2JA6J

Cpd lesion containing rna polymerase ii elongation complex b
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title CPD damage recognition by transcribing RNA polymerase II.
pubmed doi rcsb
molecule tags Transferase
molecule keywords DNA-DIRECTED RNA POLYMERASE II LARGEST SUBUNIT
total genus 12
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2006-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2ja6J00
3FISA 1W0UA 1JKRC 4FISA 1ETWA 2CQQA 3GTPJ 1FIPA 5M3MJ 3LNQA 1MBEA 1GV5A 4C3HJ 5DTDA 3GTLJ 5E3MA 1AKHB 1IJWC 4DZPA 1TWHJ 2JWTA 4V2FA 3M4OJ 2ECBA 4MLOA 3Q0WA 5M5YJ 1OFCX 3K7AJ 1F36A 3FIWA 1VI0A 3HOXJ 2X9DA 4XRMA 2R0QC 2O8KA 1GUUA 5J3LA 1QVUA 1MNMC 3Q0UA 3OOUA 3LOCA 1MBFA 3GTQJ 3ZOBA 1A6IA 1Y1VJ 1JUMA 2YUSA 1WH5A 1Z0XA 4DYCA 5FKOA 2FX0A 1TC3C 3BQYA 2XSDC 3HOUJ 3CQZJ 4A3CJ 1U9NA 2LLKA 2EZLA 5FKLA 3S2DJ 2NOGA 2NS7A 1X2MA 4C2MJ 4JX4A 1ETQA 4JX6A 4Y7NJ 4FTHA 9ANTA 3JRCA 3O8GA 3GTKJ 5E3OA 4MFDA 1ZTRA 3DEWA 3TEDA 3S16J 3WHBA 2L7FP 1RETA 5C44J 5IPAA 1CQTA 2XB5A 3FK6A 2DA3A 2CUFA 5F08A 3S1RJ 4IHVA 5M5XJ 2LK2A 3GTJJ 3I4MJ 3PO2J 1HF0A 2H1KA 1W0TA 3C2BA 4LOCA 2YS9A 1LFUP 1GT0C 2CQXA 4I6ZA 3QPLA 2DMUA 1GDTA 5EGOB 4QSHA 2DA4A 5IP9J 1K83J 2HOAA 2ZB9A 3SJMA 1FTTA 4I76A 2JA7J 2Y31A 3PM1A 3MN2A 3F0CA 1TWGJ 4QIWN 3A03A 5E3LA 2KDZA 2EH3A 1UMQA 1U9OA 3OSFA 2O7OA 3ZQIA 1QRYA 4Y52J 5FJ8J 5M5WJ 5M3FJ 3S1NJ 4AC0A 2FD5A 3S1MJ 1JKPC 5J1YA 3JRHA 4M3DA 1APLC 3QQAA 3IH4A 2E2JJ 1EF4A 5IOYA 1H8AC 2L7MP 3HBLA 2JK3A 2MGQA 3BT9A 1JKQC 1TWCJ 1IC8A 2ID6A 3OSGA 3HOVJ 1FEXA 3H3VK 4BKXA 3B6CA 5FKNA 2LFBA 2VPRA 3BR2A 5IOZA 1I50J 2MG4A 3O8HA 1IDYA 1XG1A 4V2GA 4XICA 3HOZJ 1GVDA 1JUSA 3JRAA 2XGEA 1RESA 4A3LJ 2LD5A 2D5VA 3G1LA 2EZHA 2QF7A 1OJLA 2IBDA 4AYBN 3RZDJ 3HOYJ 3MKLA 5FLMJ 3D1NI 1MSEC 4XK4A 2LKXA 2IAIA 4C3IJ 1S7EA 1YRNA 3BTIA 5IYCJ 1UG2A 3ZQFA 2DMQA 4JX5A 2HI3A 2GBYA 1ITYA 2CUEA 2ME0A 1T33A 5IYDJ 2EZIA 2XPVA 4A69C 4A3EJ 2M9HA 2JA8J 3MVPA 1OCPA 3BR0A 4UUTA 2AO9A 4B1RA 4IHWA 4X1EA 1FTZA 2K40A 4B3AA 4UUSA 1R9TJ 1HDPA 1ENHA 1P7IA 3BQZA 1H89C 4W1UA 2NVXJ 1I3QJ 1IRZA 4M3EA 4GFBA 4A3IJ 3HKZN 4FE7A 1QPIA 3BTLA 1BW5A 2OF7A 5F04A 2TCTA 2ECCA 5EDNA 4IHYA 2TRTA 4L5EA 4NDLA 1JUPA 5JLWA 4A3KJ 4A3BJ 4X6AJ 3H0GJ 5EEAA 1ZQ3P 2EZKA 2HXIA 2H8RA 1NTCA 5K7FA 4A93J 4A3GJ 3RKQA 1JJ6C 3HGGA 4IHXA 4ABZA 1WGXA 5K7ZA 2DTZA 2OPTA 2XPUA 1XC5A 1ZR2A 1NK3P 1I6HJ 1HOMA 5K7HA 1RKWA 2DA6A 4EEFG 1T56A 1RPWA 2XGDA 3HGYA 2DA7A 3TW6A 2Y30A 1MSFC 1BW6A 5IYBJ 3GTMJ 5EG0B 2R5ZB 3S17J 2Y9ZA 2ME6A 1IV6A 1IDZA 1E3OC 2XRLA 3GBGA 5GPCA 1F43A 2FQ4A 1DU6A 2HQ5A 3ZQHA 3DCFA 1MH4A 4D5FA 1X58A 2JMWA 3CDLA 1QVTA 3ZQLA 5F0HA 1VF9A 1ETOA 2FJ1A 1LFBA 3BG5A 1TWFJ 4BY1J 1XS9A 1HCRA 1FIAA 1Y1WJ 1ETXA 3BG9A 1ETKA 2E2IJ 2N8GA 3HB9A 4J19A 3RQIA 1P7JA 3FK7A 1MBKA 2VI6A 5EZHA 4IEJA 3JR9A 5GP9A 1B8IB 4BY7J 3LSPA 4JYKA 2WAQN 3WHCA 3CMYA 1BL0A 4BXXJ 3SFIA 2R5YB 1WI3A 1MBGA 4W97A 2RAEA 2M8GX 5C3EJ 5EYRA 4DYQA 3G1OA 4D7MA 4RBOA 3G1MA 2DN0A 4A3JJ 3IH2A 4BBSJ 1FJLA 4DZJA 3SDGA 4M3FA 3GTGJ 3JRIA 3RZOJ 3K2AA 3BG3A 2YU9J 2DMPA 3BR3A 2XPWA 1ORKA 3W6VA 5F1JA 1TWAJ 4XIDA 1MH3A 2NVQJ 2JN6A 4HNVA 2R5YA 3QPSA 5F27A 5JLXA 1LE8B 4M6VA 2JA6J 3S2HJ 2XB0X 3IV5A 2K9NA 1D5YA 3TP3A 4QTRA 1WPKA 4A3MJ 2E2HJ 4M3GA 2DA1A 1ZK8A 2R93J 2IEKA 2DA2A 3JRBA 2VKVA 4G12A 5EZGA 3Q0VA 2X6OA 4D5CA 1ZKGA 2AHQA 2HXOA 1VNDA 5FKKA 4RDUA 1POGA 3M3YJ 2K9SA 2CJJA 2PMZN 4MFEA 4JP0A 3PO3J 2DMTA 1JT6A 1DU0A 1ZR4A 5EGOA 2CU7A 1SFOJ 1WCMJ 1O4XA 2X48A 