2JA1A

Thymidine kinase from b. cereus with ttp bound as phosphate donor.
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
193
structure length
193
Chain Sequence
GSMYLINQNGWIEVICGSMFSGKSEELIRRVRRTQFAKQHAIVFKPCIDNRYSEEDVVSHNGLKVKAVPVSASKDIFEHITEELDVIAIDEVQFFDGDIVEVVQVLANRGYRVIVAGLDQDFRGLPFGQVPQLMAIAEHVTKLQAVCSVCGSPASRTQRLIDGEPAAFDDPIILVGASESYEPRCRHCHAVPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THYMIDINE KINASE
publication title Structural Studies of Thymidine Kinases from Bacillus Anthracis and Bacillus Cereus Provide Insights Into Quaternary Structure and Conformational Changes Upon Substrate Binding
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Transferase
total genus 49
structure length 193
sequence length 193
ec nomenclature ec 2.7.1.21: Thymidine kinase.
pdb deposition date 2006-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00265 TK Thymidine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2ja1A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2ja1A01
3EIHA 1TL7C 3OE7A 3LV8A 4IVRA 4B3XA 4WBSA 4AYWA 1P9RA 2RGNA 5IT5A 2XEXA 1AS2A 3CRQA 3VR2A 2PMDA 1H8HD 2PEZA 3GJ0A 4MGYR 2QPOA 3QKSA 3SS8A 3GFPA 2QENA 5HCIA 4PO9A 4CEIB 1S3GA 4ABYA 5AJVB 1U90A 2A5DA 2C2HA 3WNDA 1XEXA 3L8YA 1T8UA 2WMOB 3Q3JB 4YXWA 2XJ9A 4PAMA 2WIBA 3E1SA 4JSYA 2ONJA 2IF0A 1DAKA 3W34A 3SFVA 1SXJD 2ZRGA 3HJNA 2W6JD 2D4HA 3K0FA 4PSVA 1G17A 2YHSA 1OH8A 3ASYA 4UQOA 1NVWQ 3PQCA 1KK0A 1J2JA 1E69A 2IYVA 3DHWC 3ZD6A 1Q3HA 3FHTA 1XCGB 1KNXA 4XH9B 1J8YF 1U98A 2Q3HA 4XSHA 5C18A 3NIBA 3U3OA 5JBQA 1T8TA 3A4LA 5AJZA 1NJFA 1ZNZA 2WM9B 3EG5A 2IXFA 3CUEF 3O47A 5DI3A 2GKSA 1ODFA 1YR7A 1ZU4A 3RC3A 2G3YA 3AF3A 5JI2E 3MJRA 4TZ0A 2ECKA 1E9EA 4IXMA 2VPPA 1NSFA 5AJWA 1NVVR 2J0QA 4F4JA 5EUMA 2XOKD 1AK2A 3HR7A 4Q1CA 5LB4A 3IGFA 2C03A 3DMDA 1OIWA 4HB3A 4XVRA 2ZRPA 3FVQA 2OT3B 2GJ8A 2NMVA 4Q7KA 2C9YA 5IHPA 4FMDF 2XNSA 3BFXA 1PLLA 4BWYA 3Q5DA 4PFSA 1KMHA 1M7GA 1K6MA 4ZCIA 2ZRCA 5JEDA 1FW6A 2J7KA 4HAYA 4QGGA 4DIEA 2WWHA 4H9GA 3CM0A 1SKYE 2BCGY 3T35A 3LBNA 4W5JA 3CNNA 4NMMA 5FR1A 1S2MA 2NO0A 5FTJA 3MJHA 2OBLA 1G7CA 1G3QA 3H2YA 1S1CA 3NXSA 3CR7A 4NH0A 1KK1A 2EU8A 4JL5A 4ZIRB 4RD3A 5DNYB 1D2NA 3ADBA 3CRVA 4C2UA 1W4AA 4HI0E 5FI1B 4D25A 4R2HA 1XTSA 2QAGC 1N6KA 2ODEA 1R2QA 4KVGA 2EFCB 4G01B 4IEIA 4NYMR 2F55A 4D0LB 3PEWA 1Z5ZA 1Z0AA 2G88A 3K0FB 4M22A 2A2ZA 2WWGA 5FTNA 2OILA 3K70B 5FR2A 1N5IA 2CXXA 3LXXA 4GPTA 1W2GA 2VIIA 1DAMA 4RSGA 3WHKA 4OQNA 4DCNA 2FFHA 4HUTA 3TK1A 2OXCA 2JEOA 2O0KA 1H8EA 5CM9C 2NO1A 4X8MA 3CWQA 3H86A 2OLJA 2HF9A 3FE2A 1N5KA 1CU1A 4FCVA 3AM1A 1KI6A 3OEHA 1SVOA 1GL9B 4Q1AA 4Q5IA 4TMTA 5FBRB 4BZQA 4DT1B 4GDFA 2I1VB 4LHXA 2X77A 1FQKA 3I5YA 3WYAA 1P3JA 3AQ4A 3O8CA 4XTRA 1U0JA 1BMFD 2JDIA 2AK2A 4C0SA 1KHTA 2CLDX 4WOPA 1G4UR 4M0LA 2J7PD 4RKFA 3LDAA 1P4SA 2XTNA 1II0A 3FKSD 2A5JA 1Q20A 3NKVA 4LY6A 5CJ2A 5H8WA 4FWIB 3VKGA 2IYXA 5DN6D 4D0GA 3CWZA 1AZSC 1P2UA 2BBSA 1G20E 2OFWA 4GP7A 4C2TA 3AP1A 3DO6A 2J5XA 4P4TA 5DSZA 3ZQJA 2P3SA 4BQSA 1Q57A 4DSUA 4TTRA 4LRWA 1WRBA 3BBPA 5FOXA 1P73A 2GXSA 2VP2A 4PAOA 5AUPB 1XD2B 3AVVA 1N6OA 1CF4A 1G1MA 2FNAA 4RVCA 2H8KA 2IXEA 2FDCA 4JT2A 1WXQA 3V00A 3UGLA 3BC1A 1E9RA 3ZJYA 1RW4A 2WJJA 1Y8FA 3KL4A 2VRWA 3DM5A 2P6RA 4Y0AA 4A1FA 2CL7X 1ZAKA 5FPTA 1Z47A 5JCPA 1OFHA 1FMJA 1X8JA 1FZQA 4OHXA 4PSAA 1COWD 2YJTD 3BB4A 5GJVC 2ZITA 2EWVA 3VAAA 2I1QA 4M9ZA 4N0DA 2REBA 1NI3A 1P6XA 3FFBA 4WIAA 5CB6A 2O8FB 2IWHA 4Q02A 2QMHA 4KFSA 3DL0A 4JKIA 2VTKA 2W0MA 4C9BA 1HTWA 3U3MA 4GT1A 1LVGA 2V1XA 3AF4A 1NLZA 3AKCA 4KITB 3SZRA 4DSTA 1GKYA 3VR5A 3MGCA 4JMPA 3F0TA 4LX0A 2WJGA 1KY3A 2GF9A 2DCUA 3A4NA 4IEEA 5EXSA 2GVDC 4NU0A 2R62A 3EPJA 4H1VA 3L0OA 2CNWA 1RRGA 1XXHA 1G19A 4ESHA 1UKEA 5BWMA 2MSDB 3X1WA 4C0HA 1XEWY 1NG1A 1M2OB 2F7SA 1G4AE 2KE5A 2JLVA 1MRNA 4Q1FA 2DBYA 2Q9BA 2AR7A 3GEEA 2GJ9A 3LAWA 4N3NA 2ODNA 5AJYA 1A4RA 1GOTA 5B57C 5FBVB 4A0RA 1YR6A 4XSGA 1QVAA 4D4MA 4JLKA 1SVLA 5EQTA 4KHZA 3RS5A 1EFHA 1TF5A 2FNFX 4Q7MB 3RDPA 4D2IA 3OEEA 5G3ZA 2CVHA 1TX4B 2J46A 3L0IB 5GJWC 2FZLA 2NG1A 4Z51A 5C46F 5KO2A 1U94A 1IN4A 1YQTA 3A37A 5HTKA 1ZM3A 5A0FA 3K70C 2WSSA 4MRVA 5M04A 4L16A 3P4XA 3NH6A 5DI9A 3EX7C 2HT1A 5D3MA 4LGMA 1E2IA 4OJQA 2F1HA 2F9LA 2H92A 4Z8XA 3RRNA 4JLVA 4CF7A 1NLYA 5IK2D 2WPDA 1E9DA 3W6OA 5HKKD 2DYKA 1YZGA 3QPVA 4KODA 4LJ8A 4FINA 3THOA 3LX8A 4MGZR 4PHGA 3SJBA 2BMFA 1QHXA 3RNLA 1W7AA 2Q21A 1DTSA 3U44A 1T9HA 4QHYA 4E5UA 2DWOA 2ZM5A 1Z0DA 2JLRA 4IXNA 3PJRA 4POAA 3BORA 1YR8A 4LHZA 3DDCA 4NCHA 2JJ2A 4TMKA 5D3QA 3B1WA 4F93B 4PZLA 1UKVY 3VR6A 3QPWA 1UEJA 3CRW1 3IIKA 2IYSA 1N3BA 2CE7A 2HLDA 1KDPA 2OEPA 1SULA 2P6UA 3SHWA 4L9MA 1J99A 1G7TA 2WKPA 4F7WA 4RFVA 1KI4A 4HDQB 4P4UA 1T4GA 2RMKA 5EP1A 2QTFA 4LV5B 3Q72A 4URYR 2CJWA 4JBYA 2AD5A 2ZJOA 1C9KA 1R6BX 4ZV4A 3T5GA 1PVOA 5FTLA 2VO1A 2OBMA 1GKIA 2VP6A 2Z4SA 3RS0A 2W2XA 4ARZB 1Z0JA 3GLIB 2FZ4A 4DLVA 4Q01A 2EVWX 3TH5A 4TYPA 4E07A 1IJFA 4WZBE 1RPZA 3K0CA 4LJ4A 3OZXA 5FBWB 3GLHA 2NO7A 2XJ4A 4G3XA 2BDTA 3TE6A 3QOFA 2B21A 2FH5B 3T1QA 4NDZA 2MSEB 2BMJA 2Q6TA 4DC9A 3IEUA 1OSNA 1XEFA 4DBLC 4HLCA 2ZR7A 1P9WA 3PXGA 3P26A 4DXAA 1FPMA 4KYIB 5FOUA 1MOZA 1US8A 3FWYA 4U02A 