2JA5K

Cpd lesion containing rna polymerase ii elongation complex a
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
114
structure length
114
Chain Sequence
b'MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Cpd Damage Recognition by Transcribing RNA Polymerase II
pubmed doi rcsb
molecule tags Transferase
total genus 25
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2006-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2ja5K00
4A3GC 2YU9C 2VUMC 2CW0A 1Y1VK 4C3JK 1TWGK 5FJ8K 4A3MK 4C3HK 4KMUA 1TWAC 3GTPC 2E2IC 3RZDK 1I50K 5M3FK 2JA5C 4A3FK 4OINA 3GTOC 2E2HC 3HOYK 3I4MK 4XSZA 5C3EC 3GTKK 3M3YK 1XPPA 4BY1K 4A3BK 3S17C 2R93C 3HOWC 2R7ZK 3I4NC 2B63K 3HOUK 3S1NK 5IYBK 2YU9K 5IYCK 3GTGC 4BBSK 5IYDK 4BY7K 3DXJA 3FKIC 4A3GK 2JA6K 4OIRA 4XLNA 4YG2A 2VUMK 1I3QC 2PA8L 1I6HC 4Y52C 2PA8D 3GTQC 4A3LC 1TWAK 3GTPK 2E2IK 3PO2C 3M4OC 4A93C 4X6AK 3GTLC 1I6VA 1K83K 2E2HK 3PO3C 5C3EK 2NVYC 4YFXA 2JA7K 1BDFA 3HOZK 5IP9K 3S14C 3S17K 4Q5SA 2R93K 5TMCA 4JK1A 2JA8K 3I4NK 4LLGA 2WB1L 2E2JC 3GTGK 1TWCC 4LK0A 3EQLA 2WB1D 3FKIK 3HKZD 4AYBL 5FLMC 4C3IK 2WAQL 4AYBD 5M5WK 4Y52K 2NVXK 4BXXC 2WAQD 4YFNA 2O5IA 4A3LK 3HOVC 4A3IC 3M4OK 1HQMA 4A93K 1YNNA 4A3EC 2R92C 5C44C 2NVYK 4BBSC 2PMZD 3S15C 3CQZC 3S2HC 3H0GC 3RZOC 4ZH4A 2Y0SL 4A3JC 5TMFA 1IW7A 4A3CC 1TWCK 2O5JA 1TWHC 2Y0SD 5C4JC 4G7HA 5M3MK 2JA5K 4BBRC 5FLMK 4XSXA 3GTOK 4A3KC 4MQ9A 3S1QC 1ZYRA 3WODA 4BXXK 1TWFC 1YNJA 3HOWK 4A3IK 2A69A 4G7OA 1Y1WC 4OIQA 3S1MC 3HKZL 4A3EK 2R92K 5C44K 3S2DC 3CQZK 1Y1VC 4KN4A 2NVTC 3S2HK 1I3QK 4Y7NC 1I6HK 5IP7C 5M5XK 3K7AC 4A3JK 3GTMC 3GTQK 1R9TC 2NVQC 1I50C 5C4JK 4A3FC 4QIWL 3PO2K 4YFKA 2PMZL 3GTLK 3PO3K 4QIWD 4BY1C 3HOXC 3S14K 4A3BC 5M5YK 3S1QK 1TWFK 1SMYA 1WCMC 2R7ZC 4MEXA 1SFOC 2PPBA 4OIOA 5C4XC 4OIPA 2BE5A 5IYCC 1Y1WK 3S1MK 2E2JK 4NOIA 2A6HA 3S1RC 2JA6C 2A6EA 3S2DK 2NVTK 4MEYA 4LK1A 4Y7NK 4XLPA 5IP7K 3S16C 4QJVB 3K7AK 3GTMK 1R9TK 2NVQK 4A3DC 3HOVK 3GTJC 4G7ZA 4X6AC 1K83C 2JA7C 3HOZC 5IP9C 3HOXK 3S15K 2JA8C 1WCMK 1TWGC 3H0GK 4A3MC 1SFOK 5C4XK 3RZOK 2A68A 4LJZA 4A3CK 1TWHK 3RZDC 3S1RK 4C2MK 3HOYC 4BBRK 3I4MC 2NVXC 4KN7A 4A3KK 3GTKC 3M3YC 3S16K 3H3VL 5D4DA 2B63C 4A3DK 3H3VD 3HOUC 3S1NC 3GTJK 4GZYA 4Q4ZA 5IYBC 4QJVA 5IYDC 4BY7C
chains in the Genus database with same CATH superfamily
