2JA5K

Cpd lesion containing rna polymerase ii elongation complex a
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cpd Damage Recognition by Transcribing RNA Polymerase II
pubmed doi rcsb
molecule tags Transferase
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 25
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2006-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2ja5K00
2JA6K 4A3LK 2O5JA 4LK1A 4BXXC 3HOXC 4A3JK 2E2JC 2JA7K 3GTGK 3PO3C 2Y0SD 3GTKC 1TWAC 3DXJA 1TWGK 3HOVK 1YNJA 4OIRA 2R93C 3RZDC 2NVXC 4A3EC 2JA5C 5C3EK 4G7ZA 2PMZD 1K83K 5M5WK 4XLNA 1Y1WC 2NVTC 4XSXA 2A69A 4BBRC 5FJ8K 2CW0A 2R92C 5IP9K 4C3HK 3H0GK 1TWGC 3GTKK 3WODA 2JA8C 4C3JK 3GTJC 4MEXA 3HOYK 3S2HK 4Q5SA 4AYBL 3GTQC 4A3GC 1TWFC 4BY7K 3HOWK 2A6HA 3S1RC 4BBSK 1TWHK 5FLMC 5M5YK 5C44C 1BDFA 2R92K 4G7OA 1WCMK 4MQ9A 2O5IA 3EQLA 3S2HC 3S1QC 3GTQK 5M5XK 1TWCK 3HOWC 3I4NC 1R9TC 4YFNA 4A3CK 4OINA 3S2DC 5IYDC 5IP7C 5M3MK 4MEYA 3I4MK 4OIPA 3S15C 4YFXA 2YU9K 3PO3K 3S1MC 3M4OK 2A68A 3S17C 4QJVA 4A93K 3HOZC 1IW7A 2JA6C 3RZOK 4A3LC 4JK1A 1Y1VK 1SFOC 2R93K 4A3EK 4KN7A 4YFKA 3K7AC 4OIOA 5IYCC 4A3JC 2E2JK 4C2MK 2R7ZC 5IP7K 3GTGC 5IYBC 4GZYA 3I4MC 1K83C 4A3MK 4A3KC 2NVTK 4BBRK 3HOUK 4X6AC 3M4OC 3PO2C 1I50C 2JA8K 2E2HK 4Y52C 2WAQL 4A3FC 1Y1VC 1SFOK 3GTMK 3M3YK 2NVYC 3HKZD 3K7AK 4QJVB 4A3BK 1ZYRA 2PA8L 2R7ZK 4Y7NK 1TWHC 4XSZA 2NVQC 3GTOK 3H0GC 3S1NK 1I6HK 3HOXK 3FKIC 3S16C 4BY1C 2JA7C 2E2IK 3GTLK 4A3DC 4A3GK 2WB1D 5C4JC 4BY7C 4LK0A 3HOVC 2PA8D 2E2HC 3HKZL 1XPPA 5TMCA 5FLMK 1TWCC 2B63K 2WAQD 2NVYK 4XLPA 4A3CC 5C3EC 2VUMC 5D4DA 3CQZC 4ZH4A 3FKIK 3S16K 2A6EA 3S1MK 3RZDK 1HQMA 4A3IK 2NVXK 4G7HA 2B63C 1TWFK 2PMZL 4OIQA 3S15K 2VUMK 5IP9C 5IYBK 4BXXK 4YG2A 4A3MC 1SMYA 3GTJK 3HOZK 3RZOC 1TWAK 4A3IC 1I50K 3GTPK 2Y0SL 5IYCK 4Q4ZA 3S1RK 4BBSC 4QIWD 3M3YC 3I4NK 3H3VD 1I6VA 4KN4A 2JA5K 1I6HC 5TMFA 2PPBA 1Y1WK 3S1QK 2E2IC 3GTMC 5C4JK 3S17K 4LLGA 3HOYC 1R9TK 3S2DK 3S14K 2NVQK 1YNNA 4AYBD 1I3QC 4NOIA 3GTLC 2WB1L 3CQZK 5C4XK 4LJZA 3H3VL 4QIWL 5M3FK 3PO2K 3S14C 4C3IK 5C44K 4A3KK 4A3BC 1I3QK 3HOUC 4Y7NC 1WCMC 2BE5A 3GTOC 3S1NC 4X6AK 5C4XC 4BY1K 4A3DK 2YU9C 4A3FK 4Y52K 3GTPC 4A93C 4KMUA 5IYDK
chains in the Genus database with same CATH superfamily