4CRWB 3BFVA 1DAHA 3A36A 1NKTA 4TL7A 3AKDA 5KOYA 1KJYA 4M1WA 2A5YB 4RJLA 3RRYA 4TMZA 3DOEA 3UPUA 1A1VA 1KI7A 1VG9B 1ZIOA 4NCNA 2Z43A 2O8BA 1XJ0A 4Y0VA 3EXAA 2VBCA 1YZTA 1BOFA 4BRUA 1C1YA 4LWZA 4RD2A 1ZMXA 2J87A 1ZVQA 1LY1A 2Z0MA 2GCNA 3KUCA 4BPBA 1DG1G 5LDDC 2YWHA 1WQ1R 5JJLA 2KBEA 2OLKA 4X8LA 2ZXUA 5CM8B 1SVIA 4EFLA 4CT4B 4PC7A 4PPGA 2NO9A 4Q9IA 5CITA 5CB8A 2IYTA 4ZCMA 2ZJAA 2BOVA 3DEFA 1G21E 2BKEA 3EPKA 1H8HA 4M9QA 2WAXA 1JBKA 4QBIA 5FOSA 4C0LA 4Q9KA 1KY2A 1XXHE 2H7VA 2C78A 4PQRA 1KI9A 4A6XA 5FBQB 1XB2A 3S1AB 3RABA 2QT0A 3IQXA 1S1MA 3GJXC 1EK0A 4PAQA 4B6FA 1MT0A 1GP2A 1E2QA 4FCTA 3IIJA 1XD8A 2P5SA 3THYA 2RGAA 4V0OA 4JLOA 4AKGA 2JDID 3EZ9A 5HCNA 4S35A 1SXJA 1RZ3A 1TUIA 3IPYA 4HLDA 2IF2A 4DWJA 2W6JA 1WBBA 2GESA 4Q4LA 1R5OA 1LFDB 1NBME 1YZLA 4OI1A 4EFMA 2RGXA 5G40A 4E09A 1CR4A 1S9DA 1IN5A 3FB4A 1QBKC 1E2DA 3GLHB 2IYYA 4XVUA 3B1XA 3CPJB 4EQ6A 2IS2A 2XXAB 3KKNA 3MUFA 3IPXA 1F3OA 5A4JA 4UJ3A 5TMPA 1XZQA 4I1VA 3SYLA 3SNHA 3O8DA 1VECA 4FW9A 4LHVA 2JLXA 3OESA 4JZKA 2MSCB 2QP4A 2XOKA 4QGAA 4LBVA 5L3QA 2VHUA 4XOIA 2O8BB 2KI5A 2ZRLA 1U8ZA 2QROA 1II9A 4MKHA 1GUAA 3BFKA 3K0EA 4Q4HA 1XP8A 3I73A 1E79D 3K9NA 1GM5A 4DLWA 2C99A 3ADKA 4EPXA 1K8RA 2OCBA 2Y8EA 5EE5B 4MRPA 1W48A 4ZKEA 3BOSA 2EFEB 4Z8YA 1WF3A 1Z2AA 2JJ8A 2ZEJA 2WJHA 5JWOA 1VG0B 1JECA 3B2EA 3W3AA 1R4AA 5H1YA 5KNCA 4NYIR 2J41A 2KJQA 4Q4JA 3CPHA 4NE2A 3TR0A 4Q7LA 4PHFA 4DRZA 1BO6A 4M4SA 3AV0B 2R6CA 3AKYA 3G0HA 4M1TA 1T5IA 3NBXX 3MMPA 4AG5A 2GK7A 4YONB 1KOFA 3HR8A 3O8RA 2X1VA 1E9BA 5JWHA 4A36A 4NPHA 3SQWA 3RC8A 3AVPA 4IW3B 2IS4A 1W44A 1XDBA 4MYHA 3KTAA 3THYB 3LY5A 4AWXA 3ZH9B 4RCYA 4M9SA 2D7CA 5TDHA 3WYFA 3L8ZA 1NJGA 2ZRHA 3I5XA 2ODWA 2J0UA 2QPAA 2FGKA 1NRJB 3PUYA 1DAIA 2DY1A 2V9PA 1ZCBA 1EX7A 3R9XA 5FL7A 5FPYA 3CZQA 4EQ6B 3AVUA 4PC6A 1SVSA 2W00A 1E2JA 2BCJQ 4A92A 1NN0A 2GVZC 5LBIA 4U00A 1IHUA 3EZ6A 1X8LA 4KLNA 5CK5A 3BB3A 3OEED 1Z28A 3QUSA 2XB4A 3TW4A 2VP9A 4KAXA 1NG9A 4LYAA 4JVMA 2QAGA 5AWFC 4M8NE 1BMFA 3BE4A 3TKLA 1N5LA 2EFGA 1KTVA 4I1UA 1ZD8A 3ZVLA 2J7PA 3JZMA 3PFIA 4XTCS 4US2R 1GG2A 1ZNWA 3FKSA 2FGJA 1OB5A 1FOEB 3AKEA 1A7JA 2C9OA 2ZRKA 4QRHA 5DN6A 4IRUB 4GBMA 1ZP6A 2V6IA 4LSGA 4BFVA 3HDTA 2NO6A 1A2BA 2NQ2C 3CH5A 5JCZA 1CIPA 1F2UB 1FQJA 2QQ0A 2LKDA 2OHFA 2H57A 2WJYA 4RZ3A 4CZ2A 1KBEA 1QHHA 2BIFA 4EFNA 3WNBA 3EAQA 821PA 1PV4A 2FG5A 2BM1A 4B2IA 1Z0FA 3EZ2A 4YMSA 3UXMA 2O5VA 1CJTC 3K0CC 4URUR 2VP0A 4DDWA 5CIQA 4H1UA 2FPMA 1Q1QA 1R0YA 3BB1A 2HLDD 4Q19A 1SXJE 4B75A 5G41A 2AXPA 3KTAB 1HE1C 4NCIA 1NKSA 1ZD1A 1CKEA 4BFXA 2ZYWX 3BXZA 4KXFB 3B1YA 4A15A 3P4YA 3PEYA 3UMRA 5JJIA 2OCYC 3JVVA 5C4GB 4UNNA 1ZCAA 1ZYUA 1GAJA 3VNUA 3FMOB 1E2PA 5JJKA 1EESA 2PL3A 4B76A 3C16C 5FUXA 1X6VA 4B2PA 2W2TA 4MKIA 4GRAA 2ERXA 1DADA 1BIFA 2N42A 2OFOA 3KXIA 2OZEA 1Z3IX 3MAAC 4DLRA 1ZW6A 1G6OA 5EXPA 2BV3A 4TL8A 2Z83A 4Q4AA 4A82A 4TYWA 1O3YA 1W46A 2AL7A 5IDVA 2P5TB 3IHWA 3L0SA 1P2VA 5J4KA 1AZTA 1JEEA 3CPEA 2QN6A 3QI2A 2J3EA 1TTTA 2ZSFA 3N2EA 3KKQA 1R5NA 2PZEA 1Q1ZA 1CLUA 3UMFA 4C30A 3U7EB 2QBYA 1UEIA 4IOJA 4OHYA 1J70A 3BERA 3U2QA 3I4LA 4QJ5A 4ZDKA 1R7RA 3FTQA 2IYWA 1OH5A 4CGZA 1P72A 4GSYA 2OAQ1 2HJVA 2WSMA 2AXNA 3AF0A 3B8HA 1H65A 1TQ6A 1BS1A 4MDEA 4O0MA 5HE8A 2JJ1A 1B23P 3GJ7A 4MYCA 1UBEA 4JBXA 2ERYA 2AHOA 2YV5A 4DDTA 4MUBA 3EZFA 5HR5A 2ROWA 2V3CC 1G8HA 2IX3A 4P0TA 4IVQA 4PC3A 3GLFE 2V54A 5IK2A 2YWEA 3RWMB 3AEZA 2QZ4A 2YOFA 5JSZA 2AK3A 4ZIRA 3I8SA 5HKKA 3SJZA 2RCNA 3LW8A 1Y63A 5KHOC 3IKJA 1VHLA 4P32A 1GRRA 4PZZA 1CRQA 1BKDR 1OT3A 2C04A 1KK3A 3GD7A 1S3SA 1HH4A 1VG8A 3QIAA 4B32A 2FPKA 1VYTA 2XTZA 3LH5A 5J4VA 2IW3A 4BFTA 3EPLA 1MO4A 1OXXK 4PR0A 4LJ7A 4TTQA 2IYLD 1Q1BA 2ONKA 5BXQC 1SQ5A 2GA8A 5C4MA 1D8TA 4RY2A 4ASUD 2OE2A 1KO8A 5BYJA 4Q4AB 3U3RA 4DSOA 1IJEA 2JASA 4JLBA 1RE0A 2WOOA 1NY5A 1MO3A 1CJMA 4IDOA 4LV6A 4TL6A 1V43A 3ECCA 4GZMA 3KQUA 2WZQA 5LD2B 1E2GA 1KO4A 1WCV1 3QEJA 1NMZA 3UFFA 5JZVA 2ZE8A 5SZKB 2EFDB 1G7SA 2W2VA 4DT1A 1W1WA 1E0JA 2HDNB 2HXYA 5E7IA 1FP6A 2CLCX 1T0HB 3K0AB 1V5WA 5JHHB 4BZPA 2QBYB 1KI1A 1VDZA 1XMIA 1IOZA 3H84A 1RYHA 1I2DA 5FPSA 2GZAA 1OFTA 4D6PA 3QF4B 4EPTA 2VH5R 4CDGA 3C15C 4Q1BA 1E9FA 1W5SA 5FFMA 2ENNA 4BGDA 3SHFA 1Z6AA 2XX3A 3THXB 3RSLA 1JXOA 4NONA 3SYKA 3U4QB 2ZSBA 2W83A 2GETA 1NN1A 1U99A 4G5SA 4BLQA 4EPRA 2F43A 2JLSA 4BUJA 1G5RA 2O8EA 4R7ZA 3RVBA 1GFIA 3K1JA 3RS3A 3ZIAA 1W36B 1GZSA 1XD2A 4US0R 1YR9A 4V0MA 1KI2A 1RJ9A 3LWNA 1M1YE 2NIPA 4DCTA 1P5ZB 4XJXA 2ZRAA 5JSZB 1ZINA 4TMVA 4HAUA 4TLBA 3A4MA 1L4UA 1E9CA 1F2TA 2DR3A 4WZAE 4EAQA 4DEXA 3VTKA 3K0SA 5F9HA 1QHSA 4YQFA 1R0WA 2ZROA 1UBGA 2YUUA 1FL9A 4JJKA 3GEIA 1DE0A 2KB0A 2A9KA 3HYRA 5DH9A 5DYGA 4OHVA 1FP7A 1P60A 2VLIA 2E1RA 4G0NA 2VHTA 3GJ4A 1QHNA 4PZYA 2IWRA 3RWOA 1LNZA 4GOKA 1OH6A 1GL6A 2O8FA 2GEVA 1XBTA 2P6NA 2RHDA 2ZU0C 4B71A 1UBFA 3LBIA 1KMQA 4M1SA 2UZ3A 1XCPA 1TMKA 4XWOA 2ZVPX 3BJIC 2ZSAA 5FL7D 2ZETA 4NBSA 1DAEA 4Q1DA 4TLEA 4N0EA 2GNOA 4KSCA 4O25A 4V02A 4D26A 4KV9A 1NF3A 3SE0A 1N6RA 3MWKA 1P61B 4NYJQ 1RKBA 1HQCA 2G77B 2GJAA 4TYQA 2EYQA 4OQFA 1E0KA 1P9NA 3C8UA 1Z06A 4TMXA 3PV0A 2QAJA 4B48A 5FOTA 8OHMA 4QBGB 2GVIA 4JLJA 3T06B 3B7GA 2XGJA 4DLXA 1FNNA 2ATXA 1D9XA 3RLFA 2ASEA 1AN0A 4B3DA 1T0JB 3M4YA 4B34A 