2JA1A

Thymidine kinase from b. cereus with ttp bound as phosphate donor.
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
193
structure length
193
Chain Sequence
b'GSMYLINQNGWIEVICGSMFSGKSEELIRRVRRTQFAKQHAIVFKPCIDNRYSEEDVVSHNGLKVKAVPVSASKDIFEHITEELDVIAIDEVQFFDGDIVEVVQVLANRGYRVIVAGLDQDFRGLPFGQVPQLMAIAEHVTKLQAVCSVCGSPASRTQRLIDGEPAAFDDPIILVGASESYEPRCRHCHAVPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THYMIDINE KINASE
publication title Structural Studies of Thymidine Kinases from Bacillus Anthracis and Bacillus Cereus Provide Insights Into Quaternary Structure and Conformational Changes Upon Substrate Binding
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Transferase
total genus 49
structure length 193
sequence length 193
ec nomenclature ec 2.7.1.21: Thymidine kinase.
pdb deposition date 2006-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00265 TK Thymidine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2ja1A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2ja1A01
3GFPA 1II8B 2FA9A 3LV8A 5KUTA 1NBMA 3PG5A 4Q5IA 5FH9A 1XJQA 2IBMA 2IUTA 4DDWA 3IGFA 1KY3A 3B7GA 4QNMA 1Z28A 3EG5A 4HB2A 8OHMA 1U9IA 4KAXA 1IJFA 2ERXA 1L4UA 5TDHA 2VPPA 4QGFA 3AVYA 3LQRA 2HCBA 1N6PA 1XD9A 1OXVA 3GFTA 3GJ3A 4DB2A 2OFOA 1UM8A 1AS0A 2F6RA 2FFBA 2WPDD 2CNWA 1CXZA 2PMDA 2ODNA 4A2QA 1Z29A 3KL4A 1KO1A 1R5NA 5HKKD 1DE0A 3BWDD 2ZSAA 3ZD7A 2XZLA 1MO6A 2GEVA 3VR2A 2PLFA 4KODA 1DELA 1J70A 1MO5A 1NF3A 2GJ8A 2JJ2A 4W5HA 3U3JA 5JCPA 3VMFA 2CVHA 5FPSA 4DCNA 5JI2E 2XNDA 2YWHA 4YMTA 1OB2A 3CPJB 3KY9A 2MMCA 3E2IA 1N6OA 2X77A 3GEEA 2QI9C 2XTZA 3ZVMA 2WMOB 5LD2C 2QAGB 1QHHB 3DO6A 2OXCA 5G40A 3VR4A 1I2MA 1QF9A 1P9RA 3MJRA 1IHUA 2BMFA 3B6EA 2EWWA 1H8HA 2PJRA 2QEQA 2J9RA 2BBOA 2I4IA 4FMCF 1YR9A 3EWSA 3MD0A 4QBGB 1JI0A 2BBWA 3I5YA 4OI2A 3KXLA 3KDSE 3LD9A 4F93B 1T91A 2N42A 2H1LA 1P3JA 3ZS9A 3B1VA 4IDOA 2XB4A 4BASA 2AK3A 4JVMA 4C4PA 4D4KA 2ZYWX 1TF7A 2QL6A 5EXXA 4C0AC 1KMHB 3K0FB 5F9FA 1N6IA 2GEDA 4TYQA 2GDJA 2YC2C 4JLVA 2HXYA 4V0NA 4ZKEA 4YMSA 3UPUA 2JIZD 4RFVA 3SNHA 2ZAOA 3K53A 2VH5R 1KDTA 2VL7A 1P2TA 2P5TB 4MYCA 4Q1DA 3K0AA 4NH0A 5JSZB 1U98A 4A92A 4EPYA 1V5WA 4OQMA 4TLEA 2F55A 3U7EB 3RLFA 3LDAA 2ZRCA 3VAAA 4A6XA 2BEJA 4B35A 1TBOA 1OLOA 1NG1A 4M1WA 5FTNA 1COWD 1QHSA 2W2XA 4G5GA 2WJJA 3TLXA 1TU3A 5FUWA 2AK2A 2GJSA 2QE7D 3DMDA 1J90A 3L82B 4XSHA 3MFYA 1Z0KA 4Q4JB 1TQDA 4EFMA 4OHZA 1DAHA 3QF4A 2ANBA 3RANA 1KI7A 1MO3A 1KMQA 2ZROA 2WZQA 4OL0A 5SZIA 2ZRAA 2YUUA 5JRZA 2XOKA 1P5ZB 4TSFD 1MOZA 3AKCA 3ZGXA 4DLXA 2Z4SA 1P72A 2QRZA 1RE0A 3DKPA 2CLCX 1XX6A 1YVDA 2AFHE 4XH9B 1A5TA 4OJKA 2OAQ1 1AGPA 3IO5A 3BOSA 3FFAA 1KAGA 3SC3A 3X1YA 4CT5A 3T12A 1TUEA 3BJIA 3RRZA 3NH6A 3B60A 4GOJA 1N6LA 2O52A 4RZXA 3K70B 4LBWA 4DXAA 4D4MA 5BN4A 2ZUCA 3EZFA 2RB4A 2PMKA 4LBYA 3SQWA 3OFNA 1GITA 1VDZA 2DYKA 3IQXA 4KBGA 4IOLA 721PA 4BLQA 3ZVRA 4Q1CA 3C15C 1Z0AA 4B75A 3U3MA 4BFUA 4N0DA 2J41A 2YINC 3CXLA 3CPEA 1QBKC 3CIOA 1Q12A 4ZIRB 4AK9A 4II7A 2IYTA 2BV3A 2EWVA 3CO5A 4FIDA 3WHLA 2YKGA 1F2TA 2EVWX 2ZRMA 3N5CA 4R2IA 5G3ZA 5AJVB 4NCJA 2BM1A 2IYUA 3T06B 4IDQA 1OH6A 3RC3A 2QUZA 2IT1A 4Q66C 2W2TA 1U81A 1E2LA 4GRAA 3VNUA 4EJSA 3C14C 4DCVA 2RGXA 2GNOA 5C4GB 2FV8A 4AKHA 4M21A 2FJUA 1LF0A 3B5JA 5KO2A 2NO7A 1KI1A 1WA5A 1L8QA 1TQ4A 2XJ4A 4QHSA 4FN5A 4TZ0A 2BKUA 2I1VB 4C0JA 4A8JB 1GZSA 2QGNA 2WWGA 4L4UA 4YXWD 1U94A 5F98A 1CIPA 1N6NA 1OE0A 4M1MA 5IK2A 4NDZA 1R8QA 5G53C 5E7JA 4A2WA 4Q21A 2GCOA 4TL7A 3OF5A 4L9SA 4MGZR 1FUUA 3W90A 4L9MA 2Q3FA 3AB3A 3A4MA 4KSCA 3FOZA 2O8FA 3KXIA 1K5GA 5DISB 5CB6A 4PAMA 4Q1EA 3NEYA 2ZI4A 5B57C 1CRQA 2PZGA 5EP2A 3TNFA 1B23P 3REGA 4CT4B 4PO8A 2XNSA 3THWB 2HEIA 4LYHA 5JECA 1YZKA 2HLDA 2QA5A 4D0GA 4CEHA 5AUNB 3PCRB 3VQTA 1LS1A 3CRW1 4NCHA 2B7BA 4JLDA 3ND9A 2ZRKA 5TY0A 1E2KA 3EASA 5J47A 1KJWA 2PZFA 4GZLA 1M7GA 1ZU5A 2J1LA 1R0YA 1NG9A 5AK0A 2YYZA 2R44A 1XA6A 4G01B 2CCGA 1UJ2A 4TT3D 1UBGA 1HT1E 4BFSA 5C1BA 4HB4A 3A1WA 4QBHA 1G8FA 2ZREA 1G9XA 4PFSA 1J99A 3QQ5A 3NBYC 3IIKA 2F3TA 3DKVA 3THXA 1L4YA 5FUVA 1E2DA 4NZYA 5EE1A 4TTQA 3QBTA 1IXSB 1LF5A 1K8RA 3BE4A 3Q3JB 4B48A 4C3ZA 2EU8A 4ASUD 1Q20A 4DB4A 1J8YF 1YKSA 3BBPA 2YWGA 3TQFA 3UFFA 2WJHA 3MWYW 4NL4H 1YZLA 4D25A 1RRFA 4ZKDA 1T5LA 4YMUA 3C7KA 4MRPA 1M74A 4MDFA 4PQFA 1OKKA 1RC8A 1PZNA 4Z1MD 3GJ8A 3I72A 3IPXA 3W3AA 1ZU4A 2R2AA 1VG1A 1OPXA 4UXHA 4G5OA 3BB1A 4Q9IA 4X8MA 3RWOA 3T5DA 2WWXA 4JLPA 2ZI9A 3KUCA 4K8OA 3C16C 2J3EA 1Z0JA 2XXAB 2R6DA 3EIHA 5G41A 3TUZC 3GLHA 1LB1B 3WMEA 1VG8A 4FI3C 3UGIA 3KKNA 4A1FA 2W6JD 4GSYA 4M1YA 2O8EA 3IKJA 3CLVA 2J0UB 3Q5DA 2EFDB 4AIIA 1ZNZA 3CRRA 3CWQA 4NCIA 1UBFA 2OCYC 2GEUA 3UWOA 4PSKA 1QVRA 1ZUNB 2IX3A 1NNEA 4CEJB 5KHOC 3THYB 1NLYA 1PUJA 2JDID 1VCNA 1XCPA 4AKIA 4JSTA 1T3HA 4KYIB 1RPZA 2V1UA 3P4YA 1HE1C 1P73A 4D26A 1WF3A 2NOAA 3SU8A 3L0SA 2QMOA 4B3CA 4X8LA 4B32A 1IAQA 3FMIA 3T1TA 1IOZA 3BH0A 2P2LA 1GKUB 3QEJA 2G9NA 3IO3A 4LYJA 1GRNA 4F92B 5E7IA 3PEUA 1OT3A 2VRWA 4HLUA 2QRNA 2OBLA 1XPOA 1TEVA 4URUR 4OYHA 2NMVA 4WW0A 2QENA 1EWQA 1FPMA 2H5EA 2ZITA 5HKKA 5KDDA 1Z6XA 1SKYE 1TADA 2WOOA 2D4HA 2ZE5A 4NMMA 3GLFA 2VF7A 1M7BA 5C18A 2ZRIA 4M22A 2V3CC 3VU9A 2BOVA 1WXQA 