2JA1A

Thymidine kinase from b. cereus with ttp bound as phosphate donor.
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
193
structure length
193
Chain Sequence
GSMYLINQNGWIEVICGSMFSGKSEELIRRVRRTQFAKQHAIVFKPCIDNRYSEEDVVSHNGLKVKAVPVSASKDIFEHITEELDVIAIDEVQFFDGDIVEVVQVLANRGYRVIVAGLDQDFRGLPFGQVPQLMAIAEHVTKLQAVCSVCGSPASRTQRLIDGEPAAFDDPIILVGASESYEPRCRHCHAVPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Studies of Thymidine Kinases from Bacillus Anthracis and Bacillus Cereus Provide Insights Into Quaternary Structure and Conformational Changes Upon Substrate Binding
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Transferase
molecule keywords THYMIDINE KINASE
total genus 49
structure length 193
sequence length 193
ec nomenclature ec 2.7.1.21: Thymidine kinase.
pdb deposition date 2006-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00265 TK Thymidine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2ja1A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2ja1A01
3C7KA 1E4YA 1LF5A 1EFRA 2J45A 4DSUA 4FMCF 1G17A 3A37A 3I73A 2NMVA 5BN3A 1NMYA 1S9DA 2ZJAA 5AR1A 2WWHA 4BECA 3KQKA 3LXXA 4N1AA 4PZYA 4XVQA 1QVAA 4BFUA 2PEZA 5LD2C 1NVUQ 3M1IA 2NIPA 5LBIA 3SE0A 2WWWA 4M8NE 2VYFA 4PPGA 5JJIA 3IBYA 3GLFE 1G18A 2ZRHA 3JZAA 2ZANA 4BLQA 1E9EA 4TZ6A 1XTIA 2JJ2A 1JJVA 2CL0X 2ZU0C 2VP4A 4JBXA 1FNMA 4QOSA 5CM9C 1A2BA 5KDOA 3AVPA 2CNWA 5B64A 1SXJE 3PUYA 2W00A 2ZSAA 1ZIOA 5EUQB 1KKLA 3ZD6A 4O3MA 2CHQA 3FWYA 4CDGA 3THXB 3ZZ0A 2QP4A 2ZRGA 4DLUA 3EC2A 4TMKA 1OH5A 2F43B 1OKKA 1AS3A 3GJ4A 1GNRA 3VU9B 4O0MA 4HSEA 5DLQC 4KYIB 4Q01A 4TL9A 2ORVA 2QU8A 2YWHA 2OBLA 2F1JA 1J99A 3KL4A 3OE7D 2Q3MA 1UF9A 2VO1A 4RD1A 3TR5A 4KYUA 1G20E 1Q44A 3HPRA 1HA3A 1JBKA 2XZOA 2REBA 1GRNA 3UWKA 1BYIA 1Z6GA 1CR1A 3EZ6A 2V6JA 4UNRA 4KBFA 3W8NA 1IM2A 3UMFA 3GLGA 3WHKA 3WHLA 3VMFA 4OJQA 4NU0A 4G1UC 1AA9A 4BE7B 1E0AA 1EX7A 1Z0KA 2BIFA 3IEUA 4DEXA 4D4JA 5JFGA 3PEYA 3UPUA 1T0HB 3MWLA 1CBUA 4NTZA 2AKAB 1J90A 2XZPA 1SHZA 1KNXA 4XWKA 2CK3A 2HF9A 3LWNA 1X8JA 4AD8A 2R6AA 1GITA 4DXAA 3P4XA 1CJMA 3CWZA 1NBMD 4IJMA 3ZVNA 1VKJA 3BB1A 3I3SR 1E9SA 1S8FA 3KUCA 5EZ6B 2N42A 1FP6A 2GZHA 2VP9A 3MG9A 4NYMQ 721PA 2A5FA 3THYB 1U8AA 2PT7A 1OF1A 2E87A 2BMJA 4CT5A 1TQ4A 3FB4A 5JCPA 2D7DA 4EQ6B 4QGAA 2NO0A 3B82A 2DYKA 4UQOA 2CXXA 4R9UC 1UEJA 3LRPA 1OIXA 3OF5A 4XOIA 1OPXA 3W8RA 2IS4A 2WTUA 3EPLA 4JYCA 1OH8A 1WP9A 1R0XA 4XIGS 1P2SA 3CH5A 3TH5A 1N5KA 4D0LB 2FE4A 1KDOA 3TIFA 3V00A 4MA4A 3VX4A 3KTAA 2DWPA 4FWTA 1ZU4A 2E1RA 2J46A 2ZE8A 4IXNA 4ZO4A 3EPHA 2W2TA 2MMCA 4UXHA 1C9KA 3K0CA 1JNYA 2P5TB 1AQUA 2GTPA 5FL7D 5J4HA 2B21A 1KY3A 4MYUA 1NRJB 4DCTA 1NNEA 5J4YA 1XMIA 4GPTA 2RGXA 1CJVC 4WW0A 4BZXA 4LBWA 4PC2A 2FA9A 5B58C 2R6CA 1GZSA 2RMKA 3SJZA 3WNDA 3PFIA 4QFMA 1NSTA 2ANCA 4JLJA 1E9CA 4IDNA 5FI1B 1Z08A 4PANA 4DDWA 5BQ5A 2QE7D 1ESMA 2ZRAA 1E94E 1A2KC 3MWYW 1G8FA 3ZVLA 5FFMA 3CNLA 2ZRMA 3U3KA 1SVKA 2IX3A 4QM6A 1NN1A 4HB3A 1C1YA 4TN1A 1JPNA 1KDTA 3VR1A 2EWVA 4A6XA 4GFDA 3I1FA 4MITA 4V0OA 2FN4A 1LVGA 4TTRA 1MKYA 3NBFA 4NYIQ 3I72A 2IW3A 1DE0A 1ZJ6A 1G8YA 2KSQA 3CPEA 2CBZA 3BRWD 4P4UA 4HUTA 4Q1EA 4R7ZA 4II7A 2E73A 1U9IC 3FTQA 4Q4HB 1N6PA 4Q9JA 2OCYC 1H8EA 2RKOA 2O8EA 2LKDA 1F2TB 1P73A 4JYBA 1FARA 2PJZA 4I4LA 4LV5B 1WXQA 1CU1A 4JKIA 3LA6A 8OHMA 4B47A 4KI0A 2ZEJA 4PPQA 4PZZA 2WSMA 1DG3A 1XJQA 1OH6A 4Q21A 2A2ZA 4M1OA 1QDEA 4KFUA 1XTJA 2RH5A 1FTNA 2F3RA 2MMGA 4P33A 4HZIA 3C5CA 2W2VA 3SBEA 4YQFA 1KI6A 4JT2A 4KAXA 2V1UA 5KSZA 3ZZTA 5CDFA 5FBLB 3KXKA 3OEHD 3U44B 2MSEB 3JVVA 1L4YA 4YMVA 1G7CA 4LSGA 3SZRA 1DADA 3UEYA 1PTRA 2K5UA 1GKYA 2PBRA 4YLGA 1GKUB 1P2UA 3BAFA 3UGIA 2JIZD 5F2EA 4BWYA 2GZDA 2GCOA 1YHNA 1KI1A 3X1WA 3DOEA 1KDRA 3QBVA 5J4LA 3TMKA 2O8BB 2UKDA 1Y8FA 3GJ5A 3AF4A 1CS4C 2IT1A 3K0AA 4A8JA 4P32A 2FSFA 4FMCB 3D6TB 2QA5A 2JLVA 4OQXA 2WJGA 4Q4AB 4HAWA 4YMUA 3B78A 5F98A 4P31A 5KSOA 3T61A 2BWJA 2BBOA 3Q5EA 3DL0A 2EFHB 4TMVA 1WBBA 4C9BA 3LBIA 1G7TA 1II0A 3VTKA 2JASA 4HI0E 3TBKA 1NN0A 2FMXA 3P1JA 2BM0A 4MRVA 5AJXA 2PT5A 4C0LA 3QF7A 3GPLA 2Q9BA 3E5HA 3SJCA 4QNMA 2CJWB 1BKDR 3LW7A 3B13B 1OV4A 3KKOA 2W83A 1NN3A 1N0VC 4P4SA 1I2MA 1N2CE 1YZLA 2EFEB 1IONA 2ODBA 5EE0A 1O87A 4ZCMA 2VSFA 3UATA 2NO9A 2JLSA 1LW7A 4UNNA 1UDWA 2O0KA 4Q1DA 1JAIA 4M1WA 1KKMA 3EPKA 1T0JB 1MABA 1M74A 1SULA 2RHMA 4G01B 4S2EA 4DCUA 4US0R 3IIKA 3TSZA 1IN4A 3QPUA 1XMVA 4DBLC 3EIEA 2A3RA 4JLNA 3PUXA 2YC4C 1G6HA 1NY5A 4B35A 3UGLA 1DVRA 3PITA 3UEJA 3H2YA 4CEJB 1W0JA 4IFEA 2DWQA 2D06A 4GL2A 1X6VA 3M0EA 2ZIAA 1AM4D 1F6BA 1OXXK 4EPTA 2W6JA 3EG5A 1KYIA 1WDTA 4PC7A 2N46A 1OXUA 4L9MA 4HZUB 3PCRB 3A1SA 1X8KA 3NVAA 2CMKA 3R8CA 2IYUA 3N70A 3DMNA 4OHVA 3T5GA 1VG0B 1ZBDA 2DWOA 1KI7A 2JLXA 4HDQB 2IS2A 2GF0A 1FTSA 4DLXA 5E7JA 4P4TA 5CJ2A 4DSNA 3RWOA 1GKIA 4OYHA 2PX0A 2X1VA 4HAYA 1K5DA 2C04A 4BFWA 4HUQB 1ZIPA 5DISB 3RS4A 1D9XA 2X2EA 4JZKA 3RNLA 1Z2CA 1RFLA 2ZUDA 1IN5A 4TYYA 1R8QA 3TSOA 3U3MA 4LHXA 4KU4A 1TX4B 2J7KA 2QENA 1Q1EA 1E0SA 4V03A 5SZHB 1E2FA 2ZRLA 1P72A 4DDTA 2KE5A 4Q7LA 3T1QA 2VL7A 2WKQA 4KBGA 4JBYA 1M2OB 4BQSA 1GL7A 2NGRA 3W9YA 2EQBA 2H8KA 4AI6A 1ZCAA 4OJKA 4FMBB 4F4IA 4XJXA 1XA6A 3PEWA 4LV6A 4A4DA 2NQ2C 