4A3GC 4J3NA 1IE0A 2XCQA 3Q3QA 3VA7A 3CAGA 5M3FK 3GTOC 2P5MA 2ZFZA 3M3YK 1X31C 3JSTA 1AB4A 2W7VA 3HOWC 1RU0A 2YU9A 3I4NC 2VUMA 4LOWA 3T01A 3FKIC 4KMDA 1I3QC 2KWAA 1VGXA 2E2IA 2GSNA 1WOPA 2PA8D 2RGRA 3GTQC 3PO2C 4RMFA 5EGHA 4WJ4A 4G0VA 3GTLC 3PO3C 4YFXA 2JA7K 1BDFA 4GFQA 1IL2A 3LAPA 4BLAA 3GTGA 3AD7C 1F9NA 3MMLB 3BP3A 4KB2A 4LK0A 2P8TA 1J98A 2GAGC 4XCHA 5FLMC 3SZZA 4C3IK 2WAQL 5M5WK 2NVXK 1ZBSA 3NUHA 4A93K 4A3EC 2R92C 2PMZD 2Y0SL 4BLBA 4A3JC 5TMFA 1V5VA 3HXAA 5C4JC 2JA5K 3A8JA 1F7UA 4MQ9A 3S1QC 1ZYRA 3WODA 4BXXK 4A3IK 1YX2A 4KMAA 5L46A 4DDQA 3S2DC 3CQZK 4KN4A 3S2HK 3OEPA 1TWHA 4BKWA 3GTMC 1WQFA 4YFKA 1B4AA 5M5YK 1TWFK 1G51A 4OIOA 5C4XC 4P5BA 4OIPA 2BE5A 1Y1VA 1Y1WK 1IS1A 2CFAB 4WJ3M 1R9TA 2JH3A 1O25A 4LK1A 4XLPA 2D6FC 3K7AK 2GAHC 2PHCB 1WCMA 2JA7C 2R7ZA 1O29A 3AD9C 4A3MC 1SFOK 2A68A 4A3CK 3RZDC 3S1RK 4C3IC 1DCPA 2NVXC 4KN7A 4A3KK 3GEIA 2ZUEA 3H3VL 1L0WA 1XZQA 3BP8C 5IYDC 2CW0A 4C3JK 1TWGK 4KMUA 3GTPC 3GTKA 2FQOA 1I50K 2JA5C 3HOYK 2E2HC 3N0CA 1O24A 4GTEA 3I4MK 2B63A 1WORA 4BY1K 4A3BK 3S17C 3S1NK 2YU9K 5IYCK 2JA6K 2VUMK 4XLNA 4YG2A 1EK8A 1TWCA 2PA8L 1XXCA 4Y52C 1XZPB 4LQYA 4GTLA 3GTOA 1TWAK 2E2IK 1BGWA 3LPXA 4GTFA 4G0UA 4X6AK 5C3EK 2NVYC 4P9SA 1JQWA 5IP9K 2R93K 4KASA 4JK1A 2V6SA 3FKIA 3LAJA 4GT9A 1I3QA 1TWCC 3GTGK 1PJ5A 2WB1D 1F7VA 3GTQA 3GDZA 1EI6A 2O5IA 4A3LK 3GTLA 1EQRA 3QX3A 3M4OK 1O27A 5C44C 3A8KA 5CJ9A 5E68A 1WQGA 1USMA 3FHZA 1IW7A 4A3CC 3OREA 4G7HA 5M3MK 4A3KC 1XXAA 1YCLA 1YNJA 2V6UA 3TFJA 2R92A 4G7OA 4PAAA 4OIQA 3S1MC 3HKZL 2NVTC 4C3JC 1O2FB 1WOSA 4Y7NC 4O2DA 1I50C 3S0XA 4QIWD 4BY1C 3HOXC 4A3BC 1SMYA 4P5AA 1DCOA 1O28A 5IYCC 2E2JK 2JA6C 1INNA 2A6EA 1EFWA 5IOSA 3GTMA 5IP7K 4QJVB 1O2AA 1R9TK 4ILDA 2NVQK 3ERED 1WSVA 3GTJC 4X6AC 2FQTA 1BS2A 1DD5A 5IP9C 3S15K 1WCMK 3H0GK 3TTGA 2XCRB 4GTAA 1UV7A 5CHPA 4C2MK 4AH6A 1O26A 3M3YC 3S16K 3N3YA 5D4DA 2JA7A 3T00A 4A3DK 3AH5A 3AD8C 4Q4ZA 1WOOA 5TJ3A 4G0WA 3L4JA 4KC6A 4C3HK 4FZBA 5HL8A 2NVXA 3AQOA 4A3FK 3GTKK 1ZVUA 4GTBA 3TFIA 2B63K 3HOUK 5IYBK 1USOA 4BBSK 4BY7K 4A3GK 3GTPA 2JA5A 2E2HA 1VRQC 3FOEA 4A93C 1K83K 1I6VA 3N0BA 4Q5SA 2ZUFA 3I4NK 1WIHA 5IOQA 4LLGA 2WB1L 2E2JC 1WQHA 3EQLA 3FKIK 4AYBD 4BXXC 4YFNA 1IQ0A 2NVYA 4A3IC 1HQMA 1YNNA 2GSUA 3A8IA 4KAWX 3S15C 3CQZC 2Y3PA 3GIRA 3S2HC 3H0GC 4ZH4A 4KATA 1JVIA 4C2MC 3V4GA 