5L3SB 5EZ6B 1CRPA 3R20A 4GMDA 4NTZA 1CR0A 1PUIA 2C9CA 2BM0A 1OYYA 3QY0A 3W6PA 1TQ2A 5JWRA 4AKEA 1E4YA 3P27A 1OFUX 2ZAMA 4KVAA 5AUQA 1Q0UA 3U3JA 3ZLJA 2GCOA 2F43B 3NBZC 2O8EB 1FX0B 5GJCA 2FSFA 1G3IA 2AD1A 3M1IA 2OBNA 5E7MA 4HB2A 1RJ9B 4F4IA 2FEMA 4G5QA 4BLRA 1W4RA 1P62B 4PQFA 2HCBA 2BBWA 2OXRA 3REFA 2R65A 3OIVA 2C77A 1F2TB 2R6FA 3BH6A 2D06A 4DIDA 1G64A 1E79A 1QHYA 5LD2C 2CMKA 4PPFA 2ELIA 2HV8A 4LBYA 3ZS8A 2HUPA 3IUYA 4JVLA 2YINC 1JR6A 3NEYA 3GJ5A 3FGNA 1UFQA 3N70A 2RGDA 1G3MA 4LJAA 5FBLB 4DHEA 3ZVRA 1ZBDA 2PCJA 3IEVA 1W5TA 1P2TA 4R9UC 2G6BA 4AI6A 1KSHA 1W49A 4OJKA 2CCKA 3I61A 2PJRA 2RGBA 3NHBA 4R2IA 4TZ6A 3PR1A 1HA3A 4WXRA 2GK6A 3R7WA 1QF9A 2QM7A 1PUJA 3L82B 1EWRA 1N2CE 3QXCA 3BK7A 1FNMA 4C4PA 3D6TB 1NLFA 1E4VA 3EA5A 3QPUA 2BBOA 3QXSA 1W36C 1E94E 3UGIA 4HB4A 4Q47A 1IY1A 2QNRA 2X8AA 3TVTA 5KSZA 4WZ6A 3U7HB 4KU4A 1DAFA 3I62A 1MV5A 1CP2A 3DZ8A 5BYKA 4B3GA 1IN7A 1I4LD 4IDQA 1OHHD 3I72A 4HSEA 3E2IA 1FTSA 1YVDA 2ZI3A 4WW0A 4TYYA 1WP9A 1WE2A 3IBGA 5JS7A 4AK9A 1ZC4A 4ARZA 1MABB 3ZS9A 4D82A 2GCOB 3GLIA 4MGIR 2VP5A 5EE3A 3TGPA 4XWKA 4FXPA 4MQBA 4RFSB 2QPTA 4C7OB 3PUWA 3A1VA 4OK6A 2A5GA 2ZRBA 1U9IC 1G18A 2H16A 2YC4C 3UATA 2XNDD 4MYUA 4EPYA 3ND8A 2FPLA 2JJ1D 2CHQA 4P33A 1F6BA 3LLMA 5DYIA 1CJVC 2QA5A 1W36D 2W6ID 2ZVQX 1X1RA 3MCAA 1OB2A 3TJZA 2D3WA 4PPQA 2FJUA 2YWFA 2VF8A 2Z6VA 3CIOA 4HDOB 4JVSB 5GADl 5HZHA 4FN5A 2P65A 1DEKA 2HF8A 2JLQA 1OLOA 1HV8A 4Z54A 1ZUNB 4U5XA 4YMUA 1SVMA 4WAUA 2V55B 2PEYA 1C4OA 2QY9A 4IDHA 3TRFA 1F48A 3HPRA 4GOXA 2WWYA 3D3QA 2BEJA 1TADA 2B6HA 2Q9AA 3KKPA 3W8RA 2OUKA 3TW8B 3UG7A 4KFRA 3TMKA 5TB5A 2FX3A 3VR4A 4Q48A 5EXTA 4AURA 2IL1A 3B78A 4ILEA 4BASA 3R7WB 1HQYE 1DO0A 4A0HA 1KAGA 3JVUA 5EXXA 3CF0A 3D7MA 3HPQA 1S8FA 4L4UA 3UEYA 3LXRA 5FOWA 2GBLC 1GL7A 5DLQC 4DSNA 3QXHA 5KYKA 2ZJ5A 1KO1A 3KB2A 4DB4A 1KDOA 1YKSA 4DUGD 3S1AA 1QHGA 1M8PA 2ZE7A 1ZUIA 3V4FA 4I99A 2ZU6A 2J45A 4JL6A 3TSOA 4UNSA 4Q00A 4AYXA 4OI4A 1KI3A 3BIFA 1A5TA 2V7QA 3M0EA 1ONBA 4UXIA 1E1QD 2D62A 5TARA 2FV8A 2FFBA 2G0NA 1E0SA 2MMCA 4RD1A 5DHFA 2IHBA 4WA7A 1T3SA 2L0XA 5IRCD 2IHYA 3EWAA 3LFUA 4FD2A 5J5CA 4CEJA 2V1UA 3KXLA 4LZZA 3G82C 4TLDA 2AKAB 5G53C 3BS4A 3VHXA 1UADA 2XXAA 4QL3A 4AG6A 1LV7A 2ZAOA 3WP0A 4OK3A 3ZIAD 2WTUA 5E3HA 4RKEA 3VQTA 3UMSA 3QXJA 2RGCA 4HAWA 4A0FA 2G9NA 1XTKA 2IUTA 1AS0A 3LW7A 4O2RA 1XTQA 4OL0A 3UWKA 2TMKA 3WRXC 4EJSB 4BFYA 2CK3D 2BHRA 3A58B 1F5NA 4BRWA 2WVJA 1OE0A 2HEIA 3ZYCA 1ZM9A 3GFTA 4HZIA 4W5HA 2BMEA 3RAPR 2UKDA 4BEBA 2CL0X 2IBMA 3AP3A 3BD9A 4DLUA 4DDUA 2AWOA 2ZQ5A 1JR3D 2WWWA 1D5CA 2F9MA 5JI3E 2WJVA 1XWIA 2E9SA 1WMSA 1TEXA 4LV8B 5DIFA 1L8QA 3QVVA 1AKEA 1E6CA 4UJ5A 2ORVA 4QJ3A 3RRZA 1FAQA 3IHLA 4LJYA 2RAPA 2YC2C 2J9RA 5JFGA 1VYVA 4Q7JB 2PT7A 4A2QA 4E22A 3ICQB 3GLGB 3P1JA 1KDTA 5TXGA 2ZJ2A 3DKVA 1MH1A 2H1LA 4DKXA 1E9AA 1U81A 2GZHA 2UZIR 3QG1A 1OJLA 1R0ZA 2QE7D 3OFND 4S2EA 3W5IA 2RGEA 5DISB 1DAGA 3WY9A 1AIPA 1JQJC 3I8XA 3GLIE 5KSPA 2OO7A 4DLZA 2R6GA 4V0NA 3OIYA 2REXB 3LNCA 1LB1B 2YVUA 3WYGA 4JYBA 4ZKDA 1D9ZA 1YZNA 3C5CA 5FUWA 5CYOA 2BJVA 4CEJB 2NTYC 4ASUA 4G5OA 1E0AA 4LYFA 3T1TA 4BFUA 3CXLA 2CL6X 2IYRA 5BQ5A 4BFSA 3FOZA 5KNDA 3CF6R 2IS6A 3QKUA 1OV4A 5JS8A 3BH7A 5H70A 1JPJA 1R10A 1GNQA 4D4LA 4FKDA 4MITA 1GWNA 5BW8A 4IKEA 3QKTA 4KBGA 2P67A 3FHCB 2B8TA 2ZRJA 3QKRB 5FUVA 1WB9A 2ORIA 2YNMA 3A1SA 2A30A 3DPUA 2JLWA 1SHZA 3Q9LA 1Z0IA 4Q03A 3UEJA 1K5GA 1FTNA 5F98A 1XTRA 4HAZA 2JLZA 3TLXA 4L9WA 1OXVA 2YOGA 4CYMA 4NHOA 3A8TA 4EDHA 4B3CA 4ZI3A 1F2UA 3THWA 4XVQA 1KKLA 1UDWA 3MWLA 3SR0A 1RRFA 1KSJA 2ZJZA 1IXSB 1OKKA 5ELXA 4KBFA 1N6IA 2RHMA 3WMGA 2ODBA 4GMXA 1XRJA 1KSGA 1E2MA 1WA5A 3X1DA 1ZM7A 5K8TA 3ETLA 4R71A 4C0BA 1W0KD 3T34A 2F1RA 4ACAA 3EC1A 4OQLA 5EJEA 1XEWX 4Z1MD 2IK8A 1WDTA 4QNMA 1NVUQ 1OXUA 3LBHA 1OH7A 5CYPA 3NTUA 4B33A 3GPLA 2WOJA 1J90A 3H4MA 2PX3A 4Q66C 5K8LA 2HXSA 2FU5C 2VL7A 1PTQA 1FARA 4PXAA 4A8JA 1EGAA 3IIMA 1T91A 3UK6A 5GVSA 3GLHE 4TSFA 3ADCA 1NVVQ 4QNRA 2Q3MA 4UXHA 1UKYA 5KDOA 1RFLA 4OQMA 2R2AA 3NC1C 3TSZA 1VHTA 3K09C 3QVUA 3MWJA 3ZDQA 5KPDA 3MLEA 2ZJYA 4AIIA 1XD9A 3WBKA 3ICEA 3RS4A 3CX6A 5KSOA 1CXZA 3CW2A 1G6HA 2R6AA 1XMSA 2XZPA 1XTJA 3MRSA 3NVAA 4QBFA 4URZR 2GCPA 1G7RA 2IC5A 1XPOA 1WBDA 4YDSA 3T1VA 4FCWA 4P31A 4LCBA 2N1BA 2Q9CA 3KQKA 4L9SA 3CNLA 4M53A 4DLYA 5F3WB 3AVTA 3PUZA 2B7BA 4LBWA 2PH1A 2H5EA 1YZUA 1KGDA 1XNJA 3SBEA 4D4KA 1IAQA 4RD4A 4Q9JA 2WWXA 4ZI2A 1D2EA 3THWB 3GP8A 1AM4D 4IFBA 3BJIA 3D31A 4NCKA 4NYMQ 2AN9A 1NP6A 4LHWA 4L5BA 2XB2A 2MMGA 2R6DA 1N6HA 1ZM4A 721PA 2KSQA 2PCLA 1DBSA 4W9MC 3MWYW 1IQPA 1YRBA 4YDHB 4JL8A 2Q3FA 3IO5A 3TUIC 1R5BA 3CRMA 2XSZA 2EFHB 2QP3A 1E99A 1E96A 1YZQA 4IJMA 1PLKA 2GAAA 2ZUCA 3FFAA 4FMBB 4PHTA 3REGA 1DS6A 5KSYA 2A5FA 3ZZTA 5BN4A 1M6NA 4B2LA 4HEJA 1Z6TA 4UXJA 4RZ2A 3HWSA 4PO8A 2ZUBA 4A8JB 2F3RA 4HYYA 3QNUA 2Q0HA 1W0JD 3ZQ6A 3KKMA 4RD0A 2F6RA 4LI0A 3RS2A 1S9HA 2PX0A 4PO1A 1LS6A 2CDNA 3AGQA 2ZSEA 1QG2A 3DZDA 4QG7A 3RS7A 5FI0B 2ZJ8A 2V7QD 1OPXA 3QSYA 5CDFA 1XMVA 3CX7A 2RH5A 5HE9A 4LC1A 4TT3A 2KBFA 2HT6A 2X2EA 5CK4A 1P2SA 4TQ9A 5FL3A 4IOMA 4LPSA 3SOPA 2ZR9A 2DWPA 4CIDA 1SZPA 2J59A 4JS0A 1NVXQ 1FUKA 2QUZA 3NBFA 2ZS8A 2PLRA 3SEAA 1DO2A 2VP4A 2IYQA 1R79A 4TLCA 