2JA5K

Cpd lesion containing rna polymerase ii elongation complex a
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Cpd Damage Recognition by Transcribing RNA Polymerase II
pubmed doi rcsb
molecule tags Transferase
total genus 25
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2006-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2ja5K00
3HOYK 2PMZD 3HOWC 4A3BC 4QJVB 2A6HA 4Y7NC 2JA8K 4XSXA 4A3CK 2WB1D 2JA6K 3S16C 3S2HC 2NVYC 3RZDC 4QIWD 3GTMK 3S15C 3M4OC 4BY7K 3WODA 3HOXK 5M5YK 5IYBK 4A3FC 3GTLK 5C44K 2R93C 1K83C 5TMCA 5D4DA 4A3EC 3S1RK 3HOYC 3M3YK 2B63K 4BBRK 3HKZD 2YU9K 3GTQK 3PO2K 2BE5A 4C3HK 2JA8C 2JA6C 2R7ZK 4X6AK 4AYBD 1I3QC 1ZYRA 2WAQD 2NVXK 4MEXA 3GTMC 4BY7C 4YFNA 5C4JC 4A3KK 4C2MK 5C4XK 1BDFA 3GTOC 3GTLC 3S1RC 3HOZK 5M3MK 3GTKK 3M3YC 4BBRC 4A93K 4Q4ZA 3GTPK 4KMUA 4A3GK 4C3JK 1TWHC 3I4NK 4NOIA 2R7ZC 2E2IC 3S1QK 3HOUK 4LJZA 1Y1WC 2NVXC 2A68A 2PA8L 3FKIK 4A3JK 5C4XC 3GTJK 3HOVK 1XPPA 2E2JC 4Y52K 4XSZA 3GTKC 4A93C 4YFXA 4QJVA 2PPBA 2CW0A 4GZYA 5IP9K 2VUMK 3I4NC 4A3MK 4BY1K 3K7AK 5M5XK 2PMZL 3H0GK 5IYDK 2Y0SD 3HOUC 4XLPA 3EQLA 3S1MK 4BXXK 3FKIC 1I6VA 2WB1L 3GTJC 1SFOK 2O5IA 4QIWL 3S1NK 3HOXC 5IYBC 1WCMK 2O5JA 5C44C 3PO3K 5IP7K 1HQMA 4A3MC 4KN4A 2YU9C 5IYCK 4A3IK 4BY1C 4OIPA 3H0GC 1SMYA 3HKZL 2B63C 3GTQC 3S1MC 4LK1A 1Y1VK 3RZOK 4BXXC 4X6AC 4BBSK 3S2DK 5FJ8K 4AYBL 4G7HA 1R9TK 2A69A 4A3LK 2WAQL 3S1NC 1YNJA 1IW7A 4A3KC 4OIQA 1TWGK 3H3VD 5M3FK 3PO3C 5IP7C 3S17K 3HOZC 4G7OA 1I50K 5IYCC 4A3IC 3GTPC 3GTGK 4A3GC 4OIOA 4A3CC 1Y1VC 3RZOC 4OIRA 4Y7NK 3S1QC 4LLGA 3S16K 2E2HK 4A3LC 4Q5SA 1TWCK 3CQZK 2NVYK 2NVTK 4A3JC 1TWGC 2NVQK 1YNNA 4C3IK 3M4OK 4YFKA 4Y52C 2JA5K 3HOVC 3S17C 2R93K 2R92K 1I50C 3I4MK 3S2HK 4LK0A 5M5WK 2A6EA 4XLNA 5IP9C 2VUMC 3GTGC 5TMFA 3K7AC 5C3EK 4JK1A 5IYDC 2Y0SL 2E2HC 1TWFK 1TWCC 3CQZC 1TWAK 1I3QK 5FLMK 2NVTC 1I6HK 4A3DK 3DXJA 2NVQC 1SFOC 4KN7A 5C4JK 2JA5C 3GTOK 2R92C 3I4MC 1WCMC 4G7ZA 2JA7K 3PO2C 5C3EC 3S14K 1TWHK 4OINA 1TWFC 5FLMC 3HOWK 1TWAC 2E2IK 4A3BK 1I6HC 4A3DC 4MQ9A 4YG2A 1Y1WK 4BBSC 2PA8D 1R9TC 3S2DC 3RZDK 4MEYA 2E2JK 4ZH4A 3S15K 4A3FK 3H3VL 2JA7C 1K83K 3S14C 4A3EK
chains in the Genus database with same CATH superfamily