5FLMK 1VJEA 3AQPA 1TWFC 2A69A 1Y1WC 1SFOA 4A3EK 2R92K 3BUEA 1I6HK 3K7AC 4A3JK 1PJ6A 1J6WA 4C45A 5C4JK 4QIWL 4A3FC 2PMZL 2RH6A 3S14K 3S1QK 5IORA 1IBAA 1SFOC 2PPBA 4M1XA 1GE9A 3S1RC 3S2DK 1XZQB 3TFHA 4KM9A 1I50A 3GTMK 1ZXOA 3HOVK 1K83C 4KARA 1TWGC 1O2BA 3RZOK 5C4XK 2JA6A 3L4KA 4LJZA 1TWHK 4KM8A 3G4AA 3HOYC 1TWAA 1ZQ1C 4BBRK 3I4MC 3GEHA 1VLOA 3GTJA 2CFAA 3S1NC 4GZYA 2R93A 1KQ4A 2YU9C 2VUMC 1Y1VK 5FJ8K 4A3MK 3OPFA 1TWAC 3G4CA 2E2IC 3RZDK 4OINA 1PJ7A 4XSZA 5C3EC 1XPPA 2R93C 2R7ZK 3GTGC 5IYDK 3DXJA 3IPJA 4OIRA 1I6HC 1J6XA 2GSOA 3T02A 4A3LC 3GTPK 4KMHA 3M4OC 2E2HK 3S14C 3HOZK 3S17K 5TMCA 1JOEA 2JA8K 2EBBA 1DCHA 1XXBA 4AYBL 5EGEA 3HKZD 3SZYA 1B4BA 4Y52K 2WAQD 3ADAC 4GTCA 3HOVC 1EH1A 5JVOA 1XZPA 4BBSC 2NVYK 4WILA 3RZOC 1VH2A 2O5JA 1TWCK 1TWHC 2Y0SD 1BJTA 4BBRC 4XSXA 3GTOK 2XCOA 1WSRA 1ISEA 3HOWK 3FOFA 3CQZA 3H0GA 5C44K 1Y1VC 1I3QK 1J6VA 5IP7C 5M5XK 3GTQK 1R9TC 5JFEA 2NVQC 3PO2K 1TWFA 4GTDA 3GTLK 2V6TA 3PO3K 4PABA 1WCMC 1Y1WA 2R7ZC 4MEXA 3GEEA 3S1MK 4NOIA 2A6HA 2NVTK 4MEYA 4KB4A 4Y7NK 3S16C 4A3DC 4KDDA 4G7ZA 1F93A 3HOZC 3HOXK 2JA8C 5IOTA 4C3HC 3GSIA 4LR2A 4FM9A 3GTKC 1K83A 1HI9A 2B63C 3H3VD 3HOUC 3GTJK 1C0AA 5IYBC 4QJVA 1TWGA 4BY7C
chains in the Genus database with same CATH topology
4A3GC 2YU9C 2VUMC 2CW0A 1Y1VK 4C3JK 1TWGK 5FJ8K 4A3MK 4C3HK 4KMUA 1TWAC 3GTPC 2E2IC 3RZDK 1I50K 5M3FK 2JA5C 4A3FK 4OINA 3GTOC 2E2HC 3HOYK 3I4MK 4XSZA 5C3EC 3GTKK 3M3YK 1XPPA 4BY1K 4A3BK 3S17C 2R93C 3HOWC 2R7ZK 3I4NC 2B63K 3HOUK 3S1NK 5IYBK 2YU9K 5IYCK 3GTGC 4BBSK 5IYDK 4BY7K 3DXJA 3FKIC 4A3GK 2JA6K 4OIRA 4XLNA 4YG2A 2VUMK 1I3QC 2PA8L 1I6HC 4Y52C 2PA8D 3GTQC 4A3LC 1TWAK 3GTPK 2E2IK 3PO2C 3M4OC 4A93C 4X6AK 3GTLC 1I6VA 1K83K 2E2HK 3PO3C 5C3EK 2NVYC 4YFXA 2JA7K 1BDFA 3HOZK 5IP9K 3S14C 3S17K 4Q5SA 2R93K 5TMCA 4JK1A 2JA8K 3I4NK 4LLGA 2WB1L 2E2JC 3GTGK 1TWCC 4LK0A 3EQLA 2WB1D 3FKIK 3HKZD 4AYBL 5FLMC 4C3IK 2WAQL 4AYBD 5M5WK 4Y52K 2NVXK 4BXXC 2WAQD 4YFNA 2O5IA 4A3LK 3HOVC 4A3IC 3M4OK 1HQMA 4A93K 1YNNA 4A3EC 2R92C 5C44C 2NVYK 4BBSC 2PMZD 3S15C 3CQZC 3S2HC 3H0GC 3RZOC 4ZH4A 2Y0SL 4A3JC 5TMFA 1IW7A 4A3CC 1TWCK 2O5JA 1TWHC 2Y0SD 5C4JC 4G7HA 5M3MK 2JA5K 4BBRC 5FLMK 4XSXA 3GTOK 4A3KC 4MQ9A 3S1QC 1ZYRA 3WODA 4BXXK 1TWFC 1YNJA 3HOWK 4A3IK 2A69A 4G7OA 1Y1WC 4OIQA 3S1MC 3HKZL 4A3EK 2R92K 5C44K 