2FZLA 2GA8A 2ZRHA 2L0XA 2B8TA 3UEJA 3QKRA 3MWJA 3Q8XB 3W8NA 1Q44A 3AVOA 4R9UC 2YJTD 4MA4A 2IW3A 3FMOB 3RYTC 1KAOA 2PLRA 4YLGA 4B3BA 3SBEA 5B58C 1BMFA 1MV5A 3IEUA 5BYKA 2O8CA 4CEIA 3TK1A 3A1VA 5F2EA 4LI0A 3X1XA 2QQ0A 3CH4B 4F91B 5KU1A 1E2GA 3K70D 4FXPA 1KO7A 1S3SA 4RD3A 3K1JA 2CJWA 5EZ6B 2FDCA 4QHTA 4UXJA 4A0RA 1GILA 4JSYA 4AI6A 4C7OA 3PEVA 4MUBA 3KJEA 3CUEF 5FPKA 2GRJA 2UKDA 4I1UA 2VEDA 1F2UB 3HU3A 4BQSA 1W0JA 1UKYA 2Q21A 1XEXA 3O8DA 4IKEA 1G7SA 3GLGA 2ZJZA 3GMTA 3FKSA 4M53A 3AH8A 3N70A 3CPHA 2WM9B 2RAPA 2ZI6A 3K9NA 4FCTA 5KTYA 1KY2A 4EPVA 5JWRA 3QF7A 3W5JA 2J87A 2OT3B 4EPWA 4RVCA 3VHXA 2Y8EA 2QY9A 3ADBA 3QKUA 2KSQA 2ZPTX 4MYHA 4NBSA 4DDVA 2FX3A 4PC3A 4WOPA 4MYUA 2CDNA 1JR3E 2IL1A 4S35A 3QXJA 3UIEA 2NO9A 4MKIA 4A36A 4C0LA 4QJ5A 2BBTA 1A2BA 1ZCAA 3I32A 3PV0A 3KQLA 2ZJ2A 3P20A 1ZBDA 1PLLA 1U99A 4A9AA 4TL8A 1COWA 4RKEA 1KOFA 1X8LA 2F43B 2JLSA 4FW9A 5GJCA 4BECA 2QE7A 1GNPA 2QROA 1AZTA 1FX0A 1EFTA 1ONBA 4QG7A 3K0EA 1N5KA 4MDEA 3M0EA 3AF2A 4RZ2A 4Z51A 2C2HA 3CX8A 3LWNA 3B9QA 4NP6A 2GETA 3I73A 1IN7A 5DI9A 4LCBA 2R6AA 5TXGA 3U44B 2QAJA 2V4ZA 1SXJC 4HAZA 4OK5A 3LBHA 4XIGS 3SYLA 1CEEA 4ZI2A 4Q47A 1G7TA 3NIBA 3KKMA 4NYIR 3QPWA 2Z5FA 2CL0X 4JLAA 4DLZA 4AD8A 5HE9A 3SJAA 4MUAA 2DFLA 2ORVA 1A82A 4KI0A 4PPFA 2O8DA 4WAUA 2QSZA 3LXRA 4B2PA 1KJYA 4POAA 2JEOA 1KHTA 1Z0IA 1M8PA 1TX4B 4MGYR 3RS2A 1YRBA 1UKEA 2PX3A 4C0KA 1MR3F 3H2YA 4L9WA 1MABA 1S2MA 2FFQA 3HP1A 1XPUA 1E9DA 4AYXA 5CIQA 1OF1A 3V00A 4U7DA 4U02A 1OIXA 1TPZA 2ZJBA 3MRSA 1N6KA 2HF9A 4DDUA 1XTQA 3BGWA 3B9PA 2D7DA 2OM2A 2PCLA 3QSYA 3IBYA 3WNDA 4H1UA 4S2EA 1R2QA 2QM7A 1US8B 4M1KA 3SE0A 3EZ6A 1KSHA 3QVUA 1XU4A 1S1MA 2ENNA 1OIVA 2ZAMA 3DL0A 2KE5A 4AURA 1L2TA 2OFWA 3CR8A 4KFTA 5FPTA 4HYYA 1JEDA 4DCSA 5EXPA 3SI7A 2PZEA 2C98A 4G5SA 4GPTA 3EIEA 3R7WA 3S1AA 2OUKA 4E07A 3OZXA 2IS2A 2JA1A 4B6FA 1DG3A 4E22A 3BB3A 421PA 2PBRA 1A1VA 2VHJA 2XTMA 4EPRA 4LV6A 2ZVPX 2QT1A 4HAUA 1MRNA 2GBLC 1W7AA 2QAGC 1E2QA 5FOUA 1E1RA 2ZTSA 4DT1A 2VO1A 2CK3D 2RGNC 1OFHA 4TYNA 4UJ5A 4EFLA 5F3WB 5EP4A 1G4UR 1Z07A 5H68A 1G64A 3PQCA 2OCPA 1NN3A 1DADA 4M9SA 2ZJAA 1XBTA 4RY2A 4WA7A 4YXWA 3QIAA 3NDPA 1E1QD 2VYFA 2YC4C 4KJZA 4NHOA 3AVTA 1XTSA 1G8GA 1KJZA 4FWIB 3O8RA 1CULC 4ZCMA 2VHUA 2CVFA 2ZYUX 3VTKA 1JPJA 3AF3A 4RFSB 3RRNA 1ZIPA 4F7WA 1Z0FA 4AG6A 1R0WA 3EWAA 3WP1B 5CDFE 2RGEA 3A8TA 4TYPA 4Q1FA 3HU2A 4HB0A 1E9EA 4TLBA 1G1MA 5JJLA 1G3IA 4OK3A 1HY3A 1NI3A 2OLJA 3CBQA 3HDTA 1YZNA 5TVKA 2A3RA 1W4BA 2WJGA 2R8RA 5CB8A 4E09A 1AZSC 2C9OA 4HLQB 4C0QC 1II8A 4B6EA 1VHLA 4BEJA 5D3QA 1TTTA 3OEEA 4QXAA 4KVAA 1QZXA 4DC9A 4BZXA 1ELOA 2NQ2C 3GJ7A 3H4MA 1EFRA 3NG1A 1GAJA 4B71A 1GG2A 1XP8A 2PT7A 2H8KA 5DYIA 2J7PA 4Q4HB 2NO0A 4TT3A 1EESA 1G8PA 4TMWA 3SZRA 3T15A 3GJ5A 1LVGA 1U2RA 2JLQA 2GK7A 1KGDA 3ZZ0A 1AQUA 2R6CA 1E3MA 1NSTA 1JJVA 4FKDA 5DO9A 4FWTA 3VHLB 4I1VA 1GNQA 1GRQA 4MRNA 4GI7A 4X8OA 5FPHA 2WHXA 4F4IA 5J4LA 3FKQA 5DN6D 3CZPA 3U7GA 1SXJB 3F5FA 1Z6TA 1J8MF 3LLMA 3NTUA 2NPFA 5KSOA 1S96A 3RS0A 1GM5A 1EK0A 3RS5A 2OHFA 4WXPA 5EE9A 2YV5A 1ZAKA 3HYRA 4Q7MB 3BC1A 1KK2A 4LJ5A 4JYBA 3DMNA 1IXZA 4JT2A 4OHXA 5FPYA 4TMVA 4PQYA 1OH8A 2JAQA 3AVXA 2K5UA 3B85A 3BXZA 2LWIA 3UEYA 1E0JA 5L8VA 2WV9A 1Q21A 2EFGA 1J2JA 1N0VC 1CLUA 2OAP1 1SVIA 3UXMA 1KNXA 1U8ZA 1Z08A 3RSLA 5E95A 1CR0A 4M0LA 1S8FA 1YE8A 4BLRA 5CIWA 2ZANA 1E2FA 3GQBA 1JNYA 3ETLA 2ONJA 5L3QB 5L3SA 2JLZA 1TU4A 1EFCA 3VNVA 3K70C 4Q18A 2DB3A 1RFLA 4IVQA 4UKDA 4D0LB 3ADKA 1Q3TA 2W6JA 2ZYTX 5FL7D 4AYTA 3NBXX 2BKEA 2QNRA 1FQJA 4IW3B 5CJ2A 2H16A 2WBLC 3LH5A 1XTJA 2IEZA 3DOFA 2Q9BA 4MRSA 1OH5A 4V0KA 3RS3A 1IM2A 2CCJA 5FOXA 3SHWA 2AKYA 3I3SR 2P67A 4EQ6B 1N25A 4NYMR 4QFMA 1SVWA 4EKDA 2GVZC 1WRBA 4Z8YA 4BFWA 2BEKA 2KI5A 3MSXA 2G77B 4KITB 2V7QD 5G3YA 3I62A 1G8YA 1U0HC 2BMEA 1NVXQ 2AWOA 5JSZA 1G5TA 2UZ3A 2D2FA 2YNMA 1TEXA 3ZS8A 4IOJA 3GEIA 2VP5A 3DPUA 2IXEA 3NDBB 4FMCB 1O87A 2GCPA 1E79A 2P6UA 3FDIA 1AA9A 4N0EA 1SVMA 2F3RA 1G6OA 1YZGA 3M4YA 4HEJA 2X2FA 3HYTA 1E4YA 1JECA 2QBYA 4A8JC 5DI3A 5JI3E 1DAIA 4HUQB 2C03A 1ZC4A 1JBKA 2BC9A 2JJ8A 3L8YA 4Q1AA 1OYYA 4DSUA 1H8ED 1NIPA 3EZ7A 3B1ZA 2C99A 3WYFA 2HCJB 4EFNA 2DWOA 3TRFA 4B34A 3AM1A 1G3QA 1DS6A 4HDOB 2JLYA 4QHYA 2ODWA 4XOIA 1TNDA 3GCGA 3OEHA 1SGWA 1YRAA 4KFRA 5HPYB 2WSSA 4DSTA 1DARA 1UDXA 2EYUA 4Y0VA 1DTSA 4QJ4A 5FBLB 3AGPA 4BFYA 1W47A 3A1UA 4LOAA 4Q4LA 3ZH9B 4XVQA 4XD7D 4B2LA 3D7MA 1G7CA 4B43A 4ACAA 1G16A 4IDPA 3TMKA 5EP3A 1ZC3A 1SVLA 1N0WA 1KDOA 2X2EA 3VR6A 2ZETA 5HZKA 1E2EA 3L43A 1HQCA 5AUQA 5J4HA 3KZ1E 4JVNA 2J59A 121PA 2RCNA 2Z4RA 4JJKA 4MKGA 5AUPB 5BW8A 1FARA 3AEZA 3GLIA 4D4JA 1AS2A 1TAGA 5CYOA 4HZIA 5FOSA 1G17A 3SN6A 4MKHA 3ZVLA 3AUXA 3Q7QA 4BLOA 1SZPA 2VSXA 3PJRA 1XEFA 2FN4A 1Z47A 1GP2A 1Q0UA 4P33A 4R71A 2QP3A 5M04A 3IHLA 3OAAD 4ZIRA 3FFBA 4R7ZA 1QRAA 2YVUA 3PEWA 2XSZA 1XXHA 3QUSA 3RWMB 4IEEA 3WY9A 2QG6A 2ZEJA 621PA 1VYTA 2RH5A 4P32A 4KFUA 4EJSC 2Q9CA 1HURA 2W6IA 2VP4A 3U60B 5TMPA 3AVWA 1KIMA 4LGMA 4ACBA 3PITA 1E2MA 2IXFA 4LBZA 3WMGA 4G1UC 1R8SA 2BM0A 1Z22A 3LXXA 5FBRB 1OHHD 4PR0A 1TMKA 1ZINA 3ONWA 3AUYA 1T8UA 1QHIA 2RHMA 4PXAA 4JL5A 5GADl 2O8BA 1RKBA 4RZUA 3AVQA 4QNRA 4DHEA 4US0R 2NTYC 1JR3A 3EZ2A 5DLQC 3VR3A 3O8BA 