1B72A 4DYRA 5IP7J 3JRFA 1H88C 3LSGA 1JT0A 1LE8A 3HM5A 1JKOC 3HDDA 3HEFA 3ZQCA 2HDDA 2Y2ZA 3IH3A 1B8IA 1MBJA 3VPRA 1B72B 2MSYA 3OIOA 2WB1N 1IUFA 1MBHA 1Z77A 2JA5J 3NAUA 3JREA 2LVSA 2K9QA 2NS8A 4MIMA 1HDDC 2VKEA 2ELKA 1AHDP 4BBRJ 3BR1A 3S14J 1ETYA 1BJZA 5BNGA 1VFCA 1JJ8C 2ID3A 2G0EA 3CCYA 5FLVA 3FKIJ 3BR6A 1IG7A 3S1QJ 2WV1A 5IP6A 4XRSA 4M3BA 4XRSG 3TW7A 2M0CA 3S15J 4UUSB 1UHSA 2I10A 1U8BA 1WH7A 5C4JJ 3BR5A 4B4CA 1NK2P 1PUFB 2JJ7A 5HODA 2R92J 3A01B 3GTOJ 3BTCA 5EG0A 1RR7A 2MW8A 2KT0A 5J1RA 1YRNB 2EQRA 2COBA 3JRDA 1JTXA 2LR8A 2Y0SN 5DS9A 2NVYJ 1AU7A 3ZQGA 2NVTJ 1JTYA 2B63J 2LY9A 1RKTA 1HLVA 3JRGA 1BA5A 2GM4A 5J1UA 3LSRA 2O9LA 5C4XJ 1X2NA 3L1PA 3Q3SA 2HOSA 5EF6A 1PUFA 4A3DJ 3LSJA 2DJNA 1Q1VA 3BTJA 5F0FA 3A01A 2DMNA 2QCOA 4FCYA 2M34A 1JGGA 2CRGA 4A3FJ 4FE4A 1IGNA 1SANA 4CYCA 2XGCA 2Y9YA 1ZGWA 2HOTA 2LP0A 3UKGA 2DA5A 2GLOA 2M2EA 3I4NJ 2L0KA 3NARA 1K61A 3A02A 4DW6A 1U78A 4S0HB 2EBIA 4MO7A 4C3JJ 2HYJA 2VUMJ 1G2HA 1AKHA 2R7ZJ 3E7LA 2LTPA 2P81A 5F0CA 2E19A 3TP0A 1GV2A 2L9RA 1A5JA 2W48A 3HOWJ 2L7ZA 5E3NA 1ETVA 4D7NA 4AUXA 2R5ZA 2E1OA 5FKMA 5GPAA 3B6AA 4CYCB 1OCTC
chains in the Genus database with same CATH superfamily
1JKRC 2DQRA 1YO5C 3CLOA 1ETWA 2CQQA 3GTPJ 3ESWB 1QNTA 2R7TA 3TO7A 4C3HJ 2E36A 5DTDA 2VQHA 2DU9A 1P2FA 4ETSA 1A6QA 1TWHJ 2JWTA 1SC7A 3M4OJ 4MLOA 2DT5A 2OTLI 1NHAA 3MKZA 1J0RA 1Y39A 1VI0A 3L00A 3HOXJ 3BCBA 5ED4A 4EJVA 5CKTA 2VONA 2EA2A 1OCRH 3SZGA 2R0QC 5J3LA 2XAGA 5TJJA 3GTQJ 1A6IA 5KAFC 2YUSA 3C2HA 1Z0XA 5FKOA 1ZAOA 2FX0A 3BQYA 3I59A 3HOUJ 2HR3A 1QPMA 2K3PA 1U9NA 1BR2A 2EZLA 2P5VA 5FKLA 3QPTA 3S2DJ 1O7FA 5L3CA 2NS7A 3TO6A 2DOEA 5HS7A 4OIPF 2BHZA 5CQEA 4CA0A 3H9GA 3KEYA 4LG3A 1L0OC 3T1BA 5HS8A 4FQGA 4EQQA 2XV4S 1SFUA 1U3EM 5E3OA 4RB0A 3S16J 2V9KA 3KYDB 3WHBA 1BM9A 1TNTA 1XGNA 2QSFX 2BY0A 2OJED 3PNVA 4GO1A 3ROUA 1IN4A 5HDNA 1BI1A 2M45A 1UCRA 4X0GA 1IV8A 1FOXA 1IN8A 5ERIA 1Y0UA 3F6OA 2DA3A 2EIJH 4BAYA 3PO2J 2HTSA 1HF0A 2HDWA 3C2BA 4LOCA 1LDKB 2YS9A 3TL4X 2NVUB 2EILH 2DMUA 4XLNF 4QSHA 3NQOA 3N4MA 3GZ6A 2FBKA 3OY9A 3ONQA 1YITI 4XOTA 1YTYA 1DP3A 4BYYA 4CCOA 1IAWA 1RRJA 4G94A 1WJ5A 1TWGJ 2GIVA 2HQRA 3ECOA 3VOEA 2I8DA 3OWTA 5FJ8J 4ENJA 3FXJA 3JSOA 2BV6A 3M1CA 1S6LA 3S1MJ 1Z6TA 4FX4A 4XKVA 4M9XA 1WWXA 4BXUA 2TDXA 2ZBKA 3WE2A 1CF7B 4ZZDA 1UHMA 2WY7Q 4OWRB 4IZZA 1T08B 3ZRGA 1H8AC 4XONA 1R49A 1HSJA 1IC8A 3CCUI 5CVVA 1IN6A 3IKVA 3A0BC 2LFBA 2VPRA 1LJ9A 4PUSA 4AM3A 1BC7C 2CO5A 1I50J 4RA2A 4HNTA 2H6BA 2Y0SA 3FXKA 2ZMEC 2IXSA 3RCOA 1RNLA 2Z9OA 4B09A 4H0EA 1I27A 2DJIA 4YG2F 2H6CA 1R5HA 1ZH5A 2XGEA 2DODA 3GCMA 3ZMDA 2ZJPF 4HAMA 2EZHA 3EETA 3VSKA 4UV9A 4L5JA 2VJ4A 4AYBN 3ZQ7A 4L9JA 3CCSI 4HQMA 2EFOA 4XK4A 3JTGA 4CICA 2QZ8A 1XPXA 2A69F 1VQ4I 2XHKA 4XLHA 2HVRA 3IC7A 3ZQFA 2DMQA 2K9LA 2HI3A 2GBYA 1R71A 1ITYA 3RYRA 2EV6A 1IXRC 5E1XA 1L3LA 2EZIA 4KT5C 2FBHA 4I0AA 4EGZA 1O3QA 4LIVA 3ZMSA 1YI2I 2VKHA 3HPGA 3FWEA 2GIZA 2HGCA 5L3BA 1I1GA 3SEZA 4F3QA 2XAFA 3VB2A 2DPDA 2O5RA 4BEHA 5IT9Z 4A3IJ 4FE7A 5K5RA 1QPIA 4OMZA 4BQQA 3CCMI 2DBBA 1WZ2A 3L2QA 3MZHA 4EM1A 2DTRA 3L2UA 2KKOA 4M73A 1JUPA 1ONVA 1IN7A 4X6AJ 2MLGA 1ZQ3P 1X4PA 5LGNA 2JT1A 4A3GJ 3KP6A 2R7OA 3HIFA 3O3KA 3UR3C 5HNFA 4KFCA 4ABZA 4BE1A 3E5XA 1I6HJ 1ZR2A 1NK3P 3DF8A 1R5GA 2F5FA 2NS0A 4EEFG 2QVOA 2XGDA 3ULQB 1MDMB 1RI7A 4XQFA 5EJCA 2K3FA 3BZKA 5DD8A 2F5EA 3IWFA 2HPMA 1D8KA 1YJNI 2AXTC 1VQ8I 1FP2A 1SFXA 1RUOA 4XBFA 3U2RA 2R5ZB 3S17J 2OUMA 2Y9ZA 2M8EA 1SD7A 3N97A 1IDZA 1E3OC 1HQCA 2XRLA 3UNGC 