2J9ZA

Tryptophan synthase t110 mutant complex
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
267
structure length
251
Chain Sequence
b'MERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLAIIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLHHLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKIIEKNLASPKQMLAELRSFVSAMKAASR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPTOPHAN SYNTHASE ALPHA CHAIN
publication title Betaq114N and Betat110V Mutations Reveal a Critically Important Role of the Substrate Alpha-Carboxylate Site in the Reaction Specificity of Tryptophan Synthase.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Lyase
total genus 95
structure length 251
sequence length 267
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 2006-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2j9zA00
2ZRWA 3DKLA 5ABTA 4NXSA 3DH7A 2E09A 1JJKA 1TSIA 2GQAA 1FWWA 3NQEA 1TJRA 3WJSA 4JIQA 4ZVJA 2B7PA 3P60A 4RV8A 1WAUA 3UWWA 4TMCA 2CLHA 1EWEA 3CU2A 1SQ7A 4EVZA 1G67A 3IIZA 4KWVA 1SU5A 1R47A 4MYAA 3GXNA 3TXZA 3RU6A 3TDFA 2E68A 4ZQRA 3A9IA 4N6EA 3S1VA 2Y6ZA 2VOMA 1KM0A 3EEGA 5G5IA 4DO4A 2QCCA 1FCBA 3KVJA 2ZZ6A 1FDYA 3MYOA 2GJNA 3B0VC 5BW6A 1D3GA 2NZLA 5FF0A 1BWKA 2GUUA 4YMZA 1CX9A 5CSRA 2C3ZA 5LNUA 3QW3A 4FNUA 5DELA 1W3IA 5EL1A 4IUOA 3OA3A 3DZ1A 3K30A 4HKPA 1D3HA 1CW2A 1JRCA 2DZTA 5G1TA 2QDHA 2E6DA 2FDSA 5D03A 3VI2A 3GDLA 4KWWA 1LZOA 5CZJA 2V30A 1JCYA 2W6RA 3W7MA 4BR1A 5K4XA 2BZNA 2FFCA 2OCZA 1F76A 3FEMA 4JY8A 1R2SA 2JKAA 3GNDA 1T8XA 3HGSA 3C8FA 3FJLA 1LOSA 1VZWA 1Q45A 1TCDA 4Y6GA 1OX4B 1M7OA 4BI7A 4JTLA 3TJXA 2YZRA 4LS0A 1MO0A 4TR9A 4GRSA 5KZEA 1K8YA 4Q4KA 4WY0B 1GG0A 2NX9A 1I45A 2ZQ0A 3HGJA 3NQ2A 1G69A 3A22A 3HPSA 4Z0JA 1ZAHA 2A85A 4Y96A 1O5KA 3FA5A 4ADTA 3CQ0A 3KAOA 4YLWA 3F1QA 1KTBA 2YDAA 1OFPA 1JR1A 2H6RA 3P62A 1OFOA 5J5RA 4FF7A 1VPXA 1XBVA 3S5YA 4XTIA 5G4EA 3ATZA 5DXXA 1G4SA 1QO2A 3N34A 3W1AA 3C2VA 2E5BA 4O53A 3DAQA 1S5TA 3M0ZA 4IPJA 2G5WA 5U4NA 1DORA 4Z1CA 4NVTA 3I6RA 1SFLA 3HPZA 1MEWA 1G4TA 1H61A 3LGEA 4QJ1A 5KTLA 4GUIA 3LHZA 3TK7A 3DU0A 5F4XA 3MUXA 1W5NA 2J9ZA 4UTMA 3HPXA 3KRSA 4PFMA 1DV7A 2J24A 1FDZA 3GDMA 4HSOA 4IJBA 4YWIA 3M5VA 5LKYA 3CPRA 2VEPA 2A0NA 4UTUA 1H7RA 2JK2A 1K8ZA 2DZWA 2Y62A 4B5NA 5CZSA 5EY5A 4IPIA 3W7KA 3CWNA 2VFDA 1YYAA 3C6CA 5D38A 3LCXA 3C3NA 3MO7A 2J88A 4UTIA 1F7BA 2QCDB 1W5MA 2DJXA 3CEPA 1EP2A 1RR2A 4QISA 3PR2A 3EX6A 4MZ1A 2CLOA 2QCLA 5HR7A 1DL3A 3BG5A 2J27A 1GWJA 5LHFA 3DENA 2WV8A 3O63A 1N7KA 2CU0A 1F05A 4N6FA 4TU1A 1VS1A 3EWYA 3LV5A 3LDVA 2NUXA 5A5WA 3LHUA 4BI6A 4LU0A 2A6LA 1QFEA 2JBMA 5AB3A 2DZVA 2ZRXA 1G7VA 1KLZA 2XN0A 3LRMA 1P1XA 1GPWA 1FXQA 2CZFA 4AWTA 4UCGA 4HT3A 3R12A 4OBTA 1WYIA 4U4MA 2XN2A 5G4WA 3TW7A 1THFD 1FWRA 4GXMA 3TKFA 1A53A 2ZZ7A 3FS2A 4NQ1A 1H7PA 3PG8A 1LRNA 2CZ5A 1GOXA 1KBJA 2Z2UA 3Q94A 1M5WA 2HS6A 3O1NA 3PUOA 3FOKA 4ORIA 3S1XA 3HJZA 1TPC1 2B7QA 2ZBTA 3W1NA 2QCEA 4S2BA 5AHMA 4A3UA 4GJ1A 1B3OA 1TPFA 1Z42A 3CWOX 4RXGA 3GLCA 4CNNA 3O15A 5HWMA 3EXRA 2VEKA 4EIVA 3P81A 1QR7A 4LUJA 1TTPA 2ABAA 4XQ6A 4M7SA 4LWWA 3G24A 4DEFA 5AYYA 4PA8A 2C16A 3T7VA 2EPHA 3WK0A 4CQAA 3HG4A 5FF7A 3MW7A 3W7HA 4P61A 3G0SA 4BI5A 2HSAA 3BLIA 4K7YA 4O18A 4DQWA 1KM3A 2J6XA 3FLUA 1ZHAA 1LROA 3G1SA 4O50A 3NQ7A 1H7XA 4NXKA 4CNPA 2NXIA 4OU1A 3MP4A 3BLEA 3L66A 1YDVA 2GQ9A 2WNNA 5KINA 4K6AA 4HPJA 3EXSA 4LS2A 3VE7A 2H3DA 1P5BA 3BG3A 1XUZA 4IXXA 3GZ3A 3CT7A 4FNTA 1TPB1 1M7PA 1OG0A 5G2WA 1EPXA 3PS7A 4ONVA 3L0KA 4DPPA 3E96A 1TQJA 3W7QA 2B7NA 2ZYFA 1X1OA 2TYSA 4ADUA 3NPWA 1YXCA 4MIMA 4JD4A 4O19A 2X30A 1UUOA 4O1CA 4UFIA 4JTFA 1TIMA 2C15A 5E93A 1P0KA 1AMKA 3GDKA 2UV8G 4G1KA 3G8EA 4M19A 1WQ5A 3TV8A 1I2QA 1OJXA 3O6CA 1PVNA 1IIGA 3TW6A 1QNVA 3TC7A 3CEUA 3IV3A 2ATSA 3WFAA 1FWTA 3GK0A 3W86A 3KOFA 1H7OA 4DXVA 3H55A 3G0UA 4NNAA 1QWGA 4NJKA 3UYCA 1GJPA 4RXFA 4UC5A 3PSWA 2VFFA 3ABSA 2NUWA 3UY8A 2O7QA 3P61A 3EKLA 3PUEA 4Y90A 3NXFA 2QR6A 4IMFA 1PHQA 4UFHA 3IRDA 3W6YA 1FY6A 3HOJA 4JTTA 3A5VA 1TPUA 4UTTA 4DO6A 4OHQA 4UMBA 6ALDA 2V5BA 3LCFA 1ME9A 2J9XA 3NVTA 2V2DA 3V75A 3BO9A 4LT9A 3TAKA 3DKJA 1ZFJA 2QKFA 2QUUA 4HNUA 3CB8A 2WJZA 1EP3A 3LCLA 2C1HA 1GYNA 1WV2A 5EYWA 2ZTKA 3IVUA 2Y63A 3D0CA 1ME8A 4JR5A 1M6JA 1KM4A 1JCJA 4FX8A 1OFQA 2EHHA 1YXYA 1DVJA 1TB3A 2A4AA 1SW3A 1UJPA 3PB0A 5D2VA 4AF0A 1R30A 4LVDA 3QSRA 4MKNA 1W31A 2ZA2A 3G1DA 2HTMA 5CPNA 4I9AA 5HWJA 1EB3A 4FNSA 3M5YA 1A50A 5D09A 2EF9A 2V8ZA 4AWSA 5BOOA 3C4UA 1PV8A 2TSYA 4X3ZA 1IXPA 4Y8FA 1JCLA 4R7JA 1PL9A 4XKYA 7TIMA 3SR7A 4IMDA 1KA9F 3DHFA 5CZTA 4UTJA 1NFBA 1W8SA 1KW1A 3MHGA 4PODA 3W1PA 2ALDA 3NNTA 3KXQA 3FIGA 3T55A 2YGYA 3I65A 1XC4A 3S1WA 1T96A 2VC6A 3ABOA 3PSVA 3GVGA 2ZA3A 1EEPA 3O6YX 4EF9A 3TE9A 3KRZA 3DHDA 3PAJA 3C56A 2ZZ1A 3P74A 1JQVA 3RMJA 2A2IA 1VGAA 3GNNA 3MHUA 1HTIA 4IXHA 3G8RA 3DI0A 5KMYA 3W83A 3W1RA 3MHFA 2OT1A 3L0GA 3IVTA 5AHEA 4O15A 3U2OA 2QCHA 4UTWC 1OFDA 5K9CA 3WK1A 5KITA 3QSTA 3MP5A 4O0KA 5E1QA 3H53A 1I8JA 4HNNA 4S1FA 2CLLA 1H62A 3UZJA 1W37A 4R53A 2VEMA 3C2EA 4ZQCA 3RLVA 1KV8A 4NZFA 5F2MA 5TQLA 1IF2A 4UR7A 5C54A 1RQHA 4NJHA 3VE9A 4GUHA 1YXDA 2QDGA 4DF1A 1UUMA 3NO5A 3QPYA 2CWNA 4Z1DA 3S6DA 4AVFA 