2REOA 2OEPA 1W4CA 5LB4A 4YC7A 1TBNA 1DPFA 3DM9B 2FGKA 4LC1A 1E0AA 4ESVA 1Q57A 3BB4A 1KI6A 2G3YA 2A9KA 4IVRA 5GVRA 4V0MA 4MGIR 2ZS7A 5FUYA 1WE2A 1IONA 5HE8A 2GK6A 4HUTA 2OG2A 3ZJYA 4BPBA 4CGZA 2RGCA 4FMBB 4PPNA 1DAFA 4PZZA 2ROWA 1HTWA 3NC1C 3AKDA 1GDDA 1D9ZA 3K0AB 1YHNA 2CLDX 4PPQA 2FEOA 2G1KA 5FTKA 1UPTA 3LA6A 1KI4A 3THWA 1N0UA 3V9PA 2LKCA 2D74A 3TR0A 1W49A 2GXAA 5C2JB 3U6KA 3O8CA 1G7RA 2D06A 1QHNA 3DZDA 4ZDWA 4XWOA 2EYQA 3UK6A 2WAXA 1OXUA 3H86A 5SZHB 3BK7A 3GJ0A 3X1ZA 5K8TA 1XD2A 3P1JA 3TW8B 4JBXA 4DUGD 3NH9A 3QF4B 4HZUA 3ECCA 4ESHA 4UNSA 1OV4A 4Q9JA 1ETUA 3GFOA 3AF4A 2GWHA 2IHYA 3R20A 1SHZA 1DAEA 2ZRNA 2JLXA 1Z6AA 1FTSA 2AXPA 4C2TA 1MH1A 1NY5A 3OIUA 1SXJE 2JJ1A 4RJLA 5ELXA 3WBKA 4DLWA 4XVUA 4OQFA 4EPXA 2IYLD 1ESNA 4PHFA 4ABYA 4KXFB 1JQJC 1ZNWA 1SXJD 5EE5B 2XITA 4KCGA 3R8FA 3MLEA 1SKQA 1DAMA 4DIDA 2DHRA 1HEIA 3EC2A 3CM0A 4D6PA 3GD7A 4XSGA 3CNLA 4KU4A 1QHXA 5JZVA 1G21E 2CCKA 3I4LA 4E5UA 1Y3AA 3ZZTA 2ZRJA 221PA 3J81k 1NVWQ 1Z63A 2ZRGA 2IF0A 4FCVA 2J0SA 2C78A 5EJEA 4BUJA 3BORA 1DEKA 5FL3A 3ZVNA 3BERA 4TTRA 1XZQA 3LX8A 4NPHA 2REBA 2WWIA 3PUVA 4HAYA 3U4QA 2WWWA 1CJVC 4AKEA 4DEXA 4Q4AB 4DJTA 1UEIA 4AY2A 4L16A 1F2TB 1FZQA 3TR5A 1K6MA 2H57A 3CRMA 3O47A 1E2NA 2O5VA 1UAAA 1ZP6A 4M4SA 2J0UA 2V8OA 4PC2A 2FF7A 3C41J 2ODBA 2PJZA 2AWNA 4G5QA 4GP7A 5CM9C 3KFXA 3L0OA 5AUOB 2C9YA 3ZD6A 4W5WA 4A0FA 3ZIAD 1GIAA 2IA5A 4EJSB 5CDFA 3QXCA 3AVPA 3GJ6A 1N5LA 1R6BX 1OYWA 3MWLA 4MYTA 1W0KD 4A4DA 2HDNB 2VHQA 2QMHA 4CW7A 3FMFA 1KBEA 3U2QA 5BYJA 3SEAA 4QM6A 2QSYA 3QG1A 3IEVA 4P4TA 5KNDA 5J40A 2AFIE 4US1R 5AJWA 3RAPR 1JJ7A 3CWZA 3WMFA 1P4SA 5DSZA 3UGDA 3LVRE 1T5IA 4WXRA 2P65A 3ZQJA 1P2UA 1SVOA 4KO8A 2I1QA 1WBBA 4DCTA 2GCOB 1P75A 5KSZA 1ZMXA 3X2SA 3QKSA 4IDHA 1L7VC 2Z43A 1ZD1A 3BH6A 5FOWA 2CXXA 2O8FB 2DY1A 1NRJB 2D2EA 4C2UA 2B6HA 4JIMA 4CRWB 1QVAA 1KO4A 4IDNA 2XZOA 3B1YA 2JLVA 1Z2CA 5JWOA 1FQKA 1OJLA 5DN6A 5JS7A 2N46A 2NO6A 1NLFA 3L0PA 1YJ5A 1G19A 2ODEA 1D2NA 1RIFA 2ZI5A 3I8SA 4CEHB 4ZV4A 1NBMD 4GT1A 4IOMA 4XTRA 5HR5A 5AJXA 3SHFA 3EA0A 1X8KA 1PVOA 1F60A 2HYIC 2CL7X 1VTKA 1E96A 1KI3A 4LYAA 2RKOA 1T3SA 3ZZUA 3P26A 2Q3HA 3SJCA 1S4QA 2CEAA 4GMXA 3G0HA 1NMZA 2IWHA 3U6BA 2OE2A 2IYSA 1LFDB 1Z3IX 3M6AA 1N5IA 3P32A 4B33A 3W6OA 1G3MA 3FTQA 2A78A 4TQAA 3THXB 3LX5A 1Q1ZA 3TUJC 1R79A 2DB6A 2WIBA 2ZI7A 3DDCA 2JJ2D 3FB4A 2WPDA 3L0IB 2VBCA 4GL2A 3T1QA 2F1IA 4FINA 4LHVA 2F1JA 4Q9KA 1XWIA 2QMEA 3DZ8A 3M1IA 1KSFX 3WRYC 5AWFC 5AR1A 3PFIA 3F0TA 1VCIA 3BFVA 4JLMA 4ZDJA 1AK2A 2FH5B 1E2JA 3IBGA 2AKAB 2X8AA 3QVVA 1UKZA 1X8JA 2P6NA 1OFTA 4IJMA 2GILA 4KYUA 5EE3A 2RMKA 2FG5A 3W6PA 4TYWA 2WVJA 4W5JA 3HR7A 4R98A 3P4XA 2IYZA 1K5DA 1N6HA 5JBQA 4H1VA 3D8BA 1RW4A 1OB5A 3GLHB 2GAOA 3QXSA 1P62B 5D3MA 3T1VA 2O8EB 3R9XA 2ANCA 3SJZA 2WKQA 4TQ9A 1NP6A 2KBEA 1AS3A 4Q02A 5LDDC 2BWJA 1XCMA 1KI8A 2JLRA 2XB2A 4E03A 2ZVQX 1H8EA 2GHIA 1NSFA 1IN5A 3JVVA 4QL3A 2IYXA 1KDRA 2GVDC 4P4SB 1LS6A 3B2EA 3T61A 2GJ9A 1E9AA 4JVSB 2BJVA 2QPTA 3OIYA 1XD8A 5JWHA 2IUUA 2E1RA 2IWRA 1PLKA 5LB2A 1T6NA 1D2EA 3OE7D 1GVNB 5IDVA 4A6PA 1U90A 1ZNXA 1W4RA 2FNFX 3BD9A 4JYCA 5J4YA 1GKIA 1R10A 5KYKA 3ICEA 3L8ZA 1EFHA 1ODFA 5FI1B 3EXAA 2ORWA 5DGXA 1Z6YA 2JIZA 1P6XA 3SJBA 1GL9B 4UXIA 3CF0A 1GL6A 1ZUIA 4NYIQ 1XMVA 3Q72A 2VRWB 2JATA 4J0QA 4XD7A 3D31A 3I5XA 2XGJA 4RCYA 3KTAA 3UMSA 3VR1A 1G41A 5E7MA 1RRCA 1GL7A 4M8NE 3SDZA 2CHGA 5LPNA 5KNBA 1E9BA 3MUFA 4BEBA 3TVDA 5K8IA 4V0LA 5AJZA 1YU9A 4OQXA 3GLFB 1E9FA 1YQTA 4KSBA 4IHQA 5JFGA 3I92A 1HA3A 1RJ9A 1T9HA 1E69A 3SS8A 5JMTA 2A7QA 2XOKD 4P3YA 4ON9A 3TKLA 4I99A 2NO1A 1CJKC 1US8A 2RGGA 2X1VA 3K09C 4PPGA 3IIJA 4IEIA 4RD2A 2FFHA 2O0JA 3QEOA 2OZEA 2CHQA 4BE7B 3NWJA 2FU5C 3QKRB 1RVDA 4LV5B 3AV0B 1ZCBA 2ZIAA 2B7CA 3TSOA 2DFKB 2D62A 3QENA 3SYNA 4TLDA 4TSFA 1PLJA 2F7SA 2OSBA 2FFAA 1R0XA 1WDTA 2P3SA 1FNMA 3QBVA 4LX0A 5GJBA 4DZZA 4IRUB 1OHHA 2O8CB 1HQYE 1XMSA 5IHPA 1Z06A 4JKYA 5A0FA 1IY1A 5P21A 5L3VA 2XX3A 1XZPA 1G5RA 4L8GA 5KOYA 2CE7A 2ECKA 1S3GA 4LJAA 3LBIA 5KSYA 1W36C 1AGRA 3CB4A 4LYFA 4BFZA 3HR8A 3DHWC 4P4UA 4BRWA 1EXMA 3LFUA 4C7OB 3GJXC 5JJKA 2HUPA 1F5NA 1W46A 4PX9A 2AXNA 5DYGA 5EZ5A 4Q7JB 4DIEA 5FR1A 2IYQA 4XWAA 4URWR 1RYFA 3TJZA 3KB1A 1D5CA 4EAQA 2YOGA 3IILA 4YONB 2RHDA 4M1OA 1XEXB 3RRMA 3GLGB 1JAHA 3A37A 4LY6A 5EP1A 4ZCIA 1CS4C 4I4LA 2Q9AA 4KLNA 3Q5EA 1KK1A 4D2IA 2VP9A 1E98A 4LJ8A 1SVSA 1R0ZA 3UG7A 1FL9A 1NN5A 2AL7A 3UANA 3W8RA 2O0HA 2OCBA 3OIWA 4O25A 4L5BA 4ARZA 2V6IA 2ZE8A 3ZLJA 5C46F 4A0GA 2A5YB 1OFUX 4ZCLA 3A4LA 2IYVA 1F3OA 2MSEB 1C4OA 3CW2A 4B3GA 1DO2A 2W0SA 4LUCA 1NVVQ 2FZ4A 1W5TA 4KBFA 4XWKA 1Q1BA 2WWFA 3SYKA 3LBNA 2Q0HA 4QJ3A 1G3UA 1Z2AA 4O3MA 4PQRA 1PTRA 1OSNA 3MJHA 3MMPA 1EG7A 1KSGA 2R6FA 4IFBA 1DOAA 1FX0B 2F1RA 3RRYA 2WAYA 1AN0A 5ANRB 2W83A 1KDPA 1F6BA 2HT1A 1XB2A 5E4FA 2OESA 2CE2X 2WKPA 3SR0A 4US2R 4TMZA 2VSOA 1OIWA 3B1XA 2W00A 5CLQA 2E9SA 1UADA 4B76A 5JEDA 4LHZA 2E73A 1G6HA 2VF8A 4V0OA 4DLVA 1OXSC 2ZUDA 3K0CC 2VTKA 4PANA 3AF1A 5CK5A 3E5HA 1D6JA 4XTCS 3BFKA 3F3YA 4CZ2A 4OHVA 5FTMA 3WNBA 2DFNA 2ZUBA 4HI0E 5E3HA 3QOFA 2HLDD 1A2KC 2O8DB 2GZAA 3IDQA 1NVVR 3TUIC 1GFIA 4RZ3A 4A0HA 5JJIA 3UMFA 2N1BA 1CTQA 1GRRA 1VG0B 5GJVC 1KSJA 4G3XA 1MABB 1U9IC 1M6NA 