1TWAA 4PAAA 4LK1A 1O25A 2JA7K 1O2FB 1EK8A 1PJ6A 3HOVK 4OIRA 3RZDC 2NVXC 1XXCA 3OEPA 4KMAA 2GSOA 5C3EK 4G7ZA 1Y1WC 4KM8A 4BBRC 2CW0A 3SZYA 3WODA 1J98A 4AYBL 4BY7K 1WCMA 1GE9A 5FLMC 5C44C 3FOEA 2RH6A 2O5IA 3EQLA 4GFQA 3GTQK 5M5XK 1TWCK 4A3CK 2PHCB 5IYDC 4G0UA 5M3MK 2XCQA 3S15C 3S1MC 2A68A 3OPFA 2JA6C 1YCLA 4KC6A 3TTGA 4KN7A 4YFKA 3K7AC 2E2JK 5IOSA 2R7ZC 3GTGA 3G4AA 4P9SA 3FHZA 1PJ7A 1O27A 2NVTK 5HL8A 4A3FC 3GTMK 1XZQA 3M3YK 4QJVB 4AH6A 4C2MC 4Y7NK 1TWHC 1ZBSA 3GEIA 3FKIC 4BLAA 3TFHA 4A3GK 4LK0A 2E2HC 2WAQD 2GSNA 2NVYK 2JA5A 1RU0A 3CQZC 4ZH4A 3T01A 1WSRA 3RZDK 1HQMA 2NVXK 4WJ3M 2W7VA 1IE0A 1WOSA 4LR2A 4BXXK 1VGXA 1TWFA 1O26A 4YG2A 5IOTA 4A3MC 1INNA 1TWAK 1I50K 3AD7C 1I50A 4WJ4A 2YU9A 3I4NK 4FM9A 1I6VA 5IORA 1R9TA 1WSVA 2E2IC 5C4JK 3S17K 1F7UA 3ERED 3S14K 1ISEA 2NVQK 3AH5A 4XCHA 5EGHA 4KB4A 2XCRB 3Q3QA 1O28A 5JFEA 3T02A 2V6UA 3BP8C 4KMHA 1I3QK 3S1NC 2BE5A 4KARA 1L0WA 4GTFA 4BY1K 1O24A 4A3FK 3QX3A 1IS1A 4A3JK 3GTGK 1G51A 3L4JA 4BLBA 2KWAA 2RGRA 2R93C 4A3EC 2JA5C 3L4KA 4LOWA 1K83K 5M5WK 4XLNA 4XSXA 5L46A 4C3HK 1TWGC 3HOYK 4C3JK 3LAJA 4Q5SA 1IQ0A 3GTQC 1BDFA 5EGEA 2R92K 4G7OA 1WOOA 2NVYA 3S2HC 3H0GA 3A8JA 3HOWC 3I4NC 3S2DC 3GTKA 3LAPA 2JA6A 2YU9K 3S17C 3FOFA 4A93K 3RZOK 4A3LC 4OIOA 4C2MK 5IP7K 1VH2A 4BKWA 5E68A 4BBRK 3HOUK 1ZQ1C 3M4OC 1ZXOA 2E2HK 1XZPB 4Y52C 1O2AA 1Y1VC 2NVYC 3A8KA 3HKZD 3S1NK 3H0GC 4BY1C 2WB1D 1F9NA 1XPPA 5TMCA 1TWCC 3CQZA 4XLPA 4A3CC 3NUHA 5D4DA 2R92A 3S1MK 3V4GA 3TFIA 1WQFA 2B63C 1TWFK 4GTCA 3BP3A 2VUMK 1SMYA 4C3JC 1B4BA 3HOZK 1DCPA 3GTPK 5IYCK 4Q4ZA 2JH3A 3M3YC 2P8TA 3H3VD 4KN4A 3T00A 1Y1WK 2XCOA 4LLGA 3S2DK 4AYBD 4KATA 1I3QC 3GTLC 4GT9A 3CQZK 2CFAB 1SFOA 3H3VL 1HI9A 2Y3PA 4LQYA 3HOUC 1WCMC 3N0BA 4M1XA 3HXAA 4Y52K 3ADAC 1J6WA 4KMUA 2JA6K 2O5JA 2E2JC 3PO3C 2Y0SD 2VUMA 1TWGK 1YNJA 4KM9A 5CHPA 1V5VA 2R92C 3TFJA 2A69A 3GTKK 5IP9K 1AB4A 3A8IA 2JA8C 4WILA 3S2HK 1O2BA 1EFWA 4A3GC 1TWFC 3AD8C 3VA7A 3HOWK 3S1RC 1EQRA 4BBSK 5M5YK 5JVOA 1X31C 4KAWX 1DD5A 1VRQC 4KMDA 1WQHA 3S1QC 3GTMA 1J6VA 4O2DA 1IBAA 4ILDA 5IP7C 4MEYA 1UV7A 1BGWA 2FQTA 4YFXA 3M4OK 1XXBA 1XZQB 3OREA 3CAGA 1IW7A 1O29A 2FQOA 2GAHC 4JK1A 1B4AA 1Y1VK 2R93K 2R93A 4A3EK 5IYBC 4GZYA 3I4MC 1K83C 5IOQA 3MMLB 1KQ4A 4C3HC 1WOPA 3GEEA 3GTQA 1SFOK 2PA8L 4XSZA 2NVQC 1I6HK 3HOXK 4BY7C 3GDZA 3HKZL 2JA7A 2B63K 5FLMK 2E2IA 1BJTA 4P5BA 