3SI9A 1PE1A 3NEVA 2Y7EA 5DN1A 3ELFA 1F6KA 1TJPA 4O52A 3HG5A 5CZ0A 1H5YA 1TV5A 5D04C 2O7SA 4AXKA 1K3UA 3UQNA 2A5HA 1GVQA 4XTDA 2YW3A 5DCEA 2A21A 1U5JA 1DQWA 4RX0A 3WJZA 4UR8A 1LORA 5L6UA 5DLCA 2Z0IA 1VYRA 3W07A 1QPNA 1F5ZA 4AHPA 2W79A 3ZFHA 3N73A 1SZGA 4QQ3A 3GR8A 3THQA 2WNZA 3BW2A 1EUAA 3PF3A 4NJJA 2BXVA 1ZY9A 3W72A 3NQFA 4WD0A 4IQLA 4LVGA 1Z41A 2TPSA 4LVBA 3OG3A 1KM1A 4FB7A 3E02A 3W7PA 3WJXA 1SPQA 2WSQA 3LX9A 1LTDA 4HIBA 5T26A 1SO3A 3ABQA 4FO4A 4ALDA 2WOQA 5HMSA 1OABA 1XKYA 3QMTA 3TQ0A 3A24A 3A23A 1OFAA 3NGJA 1OFRA 1QOQA 3EWWA 3PULA 1UASA 4WZHA 5D33A 1GQNA 4DBDA 4BWLA 3W7CA 1KFEA 5IBXA 3IGUA 3PBVA 3DFNA 3QQ1A 3L67A 1KFCA 2JKPA 3MMTA 1H7NA 2ZRUA 2X1UA 3IIVA 3NG3A 4DF0A 3NL6A 1A5AA 3Q37A 1GVSA 3RF9A 3LXBA 2AAMA 4FX7A 2I14A 5AYZA 4M5PA 3LRLA 4O8RA 2NWSA 1G4PA 4L4MA 5G1YA 4D2JA 4OWGA 1TPEA 3L68A 3PG9A 2ZRVA 3R2GA 5TIMA 8TIMA 4Q32A 1JUBA 2E6AA 3GB6A 3LTPA 2B0MA 4WXYA 1KTCA 3S1UA 2CW6A 3OVPA 5EPDA 1ZAIA 5D2XA 2CLKA 1L9WA 1MZHA 2VFHA 3NPXA 5U7SA 3FYOA 1TTIA 1JULA 1FCUA 3KVMA 5G2HA 3JRKA 3NL2A 4POCA 2WNQA 1JCMP 1O4UA 1LLZA 1PCWA 3W1UA 3TCEA 5K9DA 3DBPA 3M1ZA 3L21A 3RK8A 3PBWA 4RR4A 2A7PA 3TSBA 4ZL1A 3PM6A 1I2PA 4FHAA 1XCFA 1DKWA 2Q3RA 2CLFA 5AC8A 5F2IA 2RDWA 4ML9A 4H4IA 3V1PA 4GFSA 1C29A 3CM4A 3A5FA 1S5VA 4BF9A 4GWEA 3B06A 4L4LA 5TBOA 3L0NA 4IOTA 2QJIA 3W1QA 4EWND 4N9CA 1TPWA 1T99A 4RKAA 1H7WA 1TRIA 1EX5A 3CIWA 3W2UA 2ABBA 1JCXA 1W56A 3MI3A 2DU2A 3W7DA 3HGRA 3QMRA 2VELA 2R14A 2V82A 4HNVA 1Y0EA 1YPIA 5CKSA 1BWLA 3B04A 2LLEA 4IX0A 3M6YA 4I7WA 3G3MA 1UBSA 4MJZA 5FEZA 4JTEA 4XBKA 3SECA 3C2OA 2C0AA 1GVRA 4JTGA 4N2YA 1YDOA 2GVGA 5AHIA 1O94A 2ISVA 2PRLA 4UMCA 1QPRA 1OX5A 1G4EA 2B7OA 2GVJA 3LCHA 1RQEA 1LBLA 4DELA 4ZMGA 4JN6A 2F7FA 5HJLA 3P8JA 5HUPA 5I3JA 1TYGA 2Y7DA 1JCNA 1OF8A 1TPDA 3TR2A 4AH7A 2H3BA 2ZCGA 1F2JA 3W22A 3MI6A 4E2DA 1ZNNA 5E0KA 5AHFA 5DBUA 1A5CA 3INPA 5HR6A 4K36A 4KKXA 2DZSA 4HPXA 2P0OA 2V2CA 3W1XA 4NNBA 2FPTA 3E12A 4RK8A 2YXGA 4C1LA 4K7VA 4ORMA 2JKEA 4UTKA 4N4QA 1W1ZA 3T44A 2DP3A 3BPWA 1KM5A 5C5YA 3MWAA 2Q8LA 3M5XA 1H1YA 1OYCA 3W75A 3E9AA 3C52A 3JS3A 3NQGA 4LVAA 4JNMA 4RZ5A 4DF2A 3GXTA 3P5YA 4YL2A 2VFGA 2DZXA 3G22A 2R94A 1GVOA 1VCFA 3HMJG 4FNQA 1ML1A 1KFKA 2FPVA 1R2TA 3LBMA 3EX4A 3HGOA 3W71A 3F03K 3T40A 4E2BA 3WJWA 4IMGA 4JTSA 3C61A 3TMQA 3P7YA 2QF7A 1EWDA 3W1MA 1AW2A 3W2LA 3BG9A 2J9YA 5KZDA 3UWYA 3USBA 1HO1A 3NM3A 3NQCA 2Y7FA 4JXCA 1GTEA 3EX2A 1B9BA 2I9EA 3IEBA 3W7GA 4LTSA 1Q6OA 1FCVA 4HHPA 3GAYA 3QH2A 4MY9A 4ZQNA 3G1VA 3L65A 5DCDA 3UWQA 1KV5A 4A22A 3QW4B 1EA0A 1RQBA 3WJYA 3TROA 1ZALA 1VLWA 1FUYA 4O57A 1MEHA 3LI0A 2NLIA 1NVMA 1VLIA 4ZQPA 4MFEA 3QPZA 3LM7A 4BK9A 3CIXA 1FXPA 3W7IA 4CLMA 2FPYA 3O16A 1WXJA 3TU9A 3SZ8A 3G1FA 3O6DA 4IWWA 1YADA 5SWUA 3KRUA 1H1ZA 3NL5A 3TA6A 3OEXA 4EOUA 3NQAA 1F74A 2NWRA 4NJIA 3P67A 1FWNA 5KZMA 3N3MA 3KX6A 1RPXA 4ZQMA 5LNRA 4GNJA 1O5XA 2YR1A 3W2KA 5H2ZA 1LBMA 2YYUA 3O06A 2W0UA 1SO6A 1P0NA 2DORA 2Y70A 3TNOA 1RVGA 4FXRA 3RNDA 1IIHA 2YSWA 3GIYA 4O14A 2Q3OA 4O28A 1YTEA 3P5ZA 3DI1A 3QYQA 3WK2A 3BV4A 2WSYA 4MZ8A 5C6MA 3NQ6A 3Q2DA 3W2JA 4CNOA 4AHQA 1I4NA 2X16A 3I7SA 1R46A 4Q33A 4Z1AA 2ZDRA 2YFOA 4NZJA 5DCBA 4GBUA 3B4UA 3W7JA 1PS9A 1AK5A 1W3NA 4JEQA 1XI3A 2QCMA 4MVAA 3W9ZA 1XL9A 2QJHA 1KFLA 3I68A 2ISWA 2OT0A 4UNKA 4CQ8A 4QAIA 1KM6A 4O4VA 2P1FA 1GG1A 2ZTJA 3TFCA 5BNKA 3LCWA 3NQVA 2CZEA 3THAA 3O8AA 5C55A 5BMXA 4RZ4A 2GOUA 1LOLA 2Z6JA 4UFKA 3FKKA 5I3FA 4MOZA 1FWSA 4UTTC 1W5PA 1SZFA 4CCEA 3M9YA 3QQ0A 3EX1A 4AHOA 5DXYA 4LNYA 4O16A 5K4ZA 3W3OA 3PB2A 1JUKA 2E6YA 4R33A 4H3DA 3AO0A 2ZRYA 1QPQA 2H8ZA 3LB0A 2Z1BA 1LRQA 2JGQA 1T0OA 1KLYA 1EP1A 2PRMA 1HG3A 3BVJA 4O4WA 1L2UA 3S42A 1VRDA 4MLJA 5FI8A 1H63A 1TTQA 2DZUA 3W7LA 5AHLA 1PHWA 5K3VA 4R34A 4UTHA 1H51A 4XWUA 5IM51 1GEQA 2YX0A 1AG1O 1DHPA 3TQKA 5LNWA 2DZPA 4Z1BA 1TPVA 3U6WA 3DFOA 3B0PA 2ZZ4A 4FIRA 4H6KA 4MUZA 2X1TA 3LERA 5AHNA 4E38A 3TSMA 3LXCA 1TPH1 1RD5A 2NX3A 1IXOA 4Z0SA 5EKYA 4RZ6A 3DFQA 1I2OA 1LBFA 3EXTA 2GVLA 2PC4A 1LYXA 5AC6A 1J2WA 4CQ9A 3I7QA 1X6UA 1GVFA 1ICQA 3N14A 1QOPA 4O13A 3TFXA 4DPQA 5MHBA 2PURA 1WA3A 3NPVA 3F4WA 1TREA 1W0MA 4EF8A 3RFAA 2A7RA 4PCFA 3QEZA 3S9YA 4O17A 1ICSA 1YDNA 3NA8A 3S5NA 4JTUA 3S0CA 3GKAA 4A21A 6TIMA 4IMCA 1XFBA 3W76A 3PC0A 2NX1A 2QCFA 5D30A 4UNLA 1SFJA 4AF0B 3W1TA 1KFJA 4JYDA 4MYXA 2H90A 1BTMA 3N9SA 4UIOA 1DBTA 4OV9A 2Z6IA 3VKJA 3TUUA 1SO4A 3IIXA 3SFKA 2V9DA 3NYZA 2GQ8A 3P84A 1P4CA 4XKYB 3Q58A 2CFFA 2RDTA 3LV6A 5FF2A 3BGJA 1F6PA 4K8HA 4OGZA 4QIUA 4WY0F 4WOZA 1FBAA 1G7UA 5LHEA 1VYSX 2FTPA 4GUJA 4PEKA 3DFPA 4KFOA 1XM3A 1JUEA 1ICPA 3P82A 3W87A 5H91A 2P10A 3EWZA 1SR9A 2BSLA 1PCKA 2RKXA 4LVFA 5BMWA 2KZHA 2E1DA 3SY5A 3ZS4A 4UTLA 3NPUA 5CPMA 1OX4A 1F73A 1Q6LA 3GXPA 5HNRA 1KFBA 2E5DA 3FFSA 4WY0A 3O07A 1UCWA 2YFNA 1NAL1 2NV1A 4FX6M 1VCGA 1SUXA 5EMUA 2QJGA 4OQVA 3P80A 4LRSA 1EUNA 1X8FA 2IQTA 3MBDA 4N9EA 2BX7A 4NX0A 4BWLC 4I7UA 4UFMA 5IBXC 5LZLA 1K03A 1RZMA 3TC6A 1TV8A 1SZEA 1X7FA 3GDRA 3R8RA 2FQIA 1W5OA 1QDSA 2NXHA 3NZRA 3M47A 4KFNA 1SSDA 3LHYA 1K7FA 4ICNA 2FJKA 4LUIA 1Q3NA 1V7YA 4P2VA 4HN4A 2OMAA 1VYPX 1C9DA 3UY7A 3FKRA 3VNDA 5L9FA 3S5ZA 3KVKA 3R13A 1J5TA 4TX9A 5DY2A 4DBEA 2JGYA 