1C0AA 4A3BC 1ZVUA 4Y7NC 2WB1D 2JA6K 1R9TA 3GEHA 3RZDC 4BY7K 4P5BA 1F7UA 1IL2A 5IYBK 2R93C 5C44K 1G51A 3QX3A 1K83C 3S2HC 2BE5A 3GTGA 2VUMA 3AQOA 1XXBA 1VLOA 1TWCA 2NVXK 2NVYA 4MEXA 4YFNA 4C2MK 1ZBSA 4GTAA 3GTLC 3HOZK 3M3YC 1WCMA 2V6TA 3T02A 4KMUA 5HL8A 2D6FC 4NOIA 2R7ZC 3S1QK 4KB2A 3GTJK 1XPPA 3GTOA 2CFAB 2PPBA 2CW0A 2RGRA 3LAPA 3I4NC 4A3MK 4BY1K 1O24A 3K7AK 3HOUC 4XLPA 1B4AA 2E2IA 1Y1WA 2WB1L 5IOTA 2O5IA 3S1NK 3V4GA 3GDZA 3PO3K 3PO2K 2YU9C 4XCHA 2ZUFA 2XCRB 3H0GC 1BGWA 4G0WA 2KWAA 4C3HC 3S1MC 1WSVA 3RZOK 1R9TK 4A3LK 2A69A 3A8JA 1YNJA 4A3KC 4OIQA 1O25A 5M3FK 1DCPA 4A3IC 3ADAC 3GTGK 4A3GC 4J3NA 4LR2A 1PJ6A 3G4CA 5EGEA 1BJTA 1TWCK 1XZPB 2NVYK 2NVQK 3M4OK 1DD5A 3HOVC 3S17C 4LK0A 3GEEA 5M5WK 4KATA 3GTPA 2JH3A 4GTCA 4KMHA 4A3DK 5C4JK 3GTOK 2R92C 3AD7C 1VH2A 4OINA 5EGHA 4KASA 1TWFC 3HOWK 4GFQA 4M1XA 2E2IK 4MQ9A 4BBSC 1Y1WK 4MEYA 4ZH4A 3S15K 3HOYK 2PMZD 5L46A 3S16C 4GTBA 1VRQC 4QIWD 5M5YK 1WIHA 4P5AA 5D4DA 4A3EC 3S1RK 1I50A 4BBRK 3JSTA 4C45A 2JA6C 1I3QC 1ZYRA 4BY7C 5C4XK 2JA5A 2W7VA 2R93A 3GTPK 1TWHC 3FOFA 3N0CA 1XZQA 4LJZA 4RMFA 1TWAA 2NVXC 2A68A 1EH1A 4C2MC 1IS1A 4FZBA 2E2JC 4XSZA 3L4KA 3NUHA 4QJVA 5IP9K 1INNA 2JA7A 2PMZL 4O2DA 1HI9A 2P5MA 3OEPA 3GTJC 3SZYA 4QIWL 1PJ5A 1JOEA 3HOXC 2O5JA 4GTFA 4A3MC 4BY1C 2B63C 3GTQC 4BKWA 4DDQA 1B4BA 4X6AC 1EFWA 3S1NC 1ZXOA 1IW7A 1IBAA 3GTMA 1WQFA 3PO3C 1I50K 1RU0A 2YU9A 1IE0A 2P8TA 3RZOC 5IORA 4Y7NK 4A3LC 1VJEA 4A3JC 3LAJA 4Y52C 2JA5K 1KQ4A 2R93K 3I4MK 1O29A 3S2HK 3GTKA 2A6EA 3GTGC 2VUMC 5TMFA 1BS2A 5C3EK 5IYDC 5FLMK 1TWCC 1TWAK 1J6WA 3AH5A 3HXAA 1I6HK 3DXJA 2NVQC 1SFOC 3FKIA 1F9NA 1WCMC 5JVOA 2FQOA 1WORA 2JA7K 4BLAA 2Y3PA 2GAGC 4KDDA 2XCOA 4A3DC 4YG2A 2PA8D 4FM9A 3S2DC 4A3FK 4A3CK 3HOWC 2JA8K 1Y1VA 4XSXA 5CHPA 1O2BA 3GTMK 3S15C 4C3IC 1TWGA 3HOYC 2YU9K 3HKZD 3L4JA 4C3HK 1USOA 2E2HA 3CQZA 3ERED 2FQTA 4A3KK 2GAHC 1BDFA 2V6SA 1YX2A 2RH6A 3S1RC 3GTKK 4BBRC 4PAAA 4A93K 4Q4ZA 3TFHA 4KMAA 4A3GK 4C3JK 1DCHA 4KB4A 1I3QA 1UV7A 4GTEA 2PA8L 3FKIK 5C4XC 3HOVK 4AH6A 4WILA 2GSOA 1TWHA 1WQGA 1XXCA 3EQLA 4BXXK 3A8IA 1ZQ1C 3A8KA 3OREA 1L0WA 5E68A 4KM9A 5IYBC 5C44C 3FHZA 5IP7K 1K83A 5IYCK 4OIPA 3HKZL 4GTDA 3T01A 4P9SA 4KMDA 3G4AA 1Y1VK 4BBSK 1TWGK 4GTLA 4GT9A 3H3VD 4BLBA 3HOZC 3GTLA 3TFJA 2B63A 3GTQA 4OIOA 5IOQA 1V5VA 3S0XA 3S1QC 2CFAA 3GIRA 2E2HK 3S16K 4Q5SA 2R7ZA 3CQZK 2NVTK 3BUEA 1JQWA 4KC6A 4YFKA 3GSIA 3AD8C 