3S2DC 3CQZK 1Y1VC 4KN4A 2NVTC 3S2HK 1I3QK 4Y7NC 1I6HK 5IP7C 5M5XK 3K7AC 4A3JK 3GTMC 3GTQK 1R9TC 2NVQC 1I50C 5C4JK 4A3FC 4QIWL 3PO2K 4YFKA 2PMZL 3GTLK 3PO3K 4QIWD 4BY1C 3HOXC 3S14K 4A3BC 5M5YK 3S1QK 1TWFK 1SMYA 1WCMC 2R7ZC 4MEXA 1SFOC 2PPBA 4OIOA 5C4XC 4OIPA 2BE5A 5IYCC 1Y1WK 3S1MK 2E2JK 4NOIA 2A6HA 3S1RC 2JA6C 2A6EA 3S2DK 2NVTK 4MEYA 4LK1A 4Y7NK 4XLPA 5IP7K 3S16C 4QJVB 3K7AK 3GTMK 1R9TK 2NVQK 4A3DC 3HOVK 3GTJC 4G7ZA 4X6AC 1K83C 2JA7C 3HOZC 5IP9C 3HOXK 3S15K 2JA8C 1WCMK 1TWGC 3H0GK 4A3MC 1SFOK 5C4XK 3RZOK 2A68A 4LJZA 4A3CK 1TWHK 3RZDC 3S1RK 4C2MK 3HOYC 4BBRK 3I4MC 2NVXC 4KN7A 4A3KK 3GTKC 3M3YC 3S16K 3H3VL 5D4DA 2B63C 4A3DK 3H3VD 3HOUC 3S1NC 3GTJK 4GZYA 4Q4ZA 5IYBC 4QJVA 5IYDC 4BY7C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3G C;  2YU9 C;  2VUM C;  2CW0 A;  1Y1V K;  4C3J K;  1TWG K;  5FJ8 K;  4A3M K;  4C3H K;  4KMU A;  1TWA C;  3GTP C;  2E2I C;  3RZD K;  1I50 K;  5M3F K;  2JA5 C;  4A3F K;  4OIN A;  3GTO C;  2E2H C;  3HOY K;  3I4M K;  4XSZ A;  5C3E C;  3GTK K;  3M3Y K;  1XPP A;  4BY1 K;  4A3B K;  3S17 C;  2R93 C;  3HOW C;  2R7Z K;  3I4N C;  2B63 K;  3HOU K;  3S1N K;  5IYB K;  2YU9 K;  5IYC K;  3GTG C;  4BBS K;  5IYD K;  4BY7 K;  3DXJ A;  3FKI C;  4A3G K;  2JA6 K;  4OIR A;  4XLN A;  4YG2 A;  2VUM K;  1I3Q C;  2PA8 L;  1I6H C;  4Y52 C;  2PA8 D;  3GTQ C;  4A3L C;  1TWA K;  3GTP K;  2E2I K;  3PO2 C;  3M4O C;  4A93 C;  4X6A K;  3GTL C;  1I6V A;  1K83 K;  2E2H K;  3PO3 C;  5C3E K;  2NVY C;  4YFX A;  2JA7 K;  1BDF A;  3HOZ K;  5IP9 K;  3S14 C;  3S17 K;  4Q5S A;  2R93 K;  5TMC A;  4JK1 A;  2JA8 K;  3I4N K;  4LLG A;  2WB1 L;  2E2J C;  3GTG K;  1TWC C;  4LK0 A;  3EQL A;  2WB1 D;  3FKI K;  3HKZ D;  4AYB L;  5FLM C;  4C3I K;  2WAQ L;  4AYB D;  5M5W K;  4Y52 K;  2NVX K;  4BXX C;  2WAQ D;  4YFN A;  2O5I A;  4A3L K;  3HOV C;  4A3I C;  3M4O K;  1HQM A;  4A93 K;  1YNN A;  4A3E C;  2R92 C;  5C44 C;  2NVY K;  4BBS C;  2PMZ D;  3S15 C;  3CQZ C;  3S2H C;  3H0G C;  3RZO C;  4ZH4 A;  2Y0S L;  4A3J C;  5TMF A;  1IW7 A;  4A3C C;  1TWC K;  2O5J A;  1TWH C;  2Y0S D;  5C4J C;  4G7H A;  5M3M K;  2JA5 K;  4BBR C;  5FLM K;  4XSX A;  3GTO K;  4A3K C;  4MQ9 A;  3S1Q C;  1ZYR A;  3WOD A;  4BXX K;  1TWF C;  1YNJ A;  3HOW K;  4A3I K;  2A69 A;  4G7O A;  1Y1W C;  4OIQ A;  3S1M C;  