A 4XAGA 4Q8OA 4DZAA 4QJ5B 4W5UA 2C91A 4DJFA 3OODA 2OXNA 4XAFA 2XFWA 2BXYA 1LRNA 3ABOA 1MZHA 4GIYA 3TSDA 1G4PA 2Y8UA 3OA3A 3B06A 1FVPA 2EF9A 3HM7A 4K8EA 3A5VA 1V77A 1HL2A 3OLIA 1E6SM 3IK4A 4GYPA 4A2RA 3BAWA 4HNLA 1RR2A 2WBGA 3I3EA 3ARUA 1YW1A 3M6DA 1V6WA 4GI6A 2AQOA 2D3NA 1SSGA 1O60A 3QR1A 2CBIA 2ZZ3A 5DLCA 1VJIA 3AUJA 3N6HA 3U2EA 2FLIA 6CGTA 2YXOA 3QKEA 3P0XA 4NZCA 3ABXA 1EHNA 4GC4A 2Y85A 3PJUA 5EKYA 4FA3A 2XVLA 1E0XA 4LOCA 5CGTA 3AZTA 4YLWA 2XVNA 3S5YA 4H6EA 2WC4A 4PMOA 3GUGA 1IGSA 1M01A 2F8QA 2IKIA 1LUCA 3VIMA 3GUWA 1L6WA 5D2XA 5F2IA 1PZ1A 5DEZA 3MCNA 9XIAA 4DAFA 4F8XA 1QBBA 4K37A 4J3UA 3EX4A 3AWNA 3PTKA 1PWMA 1XXXA 1ZJHA 1TJPA 4DF0A 3SI9A 2VDHA 4AIEA 1XQKA 5G1MA 3F2BA 3VE9A 4PL1A 4S3AA 2G3NA 2GVLA 1UQZA 4HCHA 2E6DA 4X61A 3N4AA 1QHPA 4KBXA 2DZSA 3SZ8A 5KITA 1FDZA 1QJWA 4HMDA 2GGEA 2GJPA 1HO4A 2I5IA 3IVSA 4HU8A 2I14A 1EYWA 1KLZA 3ATZA 3RCMA 1YDYA 1Q7ZA 3TWBA 1S2WA 4GZEA 2XISA 2FVMA 3BZGA 4HA1A 5D02A 3CV1A 5GJNA 3LRKA 3W81A 1JULA 4CD6A 1VAHA 3KP0A 1LG1A 1EJSC 4XO7A 2HQAA 1V3LA 1VPYA 3PPHA 3CUJA 3CV2A 4X60A 1ODUA 3R7MA 1V51A 4EIVA 3WH9A 3MSGA 1JZ6A 5TAOA 3GH4A 5HDRA 3EXRA 4DJFC 2YIHA 1WDSA 2FPYA 2PP1A 4FF5A 3T81A 4DUOA 1B30A 5LIKX 4CEUC 5FAGA 4EAYA 3PZQA 2OWCA 4IPJA 4I7VA 3WEZA 2AQVA 2GUYA 3RM4A 3TE9A 3UWEA 3UY8A 1ZNNA 5BXPA 2WHKA 1UKPA 4CLMA 3BG5A 3RRAA 4MGGA 1G4TA 5DY2A 1J18A 5HWMA 2Y5EA 3UD6A 3S2JA 2J13A 3KLLA 3IGSA 3GH7A 4O17A 1DQUA 2DH3A 2DJXA 5BMXA 4PUWA 1TV5A 4GYPC 2WCGA 4