1BS2A 2VUMC 3S16K 2A6EA 4GTDA 3BUEA 1Y1WA 2PMZL 4OIQA 3S15K 5IP9C 5TJ3A 2ZUEA 4A3IC 4G0VA 3S1RK 4BBSC 3FKIA 3G4CA 1JOEA 2JA5K 3JSTA 5CJ9A 2PPBA 3S1QK 3SZZA 3GTMC 1F93A 3HOYC 3GTLA 4NOIA 1I3QA 2WB1L 2D6FC 1DCHA 3PO2K 2V6TA 1TWGA 2GSUA 1F7VA 5C44K 1EI6A 1K83A 4A3BC 4C45A 3GTOC 4DDQA 3LPXA 5C4XC 4A3DK 1J6XA 2YU9C 3GTPC 4A93C 2EBBA 5IYDK 4KASA 4A3LK 4BXXC 3HOXC 3GTKC 1PJ5A 1TWAC 3DXJA 4KDDA 1JVIA 2NVXA 4GTAA 1YX2A 2PMZD 2NVTC 2B63A 5FJ8K 3IPJA 3H0GK 3GTJC 4MEXA 3GIRA 2A6HA 1TWHK 1Y1VA 1WCMK 3GSIA 4MQ9A 3GTPA 3N3YA 1R9TC 4YFNA 4OINA 3I4MK 1TWCA 4OIPA 3PO3K 3AD9C 1C0AA 4QJVA 4GTLA 3HOZC 1SFOC 3GTJA 5IYCC 4A3JC 3GTGC 2P5MA 4C3IC 4A3MK 4A3KC 4X6AC 1EH1A 3PO2C 1I50C 1XXAA 2JA8K 2WAQL 3K7AK 1TWHA 4A3BK 1ZYRA 2R7ZK 3GTOK 2V6SA 3GTOA 1IL2A 3S16C 4A3DC 1WIHA 2GAGC 2E2IK 2JA7C 3GTLK 5C4JC 2E2HA 2ZFZA 3HOVC 2PA8D 1XZPA 5C3EC 3FKIK 4GTEA 1USOA 1USMA 4A3IK 4G7HA 3AQPA 4KB2A 4FZBA 3GEHA 1VJEA 5IYBK 3GTJK 3RZOC 1WORA 2Y0SL 4QIWD 1I6HC 1WQGA 5TMFA 4GTBA 3S0XA 1VLOA 1R9TK 1ZVUA 4RMFA 1YNNA 2ZUFA 2R7ZA 5C4XK 4LJZA 4J3NA 3AQOA 4QIWL 5M3FK 3S14C 4C3IK 4A3KK 1DCOA 4Y7NC 4X6AK 3N0CA 4PABA 4G0WA 1JQWA 2CFAA 4P5AA
chains in the Genus database with same CATH topology
2JA6K 4A3LK 2O5JA 4LK1A 4BXXC 3HOXC 4A3JK 2E2JC 2JA7K 3GTGK 3PO3C 2Y0SD 3GTKC 1TWAC 3DXJA 1TWGK 3HOVK 1YNJA 4OIRA 2R93C 3RZDC 2NVXC 4A3EC 2JA5C 5C3EK 4G7ZA 2PMZD 1K83K 5M5WK 4XLNA 1Y1WC 2NVTC 4XSXA 2A69A 4BBRC 5FJ8K 2CW0A 2R92C 5IP9K 4C3HK 3H0GK 1TWGC 3GTKK 3WODA 2JA8C 4C3JK 3GTJC 4MEXA 3HOYK 3S2HK 4Q5SA 4AYBL 3GTQC 4A3GC 1TWFC 4BY7K 3HOWK 2A6HA 3S1RC 4BBSK 1TWHK 5FLMC 5M5YK 5C44C 1BDFA 2R92K 4G7OA 1WCMK 4MQ9A 2O5IA 3EQLA 3S2HC 3S1QC 3GTQK 5M5XK 1TWCK 3HOWC 3I4NC 1R9TC 4YFNA 4A3CK 4OINA 3S2DC 5IYDC 5IP7C 5M3MK 4MEYA 3I4MK 4OIPA 3S15C 4YFXA 2YU9K 3PO3K 3S1MC 3M4OK 2A68A 3S17C 4QJVA 4A93K 3HOZC 1IW7A 2JA6C 3RZOK 4A3LC 4JK1A 1Y1VK 1SFOC 2R93K 4A3EK 4KN7A 4YFKA 3K7AC 4OIOA 5IYCC 4A3JC 2E2JK 4C2MK 2R7ZC 5IP7K 3GTGC 5IYBC 4GZYA 3I4MC 1K83C 4A3MK 4A3KC 2NVTK 4BBRK 3HOUK 4X6AC 3M4OC 3PO2C 1I50C 2JA8K 2E2HK 4Y52C 2WAQL 4A3FC 1Y1VC 1SFOK 3GTMK 3M3YK 2NVYC 3HKZD 3K7AK 4QJVB 4A3BK 1ZYRA 2PA8L 2R7ZK 4Y7NK 1TWHC 4XSZA 2NVQC 3GTOK 3H0GC 3S1NK 1I6HK 3HOXK 3FKIC 3S16C 4BY1C 2JA7C 2E2IK 3GTLK 4A3DC 4A3GK 2WB1D 5C4JC 4BY7C 4LK0A 