5GPCA 1F43A 3H3UA 2FQ4A 1DU6A 3K4CA 3EUHC 2HQ5A 2VB6A 4IHTA 3T8RA 1J75A 1XMXA 1X4OA 2A61A 4HBLA 3OYBA 4S04A 2OD5A 2OBPA 2VIXA 3BLYA 1P4WA 3F8BA 3R0JA 2JMWA 1Q1HA 1YJWI 3ZXSA 5F0HA 2NRAC 2VBXA 3M9AA 3VSLA 2IGOA 5B66C 2VOPA 2VQLA 2KJCA 1JE8A 1TWFJ 2XUBA 4LIUA 4BY1J 2BW3B 1Y1WJ 2V6CA 2GWRA 3E6CC 2PG4A 1B6AA 4Z2YA 3T8TA 3LFUA 4PFPA 4EV0A 3GFIA 4AVZA 3E6MA 2JPCA 5TISC 4XMYA 3B73A 5HOOA 3KX2A 3M8FA 5EZHA 1D0ZA 3QPHA 2XF7A 3HXLA 5CQGA 4RB1A 3S3OA 4BXXJ 2G9WA 2IS2A 3CJTB 1WI3A 1K7AA 1DQUA 4XN3A 5D5WB 1TZLA 4W97A 1Y6IA 1I6XA 2M8GX 2L02A 2NNNA 3A2KA 3G1OA 3C1DA 1RUNA 4RBOA 2RREA 2DN0A 3BC8A 4F91B 4LD5A 2PQ8A 2RV8A 3FMQA 4ON0A 3SDGA 1REPC 3GTGJ 3I59B 2KLOA 3BG3A 4XL9A 2B7EA 3BR3A 2VXDA 2P8TA 1MKMA 1R22A 1EKEA 1QU3A 3PSFA 2HZDA 3RKXA 1MH3A 3HPHA 3QPSA 1QA6A 3KP7A 3MEXA 2F5VA 1N78A 2K9NA 4EM0B 3TP3A 5FROA 1WPKA 1IXSB 1GLNA 2VQGA 1MJBA 4CCLA 1F5TA 2R93J 2DA2A 5CLSA 1Z7UA 1GXQA 2VKVA 2ICWG 2IPQX 2K4JA 5EZGA 2JTVA 5KNLA 1O57A 3AAFA 1Z1DA 3HL2A 2XDVA 4CH7A 1A36A 3BJ6A 1PYVA 3FMRA 2W82A 1BI0A 3JAMK 2VBYA 4KISA 3K69A 4CCNA 4MFEA 5EGOA 2CU7A 3IAM2 1K78A 2X48A 2LBFB 3TBIA 4DYRA 4HDVA 2ETHA 1B72A 1LE8A 1PUEE 3HEFA 1CF7A 2OAZA 4XRFA 3SFZA 3VPRA 3DXJF 2LBFA 1B72B 5GTHC 1MBHA 2R7QA 1SMTA 3LMMA 3MZYA 3NAUA 3HRTA 2V6EA 1LNWA 4KIFA 1KZHA 3T5XA 2L2OA 3CMMA 4MIMA 4XKWA 2ELKA 4YEJA 3LSHA 3ABKH 3W2WA 1ETYA 4O6JA 5BNGA 5FD6A 1XGSA 2VC0A 3CCYA 5FLVA 1IG7A 3I0TA 4XRSG 3D5SC 2M0CA 1FBSA 4Y33A 4YELA 2AQFA 3S3NA 1XGMA 3CZ6A 2EFQA 5L3FA 3BR5A 2KL4A 2IS1A 2BY1A 2XF5A 4ENMA 1TQIA 3KEQA 3ZN0A 3GTOJ 1TBXA 1X1BA 3F23A 2G7HA 2VKDA 3BTCA 3CO7C 1OKRA 2MW8A 5LGTA 5CPRB 3HG9A 2JPBA 3V42A 2W00A 4N9IA 5FLXZ 4TV7A 1K78B 4L0YB 3RJPA 3RPUA 4B8XA 4U7DA 3JRDA 1U5TC 1WQ2A 1JTXA 4M9SA 4OAZA 4RAYA 2R7DA 4D0PA 3FKJA 4GGGA 1AU7A 1JTYA 2DDBA 1KQ0A 2MA3A 2B63J 4R1HA 3BG6A 4Y15A 3GZNB 4Y4RA 1BA5A 2HFHA 5J1UA 5ILVA 1U2WA 1ZG5A 4HRIA 4MQVA 2PMUA 4OU0A 4F93B 2PJRB 2HOSA 1AWCA 1WVRA 1YS6A 3QP5A 3LSJA 4CDGA 3A01A 1ZARA 1R36A 3CUOA 4PGGA 3VDXA 2QGUA 2IA0A 4JOMA 5DUKA 1T0FA 1UELB 4XLEA 2Y9YA 2HOTA 3E6DA 1KA8A 5ILSA 3TKYA 2NNYA 4YIFA 1USTA 3L2RA 3WG7H 2L0KA 4J00A 4S0HB 1VQ6I 1LVAA 4EJUA 2K5CA 3G6EI 1FBQA 2IA2A 4LK0F 1ZRFA 3TP0A 2L9RA 2L9VA 2XAUA 3QOEA 4RM3A 1T0FC 1F4KA 2NOJB 5K1YA 1G3SA 4AUXA 3U9GA 3VEPA 1NH3A 2ZSIB 3ELKA 4HV5A 4E6KG 3FISA 2GXAA 1QO0D 3EDPA 5E79C 3C18A 1FIPA 3MWMA 1LVKA 2GXGA 4RLQA 2B9SA 1MBEA 2DXIA 1SD5A 4Y17A 2D2WA 2K7LA 5E3MA 4F52A 3SHFA 2V1XA 2E1MC 2CYYA 1QGPA 2ECBA 1WJCA 2GA2A 3K7AJ 1KU7A 5ILUA 2X9DA 2CV0A 5LRSA 4XRMA 2HU9A 3ECHA 1MNMC 3OOUA 3E5UA 4KIBA 3ZOBA 3CMAI 2H8WA 1JUMA 2JVHA 4NNJA 4XN0A 4DYCA 3CQZJ 1PJRA 3DBRB 1OYYA 3EUKL 4O3MA 2LLKA 3LQQA 3PNYA 1MMNA 5J47A 4BJ6C 4LLNA 2CWEA 2PMHA 4U0VA 2ZFUA 3HRUA 1SMYF 3QOPA 3CP8A 1BC8C 3I64A 3K0LA 4FTHA 4LB5A 2L54A 1KU2A 9ANTA 3O8GA 2HEOA 2O6GE 1WFXA 1X1AA 1FNNA 3DEWA 3TEDA 3FHZA 2OCEA 1YW7A 2CGPA 1X1PA 5IPAA 1CQTA 4U0YA 2XB5A 2RQQA 3V7CA 3LQRA 5F08A 3S1RJ 4OAYA 2CS3A 5M5XJ 3GTJJ 3RI4A 2FQ3A 3FXLA 1PP8F 2HS5A 1EH6A 3K10A 1I3AA 4EMSA 5FLXK 3KIOA 1SD6A 1E17A 2VXZA 2RVCA 1W5SA 2ZB9A 2CW7A 4BE2A 1LEBA 2BY2A 2E1NA 4CHUA 3K4NA 3PM1A 2BZTA 3M7GA 1S7AA 5AONA 1MMAA 4QIWN 3EPZA 3SZTA 3OSFA 2O7OA 3I54A 3HZJA 3ZQIA 4XLAA 2DYSH 4PK4A 5FFZA 5M3FJ 1FYLA 2HOEA 4A6EA 1JKPC 5J1YA 4ZC3A 5D5UB 3CC7I 2KQRA 2E2JJ 4M71A 4UNOA 4IRIA 1ZRDA 1ZGJA 1SAUA 4MTDA 2WA0A 2JK3A 4OIQF 2DFEA 2FNAA 2LOOA 2ID6A 3V8JA 3OSGA 1PDNC 1V4RA 4IF4A 4DJAA 5J4YA 4G6DA 2A6EF 