5DIFA 2VSFA 2QZ4A 1VYUA 2A30A 3AKEA 1TQ6A 1B0UA 1AKYA 1EX7A 2YOHA 3C5CA 3QXHA 1RRPA 1JALA 2XZPA 1E2PA 4QM7A 5A4JA 2NG1A 3BIFA 3ASYA 3TBKA 2RGDA 2ZRLA 4JLBA 3Q9LA 2VIIA 4HAXA 3B8HA 2ZU6A 2ZU0C 2W58A 2IYWA 2BVNA 3H84A 4PHHA 4OKSA 3R7WB 3S1AB 3TSZA 2W2VA 3FWYA 3ZIAA 1ZM9A 2ELIA 5EQTA 4B44A 2QQEA 1BH2A 4GBMA 5FOVA 4IVPA 3FGNA 3RHFA 3RDPA 1RRGA 4ASUA 3KXKA 1II0A 3RVBA 4DT1B 1NLZA 3AF0A 3U5ZB 2NZJA 3BAFA 5BXQC 3SBDA 4PSAA 4BLPA 3GLHE 3AVUA 2GBLA 1YZQA 2QAGA 1QHHA 4NYMQ 1W36B 2RGNA 1XNJA 1NIJA 4Z1MA 1IJEA 5SZKB 2ZE7A 1LV7A 1UKVY 4JL8A 4URXR 3IPYA 4UQOA 3LRPA 3AGQA 3T5GA 2WICA 1NKTA 2BBSA 3NVAA 2P0EA 4UNQA 2V1XA 5IT5A 1AQYA 3KQKA 1TQ2A 1I4LD 1KI9A 4KV9A 4F38A 2J5XA 4NTZA 3JZMA 3K9HA 1NN0A 5C4MA 3UWKA 3CX7A 1EFUA 3UGLA 3VKWA 1KMHA 4LZZA 2I3BA 4V03A 3K0FA 2H7VA 2AN9A 4OK6A 1BOFA 1CKEA 2FGJA 2WOJA 4UJ3A 5F9HA 1TF5A 4HDQB 3AQ4A 4BWYA 1ZD9A 1FAQA 4I81A 2EFEB 4URVR 4C9BA 3FHOA 1W5SA 3EW9A 4V02A 2ZS9A 1GOTA 2JDIA 3U7FB 1WB9A 2CL6X 1VPLA 1N5JA 3G5UA 4D82A 1FOEB 4Q7KA 3QPVA 2SHKA 3T35A 3I8XA 4CYMA 1OXXK 2ZR7A 4WVFA 1E99A 4PZLA 3WNCA 2ONKA 1G291 2QGZA 3GLFE 1CR1A 1V43A 4Z8XA 1PJRA 6Q21A 3N2IA 5B30A 5CK4A 4Y0AA 1XTRA 2C8VA 3WHKA 1I4TD 2YWFA 2R62A 2RGAA 3R8CA 4TZ6A 4Q4JA 2BCJQ 4BGDA 3KQHA 3KX2A 2OXRA 3AVVA 3ZQ6A 4M2LA 4LBVA 1M34E 1HYQA 1KNQA 3OESA 3PUXA 4OQNA 2BJWA 3NHAA 4U00A 4LJ4A 1E32A 3HPQA 5FBVB 4NKRA 4Q9LA 4OHWA 3U3RA 2KBFA 1BMFD 4C0BA 4TWZA 3RNLA 3BJIC 2VHTA 2YOFA 1ZD8A 4B2IA 4OI1A 5L3SB 1IN8A 4LDJA 3U3OA 2KWIA 4NONA 3X1WA 1XMIA 2EFHB 3B82A 1FUKA 2B8WA 2MSCB 4JJZA 4LPKA 4EPTA 3LNCA 1XF9A 5EXSA 5HZHA 3W6NA 3GLGE 4DDTA 1W0JD 3QXXA 2J45A 1T8TA 4Q48A 2J0QA 3EPHA 4M1TA 3KJIA 2A2ZA 3FKSD 1E6CA 4LK2A 3TH5A 1W2HA 2MMGA 2H18A 4CIDA 2DPXA 5TARA 2ZM5A 2G88A 2GJAA 4K81B 4I1OA 1XEWY 3MCAA 1XPRA 2CLSA 2CHVA 3OE7A 1FMJA 3TAHA 3NXSA 2ZSDA 4JZKA 4KLZA 4D80A 1T4GA 2ZSFA 3CONA 4O2RA 1G5PA 3I61A 2MSDB 1Q1QA 3X1DA 1E0SA 4BFXA 1R4AA 2OBMA 2GXUA 5CLLA 1E0KA 1AKEA 4TLAA 1CU1A 3FVQA 2FPLA 3BRWD 3ND8A 2ZJYA 3NBFA 5KSPA 4DCUA 3C8UA 2QBYB 1P2VA 3BH7A 5DI3B 1Z6GA 4AKGA 521PA 2EW1A 5TV2A 1CP2A 3UG6A 4URZR 1OXTA 4QGHA 1DBSA 4N1AA 4D0NA 4M9XA 3WXMA 4C0SA 4A8JA 4LHXA 1XDBA 2JLUA 1SKYB 1CBUA 3IIMA 4GOXA 4CVNA 2QN6A 4UNRA 2EQBA 3JVUA 2WMNB 5EXTA 2WWHA 3CF6R 1GUAA 2FSHA 4NE2A 4UNPA 3AP1A 1ZRHA 1KYIA 2EFCB 1ZUHA 5KNCA 1RZ3A 1II9A 1HH4A 1GTVA 1KO8A 3K9GA 4R2HA 5DHAA 3TW4A 1A7JA 2OV2A 1NJGA 4HSEA 3UATA 4YQFA 1WMSA 4IOKA 3KUDA 5L3RA 5GVSA 5DNYB 4DRZA 3R9IA 4LV8B 1DVRA 3GLIB 3D3QA 1YZTA 2ZJ5A 3LW7A 3ZYCA 2FEMA 2IF2A 1BKDR 1UBEA 2XAUA 3EIQA 1G4AE 4LPSA 4ILEA 1P9WA 2ZR0A 1QG4A 1S0UA 2AR7A 4HLDA 1I2DA 1ZYUA 2DWQA 5B64A 3HWSA 3G82C 4C0HA 4Q4AA 3D6TB 2QP9X 5JS8A 1XXHB 1TL7C 3FE2A 3VKHA 2ZRPA 3CKLA 3RS7A 3QJYA 4MQBA 4PAOA 1CJUC 5JHHB 2C9CA 4OQLA 4PTLA 5FBWB 4BZQA 4OHYA 4OI4A 4B3DA 4M1SA 1NMYA 4WZBE 4LHWA 4B74A 5FTLA 2GXQA 4L15A 5LD2B 3HPRA 1BYUA 1NVUQ 4QOSA 4PSVA 1ZVQA 4JS0A 3TGPA 1E2IA 2C04A 1W4AA 2QTFA 2IS6A 1T0HB 2G6BA 2WSMA 4CDGA 4DWJA 3ADDA 2RGBA 1R7RA 3SFVA 2O8BB 4LJYA 1C9KA 1VCMA 1E1RD 3BS4A 3KJGA 1VIAA 4B3XA 4RSGA 3MGCA 3T34A 1E9SA 2AX4A 2GJKA 1VIYA 4GOKA 4YMWA 5K8UA 4HAWA 1E9CA 2C5LA 4ITRC 1W36D 2UZIR 1KI6B 1XTIA 4FMDB 3EPJA 4QBFA 3UMRA 4TTPA 3SOPA 2A5GA 2CK3A 2JGNA 2P5SA 4FMDF 2IS1A 1U0JA 5KDLA 2FPMA 3K9LA 1T0JB 4H9GA 4QBIA 2YWEA 1LNZA 1FFHA 4RCZA 4IXMA 2XXAA 1S9DA 1E1QA 2ZRFA 2ZRDA 2ERYA 2YZ2A 3GEHA 3NKVA 4Q01A 3A36A 3AP3A 1JQLB 4F4JA 1Y63A 1NKSA 1KKLA 2J0VA 3H0KA 3ADCA 5DHFA 1WP9A 4TL9A 2C95A 4MGKR 4JT4A 3OEED 1N3BA 3WYGA 1VYVA 2ORIA 4TMTA 4TN1A 3U61B 5J4VA 1XTKA 4Q1BA 3THYA 2O0KA 1EFRD 1XD2B 4P0TA 1QHGA 2J7PD 4HZUB 4JVLA 3RS4A 2IUSA 3IUYA 2XTNA 4JL6A 1W48A 3PVSA 2J46A 3GJ4A 4JLNA 3B13B 2GTPA 4HLUC 1AJEA 3A1TA 4HLCA 5CM8B 3QPUA 2FWRA 2QU8A 1NN1A 2ZI3A 1UF9A 2FPKA 3TQCA 1IQPA 3QKTA 2C96A 3EPKA 2ZYVX 1VHTA 2VP2A 4M9ZA 1AM4D 2GF9A 3LVQE 2HT6A 3RSOA 4G0NA 1Z8FA 3PUYA 4NCKA 3ASZA 4OI0A 1Y8FA 3LW8A 4HDCA 4XVRA 2KB0A 3CF2A 2IYRA 4BRUA 5FOTA 1NBME 1VCOA 3LO5A 2JLWA 1MKYA 1IN4A 5A5GA 2DBYA 1BYIA 2HXSA 5CITA 1EWRA 2A5DA 4PZYA 5CJPA 4ZI3A 4DVGA 1C1YA 2KJQA 3W3ZB 2REXB 4DSOA 3CRQA 3KJHA 1ZM7A 2G1JA 4JMPA 3FMPB 1W44A 3U4QB 4AG5A 3TE6A 1IY2A 4YDSA 4GZMA 1FW6A 1VG9B 3FHTA 1M1YE 4DEYA 3NBZC 3DVLA 1X1SA 2QMUA 4Q00A 1SQ5A 2ENZA 4QGAA 4GDFA 1MRSA 3A6PC 2CNWD 2H17A 4TLCA 4CEJA 4PC6A 3B78A 5J5CA 4YDHB 1MT0A 1AIPA 1A4RA 1Z5ZA 1OH7A 1KZGB 4NU0A 3E1SA 4ERNA 4P4SA 2G83A 2GKSA 1NJFA 1P61B 3A4NA 5FL7A 5DE3A 2H92A 1R5OA 3CH5A 4GFDA 2HJGA 5CYPA 1F2UA 5H70A 1SVKA 2V6JA 2XNDD 5FI0B 1KK0A 1YR6A 2F1HA 4CF7A 4LWZA 1D8TA 2Z83A 4WZ6A 2FSGA 1S9HA 2FSFA 2TMKA 3JZAA 1U8YA 3WBJA 1G20E 3F8TA 4MRRA 4RD1A 2BMJA 1FMLA 2IEYA 4RD6A 2PL3A 1BIFA 1H8HD 1KI2A 1DO0A 2V7QA 1E79D 2WJIA 3FYHA 4K46A 3QKSB 1MO4A 3T1OA 2QPAA 3KQNA 3FPAA 1KTVA 1QHYA 1JXOA 2GESA 3GPLA 4W9MC 1GNRA 1GSIA 3WRXC 1VMAA 4G5RA 4TYYA 2NZ8A 3LLUA 3LY5A 2X19A 5IF9A 3HJNA 3THOA 5KPDA 3VX4A 1YR7A 2PX0A 2F43A 4YMVA 2A5JA 3BFXA 5UKDA 3VFDA 2DR3A 2WJYA 3C5HA 3W9YA 1IBRA 3L2OB 4QGGA 3OEHD 3I1FA 4AC9A 4TL6A 1JB1A 2F9MA 4UNNA 4Q9HA 2WSSD 2R65A 3MAAC 1M7HA 1KO5A 4D4LA 3U44A 2HF8A 2BHRA 3ICQB 4EIWA 5EUQB 1J7KA 1ZM3A 1F48A 