3HOVC 2PA8D 2E2HC 3HKZL 1XPPA 5TMCA 5FLMK 1TWCC 2B63K 2WAQD 2NVYK 4XLPA 4A3CC 5C3EC 2VUMC 5D4DA 3CQZC 4ZH4A 3FKIK 3S16K 2A6EA 3S1MK 3RZDK 1HQMA 4A3IK 2NVXK 4G7HA 2B63C 1TWFK 2PMZL 4OIQA 3S15K 2VUMK 5IP9C 5IYBK 4BXXK 4YG2A 4A3MC 1SMYA 3GTJK 3HOZK 3RZOC 1TWAK 4A3IC 1I50K 3GTPK 2Y0SL 5IYCK 4Q4ZA 3S1RK 4BBSC 4QIWD 3M3YC 3I4NK 3H3VD 1I6VA 4KN4A 2JA5K 1I6HC 5TMFA 2PPBA 1Y1WK 3S1QK 2E2IC 3GTMC 5C4JK 3S17K 4LLGA 3HOYC 1R9TK 3S2DK 3S14K 2NVQK 1YNNA 4AYBD 1I3QC 4NOIA 3GTLC 2WB1L 3CQZK 5C4XK 4LJZA 3H3VL 4QIWL 5M3FK 3PO2K 3S14C 4C3IK 5C44K 4A3KK 4A3BC 1I3QK 3HOUC 4Y7NC 1WCMC 2BE5A 3GTOC 3S1NC 4X6AK 5C4XC 4BY1K 4A3DK 2YU9C 4A3FK 4Y52K 3GTPC 4A93C 4KMUA 5IYDK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JA6 K;  4A3L K;  2O5J A;  4LK1 A;  4BXX C;  3HOX C;  4A3J K;  2E2J C;  2JA7 K;  3GTG K;  3PO3 C;  2Y0S D;  3GTK C;  1TWA C;  3DXJ A;  1TWG K;  3HOV K;  1YNJ A;  4OIR A;  2R93 C;  3RZD C;  2NVX C;  4A3E C;  2JA5 C;  5C3E K;  4G7Z A;  2PMZ D;  1K83 K;  5M5W K;  4XLN A;  1Y1W C;  2NVT C;  4XSX A;  2A69 A;  4BBR C;  5FJ8 K;  2CW0 A;  2R92 C;  5IP9 K;  4C3H K;  3H0G K;  1TWG C;  3GTK K;  3WOD A;  2JA8 C;  4C3J K;  3GTJ C;  4MEX A;  3HOY K;  3S2H K;  4Q5S A;  4AYB L;  3GTQ C;  4A3G C;  1TWF C;  4BY7 K;  3HOW K;  2A6H A;  3S1R C;  4BBS K;  1TWH K;  5FLM C;  5M5Y K;  5C44 C;  1BDF A;  2R92 K;  4G7O A;  1WCM K;  4MQ9 A;  2O5I A;  3EQL A;  3S2H C;  3S1Q C;  3GTQ K;  5M5X K;  1TWC K;  3HOW C;  3I4N C;  1R9T C;  4YFN A;  4A3C K;  4OIN A;  3S2D C;  5IYD C;  5IP7 C;  5M3M K;  4MEY A;  3I4M K;  4OIP A;  3S15 C;  4YFX A;  2YU9 K;  3PO3 K;  3S1M C;  3M4O K;  2A68 A;  3S17 C;  4QJV A;  4A93 K;  3HOZ C;  1IW7 A;  2JA6 C;  3RZO K;  4A3L C;  4JK1 A;  1Y1V K;  1SFO C;  2R93 K;  4A3E K;  4KN7 A;  4YFK A;  3K7A C;  4OIO A;  5IYC C;  4A3J C;  2E2J K;  4C2M K;  2R7Z C;  5IP7 K;  3GTG C;  5IYB C;  4GZY A;  3I4M C;  1K83 C;  4A3M K;  4A3K C;  2NVT K;  4BBR K;  3HOU K;  4X6A C;  3M4O C;  3PO2 C;  1I50 C;  2JA8 K;  2E2H K;  4Y52 C;  2WAQ L;  4A3F C;  1Y1V C;  1SFO K;  3GTM K;  3M3Y K;  2NVY C;  3HKZ D;  3K7A K;  4QJV B;  4A3B K;  1ZYR A;  2PA8 L;  2R7Z K;  4Y7N K;  1TWH C;  4XSZ A;  2NVQ C;  3GTO K;  3H0G C;  3S1N K;  1I6H K;  3HOX K;  3FKI C;  3S16 C;  4BY1 C;  2JA7 C;  2E2I K;  