4OQFA 4DLTA 2WMOB 3ND8A 5JECA 1HV8A 3GLFB 2C9YA 2J5XA 1AJEA 4Q4HA 4BGDA 3EWAA 2ZYVX 1II9A 4RJLA 4EAQA 3AVVA 1AKYA 3F0TA 2EFCB 3RS3A 2QPAA 3S1AB 3IHLA 5GJCA 1U2RA 5TB5A 1DOAA 4PSAA 3RC8A 3C16C 1OE0A 4TTQA 5DN6A 1Q3TA 5L3SB 2QY9A 4B3FX 1W4AA 2IYSA 2OESA 2ODNA 2GXSA 4H1VA 3BS4A 3L0IB 4BFXA 1Z63A 3IEVA 2V9PA 2C2HA 3AKDA 4F4CA 5C4MA 2IYQA 2WSSD 3VNVA 2D7CA 1OFHA 5BYJA 3AM1A 3H86A 2RGCA 1SKYB 2OLJA 2FNAA 2ZVQX 5FI0B 1P2VA 1YZNA 3TQCA 4IVPA 3KKQA 4Z8YA 3QKRA 3Q7QA 4ZDJA 2IL1A 5SZIA 1RRPA 2I1QA 1QVRA 1SGWA 2YOHA 1XDBA 1L8QA 1DEKA 2BBTA 1JXOA 4QBHA 2O8FB 1LS6A 2GETA 1NJFA 2VRWA 4WZ6A 5CB8A 3RS5A 1S9HA 4TMZA 1B23P 1EFCA 1KJZA 4I1SA 4NL4H 3B9PA 4FW9A 2D2EA 3OZXA 3LBHA 5E7MA 1UBEA 4Q5IA 4TL7A 4A0RA 3K0SA 2R8RA 1ANKA 1XPOA 4CVNA 3ND9A 1DG1G 3WBKA 2CDNA 3OFND 4M4SA 4UXJA 5IK2D 1Z6TA 4MKHA 3OEHA 3WRXC 4R2IA 3K70C 1P62B 3QBTA 5FTKA 1G6OA 2PEYA 2GJ8A 4G5RA 2Q0HA 1AQYA 4LWZA 1CJKC 4TMTA 4KFTA 5EZ5A 3EPJA 4OL0A 3BE4A 3BD9A 4B2IA 3FHOA 4V0ME 3NTUA 4LDJA 2HLDA 4JBWA 5SZJA 3THWA 3K9NA 5JRZA 2XXAA 4YXWA 4KVAA 3A4MA 1AGPA 2ZYWX 1HYQA 3FDIA 4LZZA 3MJHA 5FBRB 5CK5A 4URZR 1G5TA 1GDDA 3GLHE 5H70A 3SYNA 1CKEA 1KNQA 1US8B 3T5DA 1WE2A 1U90A 4Q9LA 1XB2A 1QHGA 1Y3AA 4AKEA 1F3OA 1O3YA 5KPDA 1GSIA 2HYDA 1W5TA 2GHIA 1TL7C 4BFSA 4IDPA 4KV9A 1VYVA 2R44A 1DAIA 1WQ1R 3QNUA 1AGRA 1SVSA 5DHFA 5BYKA 1JEEA 4A0GA 3FKQA 2RAPA 4RD4A 4MRNA 2VBCA 1JJ7A 2BMDA 2ZRDA 4BEJA 2OE2A 2JLWA 1JR3E 3QXXA 1YU9A 1RC8A 3MMPA 5FOSA 1ZD9A 1PV4A 3R7WB 3BFVA 2JLRA 4DT1A 1DARA 2IF0A 4TMWA 1EFTA 2H16A 3O8RA 5AK0A 3IGFA 4LY6A 4AKHA 3U7FB 1JR6A 2OAP1 5KDDA 1ONBA 2GAAA 1ZAKA 2PZFA 4DDVA 2ZITA 2GVZC 4KITB 4TL8A 4PHFA 3TQFA 2E9SA 3OIVA 3QQ5A 4UNPA 1T5LA 4PPFA 4LJYA 3U44A 1GNQA 2BKUA 1A7JA 1XP8A 4C30A 3TNFA 2ASEA 3OIUA 3IUYA 2O8EB 4BRWA 5KSPA 4Q4AA 2ERYA 3C8UA 5FTNA 2ZJ2A 4NCNA 4NH0A 3ADBA 5DYIA 4BZQA 4EFMA 1A5TA 1H65A 3KJIA 1NVWQ 1UKYA 2FNFX 4AC9A 4OK5A 3THXA 1T9HA 2WMNB 4HB4A 3W34A 1G16A 2J0QA 4BLTA 4AKIA 3OIYA 4DHEA 1VG1A 3QSYA 2ZI7A 4W5JA 4L8GA 3K09A 2G1JA 5B30A 1TUIA 3VQTA 2P65A 1CEEA 4QC2A 4RY2A 3VKGA 2NTYC 2AK2A 2FWRA 2JJ1A 2VLIA 3FMIA 2WPDD 2EYQA 3CONA 4Q03A 2BOVA 2PX3A 3CRW1 4IVRA 5TMPA 3CNOA 3NH9A 1KTVA 5HZHA 3F5FA 2F1IA 5KPJA 4ZKDA 1CULC 4D80A 4TQUS 2ZM5A 2JCSA 2V55B 1HT2E 4Q4JB 2QI9C 1J7KA 4M21A 1I4LD 1TU3A 2CNWD 3IQWA 5CJPA 5C4GB 3C15C 3KDSE 4JS0A 5H68A 4M1MA 3ADCA 3NG1A 2QE7A 1NSFA 2O0JA 3GJ0A 3EZFA 4I1UA 4L15A 2L0XA 2KJQA 3CKLA 2FEMA 3LQQA 1QF9A 2BCJQ 1VIYA 1X8LA 2NOAA 2GBLC 1OXVA 2ZROA 2G9NA 1J8MF 1HH4A 1XRJA 2JJ8A 4JKYA 2O5VA 1OXSC 5DHAA 5JBQA 2WM9B 4PO1A 1ZU5A 1SXJD 1TADA 5FPTA 1WMSA 1NBMA 2QRZA 2BJVA 4BLPA 5AJVB 4LC0A 1E2KA 3CUEF 1CF4A 1N5JA 3GJ8A 4QGHA 1II8B 4B32A 3TLXA 3AVOA 3D7MA 5JRJA 3FHTA 1D9ZA 1GOTA 3QENA 4CRWB 3SU8A 1DAEA 3LDAA 2GA8A 1PLLA 2RGNA 1N5IA 2FPMA 1G7SA 1XU4A 4UNQA 4CEIA 2X19A 1SHKA 5EXTA 4JLMA 5FL7A 1R10A 1YJ5A 4B6FA 3PUZA 2FPLA 2ZSEA 2GJ9A 3HU1A 5GVRA 3EZ9A 3CPHA 4HUQA 3NBYC 1FFHA 1RW4A 4WIAA 4DJTA 5JWHA 2WAXA 4DIEA 2KI5A 3RDPA 5FPKA 2AFHE 1U8ZA 1G3MA 3BORA 1X1SA 2ATVA 4HAZA 2V7QA 4LBYA 4PR0A 1YR6A 4TSFD 1E0JA 5CB6A 1EWQA 3CM0A 3OFNA 4A92A 5DH9A 4TYNA 1UBCA 2DFKB 1OIVA 1XTRA 1GG2A 2JGNA 4FCTA 3WP1B 5L3RA 3NEYA 4NP6A 1XCMA 5EXXA 4PO8A 1NKSA 1IN6A 3F3YA 3SR0A 5JWOA 2YOFA 3GP8A 1IY2A 1R0WA 5K8TA 1CIPA 1XMJA 2OXCA 4F7WA 1G9XA 4ZCLA 4M1KA 3AUXA 3C14C 2QSZA 4PQYA 2ZQ5A 1YRAA 5FUVA 2RGAA 3L43A 3A36A 1FMJA 4AURA 2GAOA 2QQ0A 2BKEA 2OUKA 3W90A 2X77A 5AJZA 1UBFA 4QJ4A 1G64A 1GTVA 1Z28A 4Q4LA 4YXWD 2DFNA 1KI6B 2VP6A 1KZ7B 5BW8A 3SFZA 4FN5A 3U5ZB 1TAGA 1NN5A 4EPXA 2QMHA 1OFIA 3SOPA 3B1WA 4UNSA 2XZLA 2J7PD 1M1YE 2WWIA 4IDOA 1Q3HA 1KO1A 3AP3A 4LHYA 4HLUA 2WBLC 4IXMA 1E98A 4C3ZA 1NBME 1M6NA 3SYKA 1VG8A 4QL3A 4QM7A 3C41J 1U81A 3PEUA 1ZP6A 2QAJA 1P3JA 4LHWA 2FFBA 2VSXA 2B6HA 1TF5A 4LRWA 4IW3B 4RFVA 5J5CA 4XTRA 3BBPA 3IQXA 3EZ2A 3AF1A 1IY0A 1UM8A 2H92A 1VHLA 4KSBA 5AUPB 1A82A 4ASUA 2V54A 3FE2A 3I8XA 2WV9A 3QKSA 1RYHA 2F1RA 2QGZA 1DPFA 1ZC3A 4D0GA 1E2LA 3FFBA 4NE2A 3P26A 2WHXA 1KHTA 2IHBA 3SFVA 4GP6A 4W7SA 1M8PA 5AWFC 4G5GA 3SHWA 1E9AA 3TAUA 1ZVQA 2P3SA 2I3BA 2RCNA 3TE6A 3UWOA 2REOA 1KK0A 1S96A 4O2LA 1W0JD 3AGQA 2ZS9A 3RABA 3K9LA 1IXSB 3QG1A 3VR3A 2DB3A 3E2IA 1G21E 1IOZA 3OIWA 1TNDA 1D6JA 1KI9A 4NCHA 1DAHA 4A2PA 4DC9A 4AG5A 1Q21A 1OIWA 4JL8A 4JVNA 4G5QA 2JAQA 4GI7A 3WP0A 1RFHA 3A4NA 2B92A 2G88A 5DN6D 1HURA 3UMSA 5JZVA 1CRQA 1XFAA 3BWDD 1CJTC 1G19A 4D82A 1IAQA 5LB4A 3TW4A 1U9IA 1M7GA 1EFUA 1RE0A 5K8LA 2CE7A 2ZRKA 1KIMA 3ICEA 4L4UA 2I4IA 5CIQA 3NDBB 4LPSA 3WYAA 3A1WA 2Z4RA 3LX5A 3CF2A 4PAMA 3BB3A 1AS0A 2UVQA 3TUIC 5F9HA 1II8A 1NI3A 2PMKA 3FGNA 4HLCA 4HYYA 4L9SA 1KK1A 1P9WA 1ZM4A 1Z8FA 4OBEA 5JWRA 2BCGY 3K0FB 1XNJA 1EFRD 1ZM7A 1F2UB 5G3YA 1FX0A 1MR3F 5H8WA 1TQ6A 3K9GA 3P32A 4TTPA 2QL6A 5TARA 4B34A 3EAQA 4WXRA 2XOKA 1ZC4A 1NIJA 2Q21A 2VHUA 1ZNWA 2XSZA 3GFOA 4PSVA 5KDLA 4BFVA 4UJ3A 4B33A 5HE8A 3MFYA 4D2IA 1TF2A 3B7GA 5P21A 4LJ7A 3WNBA 3DHWC 1GP2A 4OI2A 3U7HB 4A82A 1KZGB 4MGIR 3CF6R 2KB0A 4CF7A 2HDNB 4DB4A 3FKSD 1RPZA 3E70C 3NEJA 1JR3A 1DAKA 1E1RD 1E79D 1IN7A 1XD2A 4Q9HA 3AF0A 4TWZA 5HCNA 1TQ2A 4X8HA 3O8BA 1AK2A 1G8GA 1KAOA 1Q0UA 3BJIC 4D25A 