1H9TA 3B6CA 1XCVA 2F4OB 2X6YA 1HA8A 4A0XA 5IOZA 3LAJA 2QKMB 1FLIA 3FXQA 1UFMA 1ZG3A 5FD5A 1OYWA 2DAOA 3O8HA 2QBYA 1XG1A 3OL3A 4V2GA 2WC2A 3TQNA 1D5VA 3JSPA 1GVDA 1IO2A 4I98B 2D1HA 2JSPA 1OCCH 2VOOA 4A3LJ 2XKOA 1TNSA 2D5VA 2ZKZA 4RAGA 3TOAA 2RC4A 2HQAA 1OJLA 2IBDA 4CZCA 5GTIC 3HOYJ 2LF8A 3MKLA 3G73A 1UB9A 4BDZA 2EPFA 3D1NI 1S29A 3J7ZI 2C6YA 3WGIA 2LKXA 3SYTA 3PFIA 1V54H 2Q2EA 1WJFA 3BTIA 2KZVA 5FGMA 4Q47A 5IYCJ 5D8KB 5DM6F 2L01A 2F5CA 3ISPA 1IW7F 2HTJA 2X6XA 2XPVA 3F3XA 3H9QA 3ZN1A 2M1BA 4A69C 4A3EJ 4BGDA 1IN5A 5BS6A 1VQLI 3K1MA 4UUTA 2AO9A 4BHBA 3DV8A 4IKFA 2AS5F 1S9HA 4I99C 4IHWA 2GOMA 2FA5A 2G7UA 4II2A 1P7IA 1R9TJ 4ZTFA 3QRFF 2BGCA 4PJJA 1IRGA 1MJ9A 3OYDA 1I3QJ 2IT0A 1IRZA 3R0AA 1FMVA 4M3EA 2FMLA 2ISYA 3W2VA 4GFBA 5A2QK 3I71A 5E17F 2M0MA 2OF7A 2J5OA 3CUQB 5LGUA 1QQIA 3WTSC 2J5PA 3H92A 2TRTA 4IHYA 1S7OA 1VQ9I 1AA7A 4NDLA 1DPRA 5JLWA 5BMZA 2BY3A 3MKYB 1D8JA 6PAXA 5DV5A 4PSXA 1FMWA 2HXIA 2QA4I 2H8RA 5LBQA 3QODA 4AIKA 2ACJA 5E1WA 4MTEA 2H1LA 3DP7A 1OMIA 3FXRA 2L4AA 1JJ6C 4O5VA 3PIPF 4NQWB 4CXFA 2XPUA 1XC5A 2ZXIA 3H5RA 4XNFA 5LLQA 1TTYA 4P96A 2D45A 3MZ8A 1MW7A 5K7HA 3OV8A 1T56A 1GHCA 1R4MB 2HKXA 3HYIA 3HGYA 3TW6A 2Y30A 3F8FA 4HF1A 3J81K 4L5IA 3Q9SA 3CUQA 2V1DA 3HSEA 2H27A 1BW6A 2QQAA 3LA2A 4IPAA 3E97A 5AIPA 5IYBJ 2V1NA 5EG0B 2E5NA 2Z1DA 2NXNB 2PN6A 3BPVA 1YOVB 4WWCA 4PCQA 3CJRB 2L9NA 1LKXA 4IRHA 2MD0A 3E6BA 3DCFA 1EV7A 3A4CA 4D5FA 4LFUA 1G3TA 4PDKA 2F5DA 2MBFA 2OV7A 4KYWA 1X3UA 1QVTA 5D4RA 4HNUA 1U5TB 3CC4I 1OR7C 2FJ1A 3OYFA 4Z6YA 4JK1X 2DK8A 3BZCA 1MDMA 4BUPA 1XS9A 2KIFA 1ETXA 3BG9A 3ASNH 2KRCA 2KRHA 1ETKA 3CCVI 1GXPA 4BEHB 5LFAA 5HLHA 4J19A 2GAUA 1YYVA 2DFIA 2OTJI 3FK7A 3PFYA 2EK5A 2DOAA 4ENNA 2HQNA 1MBKA 3WTTC 1R7JA 1B8IB 4JBAA 1ZREA 4H4KC 2WAQN 3CMYA 5LD2C 2Y69H 4GYIA 1EH7A 2A6TA 2XROA 3NRVA 1FSHA 1MBGA 2PX9A 3KCCA 3B02A 2ZMEA 4DYQA 2ELHA 5JVTA 2Z2SB 3OYEA 2L5QA 3OYGA 1U8RA 4RM2A 3TOBA 3JRIA 1I39A 2AXLA 4HA8A 3K2AA 2YU9J 2DMPA 3CJQB 4F7ZA 2XPWA 3RPUD 4XM3A 2LY1A 2KIMA 2Q0OA 4XIDA 2NVQJ 4EVIA 2JN6A 4RMNA 1E2XA 1LQ1A 2R5YA 1LE8B 1UZCA 5KVRA 5HLTA 3WTWC 4HPQA 3DU6A 1KYZA 4B47A 2XB0X 4AD9A 1XMAA 4MGRA 3GF2A 4QTRA 3J7AO 4A3MJ 2ISZA 4M3GA 1UAAA 1ZK8A 1YQAA 3JRBA 3L7WA 1P92A 3LSMA 3M8EA 3Q0VA 5E8IA 1BIAA 2AHQA 2HXOA 3KZIC 1ZG1A 1V5FA 3F72A 5FKKA 1WJAA 1Z6RA 4KIGA 2K9SA 2W1OA 3WTYC 2CJJA 2MC4A 2FE3A 4ZYHA 4JP0A 4XORA 3HSRA 1SFOJ 1XSXA 1X1CA 1O4XA 2EIKH 4BHPA 5IP7J 3JRFA 1JT0A 3LSGA 2W4SA 2W57A 2UV1A 3HM5A 1JKOC 1ZYRF 4ESBA 2E1CA 1H9GA 2RN7A 1R58A 2Y2ZA 1Z91A 4C30A 4AIDA 1ZN2A 3KE2A 5B5EC 2MYSA 1IUFA 1Z77A 2JA5J 4EJOA 4B43A 4U0WA 1JHHA 1F9NA 5KHDA 2PLYA 3E3VA 1LDJA 4MNUA 3RDIA 1DPUA 3PQKA 1SFKA 3C3WA 2K9QA 1UHWA 1HDDC 4DOZA 1FWZA 4UV8A 2MC3A 1OCOH 3S14J 1KQ8A 4E70A 3ERMA 1Z3XA 5IY5H 2G0EA 3ERED 5F1RA 3BR6A 1MMGA 4XRSA 1FOKA 3M07A 2HVQA 4RB3C 2Y75A 1U8BA 5C4JJ 3OS1A 2DPUA 1G8XA 4LB6B 2BXZA 4Q4ZF 1YFHA 1PUFB 2A68F 4Y13A 2R92J 3A01B 3RPQA 1N75A 4CCKA 2KT0A 5J1RA 2HPIA 2MFZA 3FM5A 3WTUC 4V19K 2KMUA 3W3CA 1KQ9A 4OOIA 3RYPA 1LUJB 3SXYA 4HOBA 5DYMA 3CCRI 5DS9A 2NVYJ 3NEUA 3DTKA 3ZMZA 2NVTJ 3CMEI 1YX3A 3P9KA 4M72A 3JRGA 2CG4A 3CF2A 2GM4A 3GLLA 5D5XB 4WXCA 3GUDA 2Y0MA 1X2NA 2BYVE 3Q3SA 4E7IA 2CQ7A 4P55A 4LMYA 2P7VB 1PUFA 3CTAA 3C2GA 5J8CA 3BTJA 3LWFA 4I7HA 2DMNA 3GMEA 2QCOA 1J09A 1V3FA 2UUZA 4G6TB 3R6SA 4Q5SF 2CRGA 3OYMA 4CCMA 3OYIA 1IGNA 1SANA 1HKQA 5H20A 2PJRA 3D0SA 3S3MA 1FBUA 2STTA 4E7HA 3D5RC 3UKGA 4BJ5C 2DA5A 2GLOA 2ZXJA 1SAXA 