3GTL K;  4A3D C;  4A3G K;  2WB1 D;  5C4J C;  4BY7 C;  4LK0 A;  3HOV C;  2PA8 D;  2E2H C;  3HKZ L;  1XPP A;  5TMC A;  5FLM K;  1TWC C;  2B63 K;  2WAQ D;  2NVY K;  4XLP A;  4A3C C;  5C3E C;  2VUM C;  5D4D A;  3CQZ C;  4ZH4 A;  3FKI K;  3S16 K;  2A6E A;  3S1M K;  3RZD K;  1HQM A;  4A3I K;  2NVX K;  4G7H A;  2B63 C;  1TWF K;  2PMZ L;  4OIQ A;  3S15 K;  2VUM K;  5IP9 C;  5IYB K;  4BXX K;  4YG2 A;  4A3M C;  1SMY A;  3GTJ K;  3HOZ K;  3RZO C;  1TWA K;  4A3I C;  1I50 K;  3GTP K;  2Y0S L;  5IYC K;  4Q4Z A;  3S1R K;  4BBS C;  4QIW D;  3M3Y C;  3I4N K;  3H3V D;  1I6V A;  4KN4 A;  2JA5 K;  1I6H C;  5TMF A;  2PPB A;  1Y1W K;  3S1Q K;  2E2I C;  3GTM C;  5C4J K;  3S17 K;  4LLG A;  3HOY C;  1R9T K;  3S2D K;  3S14 K;  2NVQ K;  1YNN A;  4AYB D;  1I3Q C;  4NOI A;  3GTL C;  2WB1 L;  3CQZ K;  5C4X K;  4LJZ A;  3H3V L;  4QIW L;  5M3F K;  3PO2 K;  3S14 C;  4C3I K;  5C44 K;  4A3K K;  4A3B C;  1I3Q K;  3HOU C;  4Y7N C;  1WCM C;  2BE5 A;  3GTO C;  3S1N C;  4X6A K;  5C4X C;  4BY1 K;  4A3D K;  2YU9 C;  4A3F K;  4Y52 K;  3GTP C;  4A93 C;  4KMU A;  5IYD K; 
#chains in the Genus database with same CATH topology
 1TWA A;  4PAA A;  4LK1 A;  1O25 A;  2JA7 K;  1O2F B;  1EK8 A;  1PJ6 A;  3HOV K;  4OIR A;  3RZD C;  2NVX C;  1XXC A;  3OEP A;  4KMA A;  2GSO A;  5C3E K;  4G7Z A;  1Y1W C;  4KM8 A;  4BBR C;  2CW0 A;  3SZY A;  3WOD A;  1J98 A;  4AYB L;  4BY7 K;  1WCM A;  1GE9 A;  5FLM C;  5C44 C;  3FOE A;  2RH6 A;  2O5I A;  3EQL A;  4GFQ A;  3GTQ K;  5M5X K;  1TWC K;  4A3C K;  2PHC B;  5IYD C;  4G0U A;  5M3M K;  2XCQ A;  3S15 C;  3S1M C;  2A68 A;  3OPF A;  2JA6 C;  1YCL A;  4KC6 A;  3TTG A;  4KN7 A;  4YFK A;  3K7A C;  2E2J K;  5IOS A;  2R7Z C;  3GTG A;  3G4A A;  4P9S A;  3FHZ A;  1PJ7 A;  1O27 A;  2NVT K;  5HL8 A;  4A3F C;  3GTM K;  1XZQ A;  3M3Y K;  4QJV B;  4AH6 A;  4C2M C;  4Y7N K;  1TWH C;  1ZBS A;  3GEI A;  3FKI C;  4BLA A;  3TFH A;  4A3G K;  4LK0 A;  2E2H C;  2WAQ D;  2GSN A;  2NVY K;  2JA5 A;  1RU0 A;  3CQZ C;  4ZH4 A;  3T01 A;  1WSR A;  3RZD K;  1HQM A;  2NVX K;  4WJ3 M;  2W7V A;  1IE0 A;  1WOS A;  4LR2 A;  4BXX K;  1VGX A;  1TWF A;  1O26 A;  4YG2 A;  5IOT A;  4A3M C;  1INN A;  1TWA K;  1I50 K;  3AD7 C;  1I50 A;  4WJ4 A;  2YU9 A;  3I4N K;  4FM9 A;  1I6V A;  5IOR A;  1R9T A;  