1I50C 4XLNA 1IQ0A 3CAGA 3K7AC 1I3QK 4LQYA 3AQPA 3N3YA 1WOSA 2JA5C 4WJ3M 1EK8A 2EBBA 3I4MC 4G7ZA 4WJ4A 3PO2C 5C3EC 3S14K 1TWHK 4PABA 3H0GA 5FLMC 2GSNA 1TWAC 4LOWA 4A3BK 1I6HC 3N0BA 1R9TC 1SFOA 3RZDK 2E2JK 1XZQB 2PHCB 3H3VL 2JA7C 1K83K 1XZPA 3TTGA 1EQRA 1WQHA 2A6HA 4QJVB 4G0VA 1F93A 2NVYC 1DCOA 3VA7A 3M4OC 3WODA 3HOXK 4A3FC 3GTLK 1USMA 5TMCA 4A3CC 3M3YK 3OPFA 2B63K 3GTQK 3GEIA 1GE9A 2JA8C 2R7ZK 4X6AK 4AYBD 1O2FB 3TFIA 2WAQD 3GTMC 1XXAA 5C4JC 3GTOC 5TJ3A 5M3MK 3BP8C 1WSRA 2R92A 1VGXA 3I4NK 3LPXA 2E2IC 1TWFA 3HOUK 1Y1WC 1O28A 4A3JK 4Y52K 3GTKC 4A93C 4YFXA 4GZYA 1AB4A 2VUMK 4C3JC 3Q3QA 1WOPA 5M5XK 3H0GK 5IYDK 2Y0SD 3S1MK 3FKIC 1I6VA 1SFOK 1J6XA 1WCMK 3T00A 1HQMA 3AD9C 3IPJA 1X31C 4KN4A 4A3IK 4G0UA 1SMYA 3FOEA 4LK1A 4BXXC 1F7VA 3S2DK 5FJ8K 4AYBL 4G7HA 2JA6A 5CJ9A 2WAQL 3SZZA 2XCQA 5IP7C 3S17K 4G7OA 2V6UA 5IYCC 4KAWX 3GTPC 1Y1VC 1J6VA 4OIRA 1EI6A 4LLGA 4KM8A 1YCLA 2NVXA 1TWGC 1YNNA 4C3IK 1O2AA 2GSUA 2R92K 2ZUEA 5IP9C 1J98A 4JK1A 4ILDA 3MMLB 2Y0SL 2E2HC 1TWFK 3CQZC 1PJ7A 2NVTC 2ZFZA 4KN7A 1ISEA 3GTJA 4KARA 1JVIA 1O26A 1WOOA 5IOSA 5JFEA 3BP3A 1O27A 3S14C 4A3EK
chains in the Genus database with same CATH topology
3HOYK 2PMZD 3HOWC 4A3BC 4QJVB 2A6HA 4Y7NC 2JA8K 4XSXA 4A3CK 2WB1D 2JA6K 3S16C 3S2HC 2NVYC 3RZDC 4QIWD 3GTMK 3S15C 3M4OC 4BY7K 3WODA 3HOXK 5M5YK 5IYBK 4A3FC 3GTLK 5C44K 2R93C 1K83C 5TMCA 5D4DA 4A3EC 3S1RK 3HOYC 3M3YK 2B63K 4BBRK 3HKZD 2YU9K 3GTQK 3PO2K 2BE5A 4C3HK 2JA8C 2JA6C 2R7ZK 4X6AK 4AYBD 1I3QC 1ZYRA 2WAQD 2NVXK 4MEXA 3GTMC 4BY7C 4YFNA 5C4JC 4A3KK 4C2MK 5C4XK 1BDFA 3GTOC 3GTLC 3S1RC 3HOZK 5M3MK 3GTKK 3M3YC 4BBRC 4A93K 4Q4ZA 3GTPK 4KMUA 4A3GK 4C3JK 1TWHC 3I4NK 4NOIA 2R7ZC 2E2IC 3S1QK 3HOUK 4LJZA 1Y1WC 2NVXC 2A68A 2PA8L 3FKIK 4A3JK 5C4XC 3GTJK 3HOVK 1XPPA 2E2JC 4Y52K 4XSZA 3GTKC 4A93C 4YFXA 4QJVA 2PPBA 2CW0A 4GZYA 5IP9K 2VUMK 3I4NC 4A3MK 4BY1K 3K7AK 5M5XK 2PMZL 3H0GK 5IYDK 2Y0SD 3HOUC 4XLPA 3EQLA 3S1MK 4BXXK 3FKIC 1I6VA 2WB1L 3GTJC 1SFOK 2O5IA 4QIWL 3S1NK 3HOXC 5IYBC 1WCMK 2O5JA 5C44C 3PO3K 5IP7K 1HQMA 4A3MC 4KN4A 2YU9C 5IYCK 4A3IK 4BY1C 4OIPA 3H0GC 1SMYA 3HKZL 2B63C 3GTQC 3S1MC 4LK1A 1Y1VK 3RZOK 4BXXC 4X6AC 4BBSK 3S2DK 5FJ8K 4AYBL 4G7HA 1R9TK 2A69A 4A3LK 2WAQL 3S1NC 1YNJA 1IW7A 4A3KC 4OIQA 1TWGK 3H3VD 5M3FK 3PO3C 5IP7C 3S17K 3HOZC 