4D81A 3H1TA 5TB5A 3K8YA 3EA5A 3PUZA 3QG5A 2E87A 1NMXA 1FP7A 1ZJ6A 2QORA 4N3NA 3GLIE 3W5IA 2G0NA 1G3RA 3CZQA 2IHBA 5K8LA 4KHZA 4DLTA 1D9XA 3RC8A 1CJMA 2ZE6A 4Z54A 3TSWA 2UVQA 1E9RA 5BN5A 4QRHA 3WYAA 3NEJA 1H65A 2D7CA 1U0LA 3QI2A 4HATA 4HAVA 4DKXA 5JHGB 2DFTA 5B2ZA 2WIAA 1XXHE 2DWPA 2ASEA 4B73A 2ZJ8A 3ZDQA 4JKIA 2HV8A 5GJWC 3FHCB 5HCNA 4AYWA 5HTKA 3E70C 1P7CA 4PO1A 2OBNA 4Q03A 3W34A 2C77A 1RFHA 2XSZD 4BLSA 3CNNA 3LQQA 1JPNA 2OCAA 1E2HA 1ESMA 1GKYA 2G0TA 3A1SA 1KZ7B 1N2CE 4BLTA 1EGAA 1KKMA 1BO6A 2W6ID 5FR2A 2QM8A 4TMKA 3V4RA 2LCFA 4IXNA 4JLKA 5DH9A 3U7HB 4JBWA 3VU9B 4DBLC 3OAAA 3PR1A 1ZM4A 4DLSA 3SQXA 2W0MA 1ZIOA 1HV8A 2PT5A 2IK8A 2XEXA 3EAQA 3KKOA 5H1YA 4DLYA 1FP6A 3SFZA 5BQ5A 1ANKA 3PIRA 2V55B 2VP6A 4PC7A 1IY0A 2Z0MA 2BDTA 1O3YA 1JR3D 2GAAA 2ZSBA 5D3MB 3VR5A 1BS1A 4MH0R 4V0ME 4GP6A 4W7SA 3LAWA 4CEIB 3OIVA 1JR6A 2CMKA 4FCWA 1XCGB 2GZHA 4B3FX 3QNUA 4TQUS 5JCZA 2Q6TA 1WCV1 4PAQA 3EPLA 1N6RA 2CJWB 3UKDA 2ZXUA 1HT2E 2CBZA 3IQWA 1Q3HA 2IC5A 2PH1A 3OFND 4PHTA 2ZRBA 3QY0A 2QTVB 4ZO4A 5SZJA 5KDOA 5IRCD 2IYYA 4LRWA 1X86B 1HUQA 1W2GA 1M2OB 4A15A 2QPOA 5JLJA 4PC1A 1XEWX 1LW7A 4GMDA 3QE0A 1ZW6A 4GNKA 3U3KA 1Z83A 4LJ9A 3OHMA 4RFSA 5FTJA 5BWMA 3Q85A 4X8HA 1G18A 2IXGA 1QG2A 2JCSA 4TMXA 5EUMA 4ZPXA 1NL3A 3C4JA 4FD2A 3KTAB 1VKJA 4QKQA 1CJTC 3AP2A 2F9LA 3V4FA 2PCJA 5LBIA 1SULA 2IS4A 1OW3B 1DAKA 5FUXA 1KK3A 2GZDA 4JLJA 4JLOA 1RYHA 4O0MA 1X3SA 3KKPA 1XMJA 1XJ0A 1E94E 1RJ9B 2P6RA 2VP0A 2BCGY 2FE4A 1EX6A 1UDWA 2WJVA 4B6DA 5IK2D 2JJ1D 1I4DD 1DAGA 1FNNA 4A2PA 4NYJQ 1NY6A 4DUGA 2Q3MA 2XJ9A 4Q4HA 2YHSA 2WWYA 1CF4A 4DLRA 2HYDA 4JBYA 4A82A 1T3LA 4OJQA 5KPJA 1CR4A 1HE8B 3PEYA 3K09A 2NGRA 3TVTA 3KB2A 4LJ6A 2ZQ5A 3CX6A 4HB3A 4Q19A 3DM5A 1PUIA 3EARA 3REFA 3R9WA 5FFMA 4BFVA 4EUNA 2Z6VA 4MKFA 2VLIA 4OBEA 1IN6A 1JXMA 3MWKA 1UEJA 1X6VA 3AKYA 1P9NA 1D2MA 3NC0C 1SXJA 2QTHA 4I1SA 4M9QA 2QT0A 4NCNA 5AJYA 2WTUA 3EC1A 4WIAA 4XJXA 1Q22A 4PO9A 4WBSA 3TIFA 1OFIA 2D3WA 3RABA 4LJ7A 2JASA 1Z0DA 2ZJOA 1LY1A 1U8AA 1WBDA 2A5FA 1Q1EA 3K0SA 1XJCA 3KFVA 1UBCA 3EZ9A 3CNOA 2QP4A 2ATVA 4WZAE 2VHCA 5FBQB 4NYJR 4C30A 2FNAA 4BZPA 2AD1A 821PA 1IXRC 2PEZA 1JAIA 2ATXA 4P31A 2R9VA 1YR8A 5J4KA 3P27A 5JEEA 3NHBA 1UFQA 1JEEA 3IHWA 4ARZB 1DG1G 4AWXA 5L3QA 2GCNA 3GP8A 3N2EA 5HCIA 1KBFA 1XRJA 4LHYA 1CRPA 4F4CA 3DOEA 2OO7A 1S1CA 2V54A 4QC2A 1PTQA 1TUIA 4RKFA 4BFTA 4IFEA 4Q7LA 5EE0A 3CR7A 2VA8A 4ZDIA 1LTQA 2HJVA 4LSGA 3MG9A 3VX3A 4LC0A 2FMXA 2OFXA 4MITA 2WKRA 4DSNA 1FTNA 4KVGA 1E4VA 4EQ6A 1OKKD 3VKGA 1CR2A 1W0KA 1YZUA 2LKDA 2VQSA 4DLUA 5BN3A 2NIPA 1XFAA 1SHKA 3PXGA 2GXSA 4ZDKA 2BIFA 1P2SA 1WQ1R 3KQUA 3A58B 2B92A 3CRVA 1G8HA 1VECA 4KFSA 2GVIA 2FOLA 5JRJA 3WP0A 4B47A 3HU1A 1R5BA 2OILA 2AD5A 2B21A 4U5XA 1ZNYA 5H8WA 1GWNA 2J7KA 3B1WA 3TAUA 3Q7PA 1X1RA 2R6GA 2FSIA 1ZM2A 1P60A 2ZSEA 4HUQA 3K0CA 2GF0A 3KKQA 2BMDA 2V9PA 2ZR9A 3EX7C 4O2LA 1TF2A 4RD0A 2OLKA 3PUWA 2NPIA 3DEFA 4PHGA 1QDEA 2DCUA 1W1WA 2PEYA 2ZS8A 4URYR 1PV4A 4MRVA 4EDHA 4RD4A 2AHOA 3PENA
chains in the Genus database with same CATH superfamily
3DB1A 1TOTA 4NZMA 5IVDA 2FA9A 1GG8A 2JHPA 3AJ8A 3BXFA 3LV8A 3PG5A 1O8CA 4J8PA 1RQ2A 3UA4A 1XJQA 1SCBA 3ENZA 4E5DA 4OFXA 4DDWA 3KPUA 1RPJA 2WU3A 2FSVC 4AIRA 4BJ1A 2GGSA 1V3TA 5BV8A 1U9IA 3NHRA 2DWCA 3WSVA 1PEKE 8OHMA 1IJFA 1FFDA 2GWRA 4HV4A 5TDHA 4HGYA 1QYXA 1BKSB 3QEBZ 1VSQA 1XDDA 3B1JA 4RHCA 1GAWA 3FKJA 3LQRA 2BFDB 2EARA 4BX2A 5BW4A 4U7TB 1XMQB 3GFTA 2NXWA 3FNEA 3MUOA 1AS0A 4Y9SA 5ADUS 2CNWA 1CXZA 3DFMA 3PE3A 4J0CA 4HVCA 2KMPA 4AZWA 1QCYA 2R5FA 4J0GA 3GJYA 3KL4A 4K6GA 1R5NA 4P84A 1V8DA 5HIMA 1ODLA 3KB8A 3ZD7A 1B7GO 4DIFA 1WVGA 3G5AA 4KODA 4RM2A 1NF3A 1MO5A 1PN3A 5K09A 4HMPA 4DGQA 3O9VA 2A94A 4TTVA 4QDOA 3WYBA 2CVHA 3DAGA 3G2IA 3HKDB 4RXUA 4UAGA 1YR1A 4MUYA 4DCNA 2FUG6 3BA6A 4H7EA 4QLBA 3S7TA 1FDTA 2E37A 3MLBA 1OB2A 5AJTA 3KY9A 2MMCA 1CQIA 3GEEA 2QI9C 2WMOB 1YJQA 2IUEA 3TN7A 3ZE8A 3ZWAA 3DC7A 1DIBA 4I3FA 3OA2A 2OXCA 4CMIA 2OZLB 3BL5A 3VR4A 3SF0A 5K0EA 1P9RA 3ZW7A 3RROA 2HRDA 3B6EA 2I4IA 4FMCF 3A0RB 3JALB 2F59A 3MD0A 4PZ0A 3W5VA 5K5EA 4QDXA 3TOSA 2FMIA 4WQMA 5DWVA 3KXLA 5HM8A 1ISFA 3T52A 2PUWA 1B0ZA 5AKYA 4F93B 2N42A 1P3JA 1FDRA 1YE3A 2PZLA 3PTAA 4OUDA 1CUGA 2A1TR 2AK3A 2YXBA 3ETJA 4H3KB 4LXHA 4Y1RB 4D9IA 2L8EA 3OA0A 2OGTA 2QL6A 1UR5A 4MGEA 5TS3A 4UARA 5FPPA 4CM9A 4UZFA 1N6IA 3K6RA 5ICEA 4PLPA 4NDNE 1CY6A 1ZFNA 4ZT5A 3L7MA 4M49A 1EXDA 4JLVA 2MSLA 1XELA 5GINE 3RC7A 3C3DA 4ZKEA 2CMHA 3L7JA 4L8FA 4KPGA 1TTQB 4EG3A 3ZKWA 4IQGA 4L5IA 1IIRA 3JARB 3JZIA 4RFVA 3S2FA 4I9GA 4C07A 1NRIA 4CU5A 3K53A 3VPSA 3LPCA 3TGLA 2A5LA 1Q3KA 2FWJA 3HMKA 4WKNA 3X2FA 4E4RA 1P2TA 2P5TB 4BU0A 2NV0A 3RHSA 4DG5A 3D6FA 1GAXA 2ONZA 1AXEA 1JLMA 4HCJA 1Z0UA 4PXYA 1TT7A 4OQMA 1TZMA 4XYBA 4WY5A 5AOAA 1QRSA 3G9QA 1ZLXA 3RLFA 2ZRCA 4A6XA 5C80A 4D57A 1ABBA 4ZU1X 3CEAA 2AS0A 5ER9A 2WDPA 4M8SA 5B7GA 1K5PA 2VZLA 4OCZA 3RVQA 3DG9A 4G5GA 4UULA 4AJ4A 4B7ZA 2WJJA 3TLXA 4UTVA 3OF3A 5FUWA 3CG4A 3BGDA 3QZUA 1IMOA 4SGBI 1UFRA 1I32A 3HM2A 5JAOA 2AHRA 4B4UA 1KH2A 4OHZA 3QF4A 4RWZA 2ANBA 4EW2A 2B6NA 2QLFA 3RJTA 3RT9A 3IAUA 2D2IA 3R6DA 4HPJB 2JC3A 5AVKA 1OAOC 4GI3C 1QIEA 5HP4A 2QVBA 3DMFA 4H7PA 2PMBA 2YUUA 2MR5A 2ZRAA 