1WSV A;  2E2I C;  5C4J K;  3S17 K;  1F7U A;  3ERE D;  3S14 K;  1ISE A;  2NVQ K;  3AH5 A;  4XCH A;  5EGH A;  4KB4 A;  2XCR B;  3Q3Q A;  1O28 A;  5JFE A;  3T02 A;  2V6U A;  3BP8 C;  4KMH A;  1I3Q K;  3S1N C;  2BE5 A;  4KAR A;  1L0W A;  4GTF A;  4BY1 K;  1O24 A;  4A3F K;  3QX3 A;  1IS1 A;  4A3J K;  3GTG K;  1G51 A;  3L4J A;  4BLB A;  2KWA A;  2RGR A;  2R93 C;  4A3E C;  2JA5 C;  3L4K A;  4LOW A;  1K83 K;  5M5W K;  4XLN A;  4XSX A;  5L46 A;  4C3H K;  1TWG C;  3HOY K;  4C3J K;  3LAJ A;  4Q5S A;  1IQ0 A;  3GTQ C;  1BDF A;  5EGE A;  2R92 K;  4G7O A;  1WOO A;  2NVY A;  3S2H C;  3H0G A;  3A8J A;  3HOW C;  3I4N C;  3S2D C;  3GTK A;  3LAP A;  2JA6 A;  2YU9 K;  3S17 C;  3FOF A;  4A93 K;  3RZO K;  4A3L C;  4OIO A;  4C2M K;  5IP7 K;  1VH2 A;  4BKW A;  5E68 A;  4BBR K;  3HOU K;  1ZQ1 C;  3M4O C;  1ZXO A;  2E2H K;  1XZP B;  4Y52 C;  1O2A A;  1Y1V C;  2NVY C;  3A8K A;  3HKZ D;  3S1N K;  3H0G C;  4BY1 C;  2WB1 D;  1F9N A;  1XPP A;  5TMC A;  1TWC C;  3CQZ A;  4XLP A;  4A3C C;  3NUH A;  5D4D A;  2R92 A;  3S1M K;  3V4G A;  3TFI A;  1WQF A;  2B63 C;  1TWF K;  4GTC A;  3BP3 A;  2VUM K;  1SMY A;  4C3J C;  1B4B A;  3HOZ K;  1DCP A;  3GTP K;  5IYC K;  4Q4Z A;  2JH3 A;  3M3Y C;  2P8T A;  3H3V D;  4KN4 A;  3T00 A;  1Y1W K;  2XCO A;  4LLG A;  3S2D K;  4AYB D;  4KAT A;  1I3Q C;  3GTL C;  4GT9 A;  3CQZ K;  2CFA B;  1SFO A;  3H3V L;  1HI9 A;  2Y3P A;  4LQY A;  3HOU C;  1WCM C;  3N0B A;  4M1X A;  3HXA A;  4Y52 K;  3ADA C;  1J6W A;  4KMU A;  2JA6 K;  2O5J A;  2E2J C;  3PO3 C;  2Y0S D;  2VUM A;  1TWG K;  1YNJ A;  4KM9 A;  5CHP A;  1V5V A;  2R92 C;  3TFJ A;  2A69 A;  3GTK K;  5IP9 K;  1AB4 A;  3A8I A;  2JA8 C;  4WIL A;  3S2H K;  1O2B A;  1EFW A;  4A3G C;  1TWF C;  3AD8 C;  3VA7 A;  3HOW K;  3S1R C;  1EQR A;  4BBS K;  5M5Y K;  5JVO A;  1X31 C;  4KAW X;  1DD5 A;  1VRQ C;  4KMD A;  1WQH A;  3S1Q C;  3GTM A;  1J6V A;  4O2D A;  1IBA A;  4ILD A;  5IP7 C;  4MEY A;  1UV7 A;  1BGW A;  2FQT A;  4YFX A;  3M4O K;  1XXB A;  1XZQ B;  3ORE A;  3CAG A;  1IW7 A;  1O29 A;  2FQO A;  2GAH C;  4JK1 A;  1B4A A;  1Y1V K;  2R93 K;  2R93 A;  4A3E K;  5IYB C;  4GZY A;  3I4M C;  1K83 C;  5IOQ A;  3MML B;  1KQ4 A;  4C3H C;  1WOP A;  3GEE A;  3GTQ A;  1SFO K;  2PA8 L;  4XSZ A;  2NVQ C;  1I6H K;  3HOX K;  4BY7 