3NARA 2VLAA 3QYEA 4BQOA 4CCJA 4NBQA 1SEUA 1BR1A 1IRXA 5J6XA 2EBIA 2K02A 4E7SA 3F21A 1G2HA 3PNTA 2ESHA 2LTPA 5F0CA 4L9VA 4C2TA 4L0ZB 5GAGJ 3O2PE 1N77A 1R1VA 5E3NA 4OIRF 1ZLKA 1ETVA 5GPAA 3B6AA 1DDNA 2WAEA 3Q9VA 1Y56A 2FNPA 3TDZC 1Z9CA 3HKZA 2CW0F 5B1AH 5M3MJ 3HC7A 2L3DA 2UXXA 2O3FA 4G8XA 3GTLJ 1AKHB 2LMDA 1IJWC 5M5YJ 2QLZA 1P4AA 1OFCX 4BH9A 1F36A 4HSRA 2Y48A 4R79A 2GOXB 1HW5A 1TW2A 3DWLE 4NB5A 4ASNA 4I2OA 2PJPA 4ESFA 5K5OA 1QHGA 3DEEA 4HF0A 4FASD 3W2AA 1K4SA 1GUUA 3F8CA 2FU4A 3Q0UA 1VQNI 5FFXA 3LOCA 1MBFA 1Y1VJ 3K6GA 3OIPA 5DDGA 1WH5A 1TC3C 2QQ9A 2WB1A 3GW2A 2XSDC 3E5QA 3QP6A 2LC2A 4LJZF 3KLNA 3ZGKA 3VFZA 4UVAA 2NOGA 4AYBA 3PSIA 1X2MA 3C7JA 3G3ZA 4BDYA 1WI9A 5JR3A 3BP8A 4JX6A 4YIIA 4Y7NJ 3OYCA 1MIJA 1WJBA 2XVCA 2M7AA 1NG6A 1YS7A 2FOKA 1ZTRA 1KYWA 4NC6A 2FMYA 2L7FP 3LSIA 1D1BA 1OQYA 1RETA 1WJDA 3GFMA 1V55H 2RNJA 5ICCA 5E8GA 4IL6C 3I55I 1RC9A 4IHVA 1Y8QB 4PFOA 1HKTA 3I4MJ 4GXOA 2A5YB 2VT3A 1A04A 4BL0B 3IL2A 1LFUP 4L9TA 2V1UA 4WF2A 2AQEA 2H94A 2CQXA 2LF7A 4I6ZA 2CV2A 3QPLA 1GDTA 1ODDA 5IP9J 1T38A 2HOAA 1HBXG 2F6CA 1STZA 3SJMA 4KJZA 2X51A 4UB6C 1YHQI 1HC8A 3IUOA 4DNCA 2Z99A 3CLQA 3GZ5A 2JA7J 2DDAA 2Y31A 4G9YA 3ZMTA 5CVRA 1FOYA 1J2XA 2O0YA 1D3YA 5DEQA 3A03A 2PMZA 2EH3A 4HEA2 1ERDA 5J8FA 3GFJA 3S1NJ 1UJ8A 2FD5A 4LGWA 2E60A 2KZGA 3JRHA 1APLC 1YW8A 3QQAA 2A6HF 2HZTA 1EF4A 2XAJA 5D6FA 3TMOA 4EM2A 5IOYA 3GO5A 3OIQA 3ABLH 3HBLA 4DGWB 2LKSA 1JKQC 4D9JA 2E35A 2LDUA 4ESJA 3BJAA 3HOVJ 1FEXA 2ZCWA 2Z33A 2E71A 3H3VK 1K6OA 2W24A 5FKNA 2QM3A 4P9FA 3LFKA 4ZTJA 2VQCA 1R1TA 2A05A 2MG4A 1TQMA 4M74A 4IJAA 1IDYA 1R1UA 4XLFA 2EFPA 3GXOA 3JW4A 3I5UA 3K4KA 2Z16A 1OLTA 2DFFA 2M4GA 1JXSA 3IWZA 2XAQA 3DKYA 3R60A 2LD5A 2JZYA 2HNHA 2KPMA 2IVMA 1O3TA 1R00A 4FETA 1LFPA 3LSTA 3K4BA 3CDIA 4KN4X 3DBLB 3RSNA 1MD0A 4II3A 1S7EA 2OZ6A 1YRNA 2XC7A 3F22A 3FBIB 3DTEA 3QYFA 2XASA 2LYCA 4E7ZA 1KU3A 1IZ1A 2ZFWA 4JX5A 2IGMA 3ABUA 5KAIC 3HJEA 1LB2A 1QZZA 2CUEA 1BOAA 3L2WA 4N4OB 5IYDJ 3MFKA 1XSDA 4ZZLA 1R5ID 2HWVA 2JA8J 3MVPA 1OCPA 3BR0A 5JVGF 2VODA 2GQQA 1WSUA 3P9IA 1FTZA 4B3AA 1ENHA 2FOWA 2E7WA 4XOPA 3U1KA 1H89C 4W1UA 2R3SA 2KIUA 3RKWA 2LNBA 4S05A 4XLPF 2W25A 1Z05A 4PJLA 3OS0A 5A2QZ 3CD6I 2KDOA 5FRNA 3HKZN 4N0BA 2XRNA 3BTLA 1X1DA 3VYRB 1BW5A 4ZDPA 1KGSA 2ECCA 2TCTA 3DFGA 2FF4A 2WADA 1JHFA 5LHGA 4NQWA 4RB2C 5EEAA 5JI6A 3OYKA 2CFXA 5K7FA 1JI8A 4IHXA 3AG1H 1WGXA 5K7ZA 2R7VA 2JUCA 5K5QA 5D5VB 1DUXC 2K9MA 1MZBA 3LA7A 3MKWB 3FF5A 1LEAA 1P9QC 3H5AA 3SDBA 2DA6A 4I02A 3RTRA 2GXBA 1RPWA 4RGRA 3BROA 4B44A 2V7FA 4I0BA 5D8LB 3MAJA 4ZH4F 3ASOH 2LRDA 1W5TA 5HDKA 4WCGA 1W7PA 2L7KA 3PL8A 2CMPA 2ME6A 5LEJA 3CCQI 3ZCOA 4YFKF 5HVQC 1XDSA 4N9HA 3ZQHA 1CGPA 1R6RA 3BJOA 3H36A 4A6DA 3DBHB 4YRVA 3ZQQA 2KISA 3ZQLA 2OU2A 2EA4A 2R7UA 1IXCA 2OCCH 1BBYA 1HCRA 3NWTA 3MQ0A 2LH9A 1OPCA 3F8NA 2VJ5A 4KDPA 1W1WE 2EINH 2K86A 3HB9A 3ZR8X 5J4VA 3RQIA 5F6FA 1C0WA 3SEQA 1G4DA 2VPLA 3BG7A 4HX4A 4I09A 5GP9A 4BY7J 3LSPA 2IRFG 3FM3A 3V8LA 2V26A 1BL0A 3SFIA 3BCAA 2R5YB 2CUJA 4M6YA 3EYIA 2YX7A 2KRFA 2DT7B 2F4IA 4WXDA 4YIRX 3FDYA 1XMKA 4PZJA 3WTZA 2QYOA 5EYRA 4D7MA 3U1DA 2V4JC 4BBSJ 2LSOA 4UVCA 4DZJA 2JRTA 3FBNB 4L9NA 3IAS2 3I56I 1SVLA 2X4HA 4YFXF 1ORKA 1HW1A 3W6VA 4CZZA 3H1CA 4KMUX 3PIOF 2LY2A 4RAFA 3CCEI 2BE5F 2R7RA 1BR4A 3KPHA 3IP4B 2WAFA 1P6RA 2EV5A 5JLXA 4M6VA 2JSCA 5CVIA 3I58A 3S2HJ 3AG3H 5BPDA 1D5YA 2CQNA 2E2HJ 2DA1A 3I4PA 3DPTA 3CESA 1ON1A 2IEKA 1EJ9A 5HLGA 2KIQA 2W85A 1ZRCA 1TLHB 1LDDA 2DYRH 3K9TA 4ZDOA 