3DKPA 4UNPA 1VCNA 5JRZA 1E1RD 1UM8A 1JQLB 2C96A 1MKYA 1OHHA 1D2MA 1UKZA 3ONWA 5FTKA 3LLUA 1NSTA 1NNEA 3RRMA 4X8HA 5G3YA 421PA 1DOAA 1RYFA 3K0AA 2ZS7A 1Q12A 1I4DD 1II8B 2XTMA 1Z6XA 3BWDD 3CZPA 3CKLA 1JALA 1GKUB 1ZNYA 3K53A 3QF4A 2O52A 3B6EA 1XF9A 3QF7A 4G1UC 5J4LA 5KDDA 3GMTA 3SYNA 1FFHA 3W5JA 1JAIA 3PENA 3HU1A 1UAAA 2JATA 4K81B 3THXA 4M1MA 3U4QA 4QGHA 1Q1EA 1XPUA 1G3UA 5LPNA 2H17A 1OW3B 2XNDA 4LPKA 1SVKA 4ON9A 2WBLC 3TBKA 2GEUA 2VHCA 2YOHA 1GILA 1M7HA 4P4SB 4OHZA 1XTIA 2W6IA 4DDVA 5B64A 3V4RA 4ZDWA 3D8BA 2QTVB 1GNRA 4P3YA 4Q18A 4B3BA 4DCUA 3FHOA 3KX2A 3SJAA 4BLPA 3CF2A 4KYUA 4LJ5A 1EWQA 4B47A 2IYUA 4O3MA 4BE7B 3AGPA 4QHTA 3BAFA 1CULC 1NMXA 4EUNA 3UGDA 4TL9A 3UWOA 4BECA 4L15A 4Q9LA 4JBWA 4FMCB 2ZUDA 2QTHA 2DFTA 3FYHA 1R8SA 4MKGA 3TQFA 3CBQA 3MFYA 1VIAA 1TU3A 1ZD9A 2P0EA 3B9PA 1M34E 4HZUB 4ITRC 3VFDA 3AF1A 4XD7D 2IS1A 3TAHA 1GIAA 1AQUA 1KJWA 1U9IA 4OBEA 1NN5A 1SKYB 1VG1A 1G291 3J81k 2CHVA 1A2KC 5J40A 5TVKA 3B13B 4U7DA 3VKWA 3AP2A 4GNKA 2JLYA 1JAHA 5B58C 4II7A 4DUGA 1Z6YA 1OYWA 2CEAA 2A3RA 1OXTA 3H1TA 4KFTA 3SBDA 2QP9X 1TQDA 1UDXA 3F5FA 3E5HA 4US1R 2ZS9A 5SZJA 3VKHA 3TIFA 1E1QA 1N25A 2C95A 3WBJA 2WJIA 4IDPA 4W5WA 4D81A 2HYIC 3AVYA 1XFAA 1YRAA 4MRRA 1S0UA 5L3SA 4C0AC 3DMNA 2AFIE 1QHIA 1G8FA 1AA9A 3P32A 1EG7A 3QE0A 1VPLA 4TQUS 3B9QA 4A8JC 1MO6A 2XITA 1B0UA 2YKGA 5L3VA 1TAGA 2E87A 3HP1A 3QBTA 3NWJA 4EKDA 4MDFA 4LBZA 3U61B 1FX0A 2GBLA 4URVR 1OFIA 1DARA 1OKKD 1YE8A 2DHRA 4CEHA 2QL6A 3FKQA 2D74A 4B43A 1DELA 2C5LA 1GTVA 2CK3A 3KJGA 3KJIA 3UANA 1LS1A 1CTQA 2JCSA 4NKRA 4PQYA 1CJUC 1EFRA 2FFQA 2PLFA 1P75A 3AUXA 3PUVA 1IY2A 2BBTA 3ZGXA 4FWTA 2OV2A 4K8OA 3SFZA 5CDFE 4BLOA 4D0NA 4N1AA 1IN6A 6Q21A 3VNVA 1JR3A 1IY0A 4QXAA 2CCJA 3MSXA 1VMAA 4URXR 4B35A 3TUJC 3WMFA 2QRZA 1N0UA 3QKSB 4TSFD 5CLLA 4ACBA 5A5GA 2R8RA 3A1UA 1KYIA 3EW9A 3VMFA 4JIMA 1VCMA 4PC1A 2WHXA 3ZVNA 1XEXB 1S4QA 3L43A 3OIUA 4LJ9A 2BJWA 3KUDA 2A78A 2PZFA 4FMDB 3W6NA 2YWGA 4AKIA 2ZI6A 4IFEA 1OIXA 4JT4A 2FSGA 3PIRA 3X1YA 2QE7A 1F60A 2VHJA 3OFNA 5F9FA 4WXPA 3FMIA 2ZPTX 2IA5A 1G5TA 4YMTA 2ZI5A 2OAP1 4KO8A 2NOAA 4OI0A 2F1JA 1HY3A 1X86B 2Z5FA 3QBVA 2D7DA 3Q5EA 3VX4A 1XJCA 2J0SA 2CE2X 2WKQA 3NH9A 3C14C 2IT1A 2ZYUX 2B7CA 2GDJA 4X8OA 4C0KA 5EUQB 2Z4RA 1T3LA 5DI3B 4QFMA 4B44A 2DFKB 4ESVA 2FN4A 1E98A 1L7VC 1D6JA 1MABA 5H68A 3NHAA 4BEJA 2FA9A 1HT1E 3ZZ0A 4RFSA 1T6NA 4C7OA 3VX3A 5FPKA 4CEHB 3CNOA 121PA 2ZRDA 1CR2A 4JJZA 2JIZD 2QQEA 5J47A 621PA 5KTYA 3R8FA 3HU2A 4AKHA 4JLDA 4B3FX 2ZYTX 1RRPA 5E4FA 2WIAA 4QHSA 2XSZD 3U7GA 3VHLB 3X1XA 4LOAA 2AWNA 1KMHB 4LJ6A 2O0HA 1FUUA 1SKQA 3AVOA 4MRSA 3U6BA 2ZREA 5ANRB 5B2ZA 1SHKA 3P20A 4JLAA 2DB3A 2OCAA 3GJ3A 1Z0KA 4DLSA 4M21A 1LF0A 4IVPA 2NGRA 1ANKA 1KDRA 2ZTSA 1N6LA 2R44A 4E03A 2GILA 5TV2A 2FSIA 2ZJBA 3K9LA 3QJYA 4RCZA 5CJPA 5IF9A 1M7BA 2VSOA 1XPRA 4TT3D 3EWSA 4JSTA 1UF9A 1W0KA 2PMKA 4A6PA 2IXGA 2QRNA 4MYTA 4HDCA 4Z1MA 4OK5A 2FMXA 5FTMA 1U0HC 1J8MF 2N46A 4BLTA 3AVWA 1NIJA 1GITA 3KJHA 1U8AA 1CJKC 2CLSA 4G5GA 4GOJA 4LUCA 1X1SA 2EW1A 3WHLA 3LVQE 1CS4C 3JZAA 3R9WA 3W9YA 1VIYA 3I32A 2ZRNA 4MRNA 4F91B 1G9XA 1NMYA 1Z6GA 4V0KA 4F4CA 1ZRHA 5EP3A 5J4YA 5KU1A 1KI6B 4QM7A 2O8DA 4V0ME 2EYUA 3LD9A 1MO5A 2GXUA 4TQAA 2BKUA 2G1JA 1TNDA 1NIPA 4JYCA 5LB2A 1JB1A 1XMJA 4F38A 1I2MA 2RGNC 1Q44A 1LF5A 1OXSC 3OAAA 3UG6A 2FFAA 1XCMA 3CLVA 5C1BA 1MRSA 2CHGA 1OIVA 4BFWA 1S96A 1U0LA 2VSXA 2XZOA 2X2FA 4NYIQ 1UPTA 2DWQA 3K9HA 4UNRA 3QXXA 2WICA 3CB4A 5P21A 3WP1B 3QG5A 2VQSA 5KDLA 1Q21A 4K46A 2C98A 5B30A 2ZRFA 3U3KA 1JR3E 2GF0A 5AR1A 3UKDA 4EJSA 4Q21A 2DPXA 3SI7A 1Q3TA 3LO5A 4RZXA 4CVNA 2GJSA 2XZLA 4V0LA 4Q1EA 1RVDA 2CCGA 2EWWA 2QGZA 1JJ7A 5DGXA 1KK2A 1N6PA 1NBMA 3AVXA 3K09A 1GDDA 1JNYA 2W58A 4M9XA 4TTPA 3A6PC 1P7CA 3B1VA 4D80A 3RYTC 1AGPA 3OE7D 1VYUA 3IDQA 521PA 5AJXA 1G8GA 3TSWA 1X3SA 1Z2CA 3PCRB 4IOLA 2VRWB 3GJ6A 1BYUA 4I4LA 3GCGA 3AF2A 2GXQA 1ZJ6A 3Q7QA 3R9IA 4JLNA 1TUEA 1G5PA 4JLMA 4PHHA 2GJKA 3GLGA 2VSFA 3SDZA 4HB0A 2QMOA 1Y3AA 3EIEA 4YXWD 2OG2A 3W8NA 1XU4A 2ANBA 3CX8A 3F8TA 1N6NA 1W0JA 4B6DA 4M1OA 4OHWA 2GAOA 3LX5A 3CH4B 2ZI4A 5EP4A 5BN5A 3GQBA 1YJ5A 4DJTA 1E2FA 3K70D 1RRCA 3ZZUA 1Z08A 2O8DB 1CEEA 1A82A 3TQCA 2GEDA 2OSBA 4HAXA 1YZKA 2VA8A 3AB3A 5CIWA 1RC8A 2ZYVX 4FI3C 4QBHA 5SZIA 3FMFA 4UKDA 3LQRA 1L4YA 3DM9B 3PEUA 1W4CA 1XXHB 1NN3A 1EFTA 1KO7A 3LVRE 3ADDA 3B60A 4GI7A 4DEYA 3PITA 1G8PA 5EE0A 2K5UA 1BH2A 4BLSA 2YYZA 1DG3A 1VTKA 2OFXA 4HATA 4KFUA 1E1RA 2PT5A 3MD0A 2GTPA 2PZGA 2GZDA 1YU9A 1UJ2A 1E2LA 2D2EA 3G5UA 2QG6A 3OF5A 1ELOA 1N5JA 3DOFA 4BZXA 3EPHA 3SJCA 4AY2A 3NG1A 1NY6A 2QT1A 2B92A 5BN3A 2O8CA 1U8YA 3QKRA 3AUYA 1EFRD 4NYJR 4HLUA 1AGRA 4M1KA 4I1OA 2QEQA 4QOSA 2ZRIA 2HJGA 3GFOA 5FPHA 3B1ZA 3KQLA 2ZR0A 3NBYC 2J1LA 3Q7PA 3I92A 3NDPA 2GXAA 4GP6A 2NZ8A 2IUSA 3ND9A 3ZD7A 5D3MB 1HEIA 1IBRA 1N0WA 3B85A 2ENZA 2J0VA 1L2TA 4A0GA 3B5JA 1R0XA 3N5CA 5L8VA 1O87A 1R8QA 1TF2A 5K8UA 3KFVA 1TBOA 2OESA 3KDSE 5AUOB 3KJEA 5EE9A 1ZM2A 4RZUA 4TLAA 4TMWA 3CO5A 2WKRA 2AKYA 4PANA 4ZDIA 4DCSA 4OKSA 2IYZA 4IOKA 3TR5A 5JHGB 1QZXA 5FUYA 3U44B 2PBRA 3IO3A 5EE1A 2I3BA 2BVNA 3T61A 4QJ4A 4MA4A 5DO9A 1YHNA 1HT2E 3I1FA 5JEEA 1X8KA 3R8CA 3WRYC 1XZPA 4C0QC 4QGFA 1RIFA 3E70C 