5DBTA 1GTHA 1JQXA 4QITA 2RDUA 3HIJA 1L6WA 3NDOA 4LV9A 1WDWA 2EGZA 4O1BA 3B8DA 1ALDA 1SZNA 1Q6RA 4QM1A 2ZZ2A 4GUGA 4NUWA 4MLRA 5D32A 2NXGA 3GDTA 4GE8A 1LM1A 1K7XA 4O10A 1JRBA 3SGZA 1IXQA 1K7EA 1XDMA 1EIXA 3B03A 3N19B 1VH7A 4O12A 1Z44A 4AB4A 3NOEA 4N9BA 1HO4A 5F4SA 3L2IA 2WQPA 2ATMA 3C2FA 3PY2A 3G18A 4E0CA 1AW1A 4JY9A 2QCDA 3OVRA 5CG7A 5DY3A 3LHTA 1QMLA 1WBJA 5K2ZA 1OX6A 3IGSA 3HQ1A 2GPTA 1XBYA 1DOSA 4CCDA 4NU7A 2E6FA 4PL2A 4XUGA 3KFTA 2VXNA 5AN7A 4YXGA 2G97A 3LHWA 1JVNA 4LC6A 2WO5A 3LCGA 4K39A 3STEA 1IGSA 3G1AA 4FNPA 1N55A 2C14A 1TTJA 1VJIA 1HL2A 3CC1A 3GX9A 5LNSA 4AAJA 3LTYA 4JGDA 4WUIA 5D2WA 3G1XA 1A5BA 3HF3A 3ABRA 4O1DA 1ADOA 5HULA 3DXIA 1FDJA 2CLIA 3W2MA 3ZR4A 2R91A 3W7OA 2CLMA 3HG3A 4C1KA 2PE4A 2TMDA 1DQXA 4O1AA 2VEIA 3EWXA 4JDBA 2D73A 3M16A 5HQEA 1BEUA 4LS1A 5FESA 4UFLA 2A7NA 3A21A 2YCEA 3BK0A 2QAFA 2DJLA 1X1ZA 1LP6A 5D02A 3W23A 5GVJA 3JR2A 2E77A 2WPBA 1RV8A 3TAOA 1OFEA 3GAKA 3UWVA 4UMAA 3F4NA 3M44A 3G1YA 4CCCA 3S5OA 4YCOA 1LOQA 4X9SA 3TSDA 5CSSA 2VFEA 5I3GA 3M43A 3TXVA 2YYTA 1MEIA 1XBXA 4RCXA 4JYEA 1XBZA 3KHJA 3PUDA 2YPIA 3OBKA 4OE7A 2RH9A 4MY8A 3MP3A 2WKJA 5FEXA 3NQMA 5FF3A 4M6PA 4JTHA 2CLEA 1QCWA 3I7RA 2F84A 2BLEA 4HSNA 4QNWA 4ADSA 5D05A 3HG2A 4WXZA 5K7JA 4O0ZA 3UPWA 3FYPA 3TX9A 2HMCA 2X1RA 1V5XA 3SJ3A 3UWZA 4JS3A 1DJNA 1I2RA 5CGQA 3NM1A 3W88A 4MJMA 3E0IA 5F1VA 4HNTA 5HINA 5D2TA 3QM3A 1SW7A 1K02A 4NT0A 1AL7A 2H8XA 3LLFA 3W74A 1TQXA 3BW3A 3B0UX 4O54A 2FLIA 1A5SA 3VCRA 5F2GA 1VC4A 2XN1A 4N9DA 3IIPA 3BLFA 3KVLA 1OK6A 4K8EA 3T4CA 4M6VA 4Z08A 4LOCA 1LDCA 3VFLA 5C2XA 3UWUA 4JDYA 5AFDA 5AYXA 2X1SA 1Q6QA 5K9XA 1VR6A 2QAPA 3W85A 1L6YA 4O11A 1WOAA 4QSHA 3MI2A 2PRHA 1GYLA 2ZFAA 3S8HA 3DFTA 3B05A 1L6SA 2V5LA 4JIPA 3M7WA 3AJXA 3LHVA 3NL3A 4JTJA 1B4EA 1O60A 1U83A 3UD6A 4A2RA 3QRHA 5EBUA 5BRBA 4TMBA 3ANYA 5F1UA 4NJGA 1B57A 3SGUA 3ATYA 2YW4A 3QZEA 1AL8A 4LV4A 2FB3A 3CHVA 3LI1A 2AQWA 3GKFA 5F4WA 2VFIA 1CI1A 3NAVA 1LRTA 1NF7A 1LCOA 2FB2A 4TIMA 1OVDA 3MJYA 3G1HA 3EWUA 5AOUA 4IX2A 4N4PA 1XUUA 4LRTA 1MXSA 2ISSA 3TMLA 1UB3A 3NZ1A 3LTSA 3SW6A 1S5WA 3OVQA 1WOBA 3L9CA 2QEZA 3HO8A 1K8XA 1VHNA 2Y61A 4TO8A 4JX5A 1LLWA 2Y89A 3C2RA 1BKSA 1FQ0A 2Y85A 4IMEA 3LXAA 2V2HA 5A8GA 4MFDA 4JTIA 5I3HA 4UFJA 4WJEA 4PL1A 2WSRA 4N02A 1KM2A 2PCQA 3NR0A 3W73A 3EX3A 1SW0A 3MYPA 1G6CA 1KTNA 3LBCA 2RFGA 1AW5A 3W7EA 1NEYA 4X2RA 5CPOA 3G0XA 4M6QA 1TO3A 2C6QA 3L5MA 4MZYA 3WK3A 3UZ5A 1SSGA 1NSJA 3TQVA 2OX1A 3BARA 3YPIA 4WOQA 2NUYA 4UXDA 4UUIA 3OHIA 2BTMA 1W54A 2B4GA 4PC8A 5F2LA 3W1LA 4JYFA 2EAWA 4RJEA 1C8VA 3O05A 1OYBA 2AGKA 3LCIA 3UXDA 3IIOA 3L5LA 1ME7A 2QCNA 3QJAA 3UNDA 5G2IA 4PH6A 4AEOA 2NV2A 3R89A 3QF0A 5AC7A 4I7VA 1ONRA 1QAPA 3W70A 3T78A 1FCQA 5HWNA 5LGZA 1QO5A 3LRKA 3P8IA 4JTKA 4K38A 4J9JA 1E51A 2A1YA 1GT8A 2G96A 3UPBA 2FIQA 3W7NA 2R8WA 4A29A 2I1OA 1TMHA 1SO5A 4XBSA 3NQDA 1H50A 4X22A 3QC3A 2A6NA 4ZZ9A 1YTDA 1VCVA 5FEPA 1YPFA 3E49A 3ZWTA 4OV4A 1ZAJA 3W2NA 5I3KA 4AWUA 4FIQA 2E5CA 2QUVA 2X2GA 2VKZG 4FXSA 3PBYA 1MSSA 4LW7A 5FF4A 1DJQA 1WBHA 2ZZ5A 4PTNA 2V81A 1W5QA 4Y9AA 1HUVA 5EA9A 1NF0A 4LY8A 2VENA 3LOTA 5J5DA 1OFBA 3STCA 1W3TA 3M5ZA 3CLMA 3PWAA 1Z48A 5LGXA 1S3HA 3N2MA 3RLUA 4XZ9A 4K37A 5KSWA 3TIMA 3CTLA 2C13A 2RHGA 3QFEA 4DO5A 4LC8A 2C19A 3EKZA 2XFWA 5FEWA 4MPQA 1HFBA 3TH6A 3DFSA 1O95A 1FX6A 3W7RA 3IVSA 3N2XA 1VQTA 3M41A 1J4EA 3GYEA 4NX5A 5CPLA 4U28A 2Y7GA 3BW4A 3STFA 3FJ6A 3SSJA 4FNRA 2EKCA 1R2RA 2ZZ3A 2QCGA 1YTKA 3U8GA 4M7TA 3TJLA 3MBFA 3DGRA 1TV7A 1PIIA 3N9RA 3G3DA 4IGHA 1OK4A 3GR7A 4UTWA 3LLDA 4RLIA 4A2SA 5LSMA 2GJLA 2BWGA 1OF6A 1XXXA 1OYAA 3EB2A 1B4KA 3HB9A 1D9EA 1ZJIA 3OIXA 4ZQOA 4WX2A 1KBIA 3EWBX 4S2CA 3QMSA 3L5AA 5HUOA 4YCPA 5LNVA 2Y88A 1H60A 1ZCOA 2ZRZA 4QNEA 3STGA 3R5EA 3IGXA 4MY1A 2TRSA 5D37A 4JX4A 3PBUA 1VHCA 2OZ0A 3C0JA 1ZENA 4AMAA 1TRDA 4JX6A 3BGGA 3UXAA 4W9TA 2HS8A 1GZGA 4WQ6A 3H54A 1XDLA 2ZA1A 2CZDA 3W84A 1WX0A 1I2NA 1IXNA 3HBLA 4FEZA 5D2YA 1OHLA 1N8FA 2QUTA 2C18A 3PVFA 3ZWSA 5I3IA 3SIZA 2V0TA 2G95A 4NNCA 1QPOA 4OT7A 4KFPA 4GC4A 2Q8ZA 2OJPA 4JICA 1YLVA 4GUFA 4BFAA 3NQ8A
chains in the Genus database with same CATH superfamily
2QGYA 5ABTA 4WR3A 2E09A 1TKKA 1JJKA 2GQAA 4NRRA 2O9TA 1TJRA 3WJSA 2B7PA 1F61A 2Z1KA 3SURA 2YB4A 4W86A 3AQUA 5A8MA 1JAKA 5A2BA 4RDVA 3IIZA 3HV9A 5HMDA 5HNUA 2QULA 4W8AA 1Y7VA 4GZIA 4N6EA 3C0SA 1PYFA 1KM0A 5DMMA 1VKFA 2PDKA 2ZZ6A 1UPMB 2YDQA 5M17A 4FK9A 3B0VC 2UZ9A 4M82A 1W9PA 1XYLA 1BWKA 1CX9A 1E70M 1CB7B 1E4IA 4J3TA 4MG4A 2D1ZA 2DH3A 3TQPA 2PGEA 4FNUA 1HP4A 1D3HA 1CW2A 2FDSA 3THUA 4DY1A 4KWWA 3RPTA 2V30A 1JCYA 1YNQA 3VABA 3VZYA 2BZNA 2OCZA 3LENA 4JY8A 3C8FA 5XINA 5T9BG 3FJLA 1VZWA 3TW9A 1Q45A 2BB0A 5BOFA 1TCDA 3LQLA 3AYVA 1OX4B 1M7OA 4JTLA 1XR2A 2XIJA 3MSYA 3S47A 1MRAA 3EA3A 4WDTA 4WDUA 1WZAA 5KZEA 1K8YA 4PTWA 5CH9A 2NX9A 1QHPA 3HGJA 1G69A 3NQ2A 9XIMA 4Z0JA 3CUJA 2A85A 4AZ5A 4Y96A 1O5KA 2X0HA 5LYRA 3V5FA 4GOAA 3FN9A 1OFPA 3F7JA 4TVUA 2PZNA 2D0GA 1RJQA 3UXIA 4GXWA 1XBVA 1XWYA 3SCNA 1ZL1A 1QO2A 3N34A 1T5AA 2YCKX 4Y9MA 3H12A 1E71M 1EGVA 3DAQA 1S5TA 2ACUA 3M0ZA 2G5WA 5A2AA 1DORA 4W93A 4S3KA 3NO1A 1MEWA 1H61A 5EGRA 5KTLA 4GUIA 4XSMA 1W5NA 4I9TA 4C90A 4UTMA 4M1RA 2EQDA 3HPXA 