3HKZ L;  4A3E K;  2R92 K;  5C44 K;  3S2D C;  3CQZ K;  1Y1V C;  4KN4 A;  2NVT C;  3S2H K;  1I3Q K;  4Y7N C;  1I6H K;  5IP7 C;  5M5X K;  3K7A C;  4A3J K;  3GTM C;  3GTQ K;  1R9T C;  2NVQ C;  1I50 C;  5C4J K;  4A3F C;  4QIW L;  3PO2 K;  4YFK A;  2PMZ L;  3GTL K;  3PO3 K;  4QIW D;  4BY1 C;  3HOX C;  3S14 K;  4A3B C;  5M5Y K;  3S1Q K;  1TWF K;  1SMY A;  1WCM C;  2R7Z C;  4MEX A;  1SFO C;  2PPB A;  4OIO A;  5C4X C;  4OIP A;  2BE5 A;  5IYC C;  1Y1W K;  3S1M K;  2E2J K;  4NOI A;  2A6H A;  3S1R C;  2JA6 C;  2A6E A;  3S2D K;  2NVT K;  4MEY A;  4LK1 A;  4Y7N K;  4XLP A;  5IP7 K;  3S16 C;  4QJV B;  3K7A K;  3GTM K;  1R9T K;  2NVQ K;  4A3D C;  3HOV K;  3GTJ C;  4G7Z A;  4X6A C;  1K83 C;  2JA7 C;  3HOZ C;  5IP9 C;  3HOX K;  3S15 K;  2JA8 C;  1WCM K;  1TWG C;  3H0G K;  4A3M C;  1SFO K;  5C4X K;  3RZO K;  2A68 A;  4LJZ A;  4A3C K;  1TWH K;  3RZD C;  3S1R K;  4C2M K;  3HOY C;  4BBR K;  3I4M C;  2NVX C;  4KN7 A;  4A3K K;  3GTK C;  3M3Y C;  3S16 K;  3H3V L;  5D4D A;  2B63 C;  4A3D K;  3H3V D;  3HOU C;  3S1N C;  3GTJ K;  4GZY A;  4Q4Z A;  5IYB C;  4QJV A;  5IYD C;  4BY7 C; 
#chains in the Genus database with same CATH topology
 4A3G C;  4J3N A;  1IE0 A;  2XCQ A;  3Q3Q A;  3VA7 A;  3CAG A;  5M3F K;  3GTO C;  2P5M A;  2ZFZ A;  3M3Y K;  1X31 C;  3JST A;  1AB4 A;  2W7V A;  3HOW C;  1RU0 A;  2YU9 A;  3I4N C;  2VUM A;  4LOW A;  3T01 A;  3FKI C;  4KMD A;  1I3Q C;  2KWA A;  1VGX A;  2E2I A;  2GSN A;  1WOP A;  2PA8 D;  2RGR A;  3GTQ C;  3PO2 C;  4RMF A;  5EGH A;  4WJ4 A;  4G0V A;  3GTL C;  3PO3 C;  4YFX A;  2JA7 K;  1BDF A;  4GFQ A;  1IL2 A;  3LAP A;  4BLA A;  3GTG A;  3AD7 C;  1F9N A;  3MML B;  3BP3 A;  4KB2 A;  4LK0 A;  2P8T A;  1J98 A;  2GAG C;  4XCH A;  5FLM C;  3SZZ A;  4C3I K;  2WAQ L;  5M5W K;  2NVX K;  1ZBS A;  3NUH A;  4A93 K;  4A3E C;  2R92 C;  2PMZ D;  2Y0S L;  4BLB A;  4A3J C;  5TMF A;  1V5V A;  3HXA A;  5C4J C;  2JA5 K;  3A8J A;  1F7U A;  4MQ9 A;  3S1Q C;  1ZYR A;  3WOD A;  4BXX K;  4A3I K;  1YX2 A;  4KMA A;  5L46 A;  4DDQ A;  3S2D C;  3CQZ K;  4KN4 A;  3S2H K;  3OEP A;  1TWH A;  4BKW A;  3GTM C;  1WQF A;  4YFK A;  1B4A A;  5M5Y K;  1TWF K;  1G51 A;  4OIO A;  5C4X C;  4P5B A;  4OIP A;  2BE5 A;  1Y1V A;  1Y1W K;  1IS1 A;  2CFA B;  4WJ3 M;  1R9T A;  2JH3 A;  1O25 A;  