C;  3GDZ A;  3HKZ L;  2JA7 A;  2B63 K;  5FLM K;  2E2I A;  1BJT A;  4P5B A;  1BS2 A;  2VUM C;  3S16 K;  2A6E A;  4GTD A;  3BUE A;  1Y1W A;  2PMZ L;  4OIQ A;  3S15 K;  5IP9 C;  5TJ3 A;  2ZUE A;  4A3I C;  4G0V A;  3S1R K;  4BBS C;  3FKI A;  3G4C A;  1JOE A;  2JA5 K;  3JST A;  5CJ9 A;  2PPB A;  3S1Q K;  3SZZ A;  3GTM C;  1F93 A;  3HOY C;  3GTL A;  4NOI A;  1I3Q A;  2WB1 L;  2D6F C;  1DCH A;  3PO2 K;  2V6T A;  1TWG A;  2GSU A;  1F7V A;  5C44 K;  1EI6 A;  1K83 A;  4A3B C;  4C45 A;  3GTO C;  4DDQ A;  3LPX A;  5C4X C;  4A3D K;  1J6X A;  2YU9 C;  3GTP C;  4A93 C;  2EBB A;  5IYD K;  4KAS A;  4A3L K;  4BXX C;  3HOX C;  3GTK C;  1PJ5 A;  1TWA C;  3DXJ A;  4KDD A;  1JVI A;  2NVX A;  4GTA A;  1YX2 A;  2PMZ D;  2NVT C;  2B63 A;  5FJ8 K;  3IPJ A;  3H0G K;  3GTJ C;  4MEX A;  3GIR A;  2A6H A;  1TWH K;  1Y1V A;  1WCM K;  3GSI A;  4MQ9 A;  3GTP A;  3N3Y A;  1R9T C;  4YFN A;  4OIN A;  3I4M K;  1TWC A;  4OIP A;  3PO3 K;  3AD9 C;  1C0A A;  4QJV A;  4GTL A;  3HOZ C;  1SFO C;  3GTJ A;  5IYC C;  4A3J C;  3GTG C;  2P5M A;  4C3I C;  4A3M K;  4A3K C;  4X6A C;  1EH1 A;  3PO2 C;  1I50 C;  1XXA A;  2JA8 K;  2WAQ L;  3K7A K;  1TWH A;  4A3B K;  1ZYR A;  2R7Z K;  3GTO K;  2V6S A;  3GTO A;  1IL2 A;  3S16 C;  4A3D C;  1WIH A;  2GAG C;  2E2I K;  2JA7 C;  3GTL K;  5C4J C;  2E2H A;  2ZFZ A;  3HOV C;  2PA8 D;  1XZP A;  5C3E C;  3FKI K;  4GTE A;  1USO A;  1USM A;  4A3I K;  4G7H A;  3AQP A;  4KB2 A;  4FZB A;  3GEH A;  1VJE A;  5IYB K;  3GTJ K;  3RZO C;  1WOR A;  2Y0S L;  4QIW D;  1I6H C;  1WQG A;  5TMF A;  4GTB A;  3S0X A;  1VLO A;  1R9T K;  1ZVU A;  4RMF A;  1YNN A;  2ZUF A;  2R7Z A;  5C4X K;  4LJZ A;  4J3N A;  3AQO A;  4QIW L;  5M3F K;  3S14 C;  4C3I K;  4A3K K;  1DCO A;  4Y7N C;  4X6A K;  3N0C A;  4PAB A;  4G0W A;  1JQW A;  2CFA A;  4P5A A; 
#chains in the Genus database with same CATH homology
 2JA6 K;  4A3L K;  2O5J A;  4LK1 A;  4BXX C;  3HOX C;  4A3J K;  2E2J C;  2JA7 K;  3GTG K;  3PO3 C;  2Y0S D;  3GTK C;  1TWA C;  3DXJ A;  1TWG K;  3HOV K;  1YNJ A;  4OIR A;  2R93 C;  3RZD C;  2NVX C;  4A3E C;  2JA5 C;  5C3E K;  4G7Z A;  2PMZ D;  1K83 K;  5M5W K;  4XLN A;  1Y1W C;  2NVT C;  4XSX A;  2A69 A;  4BBR C;  5FJ8 K;  2CW0 A;  2R92 C;  5IP9 K;  4C3H K;  3H0G K;  1TWG C;  3GTK K;  3WOD