2X6OA 2ZNZA 4D5CA 1ZKGA 4BACA 1VNDA 3CUQC 2CV1A 4KMFA 1POGA 3H5NA 3M3YJ 5H2FC 1R4NB 2NAZA 3JAMZ 2M30A 2O8XA 2OQRA 4G7OF 1VQPI 2MABA 1Y8RB 2DMTA 1JT6A 1DU0A 1ZR4A 4PSWA 1DGRM 3U21A 1BIBA 2VC1A 1H88C 3K4MA 4DBQA 4KA4A 3HDDA 3ZQCA 2LREA 3KEOA 4E7LA 1B8IA 4A2UA 4HG2A 2MSYA 1J5YA 3CDHA 4RS8A 1T6SA 2FRHA 1JGSA 2R7XA 2KHMA 3O6BB 2WTEA 1EA3A 2R4GA 1G3WA 2Q1ZB 3R61A 1J59A 1AHDP 1MGTA 1YJ9I 2ZC2A 5HDGA 4BBRJ 5D4SA 1BJZA 2D1VA 3J80K 4UB8C 2LKPA 2PI0A 2OZUA 2WV1A 5IP6A 4P5OA 4M3BA 5ICFA 2UWMA 3S15J 4UUSB 2I10A 2OA4A 3Q5FA 1HW2A 1FC3A 1WH7A 4NUBA 4B4CA 3DPUA 2XKPA 4YFNF 2DK5A 1J9IA 2O03A 1TL8A 5D6EA 3HUGB 1NG7A 2M4KA 1ZELA 4XSXF 3KP5A 3HRSA 2QBYB 1Z67A 1YRNB 4E7JA 3OYLA 5ICGA 4OMYA 2COBA 2LR8A 3DTIA 3PUFA 5L3DA 2Y0SN 2P4WA 2EWNA 3ZQGA 1PVEA 3RQ4A 4L18B 1VZ0A 3V7RA 2RKHA 2IS4A 1RKTA 3OOPA 1A35A 2IS6A 5C4XJ 3L1PA 1X3ZB 1G3YA 3OR2C 5EF6A 3COAC 1G59A 4A3DJ 2DJNA 3EUHA 3KLOA 5F0FA 2F4MB 2QKLB 4FCYA 1JGGA 1S8NA 2DW4A 3HUGA 3BOQA 3A1YA 2ZJQF 3N05A 3VYUB 2VJJA 4Y3OA 3OYHA 4BE0A 5CVUA 4XLCA 1ZGWA 4AWXB 2LP0A 3HSFA 1B1BA 1D1CA 2M2EA 2BVLA 1YW9A 2CW8A 3P7NA 1S72I 2O61A 1MNDA 1K61A 3A02A 3MD2A 2QWWA 1XDUA 2HYJA 1AKHA 2EB7A 3BPXA 3E7LA 2R7ZJ 2Q8KA 2P81A 4B48A 3T0YA 4RGUA 1GV2A 3GLXA 1KONA 2DLLA 1HXDA 1QZYA 2L7ZA 2YR2A 2M3AA 3LL7A 4D7NA 3J7AY 2R5ZA 2E1OA 5FKMA 2VL8A 3TDUC 4CYCB 1XSVA 5F64A 4GRIA 5KCMA 2ZSHB 3CCLI 1ACIA 2X0LA 1W0UA 4FISA 3REOA 2WAQA 3AKZA 1O7LA 3HRMA 3WE3A 3LNQA 1GV5A 4EJWA 4G7ZF 1RR8C 4J01A 4AVPA 4DZPA 3EYYA 2PBIA 4U88A 4V2FA 3S93A 4DIQA 1QZEA 2P0WA 3KP4A 3Q0WA 3SZPA 4FX0A 2X85A 5DCMA 4HV6A 5B1BH 2CUZA 3FIWA 3WODF 1VQMI 2IGNA 2X6WA 2HYFA 2GZWA 2O8KA 1E3HA 3DQVC 3IKTA 1K6YA 1QVUA 1W5CC 4I01A 4HDUA 4XR6A 1B59A 1X3WB 1ZGAA 5TGTA 2GA1A 4NC7A 3H3ZA 1ON2A 1XTAA 1W7PB 2IGKA 3P9CA 4A3CJ 4LLGF 3KZZA 3ABMH 1SFEA 1XN7A 1WHUA 1T8IA 3F8MA 1BJAA 1XD7A 4P1WA 1MNEA 4C2MJ 3BZ6A 3HOTA 3AL0B 4JX4A 1ETQA 2JRMA 2MD5A 1S5LC 4QWQA 5HNHA 3OL4A 2Z5UA 2ADUA 3WU0A 2X1CA 3JRCA 4BQAA 3IHUA 3FXMA 3CC2I 3GTKJ 4BU2A 4MFDA 1UG0A 4BNCA 4CGZA 1D0YA 2VE9A 1S3JA 1VTNC 5C44J 3FK6A 1D1AA 4IVNA 2CUFA 2BBYA 3KYLA 1DGWY 2LK2A 3LAPA 2H1KA 1W0TA 3KZYA 4HLYA 3HHGA 1GT0C 1VQOI 5EGOB 1YLFA 2DA4A 5E20A 3AL0C 1K83J 3K4LA 4HQEA 2BW3A 1SVOA 1FTTA 4I76A 3MN2A 3F0CA 2RNGA 4AU7A 4RLFA 5E3LA 3VYTB 1UMQA 2DQLA 3H0DA 2KDZA 2EFWA 1U9OA 4LITA 4G6QA 2EIMH 1QRYA 3ZMUA 1VQ5I 4Y52J 1D0XA 5M5WJ 3GX4X 4OIOF 3CP2A 4AC0A 2XAHA 4M3DA 3IH4A 2DOFA 1Z21A 1XCBA 1T95A 4WXHA 3FXUA 2WBMA 4F92B 3MMYB 3H35A 2L7MP 3HHHA 2MGQA 3BT9A 3OMYA 1TWCJ 4XSZF 1XGOA 3X2QH 4XKCA 1O3SA 4IHSA 1ULYA 4QPOA 4BKXA 1Y0NA 4EGYA 3A0HC 4MQ9F 3BR2A 3RIRA 4UXNA 3QU3A 2ESNA 2A07F 1K4TA 4E4HA 1KU9A 4A0ZA 1RIOH 4KNYA 3KFWX 5FRMA 4XICA 3HOZJ 2STWA 4F55A 3TGNA 3PQJA 2QQBA 1JUSA 4PJNA 3DEUA 3ZMVA 3JRAA 2K27A 1M1EB 1RESA 3G1LA 2QF7A 3AG4H 2VT2A 4RGSA 2P5KA 2Q2EB 3D5LA 2H09A 3RZDJ 2F2EA 2ZJRF 2OC6A 3E0JB 2E7XA 5FLMJ 3FXOA 3L2VA 1MSEC 4A5NA 2EJRA 2IAIA 4C3IJ 2CH0A 5GAHJ 3M8JA 3PJRA 2EFNA 2RDPA 5BOXA 3QWLA 2FBIA 1UG2A 2M7BA 3K1PA 3WU1B 4CYDA 1U0JA 4ZYGA 5GAEJ 1FYMA 2PEXA 2ME0A 4HF2A 1T33A 1T98A 4AIJA 3WGGA 4KT6A 4IX7A 2DT6A 3GFLA 2M9HA 1U6GA 4B1RA 3WTXC 1I5ZA 4X1EA 3TO9A 2K40A 2I5UA 1TP4A 2FSWA 4UUSA 1HDPA 3H9JA 5HLIA 3CCJI 4XKBA 3BQZA 3RKYA 2VJIA 1QBJA 5EEGA 1AOYA 2IA1A 3W6JB 2QUFA 2P6TA 2NVXJ 1YX5A 1Z7LA 3DU5A 1FY7A 3I3LA 3VYSB 4M9ZA 5F04A 4QPQA 5EDNA 4ANJA 3L09A 4L5EA 4P9UA 4ZDLA 2ZNYA 1FX7A 4A3KJ 2RQPA 4IRGA 4U87A 4A3BJ 3H0GJ 2EZKA 2QSGX 