2IS6A 2KBFA 3CLVA 4MGKR 2CLDX 821PA 3LO5A 3KFVA 1OW3B 3K0EA 1OLOA 1XTKA 1EG7A 3W6NA 4QHSA 2AL7A 3P20A 2HEIA 1VCOA 3V9PA 4KLNA 1YKSA 1FPMA 3KB2A 3AVWA 1ZD8A 3DKVA 3GLHA 2P67A 4QXAA 4WZBE 2QP3A 2ZJOA 4HLQB 3ZH9B 5GJVC 5J40A 3BIFA 5FTLA 1VCMA 3PJRA 1Z0JA 1Q12A 4HB2A 3MJRA 1Z2AA 2J0UA 4ACAA 2EFDB 2QUZA 5KU1A 2HT6A 3X1DA 5E4FA 4Q7JB 4FKDA 3CBQA 3OEED 4V0MA 2IYZA 4G3XA 3RLFA 3PR1A 5LDDC 2A9KA 2V4ZA 2QORA 4UKDA 2O8FA 3IDQA 3K70D 1D5CA 1TBOA 1SKQA 4M1TA 4LJ4A 2HLDD 3BH0A 4B74A 4MGZR 1KSFX 1YR8A 4DUGA 1P61B 2IYLD 2J1LA 4FIDA 1FW6A 3KQUA 3HR7A 3UK6A 1MO3A 1N6LA 2FPKA 2N1BA 2B8WA 4A0HA 2GVDC 4Q47A 4LCBA 4PO9A 1KJYA 3CRMA 2OLKA 4IDHA 1KBFA 2ZREA 3RHFA 3VX3A 4B44A 1U0HC 1W44A 2J9RA 4B3XA 4QBFA 3AP1A 2ZSFA 3FPAA 2PCJA 1S3GA 2IF2A 4PXAA 1DS6A 3AUYA 5DI9A 4Q7KA 3CO5A 2WWXA 4PHTA 3QJYA 4IHQA 4F4JA 4EDHA 2A5GA 1R4AA 1S3SA 3TW8B 3BJIA 2W2XA 1VYUA 3BGWA 5TDHA 1G3RA 4M22A 3LVRE 1E79A 1GL6A 3KFXA 1N6NA 3NIBA 2CVHA 2A30A 3FYHA 1SVLA 3QIAA 5JJKA 1G3IA 2ZSBA 1UADA 4GMXA 1KAGA 5FUXA 2JA1A 2AN9A 4AKGA 1NKTA 2AD5A 5JMTA 1FAQA 4WA7A 1HY3A 1YR9A 4QGGA 3VR4A 4A8JB 3DZ8A 1DAFA 3IBGA 3AVUA 3UIEA 4LJ5A 4BLRA 1KMHB 2ZYUX 4LYFA 4OHXA 3C4JA 3QXJA 3QPWA 4KCGA 2GJSA 2Z83A 4PC1A 4UXIA 3RANA 4LUCA 2ZJBA 4ZDKA 5DO9A 1DBSA 2CVFA 5DI3A 1E1RA 4EUNA 3WBJA 1IN8A 1VTKA 2J41A 2NPIA 4PAOA 4RCZA 1CXZA 2AWOA 5FPYA 1T91A 1VG9B 1QG2A 4HDCA 4B3CA 3CRQA 2G83A 2XITA 4I1OA 1EWRA 5C46F 4PTLA 5D3QA 3DM5A 1QG4A 4EJSB 2F1HA 3RRNA 5HKKA 1JEDA 2R6GA 1ELOA 1ZNXA 2CL6X 2IYWA 2VH5R 3KY9A 3AKCA 3IO5A 2BV3A 2PLFA 4DUGD 4QHTA 4E07A 3H1TA 3K1JA 1OYWA 3GEEA 4UJ5A 3RRYA 3OAAD 1Q22A 4MDFA 1COWA 2IUTA 1EFHA 1QHHA 5FUYA 1OFUX 1P60A 2Q6TA 2WSSA 1MO4A 2YKGA 2ZJ5A 2BBSA 2RHDA 3K09C 1XCGB 1SZPA 2GWHA 3MRSA 1LFDB 5CLQA 3U6BA 1RJ9A 3D31A 4Q9KA 2OZEA 1WA5A 4Y0VA 1NMXA 4XVUA 3SQWA 2F7SA 3MAAC 4Z1MD 5DIFA 5AUOB 4OHWA 2G1KA 4ZPXA 4XH9B 5A0FA 5J4KA 4B2PA 3THYA 1ZUHA 1UBGA 1VCIA 2H57A 3PVSA 3X1YA 1MT0A 3PG5A 3ADDA 1PVOA 2F9MA 4K8OA 3SBDA 1XCPA 2WJVA 1EESA 1JECA 1WRBA 2W6IA 3CZQA 4RZXA 2O8BA 1TU4A 1E2DA 4DCVA 1J2JA 2ZUCA 4RFSB 1G8PA 2QMUA 5E3HA 1MRNA 3IKJA 2MSDB 3L82B 3H84A 5KUTA 2ZETA 3CX7A 2J87A 2D2FA 4JVLA 4QRHA 3UFFA 4TLEA 4C0SA 2VHTA 3Q85A 4WBSA 1GAJA 1L7VC 1RRGA 2GEDA 1E69A 2F6RA 4GZLA 4M9ZA 1Z06A 4IEEA 1PTQA 1KI3A 4QBGB 3V4FA 3IILA 5KTYA 3TSWA 3AKEA 3KQNA 2ZI5A 3R9IA 1G3QA 4M9XA 3CF0A 3I32A 1YQTA 2IEYA 2WWFA 2QZ4A 3MLEA 5HTKA 4BLSA 2OEPA 1KMHA 4E22A 3RS7A 3HYTA 1Z3IX 4IOLA 1OSNA 2PLRA 5L8VA 2YWEA 1ZW6A 2FV8A 2ZRJA 2CEAA 2GK6A 3QY0A 2VP5A 2JLZA 2GCNA 4TT3A 1F60A 1ZM9A 2QEQA 3ZGXA 4DLSA 5EQTA 3RSLA 5HCIA 3B8HA 2J0SA 2B8TA 3MUFA 3SEAA 5L3QB 3NWJA 2AR7A 5IRCD 3SJBA 5KNDA 2XOKD 1FQJA 1FOEB 2OFXA 4H9GA 4NCJA 4C0BA 3EARA 3A1TA 1NLYA 2CK3D 3QKUA 1PLJA 3TRFA 3VR2A 5JEEA 3AH8A 2FGKA 3IPXA 1US8A 2HCJB 1EGAA 2J59A 2ZAMA 4EKDA 4GRAA 2BC9A 1TBNA 4D4MA 4OHYA 1E3MA 4XWOA 2VF8A 4Q1BA 3G0HA 5CITA 1Z0FA 1H8ED 2CJWA 4Z54A 3PV0A 3TKLA 3CZPA 4LYJA 1GVNB 1T5IA 1M34E 2ANBA 2F43A 2PMDA 2QPOA 2VEDA 2A78A 1E2PA 4BFTA 3W6PA 4TLDA 5JS8A 4ZDWA 5CK4A 5KNBA 1GL9B 2HYIC 4W9MC 3T1TA 5H1YA 3QXCA 3T12A 2XNDA 5FOXA 2AD1A 4OI4A 4C0HA 2W58A 3NH6A 5CDFE 4LYHA 2ZS7A 4GP7A 4LJ8A 2NO6A 1G3UA 3KKMA 4LOAA 3U3JA 1P9NA 5ANRB 4DEYA 4HAUA 4LK2A 3SNHA 1W4RA 2EYUA 4KSCA 4URYR 4JJZA 4FD2A 4ZCIA 2PH1A 1P7CA 2GCPA 3EA0A 3LQRA 3CRVA 3WYFA 3IHWA 4EJSA 2P5SA 3B2EA 3FHCB 4KVGA 4B2LA 4Q1FA 3AGPA 4M1YA 5FBWB 2WOOA 3IPYA 4CZ2A 4LJAA 1KO7A 1P5ZB 1PZNA 3BB4A 2GKSA 3N2EA 5TY0A 421PA 1MH1A 2VP0A 1NP6A 1JR3D 1XD8A 1VDZA 3CIOA 4XD7A 4PFSA 4PPNA 5LB2A 3RAPR 3W5JA 2AFIE 2WVJA 2QAGA 1G1MA 3EA5A 1W49A 3KQLA 1PJRA 4TLBA 3VAAA 1HT1E 3VNUA 2QTFA 4MRRA 4YMTA 5FPSA 2WIBA 3TAHA 4FXPA 1T4GA 3CRRA 4ZV4A 4EFLA 2VTKA 5HE9A 2NPFA 1E96A 1GNPA 2G0TA 2NO7A 4NKRA 1R79A 4NZYA 2EU8A 1KI4A 6Q21A 1UAAA 2ODEA 2GK7A 1D2MA 2GJAA 1TUEA 2CHGA 2F9LA 2Q3HA 2YWFA 3DVLA 1BH2A 4JJKA 4WVFA 3WMEA 3GLHB 1Z6XA 4RKFA 3UMRA 4F92B 1DTSA 4BZPA 5C1BA 4C7OB 2RGDA 1UKVY 1Q20A 1XTSA 2BEJA 2DY1A 2JDID 1NG1A 2ZJ8A 3A1UA 4NDZA 5FTMA 4DLZA 5CYOA 3L8YA 4DRZA 5B2ZA 4N0DA 3VHXA 4B75A 2C96A 1KO4A 3PXGA 1S2MA 4JL5A 4PZLA 4KFRA 4POAA 3L8ZA 2ZE6A 2CLSA 2QSYA 5FOTA 4DLWA 1LTQA 3JVUA 3QPVA 3OAAA 4ESHA 3FKSA 2XNSA 1IHUA 1DAMA 3UGDA 3ZS9A 4IDQA 3NBZC 2ZRNA 2IS1A 1HTWA 1TEVA 4MKFA 5EUMA 1FMLA 4TQAA 4IFBA 4HAVA 3LLUA 4M9QA 3GD7A 3B1ZA 1PUIA 1JXMA 4WZAE 1AN0A 5FUWA 1GM5A 1LNZA 4YMWA 2IUUA 4QBIA 3I8SA 4HLDA 3CB4A 4E5UA 4IOKA 4QNRA 1GFIA 1OHHD 2UZ3A 1X1RA 2FZLA 4XWAA 5DI3B 5L3QA 2C78A 3SC3A 4ZI3A 4FMDF 3DMDA 4CYMA 1BYUA 2OILA 4CEHB 1AZSC 1Z6AA 3KQHA 2R62A 4ZI2A 4JMPA 1U98A 3QVUA 4Q48A 4AK9A 1IQPA 2ZR0A 4IOJA 2IXEA 1KY2A 1WCV1 3AV0B 2XAUA 2PZGA 4RD2A 3WMGA 2ERXA 1FL9A 2JEOA 3QKTA 4EPYA 4V02A 1QHYA 3AB3A 3NC0C 3A58B 3O47A 3ONWA 5LD2B 2VRWB 2ZI3A 4LC1A 1NIPA 2ZJYA 1TF7A 2A7QA 1N6OA 4IVQA 4PX9A 2WPDA 3AVYA 4U02A 2HF8A 4DDUA 3O8CA 5JCZA 2IYRA 1E9FA 2WWGA 5EXSA 3GLGE 1E9DA 2NG1A 2GESA 3U4QB 4Q18A 1I4TD 3QKRB 3VHLB 5KYKA 5KOYA 5LPNA 5FPHA 4LBVA 1SXJB 3UG7A 2BEKA 2FF7A 4XD7D 1NVVR 2D62A 2R65A 3HDTA 4GDFA 2ZAOA 3SYLA 3V4RA 4LJ9A 1MO5A 4Q4JA 2GILA 5GADl 1TTTA 3NHAA 2JATA 1LS1A 4EIWA 3AP2A 2YHSA 3ZVRA 