4TSFD 1T36A 2P2GA 1CQWA 4J2TA 1Q6YA 1WMBA 1RXVA 2Z4SA 4ZAYA 2QRZA 5IC4A 3TDNA 2RI0A 3DKPA 4UMDA 1REQB 3ZWCA 1WHTA 4R7TA 3ZX4A 2V53A 4XH9B 2PKRA 2VDOB 3JWJA 3QA9A 2QTZA 4K40A 1JHDA 2QRHA 5AKHA 1RAFA 4C7XA 5F1PA 3HRIA 5BP7A 2X0KA 4EVIA 1Q16A 3A6HA 4RZXA 1C4KA 2PQ2A 2WHRA 3D6UA 1U3CA 1RWNA 3DF9A 2HWYA 4EB6A 4LBWA 4BNNA 4DXAA 5IZCC 4D4MA 4B3JA 5BN4A 3DLCA 4MR8A 1S5PA 2EKBA 1LJ8A 4IQ8A 3H42B 4LBYA 1P19A 1PL8A 1GITA 1UXKA 2DYKA 3DOOA 2BGWA 1QWOA 721PA 3ZVRA 1Z0AA 3FHJA 1U7HA 2X8BA 1GAEO 2UU9B 4BFUA 3H2BA 3V3TA 2YINC 4JYAB 2R85A 3CIOA 3CPEA 3H13A 4ZIRB 1JR4A 1BHSA 2VUHB 4M89A 1USWA 3DV0A 3D8RA 2PLNA 4DBLE 3KSBC 1FFSA 2X5XA 5KBYA 3TTYA 1Y9DA 3V32A 2EP5A 1XRRA 1KMCA 1P7YA 4B85A 3UQZA 2EWMA 2QTRA 3TBHA 2UYYA 2VJAA 2EX1A 1GNSA 1O5TA 3BGVA 2E55A 2YIDA 3BXXA 4JYMA 4L5JA 3RC3A 1EHYA 2HR1A 1EAMA 1LDEA 2IT1A 4MVJH 4Q66C 3NAGA 3RKSA 2W2TA 1QGAA 2XMPA 5DBOA 3C14C 4IH4A 4WJKB 3NHYA 5K8VA 2P2ZA 2I99A 1CSOI 5C4GB 1OTYA 4JJFA 2Y1EA 3KQQA 1L1FA 2FTKE 4AKHA 3M9WA 3UUFA 4MUNA 3D4OA 1WA5A 3RVJA 2XJ4A 3V4ZA 3L06A 4TZ0A 4ZQCB 2I1VB 3P45A 1U0TA 5J43A 3PNYA 4ZC1A 2QGNA 4RIGA 1R5JA 1SGEI 1JE1A 2JGDA 3PDIA 4L4UA 5GGXA 2BFFA 5HDBB 1CIPA 5EKUA 5GP1A 4YXWD 4NDZA 5KQMA 1JDUA 4BVGA 3F90A 4Y6PA 1N3LA 2CZGA 2GCOA 5EX3A 1FDSA 2NT4A 3OF5A 5HI7A 6YASA 3IUQA 1WETA 2FWPA 1C3JA 1FUUA 2NSYA 3DE4X 4MQUA 2X76A 4Q24A 3QV2A 4GWLA 1TM3E 2WIDA 1RM5A 2SGQI 1X9IA 3H5TA 4N54A 4KSCA 3WAJA 1D5WA 2O8FA 1V8FA 5H7XA 1T13A 4J07A 1Q0ZA 4IIBA 3G23A 1LBSA 1D04A 2ZI4A 4FTWA 3IJRA 3ZWWA 1RPNA 4ZYVA 3E5NA 2HA3A 2ZBQA 1F5SA 4CQMD 2JPDA 2JARA 2HPHA 2XMSA 1Z2DA 4PO8A 1MENA 2ZWAA 3THWB 3ZXXA 3O4VA 1L5SA 2ADOA 5JECA 2L19A 2AIRA 2R8YA 4B3HA 2BI7A 3WYNA 3HBAA 2JRLA 2B4QA 1JDSA 2F48A 2P9ZA 3CRW1 4P2BA 4AJKA 1RP7A 1YK1A 4ARCA 2IZZA 1RHKA 4RO0A 5TY0A 3EASA 2CT8A 3DKKA 3GROA 5H02A 2AC4A 5KQRA 4GZLA 1LPOA 1M7GA 1PT6A 1KZ4A 2YZKA 4REQA 3W1WA 3MT7A 5E3QA 1A9PA 5KYUB 2YY7A 1Z5UA 3OH8A 2CCGA 4G01B 4TT3D 2V97A 4HX5A 3EGXA 1YNOA 4YWJA 1P2DA 2YXPX 1P4AA 4ZOCA 3K6JA 2TYSB 4PFSA 3QQ5A 3CT6A 5H3HA 3NBYC 5L7TA 2F3TA 4RTNA 1U1GA 3AR7A 3DKVA 4IJKA 2F9FA 1GPWB 1VIVA 4NU8X 3UW3A 3THXA 4FBMA 3OFKA 4D9JA 4TTQA 5ALOA 3EXEA 2FP4A 1YT5A 1W1IA 1ZD4A 2Y9PB 4C3ZA 1YBHA 2EU8A 3DCNA 3VDXA 2Y2VA 3K2IA 4KQGA 1J8YF 2D5CA 3WC4A 4JJ6A 3HM9A 1VGQA 2WJHA 3C5EA 2R8XA 4K9QA 3T1NA 4AJHA 3RRBA 4BVBA 4EVRA 1FNDA 1JQKA 4J3NA 1PYGA 1U3TA 4PQFA 3UM9A 3N3BC 3WS7A 4W9NC 4Z1MD 2X6RA 3O8OB 3AFGA 5E8RA 3MQFA 1N92A 1BJKA 3LC7O 4LE2A 1ZKMA 4ABTA 3AQIA 2SICE 3BB1A 4G5OA 2CV0A 4JB3A 3T5DA 2VJLA 2ZIXB 1SQFA 3D6AA 4MCJA 5JDIA 3U4AA 5HBRA 3IOYA 2XXAB 2QTTA 2R6DA 2XCIA 1X3LA 2BGMA 5EJ2A 1C9EA 1H2RS 4U7GA 1U2EA 3FLEA 4ZVVA 4E5YA 1TO1E 1NPYA 4YBRA 2GZMA 5FP0A 2Q4EA 4KGDA 4XARA 3WMEA 4C76A 1GN9A 2XMZA 3X44A 2W6JD 3TLKA 3HSYA 2X2OA 3EDCA 1SUSA 4JUCA 3GLQA 3Q5DA 4W1RA 4YJ2B 2VNJA 5CNIA 5CA0A 3VH3A 3CWQA 3HUEA 5M7EA 5J2TA 1ZCJA 2GEUA 3ADPA 4PLWA 1V41E 3G02A 4O2BA 3JSAA 3Q7TA 4CEJB 1MJNA 2CFRA 1K2WA 3RC9A 1XCPA 1WJGA 4ARSA 1EDBA 5FWYA 3AOEA 3G5TA 4YJGA 1OBHA 3BE6A 1C9JA 1HE1C 1P73A 1WF3A 4C4YA 2QOEA 3DMGA 2QMOA 1CEQA 1J8QA 1F1BA 2XMQA 4B3CA 2RHGB 4LYYA 1AHPA 1HRDA 3KQOA 1IAQA 4C5BA 1TZKA 2VT3A 3BGSA 1IOZA 1UUFA 1J0XO 2P2LA 1JEAA 4TWIA 3PWZA 2RGRA 2HY7A 3WFJA 3L93A 2Q0SA 3HI6A 5E7IA 5GWXA 1RBYA 2VRWA 5GONA 4Y2VA 1DBQA 3H2HA 3DBRA 4MS1B 4R8RA 4KIFA 4XGNA 4XLLA 3S68A 3SEFA 1HNWB 1Z5OA 1P33A 1DUIA 2OBBA 3OZSA 4OYHA 3OU7A 3M82A 4QOFA 3AR4A 3PFGA 4URUR 2KMQA 3QELA 2H5EA 3WBBA 3NV7A 4DIMA 4ETNA 4NFLA 1JDBC 2PUTA 1Z6XA 2VATA 2XB9A 3IB3A 1HZZC 3LDFA 3SY8A 4DTIA 4EUSA 4WJLA 3FCSB 4MQEB 2XF8A 4NMMA 1I7SB 2UYGA 1UVGA 1SUPA 2D5BA 3JR3A 1Y4AE 1ADCA 3HJRA 4P83A 3WLNA 4E13A 2QJTA 4RIHA 3QVSA 4D9MA 1YI0A 3E03A 2O14A 3EMDA 3G0BA 4RCVA 5DX0A 1KJJA 4RPGA 4MA0A 1B0AA 5I4CA 2GD1O 1Q0PA 1YB1A 4X24A 3Q8XB 5H83A 3HH2C 1QGOA 4RLFA 4NJMB 2C57A 4RIIA 3HUFA 2MJLA 3EXG1 1FS6A 4L1KA 1TMOA 2JIDA 3RYTC 5AVZA 1ND6A 3I53A 1A1SA 1KAOA 2C61A 2VHEA 3RJ5A 4DUZB 3T7DA 2ERCA 3F4KA 3TTXA 1P91A 3MMSA 4B3BA 4OKNA 3IEUA 5BYKA 3TK1A 5DASA 1I7DA 3H5NA 3TO6A 3I34X 1RLIA 4LI0A 2CFSA 3CH4B 4Z99A 1JEQA 3VR6D 4F91B 1KO7A 3G1WA 1RLJA 3C8MA 4UZSA 1JIVA 2CJWA 1LZKA 2X5KO 4DR3B 2FDCA 1IBCA 5LQCA 3PGJA 3GVCA 4GPEA 4L08A 4FYXA 4O2AA 1GCGA 4C7OA 1FDIA 1YIAA 4CF5A 1ABFA 3F9RA 3CEHA 3KJEA 5B53A 1I33A 1UAGA 1F2UB 4C05A 1NP7A 1Z4JA 3I30X 3IEKA 4NPAA 1V47A 1U8XX 2Q21A 2G5TA 3B4VC 1XEXA 4IKEA 2ZJZA 1MX1A 4M53A 1AY0A 1W19A 3TZ6A 4BO6A 1C4XA 3CPHA 3HCCA 4KDRA 3V4OA 5NULA 3IALA 2RBKA 3UWMA 1ESCA 3IBTA 4ZK6A 4OYLA 1CY8A 1N36B 1ODIA 5JWRA 3VTZA 2IHKA 3JZFA 1UJ5A 4GGOA 2QY9A 4PPYA 1PJ3A 2VJMA 3MTQA 4ZI7F 3ADBA 2KSQA 3DVRX 5AVQA 2XQKA 2ZZNA 1R15A 2ZDQA 3FFTA 2CN1A 3OCYA 4N6GA 5CH8A 4WLFA 1SOWA 2VYVA 2NO9A 3ZHSA 5LLSA 4QJ5A 3ODGA 3Q3VA 1ZCAA 3I32A 4TX1A 2ZJ2A 4EI7A 3EZYA 4YP1A 1DUVG 1Z4QA 2OP0A 1N1EA 4NX2A 3JQ8B 5AHKA 1UMBB 4C6TB 3RU9A 3QFSA 1FYFA 3BMNA 4DR6B 2QE7A 3I9LA 5J5AA 1M2HA 1RWWA 3C7DB 3CU5A 5DX1A 1EUQA 1POXA 1EFTA 1ONBA 2E18A 5LZ2A 3OIDA 4QG7A 3K0EA 1AQLA 4MYSA 4FFWA 1M8KA 3K2EA 3O3NB 2C2HA 2HA5A 4LZAA 1E77A 2B37A 5BUZA 2GETA 3I73A 1IN7A 4S1OA 4AFNA 1S8AA 1HX7A 5AVOA 1KERA 4RETA 