4LK1 A;  4XLP A;  2D6F C;  3K7A K;  2GAH C;  2PHC B;  1WCM A;  2JA7 C;  2R7Z A;  1O29 A;  3AD9 C;  4A3M C;  1SFO K;  2A68 A;  4A3C K;  3RZD C;  3S1R K;  4C3I C;  1DCP A;  2NVX C;  4KN7 A;  4A3K K;  3GEI A;  2ZUE A;  3H3V L;  1L0W A;  1XZQ A;  3BP8 C;  5IYD C;  2CW0 A;  4C3J K;  1TWG K;  4KMU A;  3GTP C;  3GTK A;  2FQO A;  1I50 K;  2JA5 C;  3HOY K;  2E2H C;  3N0C A;  1O24 A;  4GTE A;  3I4M K;  2B63 A;  1WOR A;  4BY1 K;  4A3B K;  3S17 C;  3S1N K;  2YU9 K;  5IYC K;  2JA6 K;  2VUM K;  4XLN A;  4YG2 A;  1EK8 A;  1TWC A;  2PA8 L;  1XXC A;  4Y52 C;  1XZP B;  4LQY A;  4GTL A;  3GTO A;  1TWA K;  2E2I K;  1BGW A;  3LPX A;  4GTF A;  4G0U A;  4X6A K;  5C3E K;  2NVY C;  4P9S A;  1JQW A;  5IP9 K;  2R93 K;  4KAS A;  4JK1 A;  2V6S A;  3FKI A;  3LAJ A;  4GT9 A;  1I3Q A;  1TWC C;  3GTG K;  1PJ5 A;  2WB1 D;  1F7V A;  3GTQ A;  3GDZ A;  1EI6 A;  2O5I A;  4A3L K;  3GTL A;  1EQR A;  3QX3 A;  3M4O K;  1O27 A;  5C44 C;  3A8K A;  5CJ9 A;  5E68 A;  1WQG A;  1USM A;  3FHZ A;  1IW7 A;  4A3C C;  3ORE A;  4G7H A;  5M3M K;  4A3K C;  1XXA A;  1YCL A;  1YNJ A;  2V6U A;  3TFJ A;  2R92 A;  4G7O A;  4PAA A;  4OIQ A;  3S1M C;  3HKZ L;  2NVT C;  4C3J C;  1O2F B;  1WOS A;  4Y7N C;  4O2D A;  1I50 C;  3S0X A;  4QIW D;  4BY1 C;  3HOX C;  4A3B C;  1SMY A;  4P5A A;  1DCO A;  1O28 A;  5IYC C;  2E2J K;  2JA6 C;  1INN A;  2A6E A;  1EFW A;  5IOS A;  3GTM A;  5IP7 K;  4QJV B;  1O2A A;  1R9T K;  4ILD A;  2NVQ K;  3ERE D;  1WSV A;  3GTJ C;  4X6A C;  2FQT A;  1BS2 A;  1DD5 A;  5IP9 C;  3S15 K;  1WCM K;  3H0G K;  3TTG A;  2XCR B;  4GTA A;  1UV7 A;  5CHP A;  4C2M K;  4AH6 A;  1O26 A;  3M3Y C;  3S16 K;  3N3Y A;  5D4D A;  2JA7 A;  3T00 A;  4A3D K;  3AH5 A;  3AD8 C;  4Q4Z A;  1WOO A;  5TJ3 A;  4G0W A;  3L4J A;  4KC6 A;  4C3H K;  4FZB A;  5HL8 A;  2NVX A;  3AQO A;  4A3F K;  3GTK K;  1ZVU A;  4GTB A;  3TFI A;  2B63 K;  3HOU K;  5IYB K;  1USO A;  4BBS K;  4BY7 K;  4A3G K;  3GTP A;  2JA5 A;  2E2H A;  1VRQ C;  3FOE A;  4A93 C;  1K83 K;  1I6V A;  3N0B A;  4Q5S A;  2ZUF A;  3I4N K;  1WIH A;  5IOQ A;  4LLG A;  2WB1 L;  2E2J C;  1WQH A;  3EQL A;  3FKI K;  4AYB D;  4BXX C;  4YFN A;  1IQ0 A;  2NVY A;  4A3I C;  1HQM A;  1YNN A;  2GSU A;  3A8I A;  4KAW X;  3S15 C;  3CQZ C;  2Y3P A;  3GIR A;  3S2H C;  3H0G C;  4ZH4 A;  