4G7OA 1I50K 5IYCC 4A3IC 3GTPC 3GTGK 4A3GC 4OIOA 4A3CC 1Y1VC 3RZOC 4OIRA 4Y7NK 3S1QC 4LLGA 3S16K 2E2HK 4A3LC 4Q5SA 1TWCK 3CQZK 2NVYK 2NVTK 4A3JC 1TWGC 2NVQK 1YNNA 4C3IK 3M4OK 4YFKA 4Y52C 2JA5K 3HOVC 3S17C 2R93K 2R92K 1I50C 3I4MK 3S2HK 4LK0A 5M5WK 2A6EA 4XLNA 5IP9C 2VUMC 3GTGC 5TMFA 3K7AC 5C3EK 4JK1A 5IYDC 2Y0SL 2E2HC 1TWFK 1TWCC 3CQZC 1TWAK 1I3QK 5FLMK 2NVTC 1I6HK 4A3DK 3DXJA 2NVQC 1SFOC 4KN7A 5C4JK 2JA5C 3GTOK 2R92C 3I4MC 1WCMC 4G7ZA 2JA7K 3PO2C 5C3EC 3S14K 1TWHK 4OINA 1TWFC 5FLMC 3HOWK 1TWAC 2E2IK 4A3BK 1I6HC 4A3DC 4MQ9A 4YG2A 1Y1WK 4BBSC 2PA8D 1R9TC 3S2DC 3RZDK 4MEYA 2E2JK 4ZH4A 3S15K 4A3FK 3H3VL 2JA7C 1K83K 3S14C 4A3EK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HOY K;  2PMZ D;  3HOW C;  4A3B C;  4QJV B;  2A6H A;  4Y7N C;  2JA8 K;  4XSX A;  4A3C K;  2WB1 D;  2JA6 K;  3S16 C;  3S2H C;  2NVY C;  3RZD C;  4QIW D;  3GTM K;  3S15 C;  3M4O C;  4BY7 K;  3WOD A;  3HOX K;  5M5Y K;  5IYB K;  4A3F C;  3GTL K;  5C44 K;  2R93 C;  1K83 C;  5TMC A;  5D4D A;  4A3E C;  3S1R K;  3HOY C;  3M3Y K;  2B63 K;  4BBR K;  3HKZ D;  2YU9 K;  3GTQ K;  3PO2 K;  2BE5 A;  4C3H K;  2JA8 C;  2JA6 C;  2R7Z K;  4X6A K;  4AYB D;  1I3Q C;  1ZYR A;  2WAQ D;  2NVX K;  4MEX A;  3GTM C;  4BY7 C;  4YFN A;  5C4J C;  4A3K K;  4C2M K;  5C4X K;  1BDF A;  3GTO C;  3GTL C;  3S1R C;  3HOZ K;  5M3M K;  3GTK K;  3M3Y C;  4BBR C;  4A93 K;  4Q4Z A;  3GTP K;  4KMU A;  4A3G K;  4C3J K;  1TWH C;  3I4N K;  4NOI A;  2R7Z C;  2E2I C;  3S1Q K;  3HOU K;  4LJZ A;  1Y1W C;  2NVX C;  2A68 A;  2PA8 L;  3FKI K;  4A3J K;  5C4X C;  3GTJ K;  3HOV K;  1XPP A;  2E2J C;  4Y52 K;  4XSZ A;  3GTK C;  4A93 C;  4YFX A;  4QJV A;  2PPB A;  2CW0 A;  4GZY A;  5IP9 K;  2VUM K;  3I4N C;  4A3M K;  4BY1 K;  3K7A K;  5M5X K;  2PMZ L;  3H0G K;  5IYD K;  2Y0S D;  3HOU C;  4XLP A;  3EQL A;  3S1M K;  4BXX K;  3FKI C;  1I6V A;  2WB1 L;  3GTJ C;  1SFO K;  2O5I A;  4QIW L;  3S1N K;  3HOX C;  5IYB C;  1WCM K;  2O5J A;  5C44 C;  3PO3 K;  5IP7 K;  1HQM A;  4A3M C;  4KN4 A;  2YU9 C;  5IYC K;  4A3I K;  4BY1 C;  4OIP A;  3H0G C;  1SMY A;  3HKZ L;  2B63 C;  3GTQ C;  3S1M C;  4LK1 A;  1Y1V K;  3RZO K;  4BXX C;  4X6A C;  4BBS K;  3S2D K;  5FJ8 K;  4AYB L;  4G7H A;  1R9T K;  2A69 A;  4A3L K;  2WAQ L;  3S1N C;  1YNJ A;  1IW7 A;  4A3K