2QAJA 2V4ZA 3JV7A 1X42A 1DFGA 4XIGS 3WK6A 4BAGA 5KYTA 1WXIA 3RYHA 3ER9A 1LVUA 2E7ZA 5AP9A 5E8JA 3D5EA 4OMCA 2VK1A 2G25A 1XDSA 1IEXA 4O4IB 4CMEA 4F06A 4I4TA 1V1RB 1YBAA 2I2CA 4X7BA 1JYSA 3WLHA 1V11B 4RF5A 4F1KA 3SJAA 3ZNPA 1OXMA 1ICIA 1L0BA 2DFLA 2ORVA 3BREA 2AFHA 1NBAA 3L6DA 2W9XA 4PPFA 4Q3BA 4WAUA 1PNRA 3LXRA 1DC4A 5BN5B 3LCJA 3VVCA 2IDZA 1QTQA 3P9YA 1G42A 1M8PA 1XO1A 4MGYR 4HT3B 2XVYA 4R1UA 4PFQA 4BNYA 1VA5A 3JQBC 1PJBA 3DE7X 3DVAA 1E9DA 2QN9A 4AYXA 1SUBA 1UH5A 4UU0A 4FB4A 5C8YF 2PAFA 5FJJA 2CFCA 1U04A 1PNOA 4L9RA 4ADSG 4U02A 1OIXA 1GSHA 4RTQA 5JD5A 2HF9A 1PCXA 5E6UB 1NTOA 1JHAA 3DFZA 4HY3A 2J30A 3QSYA 4IKOA 3IBYA 5C35A 1FFXA 1HYGA 3NHUA 3R5DA 4H35A 2QM7A 4ZOBA 4PBRA 3ZDZB 5ECYA 2EP7A 4KVZA 5C1OA 3OUZA 1SCUA 3V8BA 4CMBA 1O6FA 1PR3A 2ADFA 3EQZA 4TXMA 5M5BA 2BFEB 1L2TA 2OFWA 2X58A 4G1FA 4R1MA 4YRGA 1TZ2A 4DCSA 4EY5A 4GPTA 3S1AA 5A5FA 2OUKA 4ZRMA 4HLNA 2JA1A 3O4GA 1EPUA 5AXCA 5D87A 4AL4A 4BO5A 3I5AA 4G0UA 1V4NA 4KWHA 421PA 2Q6IA 4GE0A 1QFSA 4CMCA 4LV6A 3SSAA 1T2CA 2ZVPX 2QT1A 4MEBA 4GH5A 3QWIA 4MKXA 2WF7A 5EWJB 2C2OA 1E1RA 2I1WA 3PX7A 2VO1A 4J43A 2FDRA 1MH9A 2GCGA 3JD3A 1LWNA 1W85A 4EFLA 1PG0A 3CS3A 4PWYA 1BXRB 1Z07A 5F3WB 2X4DA 5H68A 1UBOS 3PQCA 4WKOA 2OCPA 2FQWA 4LCJA 3RLIA 2D1QA 1LTHR 3T5GA 4RY2A 5CDYA 3GP3A 3QIAA 1J07A 1USIA 4KJZA 3UUGA 2R8OA 2MSWA 3N0XA 2I9KA 1YJXA 1XTSA 1V9CA 2EEZA 4XB6B 2FX2A 4FLFA 3SXPA 3RC2A 2UZ4A 3QMMA 3VTKA 2FMTA 1C30B 4EHJA 3AF3A 4KV7A 1TVEA 2JZNA 1Y6GA 4F7WA 1Z0FA 2HHLA 3ORRA 4FR0A 5CDFE 4K8RB 2IEBA 1SURA 3I8OA 4TYPA 2FWIA 2ARKA 4CV3A 2VH1A 3UFXB 2WR8A 4NE9A 5KVVA 3CSUA 4D8VA 4BQEA 2XKKA 1NI3A 3CBQA 1CY7A 1YZNA 2FQYA 4OXXA 2ZBPA 4MR7B 2V0CA 4OP1A 3ZWOA 1ZUWA 3KS9A 2P2NA 1JHRA 1JA0A 1U3GA 2VQ3A 1T0BA 3OPXA 3K05A 3PWTA 3BCUA 3N6VA 3BDIA 3TJRA 4B3RB 3GMDA 4IY1A 1TTTA 3R7AA 1Z2PX 1IFXA 3P0EA 1N2ZA 3QU7A 4I5DA 4MP6A 3FVVA 4G9BA 2B2NA 1TVKA 5B7QA 2YJ5A 2JA2A 2X2PA 2RHTA 4GF5A 3SLGA 4BMXA 4DC9A 5GZ6A 1S4MA 5TEVA 1KF0A 1XI2A 1EFRA 2LE0A 3L8CA 3NPAA 2PD4A 4GPAA 3V3KA 1NXOA 3KZCA 4Q4HB 2UVOA 4TV9B 1WUKS 2OYRA 1G8PA 3QKIA 3T15A 3UB4A 1VJGA 1JKXA 1CUIA 1P0MA 2XNHA 2R6CA 4KFCA 1E3MA 1NSTA 4J3JA 4KMMA 3VE5A 4FKDA 1PT8A 1V1MA 1YTLA 2R66A 4MRNA 2PR7A 4X8OA 4U63A 4XDHA 2QWXA 1K0FA 2BHLA 3R5JA 2GN4A 4GI2A 5BWBA 1SXJB 1VI5A 3F5FA 1Z6TA 1Y33E 2NPFA 1T2NA 3RS0A 3T7EA 3A1CA 3RS5A 4X20A 2JLBA 3QYJA 4HEHA 4E3ZA 3PFKA 3JQDA 1KK2A 2IKQA 3MHPA 2OO5C 2OXIA 3DMNA 1YUMA 3FNIA 1O96A 4X71A 1CQZA 3PPIA 4JT2A 3SCZA 4CIAA 2Q1TA 3CY6A 4UMFA 4PQYA 5FPYA 5B1YA 5JJBA 4BCCA 2K5UA 4OHUA 4EO7A 4WLNA 3KEQA 4KXWA 1UUCA 2LWIA 1E0JA 4LZNA 2Z3WA 4REMA 1X13A 4IV5A 4YIKA 4WLOA 1Q21A 5EIBC 4YQEA 5CCDA 4EI9A 2O54A 3EH2A 4J0KA 4X91A 5JVDB 3UXMA 1VC2A 1Z08A 3RSLA 1CR0A 4M0LA 1SD1A 2WLTA 4A5OA 4BO4A 3GQBA 1E2FA 1PJ2A 2ONJA 4IUDS 5COQA 4RDXA 2NP7A 4CR6A 1J5XA 1EFCA 1TU4A 2H5IA 3DWGA 3PDWA 4XX0B 2B4TO 1TUSA 2AYYA 5AM0A 1I14A 3F3MA 2VT7A 3TM5A 3JYPA 2DH6A 1MPTA 1GKLA 4ZZ3A 5K0NA 2QNRA 3BRSA 2FEWB 3WMRA 4DUPA 5KC9A 3MWEA 4ANFA 4JP2A 3Q7IA 3OZAA 2AYZA 5AVRA 4MRSA 3ZDDA 3RSSA 1UDAA 3RS3A 5B3KA 3CINA 1XQYA 4DG9A 2FPUA 2OD7A 1NPTO 1DRUA 2CDRA 3GR6A 1XZCA 1EYZA 1NPDA 1Z2NX 2B1IA 2WE8A 2YWJA 3JPWA 3QHAA 5AKIA 5G4KA 3ZTYA 4DCPA 3I62A 1DKMA 1UMDA 4X5OA 5BV7A 1NVXQ 1QZ3A 7MDHA 2SECE 2JI7A 4RW0A 1UANA 1B8UA 2UZ3A 2D2FA 2YNMA 2O7SA 3FC3A 3R09A 4HEA1 1IHXA 3DPUA 1KORA 2AFIB 2Y0PA 1CT2I 4PZEA 3FDIA 1AA9A 4N0EA 2F3RA 1G6OA 2VHXA 3IA2A 3MERA 4L6AA 4HEJA 3TLYA 2X2FA 3V8QA 4U4AA 5DP2A 3VHQA 2AC2A 3N53A 4CLRA 1MOSA 1TK9A 3FLBA 2N3ZA 3W2IA 4HUQB 2QD2A 1JBKA 3L8YA 1YZVA 3KSRA 1OYYA 2P2SA 3NDRA 1H8ED 1B1CA 2VHZA 4IIJF 4DSUA 5EAIA 4WKGA 4BLWA 4PNHA 4ER0A 5YASA 4NEHB 1Q0TA 3QYAA 3WYFA 1BC5A 1SKAA 2HCJB 4PG8A 3AM1A 3F5MA 1QQ7A 1G3QA 2HMYB 1DS6A 4K87A 4XUEA 5CPBA 1LPAB 2XZTA 2JLYA 2PRKA 2ZTHA 4YO7A 4I1PA 2BFBB 3ZQ4A 4JJ8A 3D6JA 5FXMA 5ICGA 2ODWA 1GADO 1EFDN 4JI8B 3B36A 3LQYA 3CC8A 2GRUA 5T6BA 1KL7A 4LMRA 1N2IA 1C5KA 2OBFA 1PGQA 4HR7A 5I4BA 4PCVA 2QGFA 1V2GA 1V4BA 2JIPA 2DUMA 2G17A 1WPQA 4MAFA 3E7PA 1EM8B 1LEHA 2C4MA 2I8LA 2R25B 2XUIA 3AGPA 1JEOA 1EXNA 2PFGA 4HL6A 4XVQA 3G88A 5K8JB 1VJDA 1F3LA 2HWKA 2X40A 1IVNA 3EN0A 1EGQA 1G16A 3LKDA 4IDPA 4R84A 4RPJA 1JFRA 1ZC3A 1M1YB 5EP3A 3TMKA 3UOGA 1SVLA 1BVHA 1ZX1A 1KDOA 3G8BA 1MJBA 5HZKA 1AQIA 1HYEA 4JI0B 5AUPB 121PA 3LBAA 4JJKA 4QASA 4MKGA 4RTMA 1QTIA 3CX3A 4ZYLA 2VK4A 1WU8A 2I03A 3JAWB 2A3NA 4JSRA 1HF3A 1JIKA 1PQ4A 1G17A 3HP4A 1K0UA 2Z4TA 1DTEA 4YUZA 4R5MA 1TURA 1XZDA 2XHZA 4M0UA 4C20A 4HQRA 4CU2A 3B12A 1E1YA 1W8DA 2R87A 4LXXA 2VKTA 2YH2A 1QRAA 4R7ZA 2YVUA 3ABSB 2Z98A 5KC8A 2XSZA 3QUSA 2ZEJA 621PA 5AICA 1EFLA 3LHSA 2AXEA 4M6WB 2CWGA 3SOZA 2R6JA 4C6RA 4BGUA 1J06A 3B6MA 1PEYA 3DTTA 3VR6H 1MPXA 2V03A 4WCVA 2DLDA 2QT9A 4L78A 1H1DA 1KIMA 2VXYA 4D3SA 2IXFA 3E82A 3LZ6A 4HUJA 4LBZA 4CCYB 1DS3I 1I1HA 3COVA 4EHIA 1F7UA 3DZKA 1QF7A 5T4FA 1ZINA 4BJ3A 3ONWA 4B83A 5AKLA 1J49A 4PXAA 3UGJA 2QTLA 2QW0X 5GADl 4C7VA 1T9GR 2O8BA 1RKBA 1ORRA 4RZUA 4J1NA 4QNRA 4US0R 4LAFA 3VR3A 5DLQC 2X9VA 4OU5A 3WA6A 3FYUB 2EGGA 1TOAA 3M6LA 4WBNF 2H7CA 3G0OA 4HXEB 4INAA 2WMDA 2ZJ7A 4WERA 5G02A 1UBSB 2AKEA 2LDBA 1B6RA 3F6SA 1WY7A 3FA2A 