4KAT A;  1JVI A;  4C2M C;  3V4G A;  5FLM K;  1VJE A;  3AQP A;  1TWF C;  2A69 A;  1Y1W C;  1SFO A;  4A3E K;  2R92 K;  3BUE A;  1I6H K;  3K7A C;  4A3J K;  1PJ6 A;  1J6W A;  4C45 A;  5C4J K;  4QIW L;  4A3F C;  2PMZ L;  2RH6 A;  3S14 K;  3S1Q K;  5IOR A;  1IBA A;  1SFO C;  2PPB A;  4M1X A;  1GE9 A;  3S1R C;  3S2D K;  1XZQ B;  3TFH A;  4KM9 A;  1I50 A;  3GTM K;  1ZXO A;  3HOV K;  1K83 C;  4KAR A;  1TWG C;  1O2B A;  3RZO K;  5C4X K;  2JA6 A;  3L4K A;  4LJZ A;  1TWH K;  4KM8 A;  3G4A A;  3HOY C;  1TWA A;  1ZQ1 C;  4BBR K;  3I4M C;  3GEH A;  1VLO A;  3GTJ A;  2CFA A;  3S1N C;  4GZY A;  2R93 A;  1KQ4 A;  2YU9 C;  2VUM C;  1Y1V K;  5FJ8 K;  4A3M K;  3OPF A;  1TWA C;  3G4C A;  2E2I C;  3RZD K;  4OIN A;  1PJ7 A;  4XSZ A;  5C3E C;  1XPP A;  2R93 C;  2R7Z K;  3GTG C;  5IYD K;  3DXJ A;  3IPJ A;  4OIR A;  1I6H C;  1J6X A;  2GSO A;  3T02 A;  4A3L C;  3GTP K;  4KMH A;  3M4O C;  2E2H K;  3S14 C;  3HOZ K;  3S17 K;  5TMC A;  1JOE A;  2JA8 K;  2EBB A;  1DCH A;  1XXB A;  4AYB L;  5EGE A;  3HKZ D;  3SZY A;  1B4B A;  4Y52 K;  2WAQ D;  3ADA C;  4GTC A;  3HOV C;  1EH1 A;  5JVO A;  1XZP A;  4BBS C;  2NVY K;  4WIL A;  3RZO C;  1VH2 A;  2O5J A;  1TWC K;  1TWH C;  2Y0S D;  1BJT A;  4BBR C;  4XSX A;  3GTO K;  2XCO A;  1WSR A;  1ISE A;  3HOW K;  3FOF A;  3CQZ A;  3H0G A;  5C44 K;  1Y1V C;  1I3Q K;  1J6V A;  5IP7 C;  5M5X K;  3GTQ K;  1R9T C;  5JFE A;  2NVQ C;  3PO2 K;  1TWF A;  4GTD A;  3GTL K;  2V6T A;  3PO3 K;  4PAB A;  1WCM C;  1Y1W A;  2R7Z C;  4MEX A;  3GEE A;  3S1M K;  4NOI A;  2A6H A;  2NVT K;  4MEY A;  4KB4 A;  4Y7N K;  3S16 C;  4A3D C;  4KDD A;  4G7Z A;  1F93 A;  3HOZ C;  3HOX K;  2JA8 C;  5IOT A;  4C3H C;  3GSI A;  4LR2 A;  4FM9 A;  3GTK C;  1K83 A;  1HI9 A;  2B63 C;  3H3V D;  3HOU C;  3GTJ K;  1C0A A;  5IYB C;  4QJV A;  1TWG A;  4BY7 C; 
#chains in the Genus database with same CATH homology
 4A3G C;  2YU9 C;  2VUM C;  2CW0 A;  1Y1V K;  4C3J K;  1TWG K;  5FJ8 K;  4A3M K;  4C3H K;  4KMU A;  1TWA C;  3GTP C;  2E2I C;  3RZD K;  1I50 K;  5M3F K;  2JA5 C;  4A3F K;  4OIN A;  3GTO C;  2E2H C;  3HOY K;  3I4M K;  4XSZ A;  5C3E C;  3GTK K;  3M3Y K;  1XPP A;  4BY1 K;  4A3B K;  3S17 C;  2R93 C;  3HOW C;  2R7Z K;  3I4N C;  2B63 K;  3HOU K;  3S1N K;  5IYB K;  2YU9 K;  5IYC K;  3GTG