2HCJB 4KLZA 2NZJA 2E73A 4LDJA 4PX9A 1QDEA 4XD7A 1ZNXA 1M74A 4I1SA 1GRQA 2IEZA 5KUTA 2REOA 2RGGA 2RB4A 1H8ED 2O0JA 2JLUA 2QI9C 3KKOA 3C5HA 2WAYA 3U5ZB 3OEHD 2NPFA 4DZZA 2CJWB 4MH0R 1G8YA 4QM6A 1OF1A 2JAQA 1ZU5A 3TAUA 4HUQA 2JGNA 4G5RA 4ZPXA 2GRJA 1KI8A 3OIWA 4MKFA 5AK0A 4RD6A 4TYNA 4EPVA 5KNBA 2FOLA 1IXZA 3VU9A 2ORWA 3QENA 2DFNA 4AYTA 4CT5A 3KQNA 1TF7A 1HUQA 3BGWA 3W3ZB 3SU8A 3V9PA 4PSKA 4TWZA 2O8CB 1UBCA 4URWR 4WVFA 1W47A 2QSZA 2R9VA 1CR1A 1AJEA 3KZ1E 3C4JA 2ZI7A 1JI0A 1TEVA 3KY9A 1VCIA 3HU3A 2KWIA 2VHQA 2P2LA 2ZIAA 3QQ5A 1IN8A 3TUZC 4O2LA 4KI0A 3BH0A 3T15A 2DFLA 1ZC3A 1SGWA 2D2FA 2VEDA 3EARA 3QEOA 3F3YA 5UKDA 4PPNA 1US8B 2LWIA 2V6JA 3Q8XB 4BFZA 2NPIA 4L8GA 4NCJA 2FEOA 4KCGA 3GLGE 4MUAA 4AD8A 3AH8A 4HAVA 3N2IA 2WV9A 1QG4A 3WXMA 4W7SA 1GVNB 1JEDA 1K5DA 3FDIA 2BC9A 2ZE5A 2FE4A 2JA1A 3X2SA 1E9SA 5J4HA 3B82A 4YMVA 3RSOA 4GZLA 4NL4H 2VF7A 1G41A 4QKQA 1PTRA 4XWAA 5FOVA 4EJSC 2AFHE 1LW7A 2VYFA 2ZE6A 1PJRA 1ESMA 4OQXA 3U6KA 3PEVA 1E32A 1VCOA 2GWHA 1AQYA 4A2PA 4OYHA 4ZCLA 4B74A 1EFCA 5JMTA 4HUQB 1Z83A 1LTQA 3SC3A 2QMEA 4B73A 1E2HA 1IM2A 1FMLA 4YMWA 1ZUHA 4DVGA 2X19A 4IDNA 3OAAD 4XIGS 3VU9B 5TY0A 1SXJB 1KIMA 1KZ7B 1J7KA 3GLFA 3GEHA 5L3RA 2CNWD 2GHIA 1KKMA 5JECA 3WMEA 4M1YA 1N0VC 3X1ZA 5EZ5A 3C41J 1Z63A 3A1TA 2BEKA 1Q22A 2CBZA 4M2LA 4NZYA 1NL3A 1TPZA 3IQWA 3EASA 3H0KA 3SQXA 1Z22A 3UIEA 3EZ7A 3KB1A 2FF7A 1II8A 1KSFX 3CONA 2ANCA 1TQ4A 3MG9A 1NBMD 3FMPB 2WSSD 4KSBA 4LYJA 3CRRA 3CR8A 1SVWA 5L3QB 1XA6A 1KJZA 2HYDA 1T5LA 2V8OA 2CVFA 2W0SA 1E2NA 4DLTA 2WMNB 1EXMA 2JIZA 4MGKR 5EP2A 2WWFA 4Q4HB 4J0QA 2QU8A 1IXRC 2FWRA 1JJVA 4NP6A 1QRAA 1GSIA 1TU4A 2WPDD 4P4SA 4PTLA 2AX4A 4V03A 3T5DA 3C7KA 3W90A 4ZDJA 4I81A 1JXMA 5CLQA 1DPFA 4A4DA 5FH9A 3ASZA 1Z07A 3T1OA 1HYQA 3EA0A 1XJQA 3RHFA 4LHYA 1RFHA 3I3SR 5JRJA 2IEYA 1MR3F 5AUNB 4Q4JB 3HYTA 3VR3A 4LYHA 5JLJA 1IONA 5DE3A 3DVLA 2WWIA 3BRWD 5KPJA 2XAUA 1GRNA 1EX6A 1E2EA 2LCFA 1ZIPA 2SHKA 3VR1A 4AC9A 4DB2A 1G3RA 3L0PA 4D4JA 2FSHA 4A2WA 1I4TD 1U2RA 2JJ2D 4HLUC 3PUXA 3KXKA 4HZUA 2B8WA 2OCPA 3GJ8A 4ERNA 1AS3A 3U60B 1VKJA 3Q85A 3LRPA 4LC0A 4TN1A 2QSYA 1E3MA 2F1IA 1GNPA 4CEIA 2G1KA 5DHAA 1T3HA 5F2EA 3EC2A 4C3ZA 2BWJA 1KNQA 2RKOA 2F3TA 3O8BA 2IUUA 3GLFB 2ZRMA 4IHQA 2DB6A 1COWA 1ESNA 4LK2A 2G0TA 1W2HA 2ZSDA 5E7JA 2YZ2A 221PA 3A1WA 1TBNA 2I4IA 4JVNA 5HZKA 3IILA 5GJBA 2J0UB 1ETUA 4CW7A 2A7QA 2G83A 1E2KA 1EFUA 1W4BA 4JLPA 1HE8B 3LQQA 2QM8A 2QGNA 1XX6A 4ZO4A 1CBUA 1HURA 4A9AA 3RANA 3KQHA 2ATVA 2QORA 3PG5A 1BYIA 1AKYA 2LKCA 2QAGB 5HPYB 3U7FB 3NDBB 5E95A 1QVRA 2ZANA 2H18A 3AVQA 4FMCF 3EIQA 4C0JA 3IBYA 4YLGA 3L2OB 3KFXA 1KO5A 3OHMA 4GFDA 4GL2A 1PZNA 1JPNA 5K8IA 4UNQA 3K9GA 3K8YA 2OM2A 1Z8FA 4Q9HA 3TNFA 4DCVA 5C2JB 3ZVMA 4JKYA 4EIWA 1G16A 3M6AA 4QC2A 1KZGB 2UVQA 3FPAA 3NC0C 2BMDA 2PJZA 4HLQB 3SN6A 4B6EA 1KAOA 4KJZA 2ZI9A 4PC2A 3T12A 3TVDA 2C8VA 4YC7A 1KBFA 3NEJA 3PVSA 3WNCA 1DVRA 1SXJC 4FIDA 3LA6A 1QHHB 4OI2A 2QMUA 4R98A 4F92B 2EQBA 5GVRA 5SZHB 1PLJA 2V4ZA 1Z29A 4EPWA
chains in the Genus database with same CATH superfamily
1EPUA 1TL7C 1G20A 3VVCA 3O3OB 3LV8A 4PZPA 4UE2A 3WMWA 2D2IA 3H2IA 3U9TA 1H8HD 3PI7A 2PEZA 1E1DA 4RHUA 4UE3S 4CDMA 5IW8A 5EOVA 3QKSA 2JFPA 1IUPA 1QUEA 1CEXA 2OFPA 5C7OO 1B3RA 1ZHFA 2PXHA 3L8EA 3EXG2 1T5SA 2IJGX 4E1PA 1U90A 4JEHA 3RJZA 2WYIA 3HBNA 3GDOA 2EKZA 3JD0A 4NECA 1E1MA 4D9HA 3H2JA 3HCRA 5B53A 1JLMA 2J09A 4FD3A 3KE8A 4ZYUA 5HGXA 4Y2PA 2GPTA 4BTVA 1XXLA 2PUEA 1Y7HA 2WIBA 3DMFA 4WZAB 2QYTA 5CU7A 4LQDA 3C3AA 1H4TA 4TS1A 3HJNA 2E4VA 4LW8A 1JIKA 2C29D 1STOA 2D4HA 3LQ2A 3B5IA 1ZI6A 1NVWQ 2EWMA 4MUYA 3F6SA 1QCCA 2SNIE 1J2JA 2IYVA 3DHWC 4F56A 2Q0SA 1Q3HA 4YPVA 2REQB 2Q41A 3E15A 2VTDA 4O8ZA 3STVA 1J8YF 1P4HA 2Q3HA 5F7XA 4E70A 1T8TA 1UXIA 2C2BA 3D8HA 1IW4A 1NJFA 3EG5A 4D9CA 3TECE 3CUEF 4P3XA 4L5YA 4AECA 3GNSA 5A3QA 5DI3A 2FQXA 5CVTA 2GKSA 1NR5A 1ZU4A 1P7ZA 2R6R1 3O2SB 3EOAI 4L0DA 4P7FA 4UEWA 3VH4A 5LJLA 2ECKA 4C22A 5TPWB 3JQ6A 1PT7A 3SS7X 1NSFA 1NU8A 5TS2A 1ULZA 4PXSA 3STWA 3RVRA 3H75A 5DCLA 1AK2A 4PLTA 1CFZA 3IMEA 1AN1I 1D04A 1NE7A 4Q1CA 4UTZA 5LB4A 3WGZA 4HB3A 3INGA 1M2GA 1Z13A 3F49S 4LOKA 4BNDB 1RJWA 2ZRPA 3HCAA 4YAEA 2NMVA 4X3OA 3K73O 4YQZA 2PKCA 4DA8A 1ZZEA 2C20A 4DZRA 4ZC1A 3R6TA 3UCEA 2KM1A 1CETA 2OD2A 3UTCA 3OUTA 2Y0MA 1XZJA 1OLSA 2J7KA 4QGGA 1XQ6A 2I33A 1G5FA 5EHQA 3AY6A 1U9CA 1XELA 4QTXA 5E3JA 2Z2YA 3TG8A 1GZ5A 1HSOA 1RLMA 3T35A 1A1SA 3LBNA 4AN0A 4DA9A 4YR7A 1M1UA 1MAUA 4P80A 4A6EA 4AP5A 4V24A 3H1EA 1G3QA 1S1CA 3LX6A 3CR7A 4NH0A 3ZR4B 2HNAA 4KZPA 3MS4A 3E7FA 2XTAA 4GSLA 5DNYB 1T9CA 3RK4A 2HOQA 3CRVA 3JQEA 1H85A 4BRZA 4W5QA 5ICFA 3RFVA 3SC2A 3ZGNA 4D25A 1GL3A 2FR8C 3OU2A 4U1RA 2W11A 4FJ0A 1N6KA 5J2TF 2NT3A 2ODEA 1FYXA 1H2YA 1R2QA 3FDZB 2EFCB 3ZY4A 3U13A 4D0LB 4QO7A 1Z5ZA 2PFKA 1PT5A 3KQPA 4Q0MA 1X2BA 2C4NA 1E89A 1XHEA 4PNHA 3G2QA 4M22A 2A2ZA 1QU2A 3A6DA 4FZRA 5FTNA 2EEZA 1DCFA 4I8IA 4NMWA 5FR2A 1N5IA 2CXXA 3FPLA 4YMGA 2C3YA 3ELDA 3UJ6A 1HEUA 2VIIA 1DAMA 3E9NA 2OQRA 2ATIA 3N0WA 3NC4A 1CQIB 3HNRA 2P2ZA 3IPCA 3CWQA 3H86A 2OLJA 3EXIA 3B3QA 1N5KA 1IQ0A 2AQHA 1CU1A 5CXSA 4FCVA 4B1FA 4H7EA 2NZXA 4Q1AA 1GL9B 5CDYA 3U62A 3DAYA 4DT1B 4I2NA 2AR0A 3UJBA 5L7TA 1YDGA 2X77A 