3KRSA 4PFMA 4XD3A 2RDXA 2GZXA 2HE8A 1A5KC 5A6BD 3CPRA 1TVNA 2VEPA 2A0NA 4IHCA 1BYCA 3MVIA 2BFGA 2JK2A 3ZT5A 1K8ZA 3MWCA 3OGSA 5EY5A 1UHVA 2VFDA 1YYAA 3C6CA 3F4DA 3N11A 5BRPA 3ZLFA 3C3NA 2E9LA 3GVRA 4H6RA 2HVOA 2QCDB 1W5MA 2VI0A 2GFTA 3GSMA 3PR2A 1JIBA 4FMVA 2I5IA 3ISIX 5HOSA 5LHFA 3RR1A 4F40A 4V1YA 3VMOA 2DV0A 3CUHA 1WKYA 4CN6A 2YDRA 5FACA 3AMLA 4N6FA 4TU1A 4KMQA 2VR2A 1M41A 4H2CA 3SDOA 1V93A 1H4PA 2PTYA 4EXQA 1XIFA 1QFEA 2JBMA 2BOGX 1KLZA 2XN0A 3CPUA 3LRMA 3QKEA 3LY0A 3LA4A 6ENLA 3TW7A 2DW6A 3GR4A 4QLLA 2F2HA 4DUWA 1LRNA 2CZ5A 1GOXA 4JQ2A 1HJWA 1KBJA 3R4IA 2Z2UA 4CQDA 3O1NA 3PUOA 5B7ZA 1OC6A 1A0CA 4QX4A 4HTBA 4DZIA 3CMJA 4D72A 1KD0A 1W91A 1I0BA 4ZB2A 2OZ8A 2YA0A 3BJSA 3IJQA 1Z42A 2MANA 3CWOX 4OVXA 3LLXA 4RXGA 2J7HA 4GYPC 5HWMA 3H24A 4LUJA 1TTPA 3SQMA 4PA8A 2C16A 3T7VA 3WK0A 3HG4A 5FF7A 1XLMA 3W7HA 2HBVA 4K7YA 2XINA 1IEWA 4BQ5A 2PTWA 4GQ0A 1JZ4A 3NQ7A 2XVLA 2CKSA 3IAQA 4FR1A 4OU1A 2VGIA 1EDTA 4LF1A 2GQ9A 2CPUA 1JXJA 4HPJA 1V0MA 3E1F1 2VHLA 2YCLA 1JXKA 1LG2A 1NQKA 5DANA 1RXOB 2WWCA 1OG0A 5G2WA 4W8BA 2BGQA 3QC0A 4ONVA 3T2QA 4DPPA 4A8RA 4XD5A 3VM7A 3CUZA 1X1OA 4MIMA 3TWAA 3B8WA 5DQPA 4AIBA 4JTFA 5B7YA 2V38A 4D8ZA 3F2DA 5JIPA 1P0KA 1I1XA 1XPGA 2D0HA 3DG7A 3EMQA 1P48A 5HQLA 4G1KA 1DWGM 1I2QA 4U31A 1QNVA 3GU2A 1V6XA 1MW1A 5JBDA 2ATSA 3BLPX 3KCJA 1L6FA 3W86A 4D6FA 2Y5EA 3KOFA 2QV4A 3VGHA 3H55A 3GS6A 3O0KA 1QWGA 3UYCA 2VFFA 4L9ZA 4JIRA 2J7DA 3UY8A 3ITYA 2O7QA 3P61A 3AXHA 4QDWA 4IMFA 4UFHA 4JTTA 1TPUA 2VCBA 4UTTA 1QNSA 4KIRA 3NVTA 2V2DA 3BO9A 3DKJA 1CXKA 1AZ2A 2VX5A 2C1HA 4XO7A 1WV2A 3BGAA 4KIEA 4H83A 3A64A 2Y63A 5EBAA 2BVWA 3D0CA 1ME8A 4ML4A 2HXUA 1S39A 2ZX6A 2I17A 3S9IA 5H8MA 1JCJA 5T9CE 4WJ8A 2EHHA 5KEZA 2A4AA 3PB0A 1SMAA 1R30A 5JVLA 4BY3A 2HTMA 5CPNA 2Z25A 3CBWA 1POJA 2OZTA 4FNSA 1G94A 5D09A 4LX4A 4PRTA 7ODCA 4R7OA 3DG6A 2TSYA 1IXPA 1OG6A 1JCLA 4R7JA 4IFRA 4LEFA 3DHFA 4UTJA 3MHGA 1XF0A 3W1PA 2I56A 1PO9A 3KXQA 4DUOA 2VZOA 2VZUA 1HVQA 1UH2A 3GVGA 2ZA3A 2W3ZA 1SZRA 3M0HA 3DHDA 2J7GA 1DQUA 3GXDA 4DUVA 2ZZ1A 1JQVA 4JFVA 2PZ0A 3CLWA 4NL1A 2A2IA 2X1IA 4IIFA 5TF0A 5FD0A 1IZCA 3H4XA 4ZXOA 4AFYA 3VVGA 4YHEA 2QCHA 1HN1A 4NI8A 1HKIA 3WK1A 3QSTA 2CESA 1C91A 3MP5A 4JTQA 4UQEA 4H1ZA 3MA8A 4AVNA 5E6ZA 3RLHA 4HOWA 1R3TA 2WC4A 4R53A 4ZQCA 3T0AA 4DAFA 1K77A 4CN4A 1US2A 4NZFA 5TQLA 1IF2A 3BANA 4UR7A 5C54A 1RQHA 3VE9A 2HNHA 5M5DA 3AMCA 1YXDA 4UOZA 1UUMA 1YE6A 3S6DA 4AVFA 3TC3A 1E0WA 1H11A 3I3EA 2Z29A 4KGLA 2IKHA 4XG1A 4KCVA 3VOGA 2ZUSA 4AXKA 3BCDA 1OEPA 3OYZA 3UQNA 2A5HA 1GVQA 2YBTA 4XTDA 3CHDA 3V5CA 5DCEA 4PUUA 1ZCCA 2DUZA 4RDYA 4JBRA 1YQ2A 4NAEB 5L6UA 4M56A 5DLCA 2Z0IA 1VYRA 4DUXA 3W07A 3M0YA 1IWAA 4AHPA 4QE5A 3ZFHA 1EJUC 2FYMA 3GR8A 4PGLA 5ABFB 2PF8A 1CNVA 3PF3A 1DP0A 4NJJA 1R38A 4IQLA 2ACQA 3H26A 1Z41A 3AALA 4Q7BA 3H2AA 1B3WA 3E02A 3W7PA 2DY3A 1SPQA 3LX9A 5I3DA 1LL7A 1E3XA 4R85A 1S38A 2WOQA 3QMTA 3IUIA 3MMUA 1QOQA 1NP2A 5D33A 1QI4A 1GQNA 1P43A 2H9AA 4DBDA 2WHKA 3Q67A 4LUYA 3IGUA 3L67A 4GYFA 3MMTA 1H7NA 3EKGA 1V8EA 2X1UA 3SCWA 4HB7A 1Q6DA 4RE4A 1GVSA 3CHEA 3WQOA 1ZRQA 4FOJA 1OCBA 3M46A 3M0VA 1G4PA 2ADAA 1C7TA 2YL5A 3PG9A 1EJ7L 2ZRVA 8TIMA 4ZO7A 4FXFA 1R3WA 1JUBA 3LTPA 2HPIA 3S1UA 3BLOA 1FFRA 2PUZA 2HZGA 1WDDA 3GC2A 1RY8A 2P5NA 2VFHA 1EJTC 3DECA 3NPXA 3FYOA 1CBGA 3KVMA 5JH2A 1RHCA 1GQIA 1PCWA 4MWAC 4R9OA 4DN1A 2VRJA 2WMHA 3L21A 3WQGA 4YN5A 5G4HC 3APTA 2GGEA 3PM6A 2INEA 4X0VA 5EU9A 3BL3A 4G7EB 4JTRA 2Q3RA 5AC8A 3TWBA 3CV1A 4NZ1A 1UR0A 1DE5A 4KCUA 3SCSA 1S5VA 3V0UA 3B06A 3ZLHA 2QJIA 4EWND 1XLLA 4N9CA 1E9LA 4LH8A 2ISFA 1RBAA 4RKAA 1H7WA 3MQTA 2WMIB 3SCVA 3UG5A 3QTGA 3QKZA 1JCXA 4MB5A 3ZXWA 2R14A 3RN6A 4GZ7A 2V82A 2YZ5A 4F79A 1WKFA 3B04A 2LLEA 1Z7AA 1MXDA 3M6YA 3G3MA 1ZPTA 5FEZA 4LYKA 4HJWA 3AWOA 3K4AA 4XBKA 2WZMA 3SECA 2C0AA 3VX0A 1V6UA 2PRLA 4BEUA 2B7OA 4AQLA 3LCHA 3B3DA 5HPCA 1OF8A 5GJPA 4NY2A 2R1PA 1JGIA 2XVNA 3W22A 3MI6A 3AI0A 5AHFA 1ODUA 3INPA 4IICA 2OO6A 1GJWA 2DZSA 2YXGA 4C1LA 4US6A 4ORMA 3PWGA 2O9RA 3MU7A 3LQGA 1EHAA 3EYPA 4AC1X 4Q8OA 3IUDA 2Q8LA 1H1YA 1O12A 3K4WA 3JS3A 1C3FA 3BJTA 3B4YA 3GXTA 1A0EA 3ID7A 4YL2A 2VFGA 2D2HA 2OLAA 2RJGA 4FNQA 2FPVA 3LBMA 2Q8XA 3EX4A 7ENLA 4OBRA 1J0IA 3W71A 1AH4A 1VJZA 4MNJA 3MZ2A 4IMGA 3TMQA 3O9NA 2QF7A 4GIEA 3GG1A 4H9MA 3W2LA 1NP0A 1RBLA 1ISYA 4GQGA 2D2GA 1XYBA 3REQA 4J7RA 2Y7FA 4JXCA 2QW5A 3TTEA 3UGRA 1GTEA 1B9BA 1XHGA 4HA4A 3GAYA 1JYWA 1GOMA 4RPQA 3QH2A 3A12A 4MY9A 1DIOA 2CBVA 1YRRA 1B9ZA 1KV5A 2X09A 2ZXBA 1E55A 1ZALA 1VLWA 3HQNA 3VKAA 3L4WA 1MEHA 2V3FA 3CHCA 3LI0A 1RD6A 1JDAA 1VLIA 4OTKA 2WC7A 4MFEA 1NDVA 3UCDA 3OQ8A 6REQA 1VEPA 3KCOA 1O1ZA 2ICSA 2HCVA 1FXPA 3W7IA 3UVIA 2X2YA 3SM0A 3UJRA 1O5QA 4CLMA 2HV5A 3O16A 3URQA 1XYAA 3R10A 3G1FA 4L4OA 4F2UA 3O6DA 1PKNA 4HCDA 3WD1A 3CUFA 3SSZA 1H1ZA 1OM0A 1TZ7A 3NQAA 4S3EA 3P67A 1FWNA 3N3MA 1RPXA 4PMNA 4C6CA 2NQLA 3L4YA 4GNJA 3W25A 1EHNA 3CH0A 2YYUA 2W0UA 2Y8KA 1W2VA 2Q02A 5A95A 1AH3A 1YTEA 3P5ZA 5BROA 4QEEA 2C71A 1HT6A 3Q2DA 5I07A 4CNOA 4AHQA 1I4NA 1R46A 3K13A 3WL1A 2ZDRA 5FJTA 4NZJA 5DCBA 4GBUA 3B4UA 3W7JA 3CZGA 1AK5A 3H7UA 3SCTA 1XI3A 4MVAA 3NGFA 4I9MA 4DWSC 4UNKA 1XLIA 4RPPA 4WF7A 3IV8A 5H6HA 2ZTJA 2G4FA 