A;  2JA8 C;  4C3J K;  3GTJ C;  4MEX A;  3HOY K;  3S2H K;  4Q5S A;  4AYB L;  3GTQ C;  4A3G C;  1TWF C;  4BY7 K;  3HOW K;  2A6H A;  3S1R C;  4BBS K;  1TWH K;  5FLM C;  5M5Y K;  5C44 C;  1BDF A;  2R92 K;  4G7O A;  1WCM K;  4MQ9 A;  2O5I A;  3EQL A;  3S2H C;  3S1Q C;  3GTQ K;  5M5X K;  1TWC K;  3HOW C;  3I4N C;  1R9T C;  4YFN A;  4A3C K;  4OIN A;  3S2D C;  5IYD C;  5IP7 C;  5M3M K;  4MEY A;  3I4M K;  4OIP A;  3S15 C;  4YFX A;  2YU9 K;  3PO3 K;  3S1M C;  3M4O K;  2A68 A;  3S17 C;  4QJV A;  4A93 K;  3HOZ C;  1IW7 A;  2JA6 C;  3RZO K;  4A3L C;  4JK1 A;  1Y1V K;  1SFO C;  2R93 K;  4A3E K;  4KN7 A;  4YFK A;  3K7A C;  4OIO A;  5IYC C;  4A3J C;  2E2J K;  4C2M K;  2R7Z C;  5IP7 K;  3GTG C;  5IYB C;  4GZY A;  3I4M C;  1K83 C;  4A3M K;  4A3K C;  2NVT K;  4BBR K;  3HOU K;  4X6A C;  3M4O C;  3PO2 C;  1I50 C;  2JA8 K;  2E2H K;  4Y52 C;  2WAQ L;  4A3F C;  1Y1V C;  1SFO K;  3GTM K;  3M3Y K;  2NVY C;  3HKZ D;  3K7A K;  4QJV B;  4A3B K;  1ZYR A;  2PA8 L;  2R7Z K;  4Y7N K;  1TWH C;  4XSZ A;  2NVQ C;  3GTO K;  3H0G C;  3S1N K;  1I6H K;  3HOX K;  3FKI C;  3S16 C;  4BY1 C;  2JA7 C;  2E2I K;  3GTL K;  4A3D C;  4A3G K;  2WB1 D;  5C4J C;  4BY7 C;  4LK0 A;  3HOV C;  2PA8 D;  2E2H C;  3HKZ L;  1XPP A;  5TMC A;  5FLM K;  1TWC C;  2B63 K;  2WAQ D;  2NVY K;  4XLP A;  4A3C C;  5C3E C;  2VUM C;  5D4D A;  3CQZ C;  4ZH4 A;  3FKI K;  3S16 K;  2A6E A;  3S1M K;  3RZD K;  1HQM A;  4A3I K;  2NVX K;  4G7H A;  2B63 C;  1TWF K;  2PMZ L;  4OIQ A;  3S15 K;  2VUM K;  5IP9 C;  5IYB K;  4BXX K;  4YG2 A;  4A3M C;  1SMY A;  3GTJ K;  3HOZ K;  3RZO C;  1TWA K;  4A3I C;  1I50 K;  3GTP K;  2Y0S L;  5IYC K;  4Q4Z A;  3S1R K;  4BBS C;  4QIW D;  3M3Y C;  3I4N K;  3H3V D;  1I6V A;  4KN4 A;  2JA5 K;  1I6H C;  5TMF A;  2PPB A;  1Y1W K;  3S1Q K;  2E2I C;  3GTM C;  5C4J K;  3S17 K;  4LLG A;  3HOY C;  1R9T K;  3S2D K;  3S14 K;  2NVQ K;  1YNN A;  4AYB D;  1I3Q C;  4NOI A;  3GTL C;  2WB1 L;  3CQZ K;  5C4X K;  4LJZ A;  3H3V L;  4QIW L;  5M3F K;  3PO2 K;  3S14 C;  4C3I K;  5C44 K;  4A3K K;  4A3B C;  1I3Q K;  3HOU C;  4Y7N C;  1WCM C;  2BE5 A;  3GTO C;  3S1N C;  4X6A K;  5C4X C;  4BY1 K;  4A3D K;  2YU9 C;  4A3F K;  4Y52 K;  3GTP C;  4A93 C;  4KMU A;  5IYD K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...