5HR5A 2V7QD 4TSFA 2AWNA 2ZXUA 4CEJA 2BMEA 4MH0R 1R5NA 3WY9A 4LI0A 1K5GA 1SXJA 2FG5A 2H1LA 4V0KA 2BJWA 5FOUA 1NF3A 1YRBA 4RVCA 3R9XA 1Z29A 2BVNA 3RRMA 3WNCA 3QVVA 3GJ6A 4DSOA 3ASZA 3QF4A 1Z0IA 2YVUA 4FCWA 3AVTA 1B0UA 2QGNA 1YE8A 3GLFA 1XPRA 1XMSA 1U99A 4MQBA 3AEZA 4A2WA 2IXFA 2R6DA 3K53A 3G5UA 3KZ1E 1YR7A 2TMKA 1Q1ZA 4MRSA 2OBNA 3AF3A 3W5IA 3WRYC 1GILA 2YZ2A 1FUKA 1XXHB 2VHJA 2PJRA 1OH7A 1XEWX 4MKIA 3KXIA 4I99A 3RSOA 3TJZA 2FEOA 5CYPA 4OI1A 2DBYA 3U60B 1W2GA 3A4LA 2IBMA 4OQLA 4A36A 2HCBA 4L9WA 1MV5A 1A4RA 2W0MA 5HPYB 1JI0A 3A6PC 2Z5FA 4GT1A 3ICQB 4EQ6A 1SVWA 3J81k 4OKSA 2WZQA 4NMMA 2YC2C 1ZYUA 4LJ6A 3D8BA 1SXJC 2BMFA 1V43A 4FWIB 3U6KA 1FX0B 1E2GA 2JLQA 3LAWA 3A1VA 4AYWA 2IA5A 1UFQA 4C0KA 3KKPA 1D8TA 1FZQA 2X8AA 5IT5A 2GXAA 4LYAA 1KBEA 4ABYA 3CNNA 3T1OA 2XTNA 4ZDIA 5K8IA 1XXHE 3PIRA 1N25A 4LGMA 1JQJC 3GLIB 4Q19A 4NYJQ 1XPUA 1W5SA 4MKGA 2ONJA 1E9BA 1P9RA 2Z6VA 2IHYA 5K8UA 2BDTA 2YJTD 3AVXA 4MYHA 4AYXA 5CIWA 2CE2X 2ENNA 2AX4A 3IIMA 3TUJC 2QG6A 3KJEA 3RWMB 4A15A 4OK6A 4CW7A 2ROWA 1W46A 3NBXX 4OI0A 1Q1BA 2QT0A 2J3EA 2QTHA 1W1WA 2GXUA 2VHCA 4M2LA 3TR0A 1QHHB 3EXAA 3B1XA 3AQ4A 3GJ7A 4O2RA 3AF2A 1J8YF 2H7VA 3HP1A 4C0JA 1E32A 2W0SA 4NYJR 1R5BA 3I92A 3LH5A 2D3WA 2WIAA 4RZ3A 2OFOA 3KX2A 4XSGA 3BFKA 3BXZA 2YINC 1TPZA 3RS0A 3GEIA 1KGDA 3W3AA 4IEIA 3DEFA 1CR4A 5JS7A 1UPTA 2F55A 3GLIE 3THWB 4NCKA 4RD0A 3GFPA 3RYTC 4MGYR 2WAYA 4YONB 2P2LA 4ASUD 1W36D 4DB2A 3K8YA 1GRQA 3N2IA 5BN4A 1HE8B 1MOZA 2A5YB 2XTMA 2ZUBA 1KSGA 4Z1MA 1H8HA 4F93B 1D2NA 4Q1AA 1RJ9B 3U4QA 4GNKA 1OJLA 4M0LA 1T3LA 1E1QA 4BUJA 3P27A 1NG9A 2IYTA 1IXZA 3GJ3A 4GZMA 5TV2A 3FFAA 1R7RA 2FX3A 2IEZA 2P6NA 2GEUA 2ZI6A 3RS2A 2CL7X 1E2MA 3RRZA 4NYMR 4C2TA 3W6OA 1WB9A 5JJLA 3LXRA 1G4AE 2RGNC 1KI8A 3MSXA 1RRFA 3N5CA 4HATA 4DCSA 5JEDA 2Q3FA 3CR7A 1RKBA 1T3SA 3D3QA 3EIHA 3LW8A 2QMEA 3S1AA 2VIIA 2ZRCA 2FFHA 2ZPTX 2WOJA 4HEJA 2FSGA 2VPPA 5J47A 4US1R 1W4CA 5E7IA 3WYGA 1VHTA 1AKEA 3T06B 3CXLA 4HAXA 4NBSA 5AJWA 1RZ3A 1XEWY 4P0TA 1OKKD 4WXPA 3ZVMA 1XX6A 1G5PA 1ZNYA 2G6BA 3SJAA 2G0NA 4ACBA 5BWMA 3NC1C 4JIMA 1N6RA 4PQRA 1OT3A 2Q9AA 5DNYB 3L2OB 1QZXA 2ODWA 1U94A 1VECA 2XJ4A 4ON9A 1NJGA 2OXRA 3Q5DA 1E2IA 4KO8A 3B1YA 5C18A 1E4VA 2JDIA 4RZ2A 5KNCA 3LLMA 1BO6A 4X8MA 3ASYA 1QHSA 1UKEA 3RC3A 2P6RA 3MCAA 4JLDA 3SS8A 5M04A 1KI2A 3I61A 2QAGB 3PEVA 2ZRFA 4YMSA 4V0NA 5DYGA 3E1SA 2ZE5A 5IDVA 3R8FA 4RZUA 4FINA 3RVBA 3G82C 1AS2A 3GFTA 2QAGC 2OBMA 3ZJYA 4DWJA 1I2DA 2J0UB 1T3HA 1GUAA 3ZQ6A 3HU3A 3SQXA 5F9FA 5EP3A 1RIFA 2QQEA 4LHVA 1AIPA 1HUQA 4TLCA 5CLLA 2FOLA 1CJUC 2ZS8A 2WICA 5E95A 3PUWA 3I4LA 4LHZA 5UKDA 3T34A 2C9CA 4F38A 1ZMXA 2YYZA 4QGFA 2AXNA 2C95A 2FJUA 3B6EA 3MGCA 3B9QA 3M4YA 4N0EA 4B6EA 4TLAA 1FNNA 2Z4SA 2ZRPA 3L0PA 4PC6A 4M1SA 2H17A 2R9VA 3HU2A 2DHRA 4H1UA 2I1VB 3K70B 5EJEA 4EFNA 4V0LA 4N3NA 5IHPA 1Z22A 2QN6A 4M9SA 2OV2A 1OXTA 4AYTA 3HYRA 2ZRIA 4FI3C 4Q00A 5KSYA 2VF7A 3M6AA 4I1VA 2C9OA 5EP2A 4CGZA 3ADKA 3T35A 2ORWA 3UKDA 2NO1A 4RFSA 2QT1A 4AG6A 1NL3A 4EPRA 1IBRA 1G5RA 4LV8B 4RCYA 1KOFA 2ZVPX 2P6UA 1WF3A 1W0KD 1XD9A 2CCJA 4IRUB 1WBDA 1U0LA 5EXPA 3O8DA 3CPJB 1W7AA 4J0QA 2A5JA 2DPXA 3L0OA 4IOMA 1MRSA 3THOA 1NLZA 4ZIRB 2O52A 1P2TA 3H0KA 5GJWC 1ZM3A 1Z0AA 3OESA 4Q66C 4BRUA 2ZI9A 1XEXB 4RSGA 5ELXA 1QHXA 2RB4A 3QXHA 4TMXA 3QOFA 4W5WA 2AKYA 2H18A 5JHGB 3LY5A 3SN6A 4C0QC 1BMFA 2ZR9A 2Y8EA 2KWIA 3AVQA 3CW2A 2F3TA 4NHOA 3B5JA 1HQCA 4MYCA 1JPJA 4DKXA 3SHFA 1XJCA 1VIAA 1W47A 2GBLA 2UZIR 4CIDA 1VCNA 5GJBA 2GF9A 4R2HA 2QTVB 1R6BX 2GNOA 5D3MA 4QJ3A 5L3SA 2YNMA 4MUBA 1XZQA 4C0AC 2X2FA 4US2R 1P4SA 1P6XA 2HXSA 1K8RA 4EPWA 1N0WA 3I5XA 4KFSA 2CLCX 3T1VA 5F3WB 1U0JA 4HDOB 1RVDA 2QM8A 4B76A 4DLVA 2EFGA 2XNDD 3VKWA 3EX7C 2NZ8A 3DO6A 4DSTA 4QG7A 2J7PA 1COWD 1E1QD 4WAUA 4Q9IA 1BS1A 1F48A 3EW9A 4GOKA 4URXR 2JJ2D 4ERNA 1X3SA 3B1VA 2YV5A 1KJWA 1L4UA 4ZIRA 2B7CA 2XSZD 3BK7A 4DLRA 1DO0A 1PUJA 2WKPA 2OFWA 1E9RA 4RD6A 1QHNA 5SZKB 3HJNA 3JZMA 1F5NA 1N6HA 2SHKA 4BEBA 3TK1A 1N5LA 4B6DA 1R8SA 4URWR 4QJ5A 2YOGA 3IO3A 1EXMA 1UJ2A 4JSYA 4JLVA 4ARZA 5GVSA 1CTQA 1YZGA 2FH5B 5G40A 5BXQC 3ECCA 1NVXQ 5IF9A 4P4SB 4DLYA 3BH7A 2FZ4A 2VP2A 1N6IA 3DM9B 4B3DA 1NVVQ 4JLOA 3VR5A 3DPUA 3VU9A 4EPVA 1W36C 4Y0AA 3Q9LA 2CCGA 3C5HA 1DELA 2OCAA 3FMOB 4AIIA 3NHBA 4BFZA 5BN5A 3VR6A 2AXPA 1W0KA 3EWSA 4M53A 2ELIA 3BC1A 4P3YA 2OAQ1 1PLKA 2WJIA 1Q57A 1KMQA 4TT3D 4D4KA 2EVWX 3LV8A 121PA 1YZKA 2GDJA 5HKKD 2QBYA 1ZD1A 2WJJA 4L16A 4R71A 3B85A 3DZDA 3HWSA 1CLUA 3KB1A 5KO2A 1SQ5A 4FCVA 4NYIR 4OQMA 3OEEA 2XB2A 2H5EA 4DT1B 2RGEA 3BH6A 5FTJA 2HT1A 5JSZA 2BBWA 2O0HA 1GIAA 3BERA 1V5WA 4K46A 2EWWA 1ESNA 4JLKA 1LY1A 1UDXA 3K9HA 2ORIA 1Q1QA 2OSBA 2LWIA 2JJ1D 2OCPA 1CP2A 1ZUIA 4BASA 4G5SA 1R5OA 4JLBA 4D4LA 1L2TA 4WOPA 1J70A 2RGGA 1XEXA 3CX6A 4ESVA 1NMZA 1JQLB 5EE5B 3ZIAD 2NZJA 1D2EA 2R6FA 1A1VA 4MUAA 3ZZUA 3FMPB 4U5XA 4B43A 2IWRA 3LFUA 4XTCS 2WWYA 2QRNA 2CCKA 1G7RA 4DIDA 2DFTA 1BOFA 1FP7A 2MSCB 2GEVA 1TMKA 4C7OA 1Z47A 3KJGA 3SDZA 1IXRC 3IIJA 1OFTA 3QE0A 4QKQA 3PUVA 3TVTA 1KK3A 1AZTA 1R0YA 2O8DB 1VPLA 1SVIA 3Q7PA 2JLYA 4DCNA 3WMFA 1CR2A 5JHHB 5A5GA 4XVRA 4JVMA 2XEXA 2JLUA 3QKSB 1ZINA 4MRPA 5G41A 1HQYE 4B71A 5CM8B 4C4PA 4X8LA 1ZRHA 1QHIA 2G3YA 