4K9DA 3ZQUA 3OE5A 1Q57A 3BB4A 2C7GA 4M76B 2G3YA 2O4UX 1Y5IA 5B3JA 2OCGA 3FCCA 4NU6A 4PVCA 1YDFA 4IDBA 1G59A 5BWOA 4K05A 5EZQA 2OG2A 1CT9A 3KT8A 3L3BA 4U1RA 5BT8A 3GYGA 4PGMA 4LGVA 4YVFA 1BRMA 3DLTA 2J6BA 4PPNA 4PZZA 4PZ9A 4C08A 1T10A 3T5AA 3AMVA 3IT2A 3D2AA 2IGTA 2YZMA 3OZEA 5CBPB 2DPGA 2VSNA 3KFLA 3WIDA 5JQGF 3G9TA 1B6GA 1YHNA 2DECA 2PFSA 3K0AB 5CXSA 1EUCB 1V3VA 1GUDA 1QCZA 3DAPA 1YL6A 4E2WA 1NYTA 3F74A 1RBMA 1KI4A 2FQXA 3DXFA 1K06A 4MUJA 1YL5A 3V9PA 3FJOA 4WNAB 2LKCA 4KN9S 3D2CA 1TTPB 3F6BX 3QPCA 5HXAA 3FNGA 3U6KA 1FP4B 1G7RA 4OGGA 3WO0A 4ZDWA 5THXA 2NU8B 3FF1A 1XL0A 3UK6A 1XHFA 3QLVA 2X42A 4G1EB 1W1UA 3GJ0A 3LOPA 4RMHA 1DV1A 4RVUA 4QLOA 3REQB 5AKZA 1QGUB 1JTFA 2OLEA 4C4OA 3BMQA 4ER6A 3ECCA 5HZMA 2PTHA 3K20A 1XK6A 2AQIA 4UNSA 1RM4A 3NHMA 4YAWA 3RYFA 5A9SA 2QYSA 3AF4A 3GOQA 3ROQA 3ZHRA 3R20A 3NJRA 1QJCA 1SHZA 2JHFA 2VJPA 2ZVJA 3JYHA 3BG5A 4Q6WA 1XTZA 4E94A 2WYHA 2YS7A 4WT7A 4C2TA 1NY5A 1BXGB 3WBKA 1K88A 1XCJA 4OQFA 4UAJA 3C48A 1ZL0A 1ESNA 4ABYA 1FLDA 1SXJD 4WUVA 4X6LA 4D3YA 1YQDA 1ECJA 2C5BA 2XITA 5C34B 3AYZB 4JITA 1UIRA 2NP6A 1DAMA 2C8JA 3VO2A 4HQFA 2DHRA 4MULA 4O4LF 5DGDA 3TAXA 2W70A 1TK3A 1WPGA 3GD7A 1NU6A 1XLTA 2PUDA 3IR5A 1CR6A 2CB0A 4A03A 1E3EA 1QHXA 2CCKA 3I4LA 1ZMBA 1Y3AA 3ZZTA 2QRUA 2ZRJA 3J81k 1U2SA 3LY8A 4TOIA 3IULA 4HJXA 1R16A 2KMLA 1JI3A 4R2XA 3AB7A 4TLMB 3B5EA 4HRAA 1ZD2P 2XCRB 3ZQKA 1Z5GA 1UPBA 3BORA 1G8KA 2PGLA 4O5AA 4PFKA 5DF1A 3BERA 5FL3A 1ID1A 3GFGA 4TTRA 1MD9A 4XI9A 1XZQA 2REBA 3U4QA 2P4HX 1PFYA 4DEXA 3KZVA 4OVKA 4MI6A 3AF6A 4FGZA 4J91A 2QLNA 4UU7A 5TQ0B 4AICA 3GPCA 3V1MA 4AY2A 3D4NA 5K3FA 3CLRC 3JRXA 4RJJA 3TR5A 1K6MA 1DCKA 2H57A 5JIBA 4LFAB 4GQAA 3GGJA 2O5VA 5JE8A 4KXQA 2J0UA 3TRKA 4IV8A 4PC2A 3T9FA 4GP7A 3C8HA 4K26A 3VDRA 2C9MA 3KFXA 3FOWA 3L0OA 4DV4B 4NIMA 1ZOLA 4ZT2A 2R6HA 3ZD6A 1SQGA 2ROQA 1TDJA 5DBIA 5I47A 3PEFA 4EJSB 3QXCA 3WK9A 3JU3A 3OJWA 5KQSA 5F12A 1ODKA 3MWLA 2WFZA 4K28A 4OBXA 1ZH4A 2I33A 3HB4X 2YMMA 4P7KA 4QJBA 3RBAA 5BPHA 4NK5A 2VZ9A 5BSVA 2QMHA 3DWEX 3P96A 1HNXB 5BYJA 4M0EA 1GLVA 4GX5A 4G8JA 4QPJC 4QM6A 2QSYA 3IEVA 1RWMA 3NZEA 4P4TA 2CFIA 2VDWA 4GYJA 1Q7BA 3TECE 1JJ7A 2ZSUA 3CWZA 3D1LA 5B2FA 5I51A 3G17A 1WLSA 3LVRE 4IGKA 1ONNA 4OJTA 1YFZA 2I3AA 2UUOA 4TROA 2ESRA 3ZQJA 1WBBA 4PYMA 5KSZA 1P75A 4P0PB 5TPWA 3MWGA 4BKMA 4XEHA 4P7FA 2XIQA 2Z43A 5FOWA 2CXXA 1SPBS 1UKCA 1NRJB 3JQAA 3P9CA 1IUNA 2B6HA 1U8TA 2INGX 3R75A 4GM1A 2RHWA 4CRWB 1QVAA 1L5QA 1R50A 2Q07A 2R7NA 5BUSA 2JLVA 5IDXA 4PR3A 1C1HA 1FQKA 3N8IA 1HE3A 1O7JA 1OJLA 3GMIA 4OQZA 5DN6A 5T3UA 5JS7A 3AEKA 1NJ6A 4FLEA 1GT91 3OU6A 1D2NA 4INPA 4CEHB 1HLPA 5IDQA 1YU6C 1VE5A 4OB6A 5DIZA 3SK0A 2R2GA 1MLDA 5HQ3A 1N7IA 1E96A 3HVUA 4BWGA 2JHCA 1T8PA 4YRRA 1MDFA 1JDZA 4P82A 5IVPA 2FZVA 3O38A 3ND7A 4PX3A 2V9CA 1S2GA 1WKBA 3MAGA 3ZZNA 2Y4NA 5B6JA 1HOTA 2OE2A 3JWGA 5LA6A 1E1LA 3ILSA 2IU0A 1CDZA 1WTJA 1N5IA 2I6FA 3F3KA 4J4BA 4EGFA 5CA1F 1F8GA 1I13A 1IZYA 2A78A 1VBKA 3ZHZA 1Q1ZA 3QA3E 1SQSA 1R79A 2DB6A 2WIBA 2E4UA 1WZNA 3EY4A 3VR2D 1NA5A 3I01A 4G0ZA 3KEMA 4GKBA 3ZEIA 1UOEA 3TO9A 1LJLA 1JR2A 4KP7A 5DLYA 3L0IB 1AKMA 2VBCA 4GL2A 2XRZA 2F1JA 4ME6A 3QH4A 4EY3A 1XWIA 2QMEA 3A9CA 1QVVA 4FKMA 4HAIA 3VISA 4ZI5A 3WYEA 4IVNA 1U8UA 3VH2A 3QSGA 4MGHA 3QAHA 1QF6A 3L8EA 2IJGX 4BO9A 3LK6A 2O5EA 1DGQA 3KEGA 4B84A 4ND4A 4MCIA 2P6NA 1A98A 1OFTA 3ODPA 1IW4A 1YVUA 3P0RA 2B4RO 3NJ8A 4COOA 1EVZA 5BQXA 3EUEA 4DA8A 1I8TA 4PRYA 4R98A 5KI6A 3F4LA 3ZWYA 1QZTA 5I7AA 5IBCA 3NGXA 2I66A 4ZA2A 3QGMA 3W9BA 3D8BA 2A14A 1RW4A 4IV0A 3BUSA 3GLHB 2GAOA 2JAUA 5K3SA 5LD2C 1RADA 1MHPA 2PT9A 3OLVA 2C97A 3PCTA 1E89A 1TFUA 3QXSA 1P62B 3GGCA 1HFWA 4UQOA 2WT8A 4YJFB 3U0VA 3W5SA 3N2GB 2Q3LA 3SJZA 1OROA 1IY6A 5ES3A 1N2BA 1YB2A 2LIVA 3BXEA 4PSCA 1H2WA 3BFJA 3H3XA 5DCUA 1KZ1A 1H23A 2GFHA 5EI5A 5DLEA 2XB2A 3JAKA 2B8EA 4GPIB 1YZ3A 4ZVSA 2NXCA 4YASA 1IN5A 1WHSA 4ITVA 4KBYA 4QL3A 4WN9B 4ZU6X 1LS6A 1X7HA 4XGQA 2B35A 4NVRA 3ISJA 3VVBA 2HOQA 5KTMA 3CVYA 1SXIA 2P9HA 2QTVA 1OX4A 2BJVA 2QR3A 2QPTA 5FNVB 3GNTA 4KR9A 3EZXA 4RS4A 3GT7A 4ZQBA 4A8PA 3SQDA 1JTVA 2AMJA 2M2IA 4L22A 4A6PA 2BKXA 2XA1A 1W4RA 3GDWA 5B4TA 4ZYZA 2BELA 2PZAA 3E5MA 2FNFX 3A06A 4JYCA 3GG9A 5KYKA 3ICEA 2Y0BA 3M4ZA 1KVQA 3WDMA 1ZAYA 5FI1B 2ORWA 5DGXA 1V2HE 5A02A 1CHDA 1GL9B 2HF7A 2Q2VA 3KQVA 2DU8A 3FOAA 2I87A 1DV2A 2BL4A 2PDAA 1ZUIA 1AN9A 1NC3A 2I8CA 1XMVA 1SB8A 1QP4A 4UBOA 2JATA 4KDCA 3HABA 4XD7A 3D31A 5BRNA 2XGJA 1R9MA 1VSBA 3KTAA 3LC2O 3O26A 5EG5A 1BS9A 1OILA 2HHCA 3MB5A 1G41A 3OT1A 4HQ0A 1GL7A 4L57A 3MGKA 2CHGA 1I2ZA 2QL7A 4OSPA 3TVDA 5IXYA 5AJZA 4UHKA 1YU9A 3LJKA 4G67A 5L7YA 3CZMA 1VE6A 4FFNA 3QWPA 4I46A 3ZG6A 4C4XA 5DHSA 4KSBA 2F4VB 1F8YA 1I6MA 3EAGA 3I92A 1I30A 1HA3A 3HUUA 2REQB 1T9HA 5TF4A 1TFRA 2H1SA 4D5GA 5LQMA 2H2GA 2ENUA 1QYDA 2XOKD 4L8WB 4PW0A 5D00A 1E4OA 3EISA 1KFBB 4WADA 1Q74A 5G1NA 1US8A 2X1VA 1N9GA 3K09C 4KO3S 4NOJA 3EGWA 4YAIA 1GZ5A 2UUPA 5HUJA 4O4HA 2HCRA 2OZEA 2FJ0A 1CHOI 1RVDA 2NUPA 2FMFA 3R2JA 1BXZA 4GW3A 3I2YX 2ZIAA 4S1TA 2B7CA 3T3EA 4AO6A 2DFKB 3D3KA 2D62A 1XKQA 3SYNA 1VZ2A 5LP6F 1GR1A 2F7SA 1C7EA 3KXDA 3PHBE 4MWEA 1M34B 2FFAA 1DWUA 4FE4A 3DA8A 3QBVA 4RF3A 3ZDFA 3ZHVA 4MYDA 1HQYE 1XMSA