3ABTA 4IO9F 2CSOA 1NTCA 3QAHA 1W36D 4A93J 3RKQA 5H6RA 3HGGA 4IQJA 3P5JA 4MEXF 3DKWA 1HKSA 1TT5B 2L4MA 2QEXI 2DTZA 2OPTA 1HOMA 3WTVC 1RKWA 3BY6A 3HOSA 2DA7A 2YX4A 3ZPLA 1P4XA 4AIHA 3KETA 3CO6C 1MSFC 2F48A 2XIGA 3L9FA 3V4GA 3BWGA 5B3SH 3K4JA 2QQ8A 4LG0B 2UXNA 3V7SA 4IQ4A 4ZYEA 3GTMJ 4N4NB 4LLLA 4UUVA 5H6QA 1IV6A 3GBGA 2PFBA 3W6KB 1MH4A 3HTUA 1BI3A 2L9SA 4HYEA 2JUGA 1X58A 1V5EA 2BOLA 4BQNA 4B3XA 3CDLA 3OR1C 3DLLF 1LPQA 4GDFA 1A31A 2A5WA 1O3RA 1IF1A 1WKMA 1IRFA 1VF9A 1T2KA 1ETOA 2JVGA 4C9YA 1LFBA 4JQFA 3BG5A 1WJEA 4KICA 1FIAA 5AIQA 4QLCU 5JHUA 2E2IJ 3R4KA 2N8GA 2WY8Q 4M6XA 1VQKI 3OS2A 5IT9K 4PGHA 1OR7A 1YG2A 2BVMA 3I53A 1P7JA 2UZKA 2ZO4A 4HSTA 4KN7X 4Q48A 2YU3A 1OISA 4K2EA 2VI6A 2KJBA 5CYVA 4IEJA 3JR9A 3F6VA 1XB4A 4R8HA 2WWYA 2YSRA 3DLAA 3LSKA 5LHHA 2R7WA 3VODA 3PUBA 4JYKA 2ZMEB 3WHCA 1VQ7I 2VBWA 4KITB 4HX8A 3ML6A 4IOAF 2V9PA 3F9KA 1TW3A 2XGXA 1FSEA 2RAEA 5DCFA 3HTSB 1E0EA 5C3EJ 3FMSA 2RGVA 4LG0A 5JFRA 3GWZA 1IUYA 3CF5F 4FHTA 3AFHA 3G1MA 3K70D 4A3JJ 3IH2A 1FJLA 3AG2H 4RGXA 1XX5A 1HSTA 3KP3A 3J81Z 4ZYAA 4IOCF 1RZ4A 3S32A 4M3FA 1PP7U 1H0MA 4NHJA 3RZOJ 1R23A 5GADJ 5F1JA 1USSA 3L2CA 1FYKA 1G6NA 2K4BA 1TWAJ 2R7FA 3GYHX 3FHNA 4HNVA 1ZLJA 4IXAA 2FXAA 5F27A 1K79A 3KYCB 3WG9A 2QSHX 4D1QA 4DQ2A 2JA6J 2P6SA 3IV5A 5L3EA 3E1SA 1FP1D 4BJTA 5DD4A 2CFOA 3M1EA 2ELJA 4G12A 3GVAA 5LRRA 2BXYA 5DCMB 4BHCA 3G71I 1FOWA 2K85A 4BXFA 2FUG2 1YIJI 4ITVA 4RDUA 1FZPB 1MJAA 1SVMA 5ICEA 3I9V2 2JA2A 3OYAA 2PMZN 4CSWA 2MH2A 1SD4A 3PO3J 2E1MB 3G2BA 5CVJA 1WCMJ 5TRDA 2P7CB 4GCVA 1E3PA 4ZYDA 3KP2A 3S2WA 2VASA 5KK1A 1X19A 2KP6A 2P5LC 5LHIA 2HDDA 5E1ZB 2V79A 3IH3A 1MBJA 3BDDA 1ZHFA 2XF6A 3S8PA 3OIOA 2WB1N 4EJTA 5HS9A 2NYXA 1MMSA 1T39A 1B4AA 2DI3A 1F1ZA 3WU2C 1FT9A 2KFDA 2OQGA 2MLKA 4HLXA 2HKOA 4G7HF 4U7BA 3JREA 1GVJA 1YIOA 2LVSA 2X1EA 2NS8A 1BI2A 1MMDA 4PJMA 2M87A 3K70C 2VKEA 3J7YJ 3IRQA 3QU6A 5LEKA 3BR1A 3J80Z 3SQNA 2BEOA 4UY8I 1WRJA 1VFCA 1JJ8C 2ID3A 3ZP5A 3FKIJ 3S1QJ 1FPQA 4CO8A 3TW7A 2EV0A 2VN2A 1UHSA 5BQTA 1B9NA 2DCEA 3FX3A 4WX9A 1NK2P 5EEHA 5CJ9A 4ZJZA 1TT0A 1YE9A 4NC8A 2JJ7A 5HODA 5L3GA 4EATA 3IRRA 1OYIA 4HZFA 2YPRA 5EG0A 1RR7A 4OINF 1QHHD 2Z3YA 3QYBA 3VWBA 4A12A 3G4SI 5FO5A 5DUIA 2W84A 2VE8A 2EQRA 4HX7A 1W36C 3NWSA 2R7SA 4LK1F 5E18F 3LA3A 4C2UA 2COMA 2DFHA 2E5ZA 1BN5A 1B9MA 4CUGA 2W7NA 3DKXA 2IP2A 2M5WA 2V9VA 1W4MA 5J40A 2LY9A 1U5TA 4A0YA 1V5GA 3V8KA 4A5MA 1HLVA 3EUAA 2IW5A 3MCZA 4MHGA 2ZXHA 3GEZA 1DP7P 2XSJC 3LSRA 2O9LA 2ZJ2A 4UHTA 1TQPA 5BPIA 5JHFA 1Q1VA 4PJ0C 3DPLC 1N25A 2M34A 4A3FJ 3JCUC 4FE4A 4CYCA 1J7KA 2HYGD 2FEZA 2XGCA 3OYJA 2HVSA 2E34A 2JQ7A 3I4NJ 3OYNA 3CJNA 3EQLF 4KUMA 2BHYA 4BS9A 4GYGA 4FT8A 4DW6A 1U78A 1W7PD 2VBZA 2DO7A 4MO7A 5DM7F 4C3JJ 2WV0A 4WK8F 2VUMJ 4E7KA 2X1DA 2B0LA 4RAZA 2QENA 2E19A 4MEYF 4HW0A 3JTHA 4DBRA 2HDCA 1OCZH 4ENKA 2ZXWH 3FZVA 2CQKA 5IT3A 1A5JA 3K1NA 2LG4A 1BOBA 2W48A 3HOWJ 2MH9A 1I1SA 1Z3YA 2IJLA 3K2ZA 3WGHA 1OCTC 4UVBA 2A3SA 1EH8A 5FB2A
chains in the Genus database with same CATH topology