2QMKA 2EPOA 3RM8A 3IJ8A 1JGMA 2NQHA 1DJWA 3FKKA 3DC0A 1W5PA 4C7FA 3V1HA 3RPDA 1IWBA 1ZSXA 4CCEA 1VFTA 4AHOA 3L4VA 5JBEA 5K4ZA 4IJRA 2B31A 3UZZA 3PB2A 4GI4A 3RITA 3IACA 4L9XA 2QVNA 1J0JA 4R33A 1T40A 2ZRYA 2OKOA 2BY1A 3WFLA 4UQCA 3ALGA 4GGHA 2Z1BA 4G1NA 2JGQA 2PRMA 4H7CA 1FFQA 4ZB0A 2D3LA 3NQBA 2J77A 3VD9A 2JEPA 4WDXA 4EX4A 4MLJA 5FI8A 5DMYA 4GKLA 1AH0A 3AMKA 1H51A 5HNTA 5IM51 3TQKA 3EOOA 3CYJA 3M0KA 3EA2A 2CXEA 3DFOA 5A94A 3NSXA 4EAMA 4FIRA 4E38A 4MUZA 3WBYA 5HJYA 2WHJA 1NWUA 1TPH1 1RD5A 2AKMA 1QI2A 3DFQA 2CBJA 4HOZA 1CCWB 4PUNA 4OKDA 3CIVA 3CAKA 4A4AA 4B5VA 3SUWA 5A6KA 2C0HA 5M03A 4WKHA 4DPQA 1QTWA 1TFVA 5DO8A 3WIJA 4UQBA 2PURA 4C6OA 4LYQA 1TCMA 4DYJA 2A7RA 4O17A 1YDNA 1UP2A 3S0CA 1AQHA 3GKAA 4UZSA 3EDDA 4BHYA 1G5AA 4FLRA 2WCGA 2NX1A 4JN8A 5D30A 2OLHA 4ERIA 1NTHA 4AF0B 1C9WA 3VDCA 1C90A 4IP4A 3V7PA 1PZ1A 2FTYA 4Q4OA 5LXEA 1KFJA 4JYDA 4MYXA 1KGWA 2YXXA 4H9ZA 4OV9A 2E67A 4JFSA 1SO4A 2GQ8A 1NU5A 2V3DA 2PCEA 3O0FA 1RJRA 2OQHA 2RDTA 3TN3A 4LY4A 3WH8A 1F6PA 2HVNA 2UY5A 4WOZA 3IGHX 1G7UA 2FTPA 2PDJA 3GFZA 1PIFA 4GIYA 3W87A 3TR9A 5H91A 4LVFA 5BMWA 3WUEA 3N6QA 1L0PA 4UTLA 5D9NA 3F4CA 2NSOA 4NHVA 1Q6LA 4PMYA 5HNRA 4A8LA 2E5DA 2QQ6A 4WY0A 2YFNA 1NAL1 3E38A 2ZXDA 1VCGA 5GNZA 3S2JA 4W87A 3TN5A 3ZYZA 1DWHM 1SUXA 3NJ3A 3UG8A 4GI8A 4Q7IA 3P80A 1Q7MA 4OUIA 1OCJA 1HJQA 1EUNA 4IM4A 1R6WA 4BWLC 2NQ9A 3FK4A 3H2MA 4I7UA 5GJMA 2CNCA 3TP4A 5IBXC 1K03A 1RZMA 3DHUA 2ZX8A 3WLRA 1X7FA 4JHOA 4AZIA 3GDRA 3U4FA 3URAA 1HKJA 1QDSA 1YX1A 3GNRA 4KFNA 1V02E 4ICNA 1P6BA 3GU9A 4HN4A 2A3AA 1OZMA 1C9DA 1ADDA 3FKRA 2HWGA 3KVKA 5DY2A 4DBEA 5DBTA 4HHMA 1GTHA 3HIJA 3C0LA 2IPFA 3NDOA 4YJ5A 1Q7ZA 1BRLB 3QOKA 1GKQA 4DM2A 3B8DA 4ERGA 1ALDA 1JPIA 1PJ9A 4GUGA 2WWDA 2VDGA 4O10A 2PODA 3SGZA 2HDJA 2DSVA 1I1WA 3ZM8A 3B9OA 1XYZA 4IZGA 4S3DA 3VXGA 4X60A 2DFAA 4P7NA 1EYEA 1VAHA 1GZJA 2V5JA 1VH7A 4EKJA 4AB4A 2NV9A 3MUIA 2WQPA 3C2FA 4O1FA 4E0CA 3G18A 1AW1A 5CG7A 5DY3A 2E7FA 2Z2BA 4AZHA 1OX6A 3AHZA 3HQ1A 1E6RA 4L6DA 2VXNA 5AN7A 4YXGA 1FHVA 4K39A 4P8UA 2C14A 2J8TA 2V3GA 3AIBA 1MDRA 3LTYA 4MDPA 1XQLA 4JGDA 3PZNA 3PJXA 4F2TA 3L23A 5D2WA 3G1XA 1I0DA 4TVCA 3BUVA 3GFYA 4CD8A 2PU1A 5CGMA 2CLIA 1OIFA 1MVYA 1K4HA 1JI1A 2WB5A 3WNPA 4PMUA 1DQXA 4JDBA 4GNVA 2A7NA 3A21A 5FJOA 5IDZA 5D02A 1QWKA 3WH7A 3UWVA 3CMFA 2OEKA 3F4NA 3M44A 4QSFA 3G1YA 3MCNA 3UR7A 4HOXA 4L6HA 5I3GA 1Q6CA 4RCXA 1XBZA 3FVMA 3R0KA 3OBKA 2RH9A 3TLQA 4DJFC 2BHZA 3MP3A 2GK1B 5FEXA 1J93A 5FF3A 4W7VA 1SFSA 5IRPA 3I7RA 4MM1A 2F84A 4XBJA 1OWQA 1QK2A 1HJUA 1LT7A 1FP8A 3EPOA 4YTTA 3FYYA 4A6GA 4C6JA 4GY7A 4WXZA 3BSMA 4M80A 2FTWA 3H2OA 2X1RA 1V5XA 3AS2A 3M6DA 4JS3A 3WUGA 2IKGA 2XH4A 1XSKA 4INFA 3R8GA 3W88A 4MJMA 2YA1A 3ITTA 4GGBA 1W9XA 1XLCA 4HNTA 1Q65A 4DAIA 2KX9A 2DVUA 3GUWA 1K02A 2OEJA 5REQB 4UR9A 3LLFA 1HKWA 1A5SA 2Z27A 4DZ5A 3KW3A 1J2BA 4WJXA 4M6VA 4H8NA 4LUSA 3UWUA 5AFDA 4XZMX 2QAPA 1L6YA 1F3XA 2WQDA 3O3RA 3MI2A 5GNYA 1DJHA 4ERAA 3B05A 5FSDC 4PUDA 2XIOA 3AJXA 4ILSA 2OB3A 4JTJA 4ZO8A 3UD6A 5EBUA 3KZSA 4JTCA 1WCGA 4GC3A 4WSHA 3ATYA 3W26A 4GYPA 1MUWA 5LA0A 3TTQA 3WF0A 2AQWA 4JL2A 4QE4A 5A6AA 2IXVA 3GKFA 1HJSA 3KBSA 5I79A 1CI1A 3KM8A 3NAVA 4PEEA 2X42A 2GOKA 3MO4A 2AOSA 3WQVA 3G1HA 1JZ7A 1NJJA 1L2QA 3PAOA 4GQBA 3CL7A 3GNPA 1XUUA 4LEQA 1AJ0A 5CLWA 5A8NA 2ISSA 3TMLA 1B90A 1UB3A 1WB0A 3NZ1A 2Z1VA 3LTSA 3M07A 1S5WA 2QUNA 3SW6A 3HO8A 3L9CA 2QEZA 4B3ZA 4ICMA 1VHNA 2Z28A 4G9PA 4F4RA 3C2RA 1BKSA 4R9XA 4P8VA 1CLKA 3QR3A 1ZBKA 1B3YA 3LXAA 4MFDA 1A4LA 4UFJA 4HMNA 5JIWA 4PL1A 3EDKA 1KCXA 4F0LA 3MYPA 3W38A 1AW5A 3WO8A 1BGAA 4BQ2A 2BDQA 4M6QA 3L5MA 3WK3A 1QU4A 1UMLA 4C60A 4QG9A 2OX1A 1TZZA 4L4PA 1UYQA 4U5KA 4UXDA 3VOIA 2BTMA 5XIMA 4AZCA 1W54A 4TV6A 5F2LA 1Q5MA 3W1LA 2EAWA 4J2MA 2AGKA 3IIOA 4KCWA 1LL4A 1C8YA 1QJWA 1ME7A 5G2IA 4FALA 4AEOA 3QF0A 4CQBA 3WD4A 3DC8A 1QO5A 3P8IA 4JTKA 1E51A 4E8GA 1V51A 5A3HA 2FIQA 2FGZA 4A29A 8RUCA 2I1OA 1KBKA 3R8HA 4X22A 1RH9A 3DUGA 3QC3A 1NELA 1ONWA 5FEPA 1AUSL 3IJ6A 3ZWTA 2VD9A 5I3KA 4AWUA 2X2GA 2VKZG 3NYDA 1S2AA 4LW7A 3KL3A 2GJPA 3ICJA 4R27A 1V3IA 4ES4A 5EA9A 2YBUA 2BV9A 2QYGA 3RX4A 3STCA 4E4FA 1BAGA 1AZ1A 2CIPA 4UBPC 3PWAA 5I06A 1Z48A 1WXZA 5LGXA 1A5OC 3LZ5A 3ARQA 3RDKA 3N13A 3CTLA 2VURA 1TA3A 4ICCX 3QFEA 1VPYA 3WLLA 3VNMA 3DFSA 4W7UA 4PULA 3UJEA 1IR1A 1RSCA 2GSEA 1E1EA 2Y2WA 2Y7GA 3VNLA 1W1PA 4W85A 3B40A 1PIGA 1CPUA 4M7TA 1HKVA 5DFAA 3TJLA 4H7ZA 2XTKA 4IGHA 5D9OA 2IPWA 2GL5A 4JKKA 3FY1A 4LAZA 2UBPC 4ZSUA 2V5DA 3OIXA 1OYAA 2I16A 1ZJIA 1OIMA 2WJFA 3KCLA 3GM8A 3VZXA 5HUOA 5LNVA 1ZCOA 3RJYA 4Q8WA 3IGXA 4MY1A 2PWUA 3QR1A 3PBUA 5M3WA 2FHBA 1L8PA 3PZMA 4WDWA 1E5JA 1TRDA 3ANUA 4ZO6A 4CEUC 1Y65A 4X61A 3BTNA 4RE2A 4RL3A 2CZDA 3K8LA 1M65A 1WX0A 1I2NA 2XISA 4C91A 3H4WA 4O8AA 1R85A 3HBLA 3MJMA 3RIKA 4S3BA 4YTRA 2WXDM 3LU2A 4IQDA 1GVEA 2F6KA 1T7LA 3PPCA 1QPOA 4OT7A 1GONA 4GC4A 3BCFA 4JICA 1KCKA 4GUFA 4JIHA 4RZBA 2ZRWA 3DKLA 3VX1A 2GDUA 4RNJA 1FWCC 3GW0A 1GORA 1TSIA 3RHGA 1M04A 4ZVJA 3AU6A 4RV8A 3P60A 3BLDA 3UYIA 1WAUA 3PZGA 3NSMA 4JEJA 2QF8A 1SQ7A 3CU2A 2YCIX 3MKCA 5LXXA 5I23A 1SU5A 1UR1A 1UQYA 2PWGA 4CQCA 5IDIA 5I78A 2PGWA 3R1ZA 2Y6ZA 1W1VA 3ARTA 4MB3A 1CGVA 3AHXA 2GJNA 