2OYRA 1LD3A 5MN5A 1MMFB 4H7DA 3AQ4A 2ENUA 3IKMB 3R3SA 1U0JA 1K3TA 2HNKA 2JDIA 4ZQIA 3O8CA 1S20A 3RRFA 2QRJA 4HQLA 5ESWA 4D0RA 4D3YA 3OQNA 4WOPA 1RLUA 3D2BA 2J7PD 1V1JA 4M0LA 3LDAA 2IIBA 3EVAA 3MBIA 2IZ6A 2XTNA 10MHA 1VPVA 3H3XA 2A5JA 2HWYA 4KQ9A 3BF7A 4FWIB 4I50A 4XGQA 2E4AA 5AOVA 3TOAA 4YWHA 4LF5B 4MCAA 3CWZA 1H22A 2BBSA 2CUKA 3PVCA 4X00A 4BP9A 4H0CA 3AP1A 2J5XA 5DSZA 1F8FA 5F76A 2UYGA 4QDUA 3GYGA 4TTRA 3E7WA 4RA9B 4LRWA 3BBPA 3ZBUA 1HFEL 2B4QA 2WQ6A 1M2EA 2GXSA 3ZDEA 4PAOA 2FF5A 3M3HA 5HILA 2OK7A 5AICA 1KJNA 4CIWA 2D6FA 1RQGA 1KH3A 1RMQA 1Z4IA 2VQDA 4J9VA 3ZE0B 5JALA 1T0UA 5TT1A 4FJ2A 2OP1A 2H8KA 1J0AA 2P1DA 2W6NA 3R4VA 2IXEA 5A05A 3OMXA 3FSYA 4G8JA 3FJOA 2FG6C 2FDCA 1KARA 2I6QA 4Z9AA 3WBFA 3TTVA 3K1AB 2I2BA 3E3NA 4CMIB 4IQ8A 1ND5A 2Y0PA 1YRHA 1LZKA 1NMEA 2VR1A 2ZYAA 4PICA 4AXXA 1YAJA 2OLEA 1RW4A 1BCSB 4HX2A 5EAIA 5KTTA 4RU1A 2P6RA 5B3JA 3IUBA 4A1FA 2CL7X 1H2FA 2X42A 3E53A 3EC7A 3EFOA 1EVQA 3PSAA 4N6GA 5BOVA 1JEYB 1DCKA 1QQ7A 3ZW8A 2DF8A 2JH3A 2ZB7A 2Z8XA 1X8JA 2YIMA 3IQEA 1CE8B 1W93A 1FZQA 3K2QA 4PSAA 4Q3NA 3VNRA 4X94A 1TTHA 2NZ2A 3BB4A 3H4VA 5GJVC 4RK5A 4BLWA 2I1QA 2MWMA 2BAGA 2JFZA 3C8MA 1QZZA 3OUZA 1C9MA 5CB6A 2XYHA 4ND1A 4JFRA 3FTEA 4OXYA 4U7PB 5D7NA 3NJ4A 1HTWA 1OMTA 4NK5A 3JRWA 2CKMA 3RFUA 5K0CA 2V1XA 2BN4A 3IAS1 1JDZA 2GFHA 2H51A 2IUEA 1QGDA 3PDNA 2I7XA 5I9NA 3FYUB 3LK6A 3SZRA 3QOYA 4WECA 4BX0A 1P1HA 3FPCA 4L8VA 2I4MA 3UC5A 1D7AA 2WSIA 2GF9A 1OLXA 1R15A 3T7AA 2H2AA 2OORA 2OQIA 2DCUA 4IEEA 1RR6A 2VHZA 2P3QA 4PGMA 3JZDA 3MQFA 4GDMA 2N0SA 1VBFA 1JZQA 3VM6A 4KR2A 4OHUA 1RQ2A 1RQRA 2CNWA 1WXGA 1Z3CA 2CL5A 1NJ8A 2W8BA 4LDRA 3GW8A 5CVUA 1U1FA 5BWMA 4UU1A 5DNWA 3KAKA 4C0HA 4ND5A 4CQJA 4Y30A 3TB4A 3G2PA 2KE5A 3CA8A 1AF7A 4P53A 5TX7A 4HH4A 1PW7A 1OD6A 5CGQB 3K6KA 2AR7A 3LAWA 3ESAA 3CX3A 2MYPA 1GOTA 1K6XA 1UZNA 3KYCB 3CXUA 2HC9A 4K8RB 4D4MA 1LCIA 4Y6LA 5EQTA 1CQJB 5JCJD 2PS0A 4GQIA 3OPNA 2F8LA 2XCUA 1UFRA 2ZB8A 3GLSA 4O2AF 2OXFA 4M86A 2WLSA 1ORVA 1QNFA 1TX4B 2CVHA 2J46A 3GN1A 1KGSA 1Z39A 3IMFA 3L0IB 4K0RA 5GJWC 4DNXA 1OWPA 4PN7A 1U94A 1IN4A 4Z51A 4C2BA 1Y8QA 5KO2A 2B1RA 4INPA 1T6XA 2ECQA 4QBKA 2O7SA 4YRKA 3P4XA 4Y1EA 1JFFA 1NLMA 4IIGA 1FXWA 3SSAA 2HT1A 4UD6A 3CU5A 4LGMA 1E2IA 1RBMA 3BULA 2AJBA 4NJEA 5JY1A 1WUTA 3K96A 2WZDA 6CHYA 2F1HA 3OE1A 1A71A 3SS9X 2OKCA 3GYBA 2WPDA 3AR5A 3WL5A 4E3ZA 5I51A 5KJ1A 2VH2A 1JSLA 2HJHA 4J0CA 4KODA 2YHBA 3DCIA 4Z9BA 1Z37A 2XDYA 4EUKA 4WJLA 4Z5XA 2GSDA 3BD7A 1GYPA 1KERA 3SQLA 3CZAA 4QPPA 3D1LA 3DE5X 1X92A 1O6CA 3N0XA 2NLOA 3UHFA 1EMDA 16PKA 2C8JA 2FQ1A 2XUZA 2WC1A 3DFKA 1C3VA 3NZEA 2EAUA 4IXNA 4POAA 1YR8A 5H3CA 2ZIUB 3N8IA 2JJ2A 3I2YX 5D3QA 3VZBA 2X7XA 3WLMA 4BRSA 4DGQA 1LNSA 1JG6A 4GMKA 3VR6A 2QV0A 3VU1A 2QRGA 1R4MA 2BR3A 5JW6A 4HTFA 3ZBQA 4CGZA 4ROTA 2IYSA 1N3BA 1YF3A 1ES9A 2HLDA 1V2GA 4QDKA 4AJ9A 1X1BA 2OEPA 1IAVA 4U9UA 1RKUA 1ZVJA 2P6UA 4BNIA 1JHAA 3RADC 1H3FA 3OVOA 4L9MA 1J99A 3EMBA 3KR2A 4HDQB 1EI9A 5B5SA 4QYSA 5DU2A 1ZOSA 1V47A 4KWIA 4RC9A 3C3WA 2J6HA 5EP1A 2QJTA 4LV5B 1F9AA 1XDZA 1XLUA 4ZAVA 2OQVA 3V7YA 2ZJOA 5KWEA 8LDHA 1R6BX 1VFPA 1PDOA 3V1MA 4E7PA 4DJAA 2O20A 4YCCA 4HGNA 4HWKA 2IDMA 3IQHX 2VO1A 5BSTA 3WYEA 4O4JF 1G8MA 3RS0A 3H0EA 4L2IA 2W2XA 2B1JA 2B37A 2FQYA 1Z0JA 3JQRA 3GLIB 3PT5A 2B8NA 3JRNA 5ALLA 1KFEB 2A7XA 4Q01A 2ABWA 4LXGA 4DLVA 3OJCA 5JC8A 4E07A 2BEVA 1SRQA 2YXNA 4MIYA 2QTGA 3DKKA 4WZBE 4RV5A 2E85A 3T3IA 4BNGA 5LMNB 4JJ4A 4J1SA 4M7WA 5IYZA 2G06A 3CHYA 3OZXA 2AOVA 3RIYA 2BZSA 1FFSA 4UBLA 3VSEA 2QUBA 3BAZA 2V7BA 1P0IA 2BDTA 3ZDFA 2OD1A 2FH5B 3ZHOA 1Q5PA 1QTQA 1N3IA 4EUHA 2PWPA 1EDEA 2MSEB 3EYAA 4MINA 4K9OA 3FM9A 4UQLA 1OSNA 3ADPA 1KRWA 2J31A 2J3IA 4HLCA 1QGYA 4H2DA 5ALPA 4DXAA 4F97A 4FYMA 5A9SA 1UOOA 5FOUA 4E1BA 1SGNI 1TGVA 4M8LA 4RYDA 4U02A 3BFVA 1VP9A 4E11A 1BVUA 4DWWA 1XEAA 5JDIA 1SCQA 2CHFA 1JQEA 2P9EA 3AKDA 5KOYA 2E1PA 3RRYA 4PSCA 1T8RA 1H9AA 2IHVA 3DOEA 2C7BA 1B16A 1O94C 4NCNA 1JHYA 2Z43A 5BNIA 1ZSVA 4BMVA 4MSUA 1BOFA 3ELYA 4OBBA 1JDSA 1MGOA 1LVHA 4TKUA 3UK2A 1ZDMA 3WGQA 3WTCA 2J87A 1EUCA 4XGRA 3FWPA 3KUCA 1RWNA 1AKTA 5HJ7A 1WQ1R 5GV8A 5FOQA 2D2VA 3GQVA 1IZ8A 1EEXB 1SAYA 1ZCJA 3MTJA 4WKCA 1UDBA 3RU9A 3M5PA 3D6MA 4WMLA 6GPBA 5LZ8A 3M9LA 4WZZA 4G8BA 3DEFA 1G21E 3HABA 4OLJA 1I6KA 2AA3A 3PDCA 4F04A 1ADCA 1QR6A 1U3WA 1OZHA 2WAXA 2ZTVA 3GVHA 4FFPA 4E1RA 4GSKA 4Q9KA 3U4CA 1AQIA 3ZCPA 1XXHE 2H7VA 1L7BA 3EY9A 3H9EO 2W2MA 4WN9A 4F12A 3CLHA 4Q7EA 4MVWA 3CG4A 3TGLA 5ENDA 2XY4A 2EZUA 4FWBA 2JGKA 3BGVA 1EDDA 5A3VA 2XUHA 3LCCA 1XB2A 4LZLA 3RABA 3DAHA 4OXKA 2N75A 1EK0A 3A6KA 4YJGB 4RTOA 2H65A 4MLCA 1UC5B 3IIJA 1CUAA 1MT1A 2RGAA 2XA1A 2BELA 4D5EA 4AKGA 1P33A 1QHEA 2UUBB 5HCNA 4UMVA 1SXJA 5KCMA 1SCIA 1TUIA 2HHJA 3UBTA 1LLDA 3EXEA 1T0BA 2UZ4A 2DUUA 5H5JA 2GESA 4BO1A 3OH8A 2QMZA 2VZLA 3KYDA 4EHNA 1YZLA 4OI1A 3YASA 2RGXA 3LFHA 2RD2A 2H4HA 1LU9A 1QZUA 1E2DA 3WDSA 5JZBA 2DM6A 4DR4B 1MDFA 2WV7A 3PC3A 4DBZA 4XVUA 2Y1EA 3AL2A 2H4JA 4EQ6A 2IS2A 2XVZA 3LKZA 3MUFA 3SYMA 1Q7BA 1S2NA 2QLJA 2CXSA 2QRQA 1HOXA 4UJ3A 5AI4A 2AN5A 9LDBA 5BO5A 1DWOA 2YCLA 4RACA 4FW9A 3DT8A 4EI9A 4G0MA 1EVZA 3OESA 4KB5A 1G9TA 3QRWA 2C7VA 1GR1A 2VPQA 1GGJA 1YZFA 4XOIA 1TKCA 4PRLA 1XR3A 