3FISA 1W0UA 1JKRC 4FISA 1ETWA 2CQQA 3GTPJ 1FIPA 5M3MJ 3LNQA 1MBEA 1GV5A 4C3HJ 5DTDA 3GTLJ 5E3MA 1AKHB 1IJWC 4DZPA 1TWHJ 2JWTA 4V2FA 3M4OJ 2ECBA 4MLOA 3Q0WA 5M5YJ 1OFCX 3K7AJ 1F36A 3FIWA 1VI0A 3HOXJ 2X9DA 4XRMA 2R0QC 2O8KA 1GUUA 5J3LA 1QVUA 1MNMC 3Q0UA 3OOUA 3LOCA 1MBFA 3GTQJ 3ZOBA 1A6IA 1Y1VJ 1JUMA 2YUSA 1WH5A 1Z0XA 4DYCA 5FKOA 2FX0A 1TC3C 3BQYA 2XSDC 3HOUJ 3CQZJ 4A3CJ 1U9NA 2LLKA 2EZLA 5FKLA 3S2DJ 2NOGA 2NS7A 1X2MA 4C2MJ 4JX4A 1ETQA 4JX6A 4Y7NJ 4FTHA 9ANTA 3JRCA 3O8GA 3GTKJ 5E3OA 4MFDA 1ZTRA 3DEWA 3TEDA 3S16J 3WHBA 2L7FP 1RETA 5C44J 5IPAA 1CQTA 2XB5A 3FK6A 2DA3A 2CUFA 5F08A 3S1RJ 4IHVA 5M5XJ 2LK2A 3GTJJ 3I4MJ 3PO2J 1HF0A 2H1KA 1W0TA 3C2BA 4LOCA 2YS9A 1LFUP 1GT0C 2CQXA 4I6ZA 3QPLA 2DMUA 1GDTA 5EGOB 4QSHA 2DA4A 5IP9J 1K83J 2HOAA 2ZB9A 3SJMA 1FTTA 4I76A 2JA7J 2Y31A 3PM1A 3MN2A 3F0CA 1TWGJ 4QIWN 3A03A 5E3LA 2KDZA 2EH3A 1UMQA 1U9OA 3OSFA 2O7OA 3ZQIA 1QRYA 4Y52J 5FJ8J 5M5WJ 5M3FJ 3S1NJ 4AC0A 2FD5A 3S1MJ 1JKPC 5J1YA 3JRHA 4M3DA 1APLC 3QQAA 3IH4A 2E2JJ 1EF4A 5IOYA 1H8AC 2L7MP 3HBLA 2JK3A 2MGQA 3BT9A 1JKQC 1TWCJ 1IC8A 2ID6A 3OSGA 3HOVJ 1FEXA 3H3VK 4BKXA 3B6CA 5FKNA 2LFBA 2VPRA 3BR2A 5IOZA 1I50J 2MG4A 3O8HA 1IDYA 1XG1A 4V2GA 4XICA 3HOZJ 1GVDA 1JUSA 3JRAA 2XGEA 1RESA 4A3LJ 2LD5A 2D5VA 3G1LA 2EZHA 2QF7A 1OJLA 2IBDA 4AYBN 3RZDJ 3HOYJ 3MKLA 5FLMJ 3D1NI 1MSEC 4XK4A 2LKXA 2IAIA 4C3IJ 1S7EA 1YRNA 3BTIA 5IYCJ 1UG2A 3ZQFA 2DMQA 4JX5A 2HI3A 2GBYA 1ITYA 2CUEA 2ME0A 1T33A 5IYDJ 2EZIA 2XPVA 4A69C 4A3EJ 2M9HA 2JA8J 3MVPA 1OCPA 3BR0A 4UUTA 2AO9A 4B1RA 4IHWA 4X1EA 1FTZA 2K40A 4B3AA 4UUSA 1R9TJ 1HDPA 1ENHA 1P7IA 3BQZA 1H89C 4W1UA 2NVXJ 1I3QJ 1IRZA 4M3EA 4GFBA 4A3IJ 3HKZN 4FE7A 1QPIA 3BTLA 1BW5A 2OF7A 5F04A 2TCTA 2ECCA 5EDNA 4IHYA 2TRTA 4L5EA 4NDLA 1JUPA 5JLWA 4A3KJ 4A3BJ 4X6AJ 3H0GJ 5EEAA 1ZQ3P 2EZKA 2HXIA 2H8RA 1NTCA 5K7FA 4A93J 4A3GJ 3RKQA 1JJ6C 3HGGA 4IHXA 4ABZA 1WGXA 5K7ZA 2DTZA 2OPTA 2XPUA 1XC5A 1ZR2A 1NK3P 1I6HJ 1HOMA 5K7HA 1RKWA 2DA6A 4EEFG 1T56A 1RPWA 2XGDA 3HGYA 2DA7A 3TW6A 2Y30A 1MSFC 1BW6A 5IYBJ 3GTMJ 5EG0B 2R5ZB 3S17J 2Y9ZA 2ME6A 1IV6A 1IDZA 1E3OC 2XRLA 3GBGA 5GPCA 1F43A 2FQ4A 1DU6A 2HQ5A 3ZQHA 3DCFA 1MH4A 4D5FA 1X58A 2JMWA 3CDLA 1QVTA 3ZQLA 5F0HA 1VF9A 1ETOA 2FJ1A 1LFBA 3BG5A 1TWFJ 4BY1J 1XS9A 1HCRA 1FIAA 1Y1WJ 1ETXA 3BG9A 1ETKA 2E2IJ 2N8GA 3HB9A 4J19A 3RQIA 1P7JA 3FK7A 1MBKA 2VI6A 5EZHA 4IEJA 3JR9A 5GP9A 1B8IB 4BY7J 3LSPA 4JYKA 2WAQN 3WHCA 3CMYA 1BL0A 4BXXJ 3SFIA 2R5YB 1WI3A 1MBGA 4W97A 2RAEA 2M8GX 5C3EJ 5EYRA 4DYQA 3G1OA 4D7MA 4RBOA 3G1MA 2DN0A 4A3JJ 3IH2A 4BBSJ 1FJLA 4DZJA 3SDGA 4M3FA 3GTGJ 3JRIA 3RZOJ 3K2AA 3BG3A 2YU9J 2DMPA 3BR3A 2XPWA 1ORKA 3W6VA 5F1JA 1TWAJ 4XIDA 1MH3A 2NVQJ 2JN6A 4HNVA 2R5YA 3QPSA 5F27A 5JLXA 1LE8B 4M6VA 2JA6J 3S2HJ 2XB0X 3IV5A 2K9NA 1D5YA 3TP3A 4QTRA 1WPKA 4A3MJ 2E2HJ 4M3GA 2DA1A 1ZK8A 2R93J 2IEKA 2DA2A 3JRBA 2VKVA 4G12A 5EZGA 3Q0VA 2X6OA 4D5CA 1ZKGA 2AHQA 2HXOA 1VNDA 5FKKA 4RDUA 1POGA 3M3YJ 2K9SA 2CJJA 2PMZN 4MFEA 4JP0A 3PO3J 2DMTA 1JT6A 1DU0A 1ZR4A 5EGOA 2CU7A 1SFOJ 1WCMJ 1O4XA 2X48A 1B72A 4DYRA 5IP7J 3JRFA 1H88C 3LSGA 1JT0A 1LE8A 3HM5A 1JKOC 3HDDA 3HEFA 3ZQCA 2HDDA 2Y2ZA 3IH3A 1B8IA 1MBJA 3VPRA 1B72B 2MSYA 3OIOA 2WB1N 1IUFA 1MBHA 1Z77A 2JA5J 3NAUA 3JREA 2LVSA 2K9QA 2NS8A 4MIMA 1HDDC 2VKEA 2ELKA 1AHDP 4BBRJ 3BR1A 3S14J 1ETYA 1BJZA 5BNGA 1VFCA 1JJ8C 2ID3A 2G0EA 3CCYA 5FLVA 3FKIJ 3BR6A 1IG7A 3S1QJ 2WV1A 5IP6A 4XRSA 4M3BA 4XRSG 3TW7A 2M0CA 3S15J 4UUSB 1UHSA 2I10A 1U8BA 1WH7A 5C4JJ 3BR5A 4B4CA 1NK2P 1PUFB 2JJ7A 5HODA 2R92J 3A01B 3GTOJ 3BTCA 5EG0A 1RR7A 2MW8A 2KT0A 5J1RA 1YRNB 2EQRA 2COBA 3JRDA 1JTXA 2LR8A 2Y0SN 5DS9A 2NVYJ 1AU7A 3ZQGA 2NVTJ 1JTYA 2B63J 2LY9A 1RKTA 1HLVA 3JRGA 1BA5A 2GM4A 5J1UA 3LSRA 2O9LA 5C4XJ 1X2NA 3L1PA 3Q3SA 2HOSA 5EF6A 1PUFA 4A3DJ 3LSJA 2DJNA 1Q1VA 3BTJA 5F0FA 3A01A 2DMNA 2QCOA 4FCYA 2M34A 1JGGA 2CRGA 4A3FJ 4FE4A 1IGNA 1SANA 4CYCA 2XGCA 2Y9YA 1ZGWA 2HOTA 2LP0A 3UKGA 2DA5A 2GLOA 2M2EA 3I4NJ 2L0KA 3NARA 1K61A 3A02A 4DW