1ITXA 3KEHA 5BW6A 4A3RA 3DFYA 1V4YA 3TZFA 1D3GA 2AQVA 4PZVA 1R3YA 1K9TA 4YMZA 2GUUA 5CSRA 2VVSA 2C3ZA 2QHAA 3SRHA 3VNYA 4IG2A 1K9EA 5DELA 5EL1A 2YBVA 3CUGA 3AUJA 4HKPA 1JRCA 3VI2A 3GDLA 2NQ5A 1LZOA 2W6RA 2VGGA 4BR1A 3QGVA 5D9MA 1F76A 1T8XA 3VNJA 4L7ZA 5CC3A 4Y6GA 3ARYA 3TJXA 3MV11 2PLJA 4GRSA 3AYSA 5E0CA 1IT8A 1GG0A 6TAAA 1J0HA 2ZICA 4AG0A 2EKGA 1I45A 7CGTA 5C9WA 2ZQ0A 2CCRA 1X7IA 3A22A 3HPSA 3KTXA 1UPPA 3FA5A 2EG6A 3SRKA 4MWAA 1VFOA 4KRZA 8CGTA 4BJHA 3F1QA 2YDAA 1TX2A 1YNYA 2H6RA 5J5RA 3MY9A 4XTIA 5DXXA 2PWEA 1G4SA 1XISA 1KXVA 3C2VA 2E5BA 2NVDA 4O53A 2FZMA 4B4HA 1BG9A 4YWSA 5U4NA 2G4JA 3PFRA 2J79A 4Z1CA 3I3BA 1OZQA 2BY2A 4QJ1A 2VWSA 3VTRA 1JEZA 5HNNA 1UA7A 4XIAA 2OR2A 2VM8A 3KOYA 3TK7A 3WBXA 1Q6GA 5F4XA 3R0DA 2J24A 3TJ4A 3GDMA 2C1GA 4IJBA 4YWIA 4EAYA 3M5VA 5LKYA 1GNXA 4L5ZA 1XH1A 4UTUA 1H7RA 3CZLA 3LYEA 2DZWA 5I24A 3W7KA 3A3XA 3MUY1 4V1XA 4PUWA 3VDBA 1JAEA 4XUYA 1WNOA 5FAJA 3CEPA 1RR2A 4M24A 4MZ1A 2CLOA 1DJYA 1XH0A 2QCLA 1GQLA 1AQFA 3BG5A 2QMJA 2J27A 5FCZA 2WV8A 3O63A 1N7KA 1F05A 4AYSA 1U1HA 3WDQA 3EGJA 4RNIA 1UWTA 2QIWA 2QXWA 1ZP3A 3LV5A 4DVOA 1O6IA 2QJJA 4BI6A 2A6LA 2VQTA 2DZVA 4FI4A 2ZRXA 1XRVA 3QXBA 1WUEA 1EF2A 2CZFA 1B2YA 2A3BA 1WYIA 2XN2A 2YA2A 1PYMA 2FZDA 5EMLA 4E6MA 9XIAA 3CT2A 1N2VA 2ZZ7A 3FS2A 2WMGA 1H7PA 3PG8A 1KNWA 3CNYA 4NIRA 4GVGA 3CZEA 2E25A 4ORIA 4LUTA 3VUSA 2ZBTA 3W1NA 5AHMA 2DT1A 1B3OA 1CXHA 3OU8A 3FXGA 3CMGA 3RR4A 4C6PA 3WH5A 4JIEA 1FWAC 3O7UA 1JZ8A 4CNNA 2V68A 3EXRA 1BVWA 5CPQA 3K46A 3P81A 1QR7A 1QW7A 2ABAA 4HCHA 4M7SA 4LWWA 3G24A 1AQMA 1H49A 3I10A 1Q6EA 1Y5WA 5AYYA 4DEFA 3ARVA 4ROQA 3G0SA 1OCQA 4PUEA 4DQWA 3FLUA 1AA1B 1ZHAA 4MUPA 4O50A 2J7FA 3WCZA 4UTFA 3BLEA 4E5TA 3L66A 2X05A 1V3KA 5HPOA 4K6AA 1D3CA 3MB9A 3EXSA 4LS2A 1U33A 1J9YA 2H3DA 1P5BA 2VC5A 3WQ6A 1XUZA 4FNTA 1TPB1 1M7PA 3CQJA 4Z2GA 2F2KA 4DNMA 4KCTA 4HPHA 5GJNA 4Q3MA 3NPWA 1YXCA 3PTDA 3UJFA 4O19A 3AWNA 1UUOA 2QLYA 4UFIA 4GX8A 1NQ6A 2GSHA 3W24A 4GISA 5E93A 3L4ZA 5CJMA 5T91A 1AMKA 3GDKA 2VYOA 4JPGA 1V3JA 2XGBA 3G8EA 3TV8A 2XGZA 3TW6A 3GH7A 3WFAA 2VX7A 3VIOA 6REQB 3N6JA 1CEOA 4DWSA 3VD7A 4QCEA 2HPMA 4NNAA 1Z6KA 4NJKA 4RXFA 1XW8A 2Z00A 4HA0A 3V0SA 3ITXA 3EKLA 3PUEA 1HF6A 4W89A 3NXFA 2GGGA 3ITVA 3A5VA 1H1NA 2CBUA 4ATDA 4JNYA 4OHQA 1MWOA 4LF2A 4URIA 3TAKA 3RMEA 4JCLA 3GH5A 4GPNA 2ZTKA 2EPMX 3URBA 2P8CA 3W6MA 4LB3A 3B8VA 1RK5A 1OFQA 4V15A 3ZIZA 3JZEA 5D2VA 3QSRA 4MKNA 4I9AA 1EB3A 4KEVA 2VUNA 3P14A 3BH4A 2R9RA 3D47A 4AWSA 5BOOA 4PB3A 3T2PA 4CD5A 4X3ZA 4Y8FA 1ITQA 7TIMA 3SR7A 1DTNA 4B15A 3MZNA 4KRUA 1AD1A 4PODA 2HEJA 1K6WA 2O0TA 3PSVA 2CEQA 1LQ2A 2OKTA 4EF9A 1J6PA 3ONCA 4LYPA 3C56A 1BD0A 3P74A 1F8MA 3GNNA 4ZFMA 1HTIA 2ONEA 3FSTA 4IXHA 3MHFA 4B9ZA 2OT1A 1FWGC 2REQB 3OQEA 3U2OA 4UTWC 1PTGA 1TE6A 2YDSA 3PTQA 1OFDA 5K9CA 5KITA 4ZCWA 2WANA 3H53A 1I8JA 3MKKA 4HNNA 3T9PA 4Q6XA 2BG5A 1XIDA 2CLLA 1VJSA 1V79A 3ES8A 2DIKA 4N0RA 1A47A 3M0JA 3BOXA 4OFCA 3NEHA 2XVKA 5F2MA 2PWFA 3RRAA 4GUHA 3DG3A 1CGWA 3H2CA 3NO5A 2PDIA 2GUBA 2J8FA 2QIIA 4HZ6A 5EFDA 4MAZA 1TV5A 5D04C 4F0HA 3N9KA 4CNUA 1HW6A 3QGKC 4X0NA 2BY0A 4CCZA 4GH1A 4PB5A 3Q65A 3UETA 4F66A 3R0UA 4B3KA 3FW6A 1W3JA 4AD0A 3PZQA 3WMLA 5C70A 1P0EA 1HGWA 2E9BA 3ZJKA 4M81A 1UC5A 2PDGA 2EEXA 2XWDA 3BAKA 3N73A 4D6DA 4J2PA 2CBIA 1UBPC 1YKWA 3W72A 3T81A 3ZT7A 4LVGA 8XIAA 4LVBA 1GOOA 1KM1A 4FB7A 2WM1A 3L4TA 1C92A 4HIBA 2YJQA 1S1PA 5T26A 1OABA 1XKYA 4HPNA 4I90A 4A8NA 1TWDA 2RJHA 3NGJA 3PULA 1F3TA 1Z69A 1UASA 1GOIA 1N82A 4BWLA 3KL5A 5J8LA 1PAMA 4QJ4B 3AIUA 4GLEA 5IBXA 3NWRA 3WBAA 1EXBA 2J8GA 3HMCA 4GYKA 4JQAA 4PUMA 3LXBA 1IE7C 2AAMA 2I14A 3DGBA 3WLTA 4M5PA 4DLFA 3POCA 3XIMA 3LN3A 4Q8PA 5G1YA 4D2JA 1XDJA 3L68A 1ECEA 3BAIA 4RNFA 3TOYA 4D8AA 1E0XA 2E6AA 3GB6A 2DQXA 3BAXA 3UT0A 5D2XA 2CLKA 4FZIA 3HURA 1MZHA 3ALFA 1YBQA 1K9DA 4KF1A 7TAAA 1FCUA 3JRKA 3NL2A 4XAPA 4QJ3B 4POCA 1J8VA 1XIEA 1B54A 1JCMP 1O4UA 3SADA 4AD4A 3W1UA 4IT1A 1BYDA 5ECUA 1F8IA 1VBRA 2R1MA 4Y7EA 3RK8A 3VCCA 4GA8A 2VCAA 4BEQA 1CT5A 1VIWA 1OINA 1V77A 4FHAA 3ABZA 5MKGA 5IFTA 1XLGA 3P2VA 3A47A 5F2IA 2R82A 3A5FA 2FHFA 4M6UA 3GQYA 3S46A 4BF9A 4FLQA 3W1QA 1T99A 2DT0A 3CHFA 1ZGDA 1CLVA 3ITGA 3C5QA 2ABBA 4CVWA 1W56A 2DU2A 3HGRA 1CXIA 1Y0EA 3LNPA 1YPIA 5CKSA 1JDCA 3QHOA 1HKKA 5CSUA 3WFZA 4GG9A 4MJZA 1V08A 1LWHA 4H9YA 4JTEA 3V4BA 2ZUNA 3FXYA 4JTGA 3IJLA 2GVGA 2INZA 2ISVA 5FAGA 1Q7QA 4YU1A 1G4EA 1J0YA 2GVJA 1E15A 1ZLPA 4NAFA 1POKA 5CZKA 1RQEA 4DELA 4MNMA 3P8JA 5HUPA 2PDYA 1TYGA 2Y7DA 2WC3A 3TR2A 3E2SA 2BVYA 3E0LA 4C7DA 1F2JA 4P7OA 1ZNNA 3DYMA 5E0KA 5DBUA 2WLZA 5HR6A 4KKXA 4YVPA 4HPXA 4CUCA 1UZHA 2P0OA 2FPTA 3E12A 1KXHA 1PDZA 3AZSA 3WLMA 4DJFA 3UERA 2JKEA 3RUBL 1O7AA 1W1ZA 3EA1A 2DP3A 4LBSA 3BPWA 3IJ7A 4QS5A 3M5XA 3WLPA 3C52A 3C8NA 4RZ5A 1NDZA 2PU0A 4DF2A 4U2ZA 3QPEA 2R94A 1ML1A 1UKSA 3SN0A 1R2TA 2BHYA 3BLLA 3BOFA 3T40A 1RALA 1TMQA 3C61A 1M9HA 1Q2RA 4C1NB 3W1MA 4I5RA 8XIMA 1NOFA 1EX1A 3UWYA 3VIPA 3V0TA 3USBA 3NM3A 4ACZB 1CB2A 3AXMA 3OLDA 1EC7A 1E1CA 4LTSA 3I4KA 1XRTA 5DCDA 1SMDA 3UR8A 3UWQA 4A22A 1ADSA 2GJXA 3QW4B 2BY3A 1TWWA 3VOCA 3UA4A 3SCQA 4F0MA 3VNKA 4EWJA 4A3HA 4IL2A 1JPHA 1J6OA 2DUAA 3CIXA 4AIOA 4D6EA 2FPYA 1UA3A 