2O8BB 1SXPA 4J4HA 1XYYA 4OP3A 3AR6A 2QROA 1GGEA 4MKHA 2WY2D 1L8LA 1PZXA 1GM5A 3I73A 1B14A 4DLWA 3BIXA 1CZNA 1K8RA 4MPIA 2OCBA 3FPSA 4I4TA 3N7AA 2EFEB 4KWCA 4QQKA 1R6VA 1Z2AA 1L5NA 2JGIA 1W4LA 1WSBA 3W3AA 4D8YA 2NV6A 3EDYA 1SXQA 5KNCA 1PYDA 3KO8A 3BREA 2KLBA 1LTHR 4NYIR 4E12A 3E4DA 3V2HA 2HRBA 1NW7A 3D3KA 4HNAB 4Q7LA 1EGMB 3W4IA 5IKEA 3U09A 2FWIA 1DMSA 4UVHA 4HEA6 5GM1A 4CMBA 2NUTB 2VXYA 3ZCSA 4M4SA 5CR9A 2VT7A 2ASVA 2VNSA 3MUOA 3UBMA 2AFVA 3IAUA 5LZ5A 3NBXX 1ZXLA 4ZPJA 1AGNA 1CIJA 2O3RA 3IRUA 1P1FA 3KXPA 1KOFA 3LWDA 3HR8A 4AG5A 2F00A 3OHPA 3O8RA 4IX1A 4L5CA 3NVDA 3LPCA 5JWHA 3NM4A 1NVFA 2VDUE 1P74A 2FUKA 4XUEA 3K71B 3AVPA 4BO6A 4MLDA 1XDBA 5HIAA 4XAQA 1YE5A 2FJPA 3UY4A 4YRIA 2OPBA 4M9SA 2R1TB 3UOAB 2D7CA 2IFTA 2O3TA 3DAOA 3RC7A 5IC4A 3OCVA 1RBQA 4RWEA 4D3ZA 1KVUA 4E88A 2KW5A 3LYUA 5TS3A 2O2ZA 2E48A 4NBKA 1JFRA 3I5XA 1PL0A 2P4HX 1GTZA 4G8CA 4Y2QA 4JZYA 1ZVMA 2FGKA 1HE3A 4FX2A 1NRJB 4NBVA 4QYWA 5FP0A 3QE3A 4FFMA 1DAIA 2DY1A 1TM7E 4R0VA 1FVXA 5FL7A 1HEVA 5FPYA 4DVJA 4DSAA 2B20A 4QGSA 1E2JA 5D1HA 1BVHA 4CGYA 4TQGA 2VFAA 2Y68A 3ENWA 4KLNA 3FRIA 3QUSA 1WABA 3TW4A 3WTBA 2EKLA 2VP9A 4PHCA 1U7XA 5IJXA 2NVUB 5JH7F 1LI5A 2FR8A 2HAEA 4X6XA 4JVMA 5L51A 5AWFC 1M8KA 2H0QA 2O2SA 3VH1A 3GX1A 3BE4A 3R7AA 5CIYA 2AI1A 2B2NA 2EFGA 3DZJA 1KTVA 4CLEA 3UGJA 4B7XA 1ZD8A 1PFGA 3FNIA 4Q3EA 2YJNA 2BSQA 2PUBA 5LOVB 5ALRA 5E9QA 5HJ2A 5JZOA 2C9OA 4R2JA 2ZRKA 2R86A 4QRHA 2R66A 4GBMA 5HCUA 2ZUFA 3HDTA 2NO6A 3KC2A 1KJ9A 2ZKLA 3LF1A 1A2BA 1SURA 5JCZA 5G1PA 2ADFA 2D8AA 2H4WA 1JHRA 3PNSA 4Y1RA 1WCWA 4ALLA 1MCZA 2CLOB 1RACA 2RK3A 5E3PA 5FLXA 2C59A 1H2AS 2H57A 4RPKA 1W19A 1QHHA 3EXFA 5DYNA 3BSYA 2XE6A 1V8PA 2GEKA 1PV4A 4TSRA 4BNHA 1O6BA 4AG3A 2O1WA 3LC0A 4YRBA 3UHAA 3ZXIA 4YMSA 1I01A 2Y6UA 1CJTC 3DO8A 3K0CC 1AT1A 4E5DA 5CIQA 3NNNA 4OXQA 1J21A 4ZRNA 3H13A 1FQOA 2XQGA 5AHKA 1SU4A 1Q1QA 3D6AA 1R0YA 3NT2A 4Q19A 3WGJA 2E4WA 2R60A 4CKBB 2I7DA 4FW8A 2AXPA 4DEVA 1ZD1A 1ZOPA 2PUWA 2PKWA 2XYGA 3PR2B 4RMIA 2XBMA 2HQRA 4W9RA 4KXFB 4M0DA 4NATA 4RV4A 1SKMA 4A15A 5JT1A 1PJTA 2POCA 1F7UA 3JVVA 1QO9A 2Q6KA 5C4GB 2DQ4A 4PYMA 1FJHA 4IDDA 1C3OA 2W6OA 3OA0A 1ZYUA 3ICCA 4NR0A 1YR1A 1SXHA 4B82A 4G1CA 2OOKA 1XP5A 1WSDA 2HBRA 3ABIA 1RXEA 1YK0A 3FMOB 4OJTA 1NBAA 3JQ7A 5FUXA 2KMQA 1X6VA 2VDOB 4QTTB 2W2TA 5F35A 4TKVA 5IDQA 5LM3A 2ERXA 1YC5A 5CGZA 4Z0TA 4AZ3A 1DADA 3GZJA 1AO3A 4CV3A 2H4XA 1JWAB 4MS3A 4DOMA 3L8GA 1ZW6A 4N6NA 1G6OA 2HA0A 1WVMA 5E38A 5ECYA 1L3CA 4EGQA 3DWIA 1QJ4A 2NXWA 2AG6A 4N76A 2OO5A 1W46A 1YL6A 3KT3A 3RV4A 2HA6A 1Y8RB 2P5TB 3NHFA 3IHWA 3MWEA 3L0SA 4LHEA 4TUYB 1O97D 2GHTA 1JKXA 1N75A 3FYCA 4IH9A 4JJ8A 4OM7A 4N47A 1ZGAA 1AZTA 1XZDA 4COOA 2QN6A 4RPJA 5C5CA 4OSPA 1U8FO 1MXFA 2PWZA 2J3EA 1IZ7A 1RWMA 3HFJA 3QK7A 2ZSFA 1X74A 3S70A 3ZE6A 1ID8A 1Q7GA 5TPZA 1P4GA 3I05A 2PLAA 1S2DA 3MMNA 2A88A 2D5AA 4GYWA 2F2TA 4MRMB 4MQMA 1OFVA 4LY0A 2G28A 3UMFA 3V9AA 4IOJA 2HLNA 5I7HA 2QBYA 4OHYA 1J70A 5KQMA 2OGWA 3NHSA 2VDQB 4ND8B 1B6SA 1YAHA 2NSHA 4PCUA 4PEVA 3H11A 1P72A 2YRXA 3NHUA 3NVMB 4GSYA 1VE1A 3DQZA 1Y9JA 2Q99A 2EC5A 2HJVA 4EGSA 3F73A 1ZN9A 1L1QA 4JP5A 1TQ6A 3IT1A 1BS1A 1MJ5A 2AFIB 4UTRA 2UUOA 5HE8A 1ZK1A 5H80A 2Z08A 3GGGA 2BCEA 3EH1A 2A9QA 3HSSA 4JBXA 2YV5A 1MFZA 2CLIB 4MUBA 4RQBA 1RBZA 3A1CA 4WX2B 5HR5A 3QWBA 3S40A 4PC3A 3GNLA 5IK2A 1K06A 2H8GA 2TS1A 2Q0XA 3F4KA 5BN4B 5THKA 1ZO8A 5JV5A 4DCPA 1ZH6A 1EB9A 1VDMA 3I4CA 1SA0B 3IFSA 3NP7A 4HYEA 4BDSA 2RCNA 5HKKA 3JYOA 5T4BA 1ISPA 5BV1A 3VBEA 5KHOC 2NSDA 3AESA 3U4MA 2XYQA 3TTXA 3C6ZA 4F9FA 1OY1A 4PZZA 5IKOA 3TZLA 3ILYA 3C3DA 1THGA 4MMZB 5F9MA 1D0SA 1Q0LA 2GF2A 3BMNB 4QFDA 3RG8A 4WBNB 2QMQA 5HKBA 4DG5A 2PBLA 3COPA 3LH5A 1WGCA 2VWGA 2YNMC 1FVHA 1X0XA 3E9ZA 3R5XA 2O54A 3CZMA 4E5YA 5LP6A 3D59A 3O21A 4ZOCA 1NVTA 4O2BB 4LJ7A 4TTQA 4ZJYA 2ONKA 4FEGA 1K7CA 4IXDA 4YDRA 4YIKA 5E4JA 2VTVA 1M76A 2GA8A 4MQEB 2NXNA 1ATIA 3U3RA 1KO8A 4TTJA 1QH1B 1UXGA 1P77A 2A57A 1HDEA 3IVGA 4EVRA 1NY5A 4YUAA 3PQ4A 4RDCA 4IDOA 4TL6A 5F7JA 4JBIA 3UN1A 1WV1A 3OBIA 3UJ8A 1VBKA 3P71T 2J5QA 5A03A 2PHZA 1EP2B 1WCV1 3JYPA 4C7XA 1NVAA 3VI4B 4JV5B 3BXEA 3UAVA 2ZE8A 2PO5A 5EX3A 1G7SA 5SZKB 1P5FA 4EA8A 5JXJA 3OZRA 1XTVA 2KLHA 3ENNA 1XQ1A 3HB7A 2HXYA 4YECA 5E7IA 1KEVA 1S2IA 1FP6A 2GUWA 4E5NA 3ZVKA 1T0HB 4BZPA 2O3QA 3AK4A 4YAIA 3H84A 1HPLA 1N7GA 3QX3A 2W71A 3T0FA 1OFTA 4D6PA 621PA 2A9RA 4TXNA 4CQMA 1L5YA 4IJVA 5B55A 1W5SA 5C53B 2XMDA 4WESB 3SHFA 1Z6AA 4NG5A 2O7QA 5AJHA 1KF0A 1LEHA 2Z3ZA 4F06A 4KNVA 1JXOA 4YCJA 4WEQA 4UBKA 4TRJA 1ISSA 3MC1A 2GETA 4BCDA 4C6SA 2JCBA 4M83A 4HNRA 3FKJA 4R16A 4BUJA 1G5RA 2XWPA 3RVBA 4GC9A 1BSVA 1GFIA 2QN7A 2Y0DA 3GJYA 3RYHB 5CEFA 1W36B 3FZEA 4MUNA 4US0R 4V0MA 2OV8A 4WLVA 3OT4A 5K5EA 3R6LA 3Q1KA 5A4IS 3X0DA 3BQNB 2II6A 2IZOA 4K2AA 4RESA 3OCJA 3RVSA 3LWNA 1N5DA 4GH5A 4P81A 2NIPA 4GYYA 4AP9A 1ZINA 4JUCA 3MBKA 4HAUA 5EIBC 5JCOA 1E3JA 1NJSA 4RENA 5AKXA 2M9MA 3FIUA 2FTKE 4CM8A 1E9CA 1PTJA 3EEOA 1RWKA 2DR3A 4EAQA 5EZYB 3UCXA 4YQFA 2QYOA 4H15A 4JB2A 1R0WA 2YQ4A 2W2LA 4KQ6A 2F59A 3MCZA 5IZ4A 2KB0A 2A9KA 5DYGA 1P9LA 2FPUA 3ICVA 4PN3A 1PJLA 1L0BA 5LQRA 5AKHA 2BM9A 5C7YA 4KUHA 2HO5A 1QHNA 3VVMA 3NGXA 4PZYA 1J20A 3OPYA 4H3KB 3OQMA 2O8FA 