4GOJA 4B73A 4AY2A 1EX6A 2JIZA 1M7HA 1S1MA 1T6NA 5C2JB 2DCUA 1YVDA 3I62A 1GRRA 5FBQB 4OHZA 2ZI4A 4B3GA 2Z43A 4JLPA 2ZJZA 3ZDQA 4DVGA 2GJKA 1KO5A 2Q9CA 2W6ID 5AUNB 3R7WA 1E99A 3HR8A 4BFYA 3KXLA 1R0ZA 4ILEA 1E2EA 3R20A 2DFLA 5FH9A 3NDPA 3PENA 2HJVA 5D3MB 3GMTA 2GCOB 3QG5A 2V8OA 4OK3A 1W4BA 2YUUA 4TL6A 1SKYE 4KODA 3ZQJA 221PA 2Z0MA 3TUZC 1IY1A 5DGXA 3CH4B 2QBYB 3ZYCA 4Q02A 4PAQA 3ZLJA 4O25A 2AHOA 4B48A 2HXYA 3CWQA 3U7EB 3MWJA 3U3OA 3TGPA 4YC7A 1N0UA 2GRJA 2WKRA 3ZIAA 4MDEA 1SVMA 2D4HA 5EE3A 3KKNA 2VHQA 5G53C 1LB1B 5JI3E 4E03A 2G77B 1UEIA 2LCFA 2C03A 4NPHA 1CRPA 1KO8A 1G4UR 1UKZA 3QI2A 4GBMA 3GCGA 3F8TA 1RYFA 1E2NA 1I4DD 2OT3B 4A2QA 1K6MA 3QUSA 2XJ9A 1E2HA 3GLGB 4BPBA 2QROA 2OO7A 2DR3A 4TYPA 2ZSDA 1BMFD 4R98A 1JAHA 4E09A 2W6JD 1Z07A 3UXMA 3DDCA 5FOWA 5FL3A 2IYYA 1S4QA 4B3BA 5JI2E 1XF9A 2D74A 3CX8A 1QRAA 2O8CB 4TQ9A 4URVR 2IYXA 2V1XA 3K0AB 2FGJA 2BM1A 2CHVA 4K81B 1FUUA 1NLFA 1W48A 1KK2A 1H8HD 2C5LA 2LKCA 5AUQA 3DOFA 4ITRC 2R2AA 4GSYA 2V3CC 1W2HA 2C77A 3CR8A 2IUSA 3A8TA 4C2UA 4CEHA 3VKHA 3K0CC 3REGA 1ODFA 2GXQA 3QEOA 1XWIA 1HEIA 5DE3A 5TXGA 3KJHA 1NY6A 4A6PA 3GJXC 4FMDB 4URUR 1LF0A 1Z6YA 2PL3A 1C4OA 3AKYA 3DKPA 3K0FA 3ZD7A 2XX3A 3P4YA 1SVOA 2QP9X 2OHFA 2FFQA 1ZNZA 5DSZA 2RGBA 5G3ZA 3FOZA 1VYTA 3TVDA 2QMOA 1XBTA 2C99A 3KTAB 2XXAB 1JALA 2HUPA 2IYVA 3LBNA 1TQDA 2IC5A 1YZQA 3OE7A 4KXFB 4Z51A 2O8CA 1YZUA 3BFXA 2REXB 2DB6A 1F2TA 3B60A 3QXSA 1FQKA 4NCIA 2FFAA 4TYWA 3Q8XB 4CT4B 4MYTA 4X8OA 3ZS8A 1CR0A 2WJHA 4CEIB 1E6CA 1OB5A 4PC3A 3FMFA 1G8HA 3T15A 3MD0A 2V6IA 4GOXA 4PQFA 1P75A 4HB0A 4S35A 2ONKA 2ZR7A 4GMDA 4HLUC 3EASA 2IWHA 1F2UA 2FU5C 4LBZA 3HPQA 4TYQA 1MABB 4LX0A 2VQSA 3U2QA 2HV8A 1T8UA 4A9AA 4JSTA 1E0KA 4D0NA 3VFDA 2OCBA 3Q3JB 1OYYA 2HJGA 4Z8XA 5EE1A 1KDPA 1XEFA 1EK0A 1G291 2PZEA 1E2JA 1QBKC 1XJ0A 1IJEA 1ETUA 4U00A 2ZTSA 1DO2A 2EW1A 1S0UA 4KJZA 3GEHA 2ENZA 2ZE7A 1XZPA 4JLAA 3UG6A 5B57C 2ZRBA 3GQBA 3QF4B 4JL6A 4D81A 3LVQE 2C98A 1BIFA 1IJFA 1Y63A 4PSKA 4A8JC 2GVIA 2IXGA 4DZZA 2YWGA 3UANA 3EIQA 5FOVA 3QEJA 1RRCA 4KHZA 3WXMA 2BHRA 2QNRA 3NKVA 1ZUNB 3X1ZA 2AK3A 4ARZB 3GLIA 3KUDA 4KLZA 4D6PA 4IKEA 2ECKA 5AJYA 4F91B 4PHGA 3ETLA 1YZTA 1S1CA 4YDHB 5J4VA 3H4MA 1JB1A 2A5DA 1ZM2A 1VMAA 2OM2A 4I81A 1X86B 4XSHA 3Q72A 2J0VA 3FVQA 1OHHA 3NXSA 2FSHA 4G0NA 1KSHA 1W36B 1GWNA 2GZAA 2ATXA 3U7GA 3LD9A 4AWXA 2IK8A 2KBEA 1T8TA 5FR1A 5EP4A 5L3VA 3X2SA 1N3BA 4NONA 3EZ7A 3EC1A 4L5BA 2ZU6A 3OHMA 1MO6A 2OG2A 4D26A 1Z0DA 1U8YA 5HZKA 3SI7A 1E2QA 1LV7A 2QPTA 1G41A 4JVSB 4Q7MB 3R9WA 4U7DA 5JLJA 1XD2B 5FBVB 1XTQA 1XXHA 3LNCA 1Z83A 1DAGA 4ZKEA 4OQNA 1R2QA 4W5HA 1ZCBA 3I5YA 2XB4A 4TZ0A 1N6KA 3REFA 2FSIA 5IK2A 3U3RA 4HZUA 4Q1CA 3L0SA 4QHYA 2C8VA 2O8DA 1HE1C 5JSZB 5A4JA 1KSJA 2B7BA 3BOSA 4EJSC 4PHHA 521PA 1M7BA 3MWKA 4BLOA 3PQCA 2ZYTX 5EP1A 2FDCA 3LX8A 4RKEA 1Z5ZA 4YDSA 5EE9A 3W3ZB 4G5OA 3X1XA 5KHOC 2XGJA 2XTZA 4RD3A 5FR2A 621PA 2P0EA 4A1FA 3U61B 2QM7A 1TEXA 4JT4A 5TVKA 4A0FA 4LPKA 1OB2A 2VA8A 2PCLA 2VSOA 2WJYA
chains in the Genus database with same CATH superfamily
3LVFO 4D9IA 4ZWNA 5HXAA 4F6CA 4DR1B 3T3OA 2E4YA 2WDZA 4I50B 4ZU6X 4EUHA 3IRUA 3KOWA 4H7KA 3ORHA 1XVAA 1YAJA 4GIBA 3SSAA 3CKYA 5EIXA 4H7HA 1KZ6A 3C6YA 2Q8QA 2WCYA 2WWWA 3ENZA 4GWLA 4M8NE 5KAMA 4HNGA 2UZ1A 3TMYA 2ZBPA 3RW9A 3J80A 1QCZA 2O2DA 2NUTB 4AJ9A 3HA7A 2YN2A 3GLFE 1J22A 4EVRA 4TZ6A 4C4SA 1TCCA 2F3UA 3GCDA 2WFLA 1KA9H 3HTXA 1C4XA 1FNMA 1V1RA 2GCGA 2WHEA 3LY8A 4Z4HA 5CA0F 5AW4A 3LE8A 1L1QA 3FOAA 2YJ5A 2B1IA 5CCEA 4ZQEA 4Q3DA 1PK7A 2W00A 4HK4A 3ZD6A 1WB5A 3JSXA 3MQ4A 2AXQA 4MO2A 1OH5A 1XDUA 5IVHA 5AM1A 3VOAA 5ECYA 2R7MA 2RHCA 2XZDA 2Q3DA 2ZT5A 2DQYA 3OJ0A 2WAAA 4HSEA 3T7KA 2N9UA 2YWHA 1ES9A 1VBNA 2F1JA 4MVJI 4N49A 3KL4A 1IJBA 1Q92A 2Q3MA 2VO1A 4GC5A 5DLPA 4BOYA 1UIMA 1EE1A 2RC6A 1WD7A 3PUKA 5CM2Z 3GCXA 1Q44A 3F71A 1NUHA 1HTBA 3HPRA 2XZOA 1M6VA 2R1ZA 2NU1I 2B2NA 2GQ0A 1EGMB 5KJ6A 1Z6GA 4WGFA 1PR9A 1KQPA 2BI7A 1KAQA 2PFGA 2QR2A 5EFZA 4UNRA 2AF4C 4EENA 1HSOA 1U3VA 1F0YA 2Z95A 3WHLA 3WHKA 4F7DA 4NU0A 1X1DA 4BE7B 1DZIA 2JZCA 3MS7A 4QX6A 2M6KA 3TDMA 1E0AA 2J3KA 5JFGA 2FX2A 2D2IA 1JDBB 1FU7A 5KYXB 4NTZA 2DOKA 2AKAB 1NC1A 2Z3WA 4DZTA 1QFJA 3JD4A 3S2YA 5KS2A 3BILA 4XWKA 1ISIA 3KK0A 1X8JA 3W78A 3WMWA 1D04A 2ZKIA 3P4XA 3UUFA 5DBGA 5B3JC 1OTXA 1NBMD 4IJMA 2RFLA 3BB1A 4WN9A 1S8FA 2P6PA 2WUGA 1E18A 4D9MA 3DWEX 1MVOA 2F3CI 1F5SA 1QGDA 3MG9A 5DWVA 3WLRA 5E3PA 4INPA 5BV0A 3JQ9C 2A5FA 2GK4A 4Q0MA 4GPEA 4FX5A 4C4RA 1GQRA 1U8AA 4FJ1A 4CT5A 1IEXA 2P6OA 3CLRC 5KTKA 3KSUA 1T5SA 1BVRA 1QH8A 2Q45A 2WYWA 3QU5A 2DYKA 1UZAA 1HRDA 3RRJA 3SSOA 2ACWA 3ZCUA 4EJMA 4G97A 1UEJA 3FVVA 3W8RA 4XIJA 1Z5VA 4XZ3A 2GOYA 2HK7A 2OKCA 5D01A 2W4IA 3V6MA 2P2NA 5AESA 2CLHB 3Q12A 4JYCA 1SB9A 4UBNA 4W8HA 1WP9A 1KRWA 2C9BA 1R0XA 4XIGS 4YRRA 3ROQA 1G6KA 1YF3A 2WC1A 4BNHA 3FDFA 1JGTA 1E3LA 2R6R1 3HXKA 4Q3EA 3TIFA 1ZITA 3V00A 4KYTA 2WTMA 4I5FA 4C87A 3KTAA 5ICFA 1VBMA 2B2XA 5BY2A 1ECFA 3VO1A 1ZU4A 2J46A 4YMGA 3L1VA 4A7PA 4YAJA 3FA2A 4ZV9A 1FNSA 5IAOA 1EU1A 1AKQA 2A9PA 5CYGA 2Q5EA 3KLNA 3PZRA 2GTPA 3F6BX 3F4KA 4P35A 4WE3A 2B21A 5J4HA 4MYUA 2AEJA 3LC1O 4MQEB 3ZHOA 5J4YA 5DP2A 1V6SA 4YQZA 5L6MB 3OY2A 2RGXA 2D59A 1PFWA 3EGEA 