3GVVA 3SZ8A 3AU2A 4IWWA 3VPLA 1W1B1 3NL5A 1ITUA 5KZMA 4PMRA 5I5RA 1O5XA 5AYIA 4LAKA 5AECA 2YR1A 5H2ZA 3O06A 4PR4A 1P0NA 3VGEA 4FXRA 3N2TA 1T6MA 3KRBA 2IW0A 5I7GA 4WVXA 1DIEA 4O28A 4IQJA 1VENA 3AHVA 4AD1A 4MZ8A 3H23A 1LUCA 1XCWA 4QDMA 3W2JA 2FGBA 1W8GA 2W4XA 4Q33A 2OQYA 2YFOA 1A80A 2P50A 2ALRA 4RV3A 1N8WA 1XL9A 2ISWA 1XJBA 4CQ8A 5BWFA 2FFIA 1KM6A 1BG4A 1FTXA 1I6NA 5JMUA 3AYTA 3O8AA 4CN1A 5E5CA 3LGDA 4CKQA 2Z6JA 4UFKA 1J0KA 5I3FA 3GRIA 4MOZA 2IMRA 3K8MA 1W1A1 1Z9AA 4ATWA 2DEPA 4O16A 5HMEA 4MWAD 1GW1A 2FZNA 3W3OA 5EMMA 4JHZA 1EZ2A 2A79A 3OBEA 4HU4A 4W5UA 3AO0A 1WDRA 2WVVB 1QPQA 4AZGA 3AOFA 2ZUTA 4K1GA 3HFTA 3LB0A 2WJDA 3TVAA 1KLYA 2AAAA 4WGHA 1U5HA 1HG3A 4I5UA 1FWIC 5E70A 5BXPA 4XZBA 5FOOA 1TTQA 2UY4A 5AHLA 1DJZA 4NP7A 1S3TC 3KLKA 4UTHA 4AZCB 4M0XA 4XWUA 3OOQA 4HQVA 4XV0A 1DHPA 5LNWA 2DZPA 4Z1BA 3CB3A 3RILA 1D2KA 2Z24A 1P6WA 4PFHA 3WQWA 3B0PA 2I57A 4H6KA 5AHNA 3JW7A 1FRBA 3LERA 4KEUA 3B97A 3ZJ7A 3CH9A 4Z0SA 5EKYA 2PMQA 4RZ6A 1I2OA 2OGYA 3D6NA 3EXTA 2GVLA 1US0A 1LYXA 5AC6A 1XGDA 4HU8A 3I7QA 4IF2A 3Q45A 1O66A 3DYOA 1WDSA 1QOPA 4JN7A 4O13A 5C9RA 3NPVA 1TREA 5CSYA 3OLIA 3RFAA 1Q85A 3H8AA 3QTPA 2ZOXA 3F5LA 2A3HA 4Z42C 3W76A 3PC0A 3GFXA 2QV5A 2QCFA 2YB1A 4H6QA 4UNLA 3RGTA 2Z2AA 3T42A 1X39A 1NM9A 3W1TA 1IEIA 3K5XA 1BTMA 3N9SA 1KC7A 2Z6IA 4ZGYA 3VKJA 3TUUA 3IIXA 3E2RA 3P84A 1V0LA 1P4CA 3SJNA 4XKYB 1RJPA 2CFFA 4BS0A 1TR1A 1B3VA 5CJNA 2C91A 1OADA 4ZO9A 1VYSX 4CU8A 1PEZA 3DFPA 3TTOA 2A3EA 1NARA 2P10A 4NASA 3EWZA 1SR9A 5EMKA 2E1DA 3SY5A 1ZB5A 5CPMA 2CYGA 1OX4A 1EC8A 2NT1A 4ECLA 3GXPA 3MPGA 1KFBA 1UCWA 2GDVA 1UWIA 3APYA 4O1EA 4LYRA 5A2CA 2QJGA 4OQVA 2IQTA 3MBDA 4N9EA 5E09A 3WLOA 2BX7A 5FA5A 1P0DA 4L80A 3TTYA 4UFMA 5LZLA 1M53A 2BVDA 3TC6A 3QN3A 1AJ2A 3R8RA 2FQIA 3CUXA 4HNOA 3ZVHB 3M47A 1SSDA 3LHYA 1K7FA 2CWXA 2FJKA 1V7YA 4P2VA 4KQNA 3I3DA 1E4LA 3ARWA 1L8NA 1VFSA 1J5TA 4TX9A 1XD1A 5CC7A 1KR1A 1VFFA 2YIHA 1XYFA 1FH9A 2OEMA 2RDUA 1L6WA 1EBHA 3U2EA 3WD3A 4D6IA 4JIIX 3GH4A 4EPEC 3H7VA 4L65A 2WMKA 3GDTA 3TOPA 1XKJA 1JRBA 2VEGA 1XDMA 3OIHA 1EIXA 1XLAA 4A3YA 4B5WA 3GG8A 3WMSA 4ZOAA 4AEFA 4O12A 4N9BA 5I2UA 1QNRA 4DWSD 5CAKA 3OGVA 4DX3A 1K4GA 3PY2A 1UKTA 2QCDA 3OVRA 4C6QA 3LHTA 3AXXA 3KOWA 5K2ZA 4KH2A 3IGSA 2GPTA 1XBYA 4NU7A 2PSNA 4ACYA 3BLKA 3CAWA 3LHWA 2DSWA 2PDCA 3R58A 3APGA 1P7TB 3LCGA 3G1AA 4FNPA 3CC1A 3GX9A 4AX7A 4IG2B 4H8VA 1R8LA 3B8UA 4J3SA 1A5BA 2GSJA 4S38A 4O1DA 4PTDA 5HULA 3DXIA 1FDJA 1V03A 3W7OA 2GQ3A 3HG3A 5DMNA 2VEIA 3M16A 5HQEA 1V6YA 2FHCA 2YCEA 3BK0A 3DHPA 1NY1A 2QAFA 3GTXA 5A6JA 1ODZA 5GVJA 3JR2A 2E77A 4CGTA 1RV8A 3LG3A 3WDJA 1OFEA 3GAKA 1KXTA 3TYZA 1UKQA 3TSDA 2BHUA 1QBBA 3BMVA 3M43A 4MWAB 2YYTA 3TXVA 2YOCA 4JFWA 3KHJA 3PUDA 4U2YA 4W8LA 1UZDA 1RPKA 2I9UA 1F3WA 4OE7A 1LWJA 2YLLA 2FMNA 3T0DA 1VB9A 4HZMA 1TE1A 4M6PA 2XFYA 1WKDA 3KDOA 5LIYX 1FP9A 1PSCA 1TUFA 4Q8TA 1V6VA 2IKIA 4D8LA 4O0ZA 3UPWA 4BQ3A 3ZVIA 3TX9A 3IARA 3OBAA 3SJ3A 1EXPA 3UWZA 3HV8A 1XLFA 3PANA 5G1MA 5CGQA 3CK5A 5F1VA 4AIEA 4HHHA 5HINA 5D2TA 3HPFA 1S2CA 4NT0A 5AC5A 1AL7A 3W74A 5IOBA 2O9OA 4IIHA 1UIPA 2FLIA 5F2GA 3UGVA 2XN1A 2JFEX 1MZRA 3FJNA 4Z08A 3VFLA 5C2XA 2ZVRA 5AZ1A 2GGJA 2X1SA 1Q6QA 1MQPA 3W27A 3AUOA 6XIAA 1WOAA 4QSHA 2PD5A 2FH8A 4I5XA 1BHGA 1GYLA 2ZFAA 5TAOA 1WUFA 2WJEA 4AW7A 1L6SA 3UNTA 4ZB5A 3M7WA 1B4EA 4HBKA 3QQWA 2JF6A 3M7SA 4GACA 5BRBA 4TMBA 1A3WA 4E4PA 1OGGA 1S5NA 2BVTA 3IAPA 2AMXA 2XVGA 1AL8A 1BGGA 3UA3A 2FB3A 3CHVA 4HYVA 2G50A 2DSZA 4LCSA 3T6CA 2VFIA 4WKAA 3RCNA 2X0SA 1FWBC 1NF7A 2X0YA 4TIMA 3MJYA 1W17A 4IP5A 4N4PA 3R6IA 1RAKA 1MXSA 4WEVX 2PDQA 3HN3A 6A3HA 1CXLA 5BOEA 1XIMA 1K8XA 2ZC1A 3ZOAA 4ZBCA 2XM2A 4REQA 1V0NA 2Y89A 1ONEA 1OSEA 2ZE0A 2Y85A 3PJTA 2V2HA 1RCXB 1AMYA 4GCXA 3OP2A 4WJEA 3SCOA 3VIKA 3KDNA 3UP8A 4E2VA 4N02A 4PCPA 3W0KA 4D9PA 8A3HA 2VD8A 3EX3A 4XO6A 1JG9A 3LBCA 1MNZA 3EDJA 1NEYA 1EQPA 5CPOA 4TXEA 1TO3A 2C6QA 4ROPA 3TYUA 1HVXA 3PJWA 5CCZA 4WOQA 1EOMA 3BMWA 4UUIA 1KGXA 3QZAA 2B4GA 4JYFA 2VVNA 2NLYA 3O05A 1W3LA 1I75A 1H5VA 3LCIA 3U4AA 4B2DA 4WLCA 2BOEX 2G3MA 1E6SM 1QVBA 3DYPA 2QCNA 3QJAA 3UNDA 2QS8A 1L6GA 3MDUA 1KRMA 4PTVA 4I7VA 1QAPA 3T78A 1FCQA 5HWNA 5LGZA 3LRKA 2IXUA 4J9JA 3C2YA 3FSUA 2A1YA 3AS1A 4D6GA 1GT8A 3UPBA 1KQZA 3W7NA 2J62A 3R79A 1WZLA 1CGYA 1TMHA 1PX8A 2VQUA 3NQDA 1H50A 4Z2LA 4PYSA 2A6NA 1YTDA 3BXWA 1YHTA 3WLIA 1YPFA 1EJSC 2J7EA 4OV4A 2WCSA 4FXSA 1P0BA 4IGSA 2AL1A 5FF4A 4U3AA 2V3EA 1DJQA 1E6QM 1R5YA 4UZUA 1W5QA 1WP6A 3KP0A 4GJIA 4EXAA 4LY8A 3P6LA 1QI5A 2F8QA 5J5DA 1REQA 1R87A 4UOQA 1OFBA 1F4AA 3G6LA 1JZ3A 2AMGA 4H01A 3FHQA 3UF9A 3RO8A 1S3HA 3N2MA 3VKDA 4S3JA 1X8CA 2XVPA 4XZ9A 3R94A 5KSWA 2C13A 3RAOA 4GVIA 4M51A 5LIKX 1GVIA 4FXJA 2C19A 3FVDA 1KQYA 4XIMA 4LXFA 4ZR8A 3W7RA 3N2XA 4MB4A 4D1IA 3GYEA 3FA3A 1HX0A 5CPLA 3BAWA 4NAEA 4U28A 4E3TA 3BW4A 1M7JA 1B3XA 3PZOA 4Q4QA 2ZUMA 4FNRA 4J1OA 2ZZ3A 1MW3A 1YTKA 2PF0A 1PKMA 3U8GA 4C5ZA 1XFCA 1S2UA 3E2VA 3LGGA 3N9RA 4DJFD 2WZEA 5IXEA 5A6MA 1GK8A 4UTWA 3LLDA 4RLIA 4B4FA 5LSMA 1YEYA 1QRQA 1H0IA 3EB2A 4DJDC 2QNEA 1GCYA 1KBIA 1DYSA 4S2CA 5BXSA 1UW9A 3QMSA 3I4EA 1UD6A 2GGHA 3RX3A 1H60A 2E4TA 2VCCA 3VU2A 3EOEA 4QNEA 2W62A 2EG7A 2X8RA 3R5EA 3STGA 