6LDHA 2P6NA 1N33B 4R68A 2C31A 4CHGA 3DEKA 3JTEA 2ZTLA 3JW8A 1DQYA 1TMKA 1XCPA 1PWXA 1VKZA 2YJ4A 4MQFB 2ZVPX 3BJIC 2ZSAA 3ROZA 3TD9A 5LXTA 2CXQA 4Q1DA 4BNNA 4TV9A 4N0EA 4KSCA 4O25A 4V02A 1X7YB 2FEAA 3P9IA 4NYJQ 4AQYB 4TYQA 1XLWA 4TKZA 2NZUG 4OQFA 1P9NA 1XAHA 1D7OA 5CVJA 5AM1A 5BSMA 3WKAA 3FI0A 1O94A 3IMGA 5CH8A 4LKOA 5LZ2A 5D51S 2BFFA 2O3SA 4QUDA 2JKYA 4QBGB 3DJFA 3WG9A 1N1DA 2XGJA 3E05A 5K3DA 3PL5A 1UBUS 2PL9A 3RLFA 4OQZA 1MG5A 1SU7A 2F67A 4B34A 5ERYA 4QASA 1CRPA 2C9CA 4KXVA 1GCOA 4FCCA 4OFXA 3I5AA 4UTNA 2NUBA 2RI6A 2I54A 3RASA 4GYJA 5I9IA 3DL4A 5KQGA 5CG2A 2PKXA 2GOYA 3P27A 3R7NA 4WCFA 4RWZA 2PSJA 1RS0A 4EZBA 3IQZA 4KVAA 3U3JA 4OGFA 5ALTA 1VYHA 1FX0B 2XKBA 3ZQ4A 5J5VA 5D6OA 2AD1A 2B3TA 3VNSA 1U28C 4MV7A 3ZOKA 4CN9A 1YJ8A 2HPAA 2IP1A 1L5FA 4HB2A 4O5AA 3IR7A 1RJ9B 3VVBA 2YMMA 4KXXA 4W1PA 5KOJB 5KVSA 4BLRA 4TSKA 5ILOA 2YY5A 5EMMA 4WKPA 2HCBA 1I2AA 2BBWA 2G67A 2QB5A 4JQSA 2Z2IA 4Z86A 2R65A 3ZWCA 3OIVA 2DJ5A 3PPXA 5E3RA 1F2TB 4LVNA 1W87A 3FUCA 4PAWA 5M5BA 1HNXB 4DIDA 3D2CA 4S1TA 1QHYA 2R1ZA 5LD2C 4XJVA 4L85A 1YBHA 3C6KA 1KH2A 2NWQA 4MHTA 4ZAZA 4V2IA 4G23A 2YINC 2YUIA 4FHFA 2HKIA 4X71A 1PS8A 3DEZA 3FGNA 4B7UA 1H6BA 5DZSA 3L6CA 1G4HA 1ABFA 4LY3A 1NP7A 1ZBDA 3ZVRA 5KYYB 3HVIA 5IH7A 1W5TA 1YQQA 5JVDA 3TW8A 3IUMA 2D13A 3JCZA 1E3WA 3KFLA 1W49A 2ACKA 1VFNA 4B3HA 2CCKA 2VT2A 4QWWA 4WFQA 3T7DA 1UMDA 4PGGA 5K9ZA 3DC7A 2PA3A 4AMUA 3M4NA 1L1EA 2O2YA 1QF9A 3PC6A 5BVGB 2FX5A 1SCNE 3E22B 4X1IB 5DPMA 2RGRA 1DIHA 3LC7O 3IV9A 4B6RA 2ZXFA 2DWCA 4N8DA 1FDSA 3QY9A 3I53A 3AQIA 4X1YA 3DDUA 5FPQA 1XZGA 2DOKA 4HB4A 3FFXA 3ZX4A 2LB7A 3EOZA 4KU4A 3DONA 3O4HA 4KIUA 4MPDA 2ZAYA 4DV5B 2W2QA 3UOGA 3FCYA 2A9VA 5CLJA 4UNIA 2HTFA 3VYSB 1LRJA 4OMFG 3I72A 2JD1A 1B8NA 1YVDA 1NJ1A 2H2FA 2M2IA 4R1MA 4HFJA 1V7CA 3W9UA 3ND5A 1ZC4A 4CUKA 3SCZA 1WOMA 3SIWA 4MGIR 3BJZA 3A2KA 5IU6A 6REQA 4XWKA 3ECSA 1H0KA 2H1HA 1AKNA 4XB2A 4AJ2A 4C7OB 4C1NA 1JQKA 4DNPA 4HHEA 2R8PA 1HMYA 1G18A 2GZ1A 2H16A 1IRIA 2Y9PB 3BILA 1K7XB 3DBIA 1CRWG 4OOFA 2IV7A 4DV3B 1X14A 2GN1A 3LLMA 1QP0A 1FNSA 4JR1A 5ICCA 1TLFA 2QA5A 1C0PA 1T2VA 1W36D 1E0DA 1I24A 1M2WA 2D3WA 4PPQA 2OV4A 2Z6VA 2WFLB 3ROTA 2Q6IA 1U7UA 4FN5A 2OBXA 4ZYTA 3G1UA 4HXFB 2AH5A 5EZQA 3PS9A 3EEYA 2D1TA 3L6EA 5DDIP 3JASB 4UW9A 1TYBE 2OGTA 3DBHA 2V55B 2PEYA 4XFJA 1C4OA 1WDWB 1T26A 2QY9A 4IDHA 4XKJA 3OIDA 3AV3A 1T5TA 3P9NA 4MWBA 2PZ8A 5JATA 3IIIA 3SF8B 4DBLE 1U5AA 4UFOA 2Q9AA 5BUZA 2HHCA 2O8VA 3ZU3A 3REQA 3A3OA 3UG7A 3BL8A 2B25A 4I36A 3EG9B 3AFNA 3U19A 2IP4A 4AURA 3LT5A 4DYHA 5MN6A 4JH0A 3B78A 4BASA 4H6WA 2AZMA 3PKZA 3OQHA 4A0HA 5IJWA 2QX7A 3P5SA 1CZRA 3GH1A 1U02A 5K20A 1NV8A 1ISHA 1BROA 4FWTA 1TM3E 1VJCA 2PU5A 3LBYA 5EXXA 3CF0A 3HPQA 4RF2A 4GMHA 2V1CA 1BN6A 3GPCA 3WDMA 5J3JA 5DM70 1GPAA 2H54A 3C3KA 1QYWA 1GGVA 4H27A 2JANA 4N12A 4D9GA 3UMMA 5KYKA 1TAUA 2LZ0A 2W9XA 1FY7A 2I6XA 1KDOA 2VUHB 2RI1A 1YB1A 3CB2A 3IS3A 4J07A 2HU2A 2X5OA 4MCIA 1M8PA 5E3QA 1QE0A 1ZGBA 1ZUIA 4K9RA 3S1AA 2NU2I 4I99A 3K5PA 4JL6A 3TSOA 4RGQA 4Q00A 3HJFA 1KI3A 1U5CA 2PRJA 3K9WA 1A5TA 3U4IA 4MI1A 2EP8A 3DNPA 4GM4A 1K7SN 5BR4A 1E1QD 3K20A 1T3TA 3Q2KA 4IIFA 1XZHA 3N75A 2HK9A 4RJJA 2Y27A 4KPFC 2G0NA 4BVFA 2KCXA 1E0SA 5CDHA 3H6GA 5I9TA 2CFSA 1JVNA 2IHYA 3DHVA 3A28A 2BGMA 2FEPA 2PA0A 2V1UA 5ARDA 5KWSA 2JZNA 4MYDA 3G82C 3ZDAA 5DNAA 4TLDA 1RQNA 2QVGA 2AKAB 2X4LA 4KQKA 5DCYA 1YCDA 1JHUA 1OBCA 3L7JA 2XXAA 4FGUA 4YAUA 3I09A 4OK3A 3UA3A 2YIDA 1BRTA 1S01A 1SOAA 3QXJA 3T6KA 1QFXA 2RGCA 5CFQA 2AOUB 3N2ZB 3ZEIA 3ITNA 4OL0A 2TMKA 4EJSB 2Y05A 3IMKA 1XSEA 2BHRA 3KB8A 1OROA 3CVJA 4W6ZA 3FMGA 4HRAA 4IMIB 3MBOA 4BRWA 2WVJA 2HEIA 3RGGA 1N8SA 4XA8A 1XTTA 2XGSA 2OUIA 2CFCA 3T41A 1F2VA 3R5BA 3EIUA 1E3QA 1RM5A 5IAKA 2IELA 1XWWA 3HEBA 4BEBA 1ZJ4A 4NV0A 3D0KA 3I9V1 4P35A 1KC3A 5C34B 7REQB 4DR1B 4GOMD 2VYVD 1Z82A 3ZJTA 3V8EA 3UT0A 5D5HA 3V8QA 4IL5A 3K6SA 4GGMX 4N5LA 1MLDA 3U3XA 1XWIA 2E9SA 2ZIEA 3QVVA 1WX1A 5K1ZA 1EFVB 3HUUA 1QH8A 3FTPA 1RKQA 3PNMA 2BUBA 5EYPB 1JG1A 2Z09A 3BE8A 4AX8A 3IHLA 3RWBA 5TLSA 4H1HA 2RAPA 1P5HA 3AEQA 5JFGA 1VYVA 1WPXA 2ID7A 3AY0A 3HNPA 4DR2B 2D2XA 4E22A 1KDTA 5D6NA 1GRCA 2HBZA 3X1KA 2H1LA 4KLAA 2B94A 4ZT3A 2WPNA 3ERCA 5LNK1 1FJGB 3N8GA 1O5IA 4RK7A 4F1JA 1FUIA 2NAPA 2PGDA 3I8XA 1EDBA 3ZWQA 1W35A 2QR3A 3A10A 1WHTA 1YS6A 4OP1A 1F8UA 1GTSA 3WYGA 1C1DB 2ZIFA 1D9ZA 3T9BA 1PS0A 2FW7A 3A11A 1YTLA 5H81A 1LC3A 1TJYA 5B1SA 4D9NA 5JTUA 4X1KA 1YHYA 2C5BA 2QG4A 2QLMA 2NTYC 5L95A 4CEJB 2FOXA 4KR7A 1ZN8A 4LYFA 2BFMA 4XEHA 3G6WA 1DX6A 3O4GA 2OV6A 3CXLA 1GPWB 3E9EA 2IYRA 5AKZA 3JATB 4BFSA 5IVKA 1NPYA 3IQIX 3FOZA 2QPLA 1DDIA 3EJ6A 3E18A 2CYBA 2OD9A 5JS8A 2VZ8A 1A4IA 2YZKA 4L3VA 3L05A 1HOTA 4LNUB 5I7WA 1GWNA 5CTJA 3KEGA 2RAVA 1SB9A 3D7KA 3MINB 4Y9SA 2Z6UA 2P67A 5C8YB 3FHCB 1AURA 1X7ZB 3NASA 3VI3B 4D02A 1E6EA 5FUVA 3TZEA 5ALYA 2Z04A 1H1LA 5KWVA 4IG9A 2YNMA 1YHZA 2B6NA 1DKNA 1PQWA 3A1SA 1SCAA 3DPUA 4IIDA 2IY7A 3THSA 3JQPA 5AW2A 1CQZA 4BO4A 2Y1XA 9ATCA 3UEJA 2VDVE 3D4IA 3I64A 1J9GA 3I0ZA 1HI9A 3AFIA 1UFKA 1DCTA 1K5GA 1SMKA 4X64B 1SHLA 1VBNA 2YOGA 1RPAA 3DE0X 4NHOA 5CNKA 3GZNA 2G9VA 4ZVTA 3AUJB 3MWLA 4KX5A 3DB2A 3R5KA 4MA5A 2OP0A 4A1OA 1Z5NA 5KS2A 1AMUA 2HN9A