3I04A 3IE2A 2P4QA 4P3NA 5LJLA 4KUGA 3QE9Y 1HM5A 2QV0A 4WOJA 5AICA 4XW2A 3IAM6 3ONEA 1U2TA 1Z16A 2GO1A 1E1NA 4R1OA 3VUFA 1AO0A 2ZAYA 2RJOA 1UMCB 2AJCA 4JB0A 4QFMA 1E5QA 4JLJA 1V41E 4IDNA 5FI1B 1GCIA 1Z08A 2RHGB 1T1EA 4JQYA 3DLCA 4PCUA 3AUAA 4P53A 1IWOA 1CY1A 3ZLTA 5B7PA 1PYGA 2ZRAA 1RHQA 4FDUA 1QIKA 1LDEA 3L41A 3HGQA 3MWYW 3IP1A 1EDEA 3DZKA 3CNLA 2ISSD 4LXQA 3VA7A 3U3KA 1NN1A 2PNJA 1F7VA 2XUOA 1ZUD1 2EWVA 3WGOA 3UMCA 4GFDA 1SXPA 1I6KA 1L5HB 4PWZA 3ZNNA 3G8AA 4V0OA 5CX1A 1U2DA 3SK0A 2GYWA 4RW0A 1CY4A 2M6LA 4C21A 1JZSA 4N76A 1O1YA 1G8YA 5D8DA 4XASA 3BRWD 3DVAB 2NYUA 1P2FA 3TJQA 4LKRA 3N1UA 3W05A 3HCRA 1EWVA 4HUTA 2GZRA 3FTQA 4OEHA 4Q4HB 4Q9JA 1H8EA 4NU5A 2Z8ZA 2Q49A 3DDOA 1KVSA 3IP3A 2AOTA 1W88B 4J9VA 1A97A 3WFZA 1EUQA 1FARA 2JIRA 3TGLA 1YUBA 2V7EA 1CU1A 1GLVA 1K7CA 3EXIB 1CEYA 8OHMA 1DLJA 1UJBA 4KI0A 3L8DA 1GN8A 1DJLA 4PPQA 4PZZA 2WSMA 1WTAA 1L3IA 1WAMA 1XZEA 1DG3A 1R8XA 1OH6A 1DRJA 2A2ZA 4G41A 4KFUA 1KC3A 1GN9A 3ED5A 1OD6A 3F49S 1FTNA 4N8DA 2A0FA 5IH3A 1CRWG 2COKA 2VOEA 4YGXB 4D42A 4L02A 5CFZA 1CX9B 2FF5A 1QRRA 5DT2A 5KSZA 4RPJA 4EY3A 2XDAA 2F1OA 1S7CA 3LOUA 4KL8S 4MVJA 3IUMA 5FBLB 1IEWA 3OEHD 4CM7A 5AKZA 1Y9JA 1PD1A 3N59A 3ZQKA 4J0DA 4EG5A 4YMVA 1G7CA 2VZ9A 2PBRA 1B0ZA 4PXSA 4YLGA 3TB4A 3VU3A 1GKUB 3W9SA 1V35A 3UGIA 1ISFA 4DR5B 3Q9NA 3SGLA 1UC8A 2DETA 1CYEA 2R1VA 1KI1A 3SD7A 2P75A 3O83A 1KDRA 1ZGCA 1SD5A 1Y8FA 5F77A 1XWFA 3GJ5A 1RLTA 2O20A 3JPYA 4REQB 5CW2A 3FJ1A 4UOZA 4AMZA 2IT1A 4NOMA 3NOXA 1NATA 2B1RA 2FUCA 2QA5A 2QY6A 2JLVA 4RKYA 4B0OA 4Y6RA 4ZVNA 4HAWA 2GHQA 2FSSA 1R12A 5FBHA 5TMEA 2PRIA 2PH3A 3T61A 5IVKA 2Z5GA 2P7HA 3N75A 1ISGA 4Y9RA 4W82A 5AKXA 2CBGA 4DLBA 4R68A 1WBBA 5KU7A 3IB6A 4JI8B 1VKHA 2OORA 3BREA 2E55A 1NN0A 1G0NA 2I4NA 2HHAA 1XT6A 1GG5A 2FMXA 2YWRA 3KQYA 3A6GA 1YBFA 4JBHA 5AJXA 3DZCA 3R2JA 2XWQA 3QF7A 3GPLA 1SVNA 1ZH0A 2Q9BA 2FAXA 3EISA 3IP5A 2QNIA 5FO1A 3SJCA 4QNMA 2WHYA 2BYTA 1OUMA 3GUVA 2XQFA 2CJWB 4KIUA 1S8NA 3ETEA 4UE3S 3RYFA 1ZH6A 4B46A 3O4FA 3KKOA 4MVJP 4ZOLB 5DGDA 4BO9A 5BSGA 1JFFB 2H29A 2TECE 2PK3A 2M9MA 3LNTA 1GZUA 2QTZA 1XVVA 1KMCA 4RF3A 3PR3A 1CETA 3LKDA 4ZCMA 4TS4A 4IIDA 3WTCA 3K1ZA 1ONNA 2O0KA 3HO1A 5IM4A 4PYIA 1GQYA 2H11A 2FUG1 4MI3A 4PS0A 2A1UA 2AVNA 1RHJA 1TA0A 4J2HA 1SO8A 4IILA 4KNWA 5EQFA 3WLKX 3ZXUB 3IUPA 5J1TB 4Y98A 1O6BA 1DHRA 4G01B 3RRXA 4BVAA 4E4RA 4BQPA 1XPJA 3SF8A 1K3TA 3UWSA 3A3KA 4IAOA 4PLYA 4S1WA 1RBZA 5DNDA 3C39A 2A3RA 2HU2A 2Y05A 3F6SA 4JLNA 2Z2ZA 1NY5A 4Y2XA 3UGLA 5HQJA 3DVQX 1SUBA 3BM5A 1RHRA 2R7KA 4XQGA 4CEJB 3ID6C 2AF3C 5DLEA 2VDOB 2P9YA 4UE6A 5D87A 3WMRA 5EPOA 3C5WP 4EJFA 1N33B 2CMHA 4K9NA 2JH9A 4YRZA 5FUMA 1KYIA 4XWWA 4RF2A 2N46A 1OXUA 4L9MA 2PKRA 3A3OA 4JOCA 3M6IA 4P8RA 2IV7A 5DTRA 4GOLD 1KVQA 1X8KA 2FSVC 3HL4A 1JHPA 3UGKA 1YOVA 2C1ZA 2IE0A 3DMNA 3N70A 4IY1A 2ORYA 4ZOLA 4I36A 2DWOA 2ZATA 1DBVO 1WDMA 3MTQA 2C8LA 1PEAA 2JLXA 4DLXA 1FTSA 4AF8A 2IX9A 2IS2A 1ZUNA 2WJWA 3ZZNA 4ZEMA 3Q8LA 1R0LA 4MRAA 4ZZIA 2DVMA 4EELA 5FHRA 3H5VA 3I2YX 4M0FA 1ZIPA 3HWWA 1D2HA 1WUIS 3CG0A 4MV7A 4AJEA 1HG1A 1D9XA 2VUIB 2BJHA 4I50F 3FUUA 3G2PA 1C30B 1GPMA 4RXUA 1IN5A 1UK6A 5LA6B 5K8VA 2J48A 4HF7A 5F7ZA 1S6YA 3LOQA 1UMBB 1ULSA 4KU4A 3WZMA 5MFPA 5SZHB 1JMKC 1XRQA 4YJ3A 1E2FA 5BQFA 2G4CA 2OVOA 2KE5A 1BD4A 2VI5A 1YDMA 4KBGA 3NM6B 3FF4A 5EIAA 4B45A 3V80A 4HWTA 5EWJB 2C2BA 3UW1A 1P17A 3CEHA 3PDUA 3L7NA 4D8YA 5LNK1 1X80A 1EM6A 4XJXA 3QELA 4LV6A 2WVGA 4REOA 1ECJA 5CEFA 1ULMA 4TXHA 4CMCA 4DR6B 2H0QA 4HJRA 4IXWA 4ZK2A 1DQPA 2J5XA 2PGOA 2DUMA 1EP2B 4B6SA 1AJEA 3N2GA 2R7LA 2D54A 3OE4A 1QO0D 3EWAA 3AVVA 1AKYA 3KWJA 2G82A 2D1YA 2LIVA 1N3LA 3F0TA 4OQYA 4NEHB 5IJXA 2C54A 5BSTA 3RS3A 3WL3A 4EYQA 1JR4A 1Z6QA 4FNMA 3TNYA 4WK4B 4JEHA 5GJCA 1M9NA 1KWKA 1DOAA 1P77A 3K31A 3K32A 3QAHA 4PSAA 1YJXA 3G1TA 3CZCA 3C16C 1P0PA 2QJWA 4IHJA 2HSEA 1BGWA 4KZPA 4X71A 4B6GA 1VB5A 1ZRMA 2A67A 2OESA 1H3FA 2GXSA 3C24A 3JQCA 3KVVA 2OZVA 3ZJTA 4PCAA 2AOXA 3EEBA 4YY3B 3KUUA 2V9PA 1SHUX 2X2OA 3AKDA 4JLSA 2OO5C 3INNA 4PZPA 4FPXA 3EMBA 2D7CA 4R40A 5G4LA 1RWKA 2BTEA 2AYXA 1SKYB 4WDQA 4BMZA 4E5SA 4I5DA 4IVPA 3KKQA 3DTVA 2CXUA 1LLQA 4RGQA 1I30A 1X39A 3Q7QA 3QKRA 3IV9A 1XNQB 4UUAA 1RRPA 2YHIB 1X92A 4EB3A 1V2GA 3SX4A 4BWVA 4NBVA 4WTOA 4UPEA 5JASA 3IERA 4W99A 4U6QA 2SGFI 3ZI7A 2YOHA 3TZEA 4LAFA 1L8QA 1JXOA 4MUXA 3JQPA 3P94A 4ETMA 1ATIA 3BMOB 1YIOA 3HB4X 3OC6A 1CF2O 3RS5A 1YRLA 5KVQA 2GKTI 2IP2A 5FO0A 1EFCA 4X8OA 4MR9A 3HMKA 1KJZA 5DK6A 5FNVF 5GONF 4L3OA 4FW9A 2D2EA 5F21A 3OZXA 2MWMA 4C14A 4Q5IA 4TL7A 2VPTA 2QQGA 1FVOA 4A0RA 1SGDI 3VH4A 5IU6A 1ANKA 1JHUA 1O2DA 4GLOA 1DG1G 4OJTA 2CDNA 2Z1MA 4QYXA 3IUNA 4Y2JA 3SX0A 4QTUB 5HOEA 3IPCA 5KWJA 3OEHA 3ENQA 3I5MA 1NPDA 3AONB 3K70C 3QBTA 5P8WA 2IQIA 4PRZA 4YFYA 1QGED 2VNKA 3PUHA 2Q0HA 2JCVA 4LWZA 2B34A 5AM2A 5IXYA 4TMTA 1TUGA 1NHWA 3DDWA 4KFTA 3UF0A 3MGAA 4EEZA 3EPJA 4JNCA 1FU8A 4F9FA 4R7TA 3MTGA 3ASVA 4B2IA 4YLEA 4IHKA 2G1AA 3STTA 1TM1E 1UM9A 3NTUA 2HLDA 4BTEA 1YK0A 4K2HA 4BKRA 5IKXA 1ZXXA 3SXJA 1NMSA 3FH0A 5B3AA 4CIXA 3IKMB 1CP3A 4YXWA 2OXEA 3JASA 2O59A 3GRRA 4GMKA 4EH1A 4X1IA 2XUQA 3D3WB 3MJHA 1OXKB 1T9ZA 1G5TA 3UB3A 1KNQA 3K6JA 4OM7A 3RHZA 3G9XA 1C8LA 4M88A 1U90A 