C;  4OIQ A;  1TWG K;  3H3V D;  5M3F K;  3PO3 C;  5IP7 C;  3S17 K;  3HOZ C;  4G7O A;  1I50 K;  5IYC C;  4A3I C;  3GTP C;  3GTG K;  4A3G C;  4OIO A;  4A3C C;  1Y1V C;  3RZO C;  4OIR A;  4Y7N K;  3S1Q C;  4LLG A;  3S16 K;  2E2H K;  4A3L C;  4Q5S A;  1TWC K;  3CQZ K;  2NVY K;  2NVT K;  4A3J C;  1TWG C;  2NVQ K;  1YNN A;  4C3I K;  3M4O K;  4YFK A;  4Y52 C;  2JA5 K;  3HOV C;  3S17 C;  2R93 K;  2R92 K;  1I50 C;  3I4M K;  3S2H K;  4LK0 A;  5M5W K;  2A6E A;  4XLN A;  5IP9 C;  2VUM C;  3GTG C;  5TMF A;  3K7A C;  5C3E K;  4JK1 A;  5IYD C;  2Y0S L;  2E2H C;  1TWF K;  1TWC C;  3CQZ C;  1TWA K;  1I3Q K;  5FLM K;  2NVT C;  1I6H K;  4A3D K;  3DXJ A;  2NVQ C;  1SFO C;  4KN7 A;  5C4J K;  2JA5 C;  3GTO K;  2R92 C;  3I4M C;  1WCM C;  4G7Z A;  2JA7 K;  3PO2 C;  5C3E C;  3S14 K;  1TWH K;  4OIN A;  1TWF C;  5FLM C;  3HOW K;  1TWA C;  2E2I K;  4A3B K;  1I6H C;  4A3D C;  4MQ9 A;  4YG2 A;  1Y1W K;  4BBS C;  2PA8 D;  1R9T C;  3S2D C;  3RZD K;  4MEY A;  2E2J K;  4ZH4 A;  3S15 K;  4A3F K;  3H3V L;  2JA7 C;  1K83 K;  3S14 C;  4A3E K; 
#chains in the Genus database with same CATH topology
 1C0A A;  4A3B C;  1ZVU A;  4Y7N C;  2WB1 D;  2JA6 K;  1R9T A;  3GEH A;  3RZD C;  4BY7 K;  4P5B A;  1F7U A;  1IL2 A;  5IYB K;  2R93 C;  5C44 K;  1G51 A;  3QX3 A;  1K83 C;  3S2H C;  2BE5 A;  3GTG A;  2VUM A;  3AQO A;  1XXB A;  1VLO A;  1TWC A;  2NVX K;  2NVY A;  4MEX A;  4YFN A;  4C2M K;  1ZBS A;  4GTA A;  3GTL C;  3HOZ K;  3M3Y C;  1WCM A;  2V6T A;  3T02 A;  4KMU A;  5HL8 A;  2D6F C;  4NOI A;  2R7Z C;  3S1Q K;  4KB2 A;  3GTJ K;  1XPP A;  3GTO A;  2CFA B;  2PPB A;  2CW0 A;  2RGR A;  3LAP A;  3I4N C;  4A3M K;  4BY1 K;  1O24 A;  3K7A K;  3HOU C;  4XLP A;  1B4A A;  2E2I A;  1Y1W A;  2WB1 L;  5IOT A;  2O5I A;  3S1N K;  3V4G A;  3GDZ A;  3PO3 K;  3PO2 K;  2YU9 C;  4XCH A;  2ZUF A;  2XCR B;  3H0G C;  1BGW A;  4G0W A;  2KWA A;  4C3H C;  3S1M C;  1WSV A;  3RZO K;  1R9T K;  4A3L K;  2A69 A;  3A8J A;  1YNJ A;  4A3K C;  4OIQ A;  1O25 A;  5M3F K;  1DCP A;  4A3I C;  3ADA C;  3GTG K;  4A3G C;  4J3N A;  4LR2 A;  1PJ6 A;  3G4C A;  5EGE A;  1BJT A;  1TWC K;  1XZP B;  2NVY K;  2NVQ K;  3M4O K;  1DD5 A;  3HOV C;  3S17 C;  4LK0 A;  3GEE A;  5M5W K;  4KAT A;  3GTP A;  2JH3 A;  4GTC A;  4KMH A;  4A3D K;  