1M01A 4XVEA 5H1WA 3FGCB 1Q4WA 1OCNA 1GHRA 1VHCA 3C0JA 1ZENA 4AMAA 4M8UA 3CO8A 2WLYA 3VOHA 3D3FA 1GZGA 2ZA1A 3W84A 3T8LA 2PDWA 2PWHA 1C8QA 1NH6A 1IQ8A 3SCRA 1N8FA 3VCNA 4DZHA 5I0DA 1A3HA 1J12A 3SIZA 2BGSA 3GTFA 4H9VA 2V0TA 4J28A 3UZWA 4Q4SA 1M68A 2Z1SA 4B9YA 4BF7A 1YLVA 3QV6A 4BFAA 3NQ8A 1UMYA 1TZ9A 4H00A 4NXSA 1DTUA 3NQEA 4Q8UA 3N17A 3CQHA 3UWWA 4TMCA 3STPA 1XRSA 1EWEA 3U57A 3HM7A 4ZEPA 5JXQA 3V5OA 1G67A 4KWVA 1R47A 3RRXA 3TXZA 2DPEA 2E68A 5CBJA 3MVTA 4S3GA 1G9HA 2PDPA 3EEGA 4XKMA 2QCCA 3V18A 1FCBA 1FDYA 2FVMA 1KGUA 1SM9A 2CC0A 3HJEA 3RX2A 4IIBA 2NZLA 5FF0A 1Q4NX 2ZUWA 3S83A 3WUFA 2WMIA 5LNUA 2QPUA 1T41A 4F9DA 3QV7A 5EFFA 2HISA 2XZ7A 3GHRA 4G8TA 3K30A 1BXNA 3T0BA 3SN4A 2GVYA 1M7XA 5G1TA 2QDHA 2E6DA 3TN6A 1Q66A 5D03A 5A6SA 1ZBVA 3N1AA 4MJ2A 1JZ2A 2ACSA 3GXMA 1D8WA 2RAGA 2FFCA 3GW3A 1R7AA 5ABHA 3GNDA 3HGSA 2OO0A 1JPMA 2P76A 1LOSA 4KEZA 1WDQA 1JD7A 4PCSA 3VK5A 3AMDA 4GINA 2YZRA 1ELSA 2J13A 1MO0A 2RGMA 4KWSA 4Q4KA 3F2BA 4J3XA 1S2TA 3VFCA 2XSAA 1QK0A 1LQ0A 1PTDA 5BCAA 1W9UA 3UJ2A 5LA2A 3WF3A 3CQ0A 3KAOA 4Q6JA 4YLWA 4L61A 1KTBA 2VRQA 4C6EA 2DT3A 7REQB 3GBDA 4PBEA 1SR0A 1GOWA 4DRSA 2BXYA 1VPXA 3RM9A 2W5FA 3ATZA 2HJPA 1EH9A 2B81A 4J35A 1BTCA 4M3PA 5I02A 3CTTA 1MFVA 4ZTYA 1A3XA 3FAWA 4BZYA 3I6RA 5JBFA 1SFLA 3LGEA 1G4TA 2PDMA 4HYRA 1S2VA 2VTFA 3GBEA 2WM0A 2BASA 3DU0A 5LIWX 1V6WA 3ZR6A 2VX4A 1UOKA 1EL3A 3W53A 1FDZA 3NDZA 4HSOA 1OGBA 1E6PA 3MSGA 6XIMA 2VDIA 4B91A 3M0LA 4GYJA 1Z89A 4L1WA 1IEXA 2ZXQA 3BSHA 3CWNA 5CBIA 5D38A 4K3ZA 1ENUA 2J88A 3DN5A 4UTIA 1EZWA 1F7BA 5AVNA 4KS0A 4KGJA 2DJXA 4QS6A 3PPFA 1EBGA 3QVQA 4W84A 3BAJA 3VGFA 2QVHA 3UR2A 4Q4MA 4XAZA 2CU0A 4GIRA 3AICA 2ZWZA 4C65A 1CXFA 5BWAA 3O2LA 5A5WA 3SCPA 3LHUA 2XWEA 4LU0A 5I6SA 3NTYA 1H0GA 5AB3A 4OZOA 4GABA 1UR3M 1E72M 4HU0A 1UWRA 1GPWA 2D20A 5FIPA 2G3JA 4UCGA 4EE9A 4YIWA 3L2LA 4OBTA 2ASHA 4U4MA 5G4WA 3PZUA 2VEFA 1BYAA 2PDLA 1A53A 3VC6A 3UXKA 4AX6A 4NRSA 3PZVA 4NQ1A 2PEVA 2WNWA 1V6TA 2NT0A 3Q94A 3WY1A 1M5WA 2HS6A 2BMBA 1AQ0A 1XV8A 3FOKA 4RDWA 3NIYA 1MQRA 1TPC1 2B7QA 4AISA 4UQDA 4A8IA 1DHKA 3UBPC 2X41A 4MF4A 4R88A 1E1FA 4FPSA 3GLCA 1TG7A 3O15A 3VKKA 2VEKA 5AYBA 4EIVA 1QATA 3OHMB 4CQAA 5A6TC 3MW7A 4P61A 2HSAA 3FEQA 3ARZA 4O18A 3CWHA 5AY7A 3VMNA 3PN8A 2J6XA 1UZ1A 3KBWA 4NXKA 4CNPA 1R9XA 1JZ5A 2NXIA 2HROA 1XS2A 2WNNA 5KINA 3PTMA 3VE7A 3ARRA 3BG3A 4GXPA 3VIHA 3PS7A 3L0KA 3E96A 5A8OA 1TQJA 4J4KA 3W7QA 3TYBA 2B7NA 3GHTA 4RW3A 3VD4A 5M2FX 4V28A 2NQJA 4ADUA 3BWWA 3B8IA 3ENLA 4UWMA 1C93A 2X30A 4K8GA 2VT0A 1TR9A 4O1CA 1E1CB 4Q8NA 3VGBA 2C15A 4E4UA 2UV8G 2BOFX 5GQBA 2GJXB 3OLEA 2QJNA 1WQ5A 4GZEA 1OJXA 3O6CA 2Y5JA 2IUZA 3IV3A 4CNSA 1NWTA 1ZZMA 2Q71A 3DERA 3VGGA 3G0UA 4QE1A 2DIJA 4IIDA 3PSWA 4JOMA 4RE0A 2Z26A 4OBSA 1SVDA 4Y90A 1B1YA 2QR6A 1PHQA 3IRDA 3W6YA 1FY6A 2E8ZA 2BBFA 3HOJA 4IIEA 4IGNA 4YTQA 4HN8A 4DO6A 6ALDA 4UMBA 3G2GA 2V5BA 3LCFA 4GVHA 1E0TA 1UQZA 2J9XA 4I8DA 4OOZA 3V75A 3OYXA 2GJRA 2NVAA 4ENLA 3AIWA 2HBXA 4UOJA 1K70A 2QUUA 4HNUA 2WJZA 1EP3A 1DWJM 4HMDA 5EYWA 4HMEA 2ZUUA 4PRWA 1K8CA 1A5LC 4B5UA 1KM4A 4S39A 4NKCA 4PBGA 3UCCA 4DBUA 4FX8A 1JFHA 3BZJA 1DVJA 1CYGA 4PB4A 1TB3A 2PDHA 2PPGA 3CQKA 1UJPA 3KP1A 3UEQA 4NF7A 4LVDA 4AF0A 3WELA 3ARSA 3G1DA 1VFUA 3KBJA 3M5YA 1A50A 3M4HA 4JTDA 1TVLA 4CEXC 2EF9A 2VO5A 4KPLA 2WZHA 3GD6A 4BQ4A 5C0QA 3GTNA 1EOKA 1R3SA 1KA9F 5CZTA 4HHLA 4ZE4A 1NFBA 1KW1A 4AVOA 4S3FA 2ALDA 1TX0A 3NNTA 3NURA 2YGYA 3I65A 1UR4A 1E6ZA 5CQ1A 2VC6A 3WQ4A 1EEPA 4IQEA 3OZYA 3KRZA 3TE9A 1JNEA 3PAJA 1EQCA 5BXRA 1BF6A 1GUVA 3RMJA 2X40A 3QYSA 2QGHA 1Y5XA 3ITCA 4IFKB 1VGAA 1TJ2A 2MUCA 3HZ3A 3MHUA 4TUFA 4YS1A 4BCEA 3G8RA 3DI0A 3GXFA 4GO9A 3UXLA 3W83A 3W1RA 1XINA 3CPGA 3IVTA 1BYBA 1Q8JA 1Z32X 5E1QA 4QG8A 1DWFM 3UZXA 5AVHA 1W37A 2BP1A 3C2EA 2IQ0A 3PZIA 3CJPA 2ZXAA 1J0ZA 2OWXA 4Y8EA 4NJHA 2C79A 1U1UA 2QDGA 4LPCA 2CWNA 3AMGA 4QP0A 2FVLA 4Z1DA 3WKZA 2DVXA 3SI9A 1PE1A 3NEVA 2Y7EA 3ELFA 1F6KA 3SFWA 4H9XA 1H5YA 1M03A 2O7SA 1K3UA 1BRLA 2HQAA 3AXIA 1IT0A 1BF2A 2WMJA 3WDHA 2YW3A 4M1BA 2P3ZA 2VWTA 2A21A 1DQWA 3WJZA 4UR8A 4MB1A 1LORA 2FZ9A 2BNJA 3RLGA 1U5VA 1RP9A 5DEZA 3RXZA 3EZ4A 3BSGA 2W79A 1KO0A 4A05A 1SZGA 3M0IA 1YPXA 4QQ3A 4QCFA 5ECVA 3THQA 4PMXA 2WNZA 1XGEA 2BXVA 1ZY9A 1TELA 3NQFA 4WD0A 1OC5A 2TPSA 1CXEA 1E9YB 3EEZA 3OG3A 1IR2A 4QAWA 3WJXA 2CXGA 1OD8A 1LTDA 3ABQA 4FO4A 4DIAA 5HMSA 3AYRA 3V3WA 3NUKA 3WLHA 4EP8C 3NVDA 1OFAA 2OOFA 1KR0A 3EWWA 3GHSA 1KFEA 3ZJ8A 4QGCA 3QQ1A 2G3IA 2JKPA 2ZRUA 1G0CA 3NG3A 1MDLA 3NL6A 1A5AA 3Q37A 4DI8A 1QW9A 3R43A 4XISA 4FX7A 4GX9A 3PNUA 1J10A 5AYZA 3EDEA 4YTUA 2CETA 4FP1A 3S6TA 2CERA 1TPEA 5I03A 3R2GA 1UIOA 3DOPA 4Q32A 1SJBA 1RCQA 1Z8AA 2OWCA 2B0MA 4WXYA 2CW6A 4N7QA 3OVPA 5EPDA 1ZAIA 3U5UA 1L9WA 2YXOA 1D8CA 2J47A 5U7SA 1PZ3A 4U5IA 1TTIA 3ZSSA 1JULA 5G2HA 4A35A 2WNQA 1V3MA 2D3NA 4LJ3A 3TCEA 5K9DA 3DBPA 3GNXA 4B2DD 3UPMA 1EDQA 3WNNA 2CHRA 3PBWA 4RR4A 4OOUA 3TSBA 3LD5A 4ZL1A 3WQCA 1I2PA 3QGAC 1XCFA 3N2OA 3EMCA 2GK1A 3S2NA 1DXEA 2RDWA 3VDAA 4H4IA 2PA6A 3V1PA 4GFSA 1UKOA 1KBBA 3CM4A 3TNBA 3OZOA 2GLKA 1BSLA 2GWNA 2PDBA 4L4LA 3WF4A 4IOTA 1TPWA 4NZ3A 3VNZA 1EO7A 4IH3A 4IPNB 1TRIA 1EX5A 3IS4A 4E8CA 1V3LA 3CIWA 3W2UA 3SBF