2IV2X 2FP4A 2OD7A 3E3AA 1SD2A 3VE5A 1WULS 1KH2A 1QHGA 3TKAA 1YONA 1GSIA 4MIEA 2JI8A 1MX9A 3VZDA 4XR4A 5CUQA 4F3NA 3ANNA 2GHIA 1TIKA 4NNPA 1TL7C 4QFDA 4JIGA 4IDPA 1RI3A 3WJAA 2Q3LA 4KH1A 1SVSA 3ZXIA 3MNFA 4DV5B 4AJHA 3QTLD 4XPIB 3ND5A 1LLCA 4YB8A 3FKQA 1A7AA 4M8KA 1EZZA 4B8YA 3RVNA 2VBCA 4L5AA 2D00A 1CUFA 1WSWA 2BMDA 4RHFA 5CPBA 2PZMA 1JA9A 5T4HA 1OWPA 2WD9A 5ENVA 2JLWA 3OEYA 2I9KA 1DRVA 1XJWA 2VQ3A 1ZD9A 3G8CA 4TRMA 3R7WB 4RTMA 1B0PA 4IIJB 4QASA 3U0BA 4DT1A 4FD3A 3H7IA 1I6LA 3MRTA 4TMWA 7GPBA 1V26A 3AESB 2H16A 2B94A 5JPDA 3BZUA 4NMHA 3U7FB 4KDRA 4FXOA 2OAP1 2QR5A 3ELUA 1ONBA 2GAAA 1ZAKA 4NF2A 3JQRA 5KDDA 2EBFX 2Q3JA 3FUVA 2C83A 3TQFA 5KJEA 4AMLA 2RC4A 3KAQA 4ZOQI 1L4MA 1OTYA 1UFKA 3IR6A 3Q4GA 4ND1A 3PB3A 4WCDA 3Q3IA 2QN8A 2R87A 1AQIA 3LYAA 2OECA 4KRGA 4LZAA 5DCUA 3S7TA 3WIUA 4E5PA 1T0UA 2I3GA 4KSYA 3NHRA 4Z4IA 2OQRA 1QTIA 4HEHA 4AJ2A 3IUYA 3DB2A 4BN5A 3LS2A 4GMHA 4BRWA 2ZYDA 3FCOA 3BL8A 3VKFA 3ZBPA 2J0EA 4PAWA 1YJBA 3T54A 4NCNA 3PD1A 5KOHA 2WU4A 3AFGA 1YI8A 3PI6A 4WZBB 3ADBA 4D9JA 3CMMA 3FPKA 1I94B 3CC8A 3CH6A 3L01A 2VBIA 2HM7A 5GONA 4I9GA 5ITZB 1F51E 1NVWQ 2GTIA 3NEPX 4R51A 5CLHA 1N9ZA 5JARA 1U3DA 3UV6A 3EIOA 1ABFA 2WDPA 2ID4A 1G16A 5ALVA 4BXOB 3B3FA 5HJ5A 4MK4A 4QRDA 1G5IA 2ZIFA 4DHEA 3OXLA 3PXBA 2ZI7A 3QV2A 2WNSA 4JLWA 1VL8A 2OZLA 5F9HA 3AJEA 3CLKA 3R3UA 4X3OA 4XAQA 3VKGA 2NTYC 2QL9A 4MYDA 2IIQA 3FMIA 1G21A 1B2LA 1Z39A 2DJ5A 3CONA 3A28A 3GAFA 1EQUA 4IVRA 2PX3A 3CRW1 4WL0A 4QYSA 1UBHS 1KL7A 1Y37A 1GG9A 1XLVA 2P0AA 1RRKA 1QFZA 3GX1A 5ESXA 4ETWA 4I5GA 4YR7A 3K70D 1EUCA 5FPPA 1OI3A 1OWNA 4Q4CA 3E84A 2QI9C 3DDUA 1CFJA 1I4LD 1LD3A 1T8RA 2PGDA 4H7EA 4UDYX 2AKEA 1DTEA 3KDSE 5H68A 4BVKA 4M1MA 4KWEA 4XDHA 3NG1A 3BMQA 1WW2A 3MB5A 5IFLA 2OHVA 4XUDA 1CT0I 2Y27A 3CJTA 4CQMB 2WT9A 3T3MB 3D43A 4I1UA 4DE5A 1D7OA 2L0XA 3A1EA 5IDXA 2FJPA 2XCOA 4EW3A 3I42A 5SY4A 3DL2A 2FEMA 1QF9A 2Z5LA 4MLZA 5C1IA 2NOAA 4GEGA 4FYVA 3WIEA 3OHSX 1DRUA 2ZROA 1VZ2A 2GB4A 1S2GA 3LQ1A 4IINA 2HA3A 2C4VA 2Y4OA 2O5VA 3E23A 1I5OA 1VHQA 4R1SA 2X0NA 4A2CA 3L7BA 1BE8A 3GRCA 3HUTA 4BCDA 3UBTA 2QRZA 2I4RA 3JVDA 2BJVA 3MHPA 2X13A 1XKQA 3QLUA 4U8GA 5ILGA 4EITA 4LZLA 1FJ2A 4IPTA 1CF4A 1N5JA 2BY4A 2EJVA 3GJ8A 4QGHA 3SLKA 1II8B 1KS2A 1M1YA 3K1YA 5J63A 4B32A 3HKCA 1AKVA 5BVGB 1D9ZA 3QENA 4PICA 4PE5B 1N9KA 3MT9A 1ISJA 1PLLA 1RQNA 2GA8A 2RGNA 1RJFA 3A9VA 3EXG1 2H2HA 3H2GA 2PVCA 2CNOA 3ZWNA 4CM3A 1FDIA 1ZPDA 1NULA 1NRIA 1ZN8A 4I3FA 4JFAA 3TTSA 1SHKA 3ROGA 4Q15A 4D9KA 1RP7A 3BCHA 3RSSA 4B6FA 4ILKA 1ENPA 4YAWA 1Y3CE 5IC5A 4GPZA 3PBKA 1QJCA 3ES9A 1KMIY 1ECPA 4JB2A 4HUQA 4RVUA 2V98A 5EEHA 1RW4A 3HVHA 5BQXA 4HX2A 3BIWA 4DIEA 3VOTA 3LUBA 2AFHE 1LSSA 1G3MA 5FCDA 4PR0A 2W0TA 2C7VA 5JO9A 3D4BA 3B5IA 1ZA2A 4D8VA 1U5AA 4NICA 4TYNA 5JYBA 3KZNA 1RWXA 4F2GA 4JBLA 3UQYS 4OKNA 1FJHA 3V2HA 1M5RA 4MRMB 2J5RA 1NKSA 1IN6A 1YBHA 4JU9A 5EHXA 2OZLB 1SGEI 2H0AA 1LPPA 2RONA 4BQEA 4JCOA 1G9XA 1EB9A 4ZCLA 1YS4A 3C14C 1XKTA 3QUQA 3QWBA 4M1KA 4PQYA 5FUVA 1UPFA 3G59A 3L43A 5LCXA 4CV2A 3A36A 2EBWA 3SEZA 1R6XA 3W90A 2X77A 3IXMA 1FPQA 5AJZA 2CJYA 4CIWA 4PEVA 2XT0A 1G64A 2P40A 1GTVA 2XRFA 2OO3A 3CN7A 3NV7A 1MTOA 1OAKA 4PCLA 2WWRA 1CZNA 1XYGA 2FR1A 3CUTA 3L8GA 4JGIA 4FN5A 4WNAA 1GG8A 1UWCA 3ZW8A 4DEVA 4ZYVA 1I5EA 1IDOA 1YQXA 3B1WA 5HIIA 3I39X 1M1YE 3WLIA 9LDTA 1X1EA 2C00A 2QUAA 2FPRA 3MJEA 4H27A 1MEJA 1V4NA 2QDXA 3L06A 1KO1A 3AP3A 1R6AA 4IDOA 4LHYA 2BFEA 3PP8A 3C48A 4N5MA 3S1LA 1FF9A 5HILA 4Z4EA 5KVSA 4C3ZA 1CUEA 1M6NA 3PPYA 4L75A 1VG8A 3LT4A 4P81A 4QL3A 5KOJB 1PJQA 3RSZA 2AZTA 3L79A 3LC0A 4PQGA 3PEUA 2QAJA 3QFFA 2IOQA 2SKCA 2GERA 2YN0A 1TF5A 4QOHA 1U5BA 3WIVA 1KYZA 3O90A 4KXXA 1PGQA 5B4UA 1SHJA 4KWHA 4UHCA 1IY0A 4LXGA 2H92A 3OT5A 4KSBA 1DEXA 5K0SA 2B4YA 4ASUA 1IY5A 5KQSA 3VJLA 3FE2A 4FE3A 1ZI6A 3LC2O 4U2GA 5C8VA 2F1RA 3JYNA 1ORTA 3H9EO 1E2LA 2ACKA 1V48A 3STVA 1R9JA 1HBJA 1XL1A 2WHXA 1KHTA 4HJXA 3TG8A 5K3FA 3HBNA 5GONB 4M76B 1BCRB 4GP6A 5AWFC 4G5GA 2EKZA 5B1DA 2Y2UA 4CG3A 4PONA 2CWHA 3JWGA 4D8UA 4LQDA 3DLPX 4E14A 2REOA 4HX9A 3TLCA 3QFCA 1W0JD 1LH0A 4AF6A 3OQIB 2QV7A 5BMVB 1NYLA 3E2IA 2EXXA 5L4LA 3K6KA 3EPPA 3FPJA 1FS6A 1Q21A 2OQIA 2PM8A 3SZUA 4Z6KA 1D0SA 3ORRA 3R7BA 3T0FA 1Z0UA 4BJ5A 1QIDA 1W35A 1XFAA 1E8MA 4KDFA 4WOCA 2EW2A 1MMFB 2I03A 3BCUA 1NUUA 3TW4A 3ZEAA 1P4GA 1U9IA 1RAGA 1EFUA 2I29A 3LUHA 4C7XA 2JAXA 4HFJA 2ZRKA 4QUGA 2FVXA 3WYEA 5A04A 3Q6NA 4EYOA 4ND6A 1NVTA 5JSQA 5D3KA 3D3NA 4PN3A 1EWKA 4LPSA 3RT7A 3MMNA 5JFOA 1DBIA 2ZIXB 2GAFA 4BBAA 2GBPA 3BB3A 5H9WA 4R8SA 4PYKA 4O1HA 4TTIA 2PMKA 4HLCA 4BBPA 1P9WA 3OICA 3PQ7A 3KAPA 1UM9B 4F4HA 4YCDA 2RI0A 5H8WA 4TTPA 4WFJA 1M34B 4Z86A 1DKPA 1BX1A 3WL8A 1VLHA 2FB9A 1F9AA 1P0QA 1C8BA 4DMRA 2FUKA 3WLAA 5IZCC 1ZNWA 4K6FA 4MA0A 1B76A 4JJ8A 5EMMA 4TUYB 5KDLA 2C4WA 1TZCA 5AVUA 3G02A 4MKZA 4O4LA 4UFNA 1C1XB 4B33A 1ZJ4A 4D2IA 4QU9A 2WMDA 3IOCA 4CLOA 4LJ7A 1XTUA 2NU6B 4FOSA 3RVKA 2MTBA 3WNBA 3RIYA 1GP2A 4COOA 2HMAA 1GNTA 4MGIR 4UEWA 4XRGA 5HTOA 3OWXA 3PFKA 1N2SA 1V5FA 2PKYX 1RQRA 2BR3A 4YAOA 1Y7PA 1ESZA 3D3WA 4P2BA 4C20A 6AT1A 5C9ZA 3M9WA 1E1RD 2ZWOA 4FOTA 2X9VA 3HGTA 3FLBA 1XD2A 1NXTA 1T5OA 1Y42X 3AF0A 3BDAA 1DXQA 1GUFA 2C5GA 2G06A 4N7JA 