5C4J K;  3GTO K;  2R92 C;  3AD7 C;  1VH2 A;  4OIN A;  5EGH A;  4KAS A;  1TWF C;  3HOW K;  4GFQ A;  4M1X A;  2E2I K;  4MQ9 A;  4BBS C;  1Y1W K;  4MEY A;  4ZH4 A;  3S15 K;  3HOY K;  2PMZ D;  5L46 A;  3S16 C;  4GTB A;  1VRQ C;  4QIW D;  5M5Y K;  1WIH A;  4P5A A;  5D4D A;  4A3E C;  3S1R K;  1I50 A;  4BBR K;  3JST A;  4C45 A;  2JA6 C;  1I3Q C;  1ZYR A;  4BY7 C;  5C4X K;  2JA5 A;  2W7V A;  2R93 A;  3GTP K;  1TWH C;  3FOF A;  3N0C A;  1XZQ A;  4LJZ A;  4RMF A;  1TWA A;  2NVX C;  2A68 A;  1EH1 A;  4C2M C;  1IS1 A;  4FZB A;  2E2J C;  4XSZ A;  3L4K A;  3NUH A;  4QJV A;  5IP9 K;  1INN A;  2JA7 A;  2PMZ L;  4O2D A;  1HI9 A;  2P5M A;  3OEP A;  3GTJ C;  3SZY A;  4QIW L;  1PJ5 A;  1JOE A;  3HOX C;  2O5J A;  4GTF A;  4A3M C;  4BY1 C;  2B63 C;  3GTQ C;  4BKW A;  4DDQ A;  1B4B A;  4X6A C;  1EFW A;  3S1N C;  1ZXO A;  1IW7 A;  1IBA A;  3GTM A;  1WQF A;  3PO3 C;  1I50 K;  1RU0 A;  2YU9 A;  1IE0 A;  2P8T A;  3RZO C;  5IOR A;  4Y7N K;  4A3L C;  1VJE A;  4A3J C;  3LAJ A;  4Y52 C;  2JA5 K;  1KQ4 A;  2R93 K;  3I4M K;  1O29 A;  3S2H K;  3GTK A;  2A6E A;  3GTG C;  2VUM C;  5TMF A;  1BS2 A;  5C3E K;  5IYD C;  5FLM K;  1TWC C;  1TWA K;  1J6W A;  3AH5 A;  3HXA A;  1I6H K;  3DXJ A;  2NVQ C;  1SFO C;  3FKI A;  1F9N A;  1WCM C;  5JVO A;  2FQO A;  1WOR A;  2JA7 K;  4BLA A;  2Y3P A;  2GAG C;  4KDD A;  2XCO A;  4A3D C;  4YG2 A;  2PA8 D;  4FM9 A;  3S2D C;  4A3F K;  4A3C K;  3HOW C;  2JA8 K;  1Y1V A;  4XSX A;  5CHP A;  1O2B A;  3GTM K;  3S15 C;  4C3I C;  1TWG A;  3HOY C;  2YU9 K;  3HKZ D;  3L4J A;  4C3H K;  1USO A;  2E2H A;  3CQZ A;  3ERE D;  2FQT A;  4A3K K;  2GAH C;  1BDF A;  2V6S A;  1YX2 A;  2RH6 A;  3S1R C;  3GTK K;  4BBR C;  4PAA A;  4A93 K;  4Q4Z A;  3TFH A;  4KMA A;  4A3G K;  4C3J K;  1DCH A;  4KB4 A;  1I3Q A;  1UV7 A;  4GTE A;  2PA8 L;  3FKI K;  5C4X C;  3HOV K;  4AH6 A;  4WIL A;  2GSO A;  1TWH A;  1WQG A;  1XXC A;  3EQL A;  4BXX K;  3A8I A;  1ZQ1 C;  3A8K A;  3ORE A;  1L0W A;  5E68 A;  4KM9 A;  5IYB C;  5C44 C;  3FHZ A;  5IP7 K;  1K83 A;  5IYC K;  4OIP A;  3HKZ L;  4GTD A;  3T01 A;  4P9S A;  4KMD A;  3G4A A;  1Y1V K;  4BBS K;  1TWG K;  4GTL A;  4GT9 A;  3H3V D;  4BLB A;  3HOZ C;  3GTL A;  3TFJ A;  2B63 A;  3GTQ A;  4OIO A;  5IOQ A;  1V5V A;  3S0X A;  3S1Q C;  2CFA