C;  4BBS K;  5IYD K;  4BY7 K;  3DXJ A;  3FKI C;  4A3G K;  2JA6 K;  4OIR A;  4XLN A;  4YG2 A;  2VUM K;  1I3Q C;  2PA8 L;  1I6H C;  4Y52 C;  2PA8 D;  3GTQ C;  4A3L C;  1TWA K;  3GTP K;  2E2I K;  3PO2 C;  3M4O C;  4A93 C;  4X6A K;  3GTL C;  1I6V A;  1K83 K;  2E2H K;  3PO3 C;  5C3E K;  2NVY C;  4YFX A;  2JA7 K;  1BDF A;  3HOZ K;  5IP9 K;  3S14 C;  3S17 K;  4Q5S A;  2R93 K;  5TMC A;  4JK1 A;  2JA8 K;  3I4N K;  4LLG A;  2WB1 L;  2E2J C;  3GTG K;  1TWC C;  4LK0 A;  3EQL A;  2WB1 D;  3FKI K;  3HKZ D;  4AYB L;  5FLM C;  4C3I K;  2WAQ L;  4AYB D;  5M5W K;  4Y52 K;  2NVX K;  4BXX C;  2WAQ D;  4YFN A;  2O5I A;  4A3L K;  3HOV C;  4A3I C;  3M4O K;  1HQM A;  4A93 K;  1YNN A;  4A3E C;  2R92 C;  5C44 C;  2NVY K;  4BBS C;  2PMZ D;  3S15 C;  3CQZ C;  3S2H C;  3H0G C;  3RZO C;  4ZH4 A;  2Y0S L;  4A3J C;  5TMF A;  1IW7 A;  4A3C C;  1TWC K;  2O5J A;  1TWH C;  2Y0S D;  5C4J C;  4G7H A;  5M3M K;  2JA5 K;  4BBR C;  5FLM K;  4XSX A;  3GTO K;  4A3K C;  4MQ9 A;  3S1Q C;  1ZYR A;  3WOD A;  4BXX K;  1TWF C;  1YNJ A;  3HOW K;  4A3I K;  2A69 A;  4G7O A;  1Y1W C;  4OIQ A;  3S1M C;  3HKZ L;  4A3E K;  2R92 K;  5C44 K;  3S2D C;  3CQZ K;  1Y1V C;  4KN4 A;  2NVT C;  3S2H K;  1I3Q K;  4Y7N C;  1I6H K;  5IP7 C;  5M5X K;  3K7A C;  4A3J K;  3GTM C;  3GTQ K;  1R9T C;  2NVQ C;  1I50 C;  5C4J K;  4A3F C;  4QIW L;  3PO2 K;  4YFK A;  2PMZ L;  3GTL K;  3PO3 K;  4QIW D;  4BY1 C;  3HOX C;  3S14 K;  4A3B C;  5M5Y K;  3S1Q K;  1TWF K;  1SMY A;  1WCM C;  2R7Z C;  4MEX A;  1SFO C;  2PPB A;  4OIO A;  5C4X C;  4OIP A;  2BE5 A;  5IYC C;  1Y1W K;  3S1M K;  2E2J K;  4NOI A;  2A6H A;  3S1R C;  2JA6 C;  2A6E A;  3S2D K;  2NVT K;  4MEY A;  4LK1 A;  4Y7N K;  4XLP A;  5IP7 K;  3S16 C;  4QJV B;  3K7A K;  3GTM K;  1R9T K;  2NVQ K;  4A3D C;  3HOV K;  3GTJ C;  4G7Z A;  4X6A C;  1K83 C;  2JA7 C;  3HOZ C;  5IP9 C;  3HOX K;  3S15 K;  2JA8 C;  1WCM K;  1TWG C;  3H0G K;  4A3M C;  1SFO K;  5C4X K;  3RZO K;  2A68 A;  4LJZ A;  4A3C K;  1TWH K;  3RZD C;  3S1R K;  4C2M K;  3HOY C;  4BBR K;  3I4M C;  2NVX C;  4KN7 A;  4A3K K;  3GTK C;  3M3Y C;  3S16 K;  3H3V L;  5D4D A;  2B63 C;  4A3D K;  3H3V D;  3HOU C;  3S1N C;  3GTJ K;  4GZY A;  4Q4Z A;  5IYB C;  4QJV A;  5IYD C;  4BY7 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...