3PI7A 1NXUA 2JB9A 4MR9B 1G8GA 1NTOA 3BJIC 3ZIDA 4AB1A 2GAJA 3L84A 4YRKA 1XA0A 4D02A 3OA2A 1G4HA 1IHOA 4E88A 4H4DA 1W3SA 1CGJI 1ADGA 3O91A 2ZSUA 1K7UA 1OLOA 1D07A 2PSEA 4K86A 3WK7A 3TD2A 4L3WA 1LBQA 4NLLA 4R83A 3TN7A 3P20A 4X6XA 4BVBA 1KDZA 3DEHA 6YASA 2QYHA 3DOJA 2RJNA 5C1DA 2OB1A 3UFXB 1NVFA 2CGEA 2YRXA 4FNAA 1ZD8A 3GPDG 5AOAA 2Q7OE 1RYMA 3CBGA 1RQPA 1PR1A 1YQQA 2QP3A 4RIGA 1HETA 2D5AA 3FYCA 4D97A 5FTLA 3CCCA 3OX1A 3SZGA 4NFLA 4NH4A 2J0UA 3KQTA 3QHQA 1HNWB 3PFBA 4AJNA 1BW9B 3IFSA 3KDPA 5EZSA 3GUYA 3W4IA 2C9ZA 1TJYA 1HF3A 2JI9A 4IHJB 4WVLA 1LPBB 3DT8A 3QRWA 3R75A 4V1CI 4B8ZA 2VXOA 3M82A 3OQBA 4LJ4A 3RC9A 3ZW7A 4B7XA 4B74A 1GGFA 4ZT4A 1ADFA 1Z5OA 4C4YA 2IYLD 4FIDA 2VTBA 2BGGA 4NECA 4G89A 3FTFA 3NFYA 5K0NA 5HQ3A 3G49A 3WADA 4CCWA 1H2BA 2FWPA 3VC2A 1UBUS 2GVDC 4Q47A 1XRSB 1RM5A 3VPGA 1KAMA 1VPTA 3BXEA 1X80B 4FC6A 2OCXA 2DP4E 1WVGA 4G67A 4I66A 4X1KA 4ZVUA 4U6NA 1EQ2A 3FLAA 3VZSA 3AP1A 4BMDA 4UBKA 1ZVMA 2AVDA 3DMTA 4PXAA 3WTBA 3AUYA 5IAGA 3BMCB 3D1JA 3EXEA 4G8JA 1C7ZA 1UPXA 3LZDA 4BGUA 3N8DA 4IHQA 3FIJA 3UWMA 3GZJA 6PFKA 5I7FA 1XAGA 4Y6GB 3E2PA 1VYUA 5I5GA 1H5NA 3QK7A 4AY2A 2H4WA 2VQ6A 3UJ3X 5TDHA 1G3RA 1XO1A 2IJGX 3ZBTA 3LVRE 3TQQA 5KCMA 5LU9A 5LDGA 3K0BA 5BRAA 5JRDS 1JYSA 3NIBA 2CVHA 2A30A 2WF6A 3DMTC 4DV0B 5JJKA 1UP4A 3G8BA 1UADA 3LUDA 3DAPA 3FMVA 1XNGA 2JA1A 2GPBA 2P1ZA 3IRVA 3V4OA 4JA0A 5T4FA 3DWIA 4HWSA 3PTZA 3ADPA 3L7DA 1K75A 4I1YA 4IDCA 1JIJA 2G5CA 3N6RA 2I6SA 4OGGA 3RC7A 3FHJA 3TCXB 2J3IA 1TA4A 2Q3BA 1KMHB 2AI1A 3QXJA 3PC4A 3DBHA 4CKWA 5HJEA 5CVUA 2J3MA 2ZIUB 4LGCA 3I30X 1QBGA 2GJSA 4OP2A 4BBZA 3HSYA 3KC2A 4BJHB 2VJDA 2Z83A 4PC1A 2EDAA 4UXIA 2JGFA 4QPJC 4TXJA 5DX0A 4LUCA 2B20A 1O94C 4HDKA 4XEHA 5EMLA 2HSWA 4D9EA 2DUWA 1P9GA 2ZJBA 3EXHA 3HRKA 4ZDKA 4HUJA 2CVFA 1E1RA 3EXFB 3PQ8A 3LGSA 3OI7A 4K05A 1PW7A 4PAOA 5FPYA 4X64B 3HEAA 2Z04A 3MUOA 4X63A 4B3CA 3PX7A 3VSBA 3DBRA 1X4SA 2FJ0A 2G83A 4IXTA 5BYBA 1BDBA 3I6YA 2HK8A 2I6XA 2ZJ4A 3IE0A 4BY9E 1JEDA 4ZODA 4Z9YA 2IYWA 1IG0A 1ULNA 2BFNA 2CL6X 2XMRA 3AKCA 2BV3A 2VUTA 5IT9A 4FYHA 3TSYA 5MN6A 3H1TA 4LQCA 1OYWA 3GEEA 1I3NA 1TB4A 1XZDA 4CIVA 1Q22A 1WNFA 2OM6A 1PCXA 3IP6A 2GMWA 3MPUA 3B4VC 5FUYA 1S8AA 1P60A 2YV4A 4MLDA 3VBEA 1B1CA 2YKGA 1D4FA 2RKBA 2ZOSA 3MJ4A 1YZVA 5A7GA 4ZHQA 3ITKA 1PFVA 3LIIA 3RBXA 1R64A 5WRFA 3IQGX 1KYQA 3N8IA 2VHWA 4AZSA 5F73A 1UDAA 1LFDB 2B8EA 4CIYA 5K3AA 3FPBA 2X41A 4Q9KA 2OZEA 4AJ1A 3TW0A 4UFPA 1E3DA 1NMXA 4XVUA 1OX5A 2JD0A 5BVHA 5KNCH 3SQWA 3K05A 1XMQB 4RJTA 3F6PA 2IPXA 2LXNA 2MINA 3E18A 5DF1A 4OHWA 5FA8A 1B23P 1EQAA 2XYVA 1UDBA 3S5UA 1ZUHA 1MB3A 1KETA 1MT0A 2FQWA 3X1YA 4DABA 4KYVA 3WLQA 3SBDA 1XCPA 2ZBQA 1EESA 1JECA 1WRBA 2W6IA 4RZXA 1RJGA 4W8GA 1Q0ZA 1TU4A 1BEZA 1PQWA 2ZUCA 3GAMA 5ENDA 4B6PA 1G8PA 3GXBA 4EMBA 2N17A 1NWCA 1QK3A 2WJ4A 3COPA 3CX7A 4C0SA 2D2FA 3U9LA 5CDUA 2CSUA 3E81A 1NUQA 1YCHA 3I6ZA 3Q85A 1NE2A 2NXNA 1RRGA 1RLUA 3ZLBA 1ZIDA 1MH9A 3VYVA 5HSGA 4NJMA 4KPYA 2FEXA 3R6WA 3ZQ4A 2XUGA 2O14A 1CHNA 3RHTA 5FWYA 1I10A 3NIGB 4IEEA 4M9UA 3DE3X 5AI9A 4BNUA 5IKPA 2EJUA 3E9QA 1DC5A 1KI3A 1JEOA 2G4VA 2IY7A 1YUNA 3IILA 4QBGB 3TSWA 3V4FA 4HBGA 2ZI5A 3LUPA 4MV1A 4P83A 3TI9A 1IFXA 4B6RA 1X70A 3FPLA 3WHPA 3I32A 1LEHA 1JFVA 3MLEA 2WWFA 2QZ4A 4WLNA 2WYUA 5JH7F 4QWWA 2NM0A 1ZXLA 5TS3A 2FHSA 3RS7A 5F5LA 5ULLA 5F1PA 2DQ4A 2W6CX 2QXTA 3MTBA 3S44A 2K9HA 5JTUA 2PLRA 2X8JB 2FV8A 3HHPA 4YO8A 5BSHA 2CEAA 3KQQA 3QY0A 2ZYSA 3OQNA 3NNNA 3QTLA 1Y6ZA 2GCNA 2C8JA 4TT3A 4QPDA 4QREA 4H7PA 1IZ9A 5FFFA 3ZGXA 1SIBE 2BGKA 4NDAA 3P9RA 3IT1A 3N7AA 2YL2A 5HCIA 3ZU3A 5L3QB 4DV1B 3HDGA 3ODGA 5AVXA 3NWJA 2BDEA 4CF6A 2QJTA 4UAVA 5CFMA 5IRCD 1MEOA 1DOHA 2Z1DA 3DPIA 2YUIA 1V0JA 3R0XA 2OFXA 2GK3A 4JOBA 1QVVA 4N7RA 1YL5A 3HXTA 4NCJA 5DN9A 5JNTA 1N4AA 1T6YA 4QFCA 3U1TA 3NUGA 3QKUA 2EFYA 3QBDA 4CQMD 3AH8A 2FGKA 5JZOA 3PL5A 1WLSA 2OMEA 3T9FA 3LDHA 4GZ5A 4NJEA 2XYHA 2G9ZA 3JWJA 4O4IF 2SBTA 1X1AA 2QHXA 2ZAMA 5CH3A 4A6EA 5KIAA 3HP7A 1J1UA 4CUKA 3HADA 1DAOA 1E6UA 2VF8A 5EIBD 1H6DA 1A9QA 4NBLA 1OYVI 4U2EA 4CTMA 3FNRA 2DRIA 1PU2A 2HD4A 1ZBQA 3PV0A 5IYZF 1T15A 2M2IA 2FW8A 2ANBA 4ZVSA 4KQGA 2PS0A 4OPMA 2QPOA 4JUFA 3SPXA 1E2PA 3A10A 4BFTA 3THXA 5CK4A 2R4UA 4HXFB 2GM4A 2GM9A 2GJ4A 3ZGYA 4AZWA 4AN1A 3PQ2A 3QXCA 1R27A 2I7VA 4Y2TA 1FFBA 3AZQA 1KWGA 4TPKA 3H2HA 5FHQA 3O4RA 5I3ZA 4GP7A 3KKMA 1QQTA 2O9JA 3USCS 3N87A 4M8LA 1IUKA 4MV5A 3Q10A 3P19A 2QOEA 4XIFA 5ANRB 5ALNA 4DEYA 4DA7A 4YV1A 3D6UA 2EYUA 2JJYA 2XXBA 1YQDA 1PWXA 2W6PA 4W9RA 4KSCA 1EWTA 2Q2NA 2P9ZA 4FD2A 1H2ZA 3PWSA 2GCPA 3ABQB 2PBZA 3IHWA 3OJEA 1QFMA 2P5SA 4IJUA 5EIFA 1GGVA 3RSHA 4KVGA 4Q1FA 1T4BA 3KYBA 4J7XA 1DHTA 4IGFA 3O95A 3IPYA 4FEEA 4RMJA 3T7AA 3JQBA 4RPIA 4LJAA 2E82A 2YJ6A 1P5ZB 3DCIA 4CZ2A 4EX6A 1PZNA 1Q83A 1T43A 2GKSA 3KBBA 3N2EA 4YA6A 3ORFA 2OYRA 3UK7A 421PA 1AKUA 2QRQA 3Q7RA 3BD6A 3AZPA 1VYHA 1JR3D 1LI5A 2IYFA 1CZRA 2WYIA 4HWOA 4BFCA 4Y9SA 3HCWA 5ALMA 3R3WA 5CAEA 4IQFA 3UHJA 1Q95A 4HOYA 1ZH8A 1G1MA 2Z09A 1L7XA 1CUYA 1SBQA 1W49A 1PJRA 4NMLA 2FZEA 4JR2A 3VAAA 2LUYA 3QIVA 4XVCA 3VNUA 2EW8A 3DL4A 4MRRA 1NXXA 3UENA 1ECLA 2WIBA 3KR2A 3TAHA 1T4GA 4OJMX 3PFCA 4LDNA 5DV9A 4ZV4A 6REQB 4J07A 5K99A 5DHSA 2V65A 2G0TA