A;  3GIR A;  2E2H K;  3S16 K;  4Q5S A;  2R7Z A;  3CQZ K;  2NVT K;  3BUE A;  1JQW A;  4KC6 A;  4YFK A;  3GSI A;  3AD8 C;  1I50 C;  4XLN A;  1IQ0 A;  3CAG A;  3K7A C;  1I3Q K;  4LQY A;  3AQP A;  3N3Y A;  1WOS A;  2JA5 C;  4WJ3 M;  1EK8 A;  2EBB A;  3I4M C;  4G7Z A;  4WJ4 A;  3PO2 C;  5C3E C;  3S14 K;  1TWH K;  4PAB A;  3H0G A;  5FLM C;  2GSN A;  1TWA C;  4LOW A;  4A3B K;  1I6H C;  3N0B A;  1R9T C;  1SFO A;  3RZD K;  2E2J K;  1XZQ B;  2PHC B;  3H3V L;  2JA7 C;  1K83 K;  1XZP A;  3TTG A;  1EQR A;  1WQH A;  2A6H A;  4QJV B;  4G0V A;  1F93 A;  2NVY C;  1DCO A;  3VA7 A;  3M4O C;  3WOD A;  3HOX K;  4A3F C;  3GTL K;  1USM A;  5TMC A;  4A3C C;  3M3Y K;  3OPF A;  2B63 K;  3GTQ K;  3GEI A;  1GE9 A;  2JA8 C;  2R7Z K;  4X6A K;  4AYB D;  1O2F B;  3TFI A;  2WAQ D;  3GTM C;  1XXA A;  5C4J C;  3GTO C;  5TJ3 A;  5M3M K;  3BP8 C;  1WSR A;  2R92 A;  1VGX A;  3I4N K;  3LPX A;  2E2I C;  1TWF A;  3HOU K;  1Y1W C;  1O28 A;  4A3J K;  4Y52 K;  3GTK C;  4A93 C;  4YFX A;  4GZY A;  1AB4 A;  2VUM K;  4C3J C;  3Q3Q A;  1WOP A;  5M5X K;  3H0G K;  5IYD K;  2Y0S D;  3S1M K;  3FKI C;  1I6V A;  1SFO K;  1J6X A;  1WCM K;  3T00 A;  1HQM A;  3AD9 C;  3IPJ A;  1X31 C;  4KN4 A;  4A3I K;  4G0U A;  1SMY A;  3FOE A;  4LK1 A;  4BXX C;  1F7V A;  3S2D K;  5FJ8 K;  4AYB L;  4G7H A;  2JA6 A;  5CJ9 A;  2WAQ L;  3SZZ A;  2XCQ A;  5IP7 C;  3S17 K;  4G7O A;  2V6U A;  5IYC C;  4KAW X;  3GTP C;  1Y1V C;  1J6V A;  4OIR A;  1EI6 A;  4LLG A;  4KM8 A;  1YCL A;  2NVX A;  1TWG C;  1YNN A;  4C3I K;  1O2A A;  2GSU A;  2R92 K;  2ZUE A;  5IP9 C;  1J98 A;  4JK1 A;  4ILD A;  3MML B;  2Y0S L;  2E2H C;  1TWF K;  3CQZ C;  1PJ7 A;  2NVT C;  2ZFZ A;  4KN7 A;  1ISE A;  3GTJ A;  4KAR A;  1JVI A;  1O26 A;  1WOO A;  5IOS A;  5JFE A;  3BP3 A;  1O27 A;  3S14 C;  4A3E K; 
#chains in the Genus database with same CATH homology
 3HOY K;  2PMZ D;  3HOW C;  4A3B C;  4QJV B;  2A6H A;  4Y7N C;  2JA8 K;  4XSX A;  4A3C K;  2WB1 D;  2JA6 K;  3S16 C;  3S2H C;  2NVY C;  3RZD C;  4QIW D;  3GTM K;  3S15 C;  3M4O C;  4BY7 K;  3WOD A;  3HOX K;  5M5Y K;  5IYB K;  4A3F C;  3GTL K;  5C44 K;  2R93 C;  1K83 C;  5TMC A;  5D4D A;  4A3E C;  3S1R K;  3HOY C;  3M3Y K;  2B63 K;  4BBR K;  3HKZ D;  2YU9 K;  3GTQ K;  3PO2 K;  2BE5 A;  4C3H K;  2JA8 C;  2JA6 C;  2R7Z K;  4X6A K;  4AYB D;  1I3Q C;  1ZYR A;  2WAQ D;  2NVX K;  4MEX A;  3GTM C;  4BY7 C;  4YFN A;  5C4J C;  4A3K K;  4C2M K;  5C4X K;  1BDF A;  3GTO C;  3GTL C;  3S1R C;  3HOZ K;  5M3M K;  3GTK K;  3M3Y C;  4BBR C;  4A93 K;  4Q4Z A;  3GTP K;  4KMU A;  4A3G K;  4C3J K;  1TWH C;  3I4N K;  4NOI A;  2R7Z C;  2E2I C;  3S1Q K;  3HOU K;  4LJZ A;  1Y1W C;  2NVX C;  2A68 A;  2PA8 L;  3FKI K;  4A3J K;  5C4X C;  3GTJ K;  3HOV K;  1XPP A;  2E2J C;  4Y52 K;  4XSZ A;  3GTK C;  4A93 C;  4YFX A;  4QJV A;  2PPB A;  2CW0 A;  4GZY A;  5IP9 K;  2VUM K;  3I4N C;  4A3M K;  4BY1 K;  3K7A K;  5M5X K;  2PMZ L;  3H0G K;  5IYD K;  2Y0S D;  3HOU C;  4XLP A;  3EQL A;  3S1M K;  4BXX K;  3FKI C;  1I6V A;  2WB1 L;  3GTJ C;  1SFO K;  2O5I A;  4QIW L;  3S1N K;  3HOX C;  5IYB C;  1WCM K;  2O5J A;  5C44 C;  3PO3 K;  5IP7 K;  1HQM A;  4A3M C;  4KN4 A;  2YU9 C;  5IYC K;  4A3I K;  4BY1 C;  4OIP A;  3H0G C;  1SMY A;  3HKZ L;  2B63 C;  3GTQ C;  3S1M C;  4LK1 A;  1Y1V K;  3RZO K;  4BXX C;  4X6A C;  4BBS K;  3S2D K;  5FJ8 K;  4AYB L;  4G7H A;  1R9T K;  2A69 A;  4A3L K;  2WAQ L;  3S1N C;  1YNJ A;  1IW7 A;  4A3K C;  4OIQ A;  1TWG K;  3H3V D;  5M3F K;  3PO3 C;  5IP7 C;  3S17 K;  3HOZ C;  4G7O A;  1I50 K;  5IYC C;  4A3I C;  3GTP C;  3GTG K;  4A3G C;  4OIO A;  4A3C C;  1Y1V C;  3RZO C;  4OIR A;  4Y7N K;  3S1Q C;  4LLG A;  3S16 K;  2E2H K;  4A3L C;  4Q5S A;  1TWC K;  3CQZ K;  2NVY K;  2NVT K;  4A3J C;  1TWG C;  2NVQ K;  1YNN A;  4C3I K;  3M4O K;  4YFK A;  4Y52 C;  2JA5 K;  3HOV C;  3S17 C;  2R93 K;  2R92 K;  1I50 C;  3I4M K;  3S2H K;  4LK0 A;  5M5W K;  2A6E A;  4XLN A;  5IP9 C;  2VUM C;  3GTG C;  5TMF A;  3K7A C;  5C3E K;  4JK1 A;  5IYD C;  2Y0S L;  2E2H C;  1TWF K;  1TWC C;  3CQZ C;  1TWA K;  1I3Q K;  5FLM K;  2NVT C;  1I6H K;  4A3D K;  3DXJ A;  2NVQ C;  1SFO C;  4KN7 A;  5C4J K;  2JA5 C;  3GTO K;  2R92 C;  3I4M C;  1WCM C;  4G7Z A;  2JA7 K;  3PO2 C;  5C3E C;  3S14 K;  1TWH K;  4OIN A;  1TWF C;  5FLM C;  3HOW K;  1TWA C;  2E2I K;  4A3B K;  1I6H C;  4A3D C;  4MQ9 A;  4YG2 A;  1Y1W K;  4BBS C;  2PA8 D;  1R9T C;  3S2D C;  3RZD K;  4MEY A;  2E2J K;  4ZH4 A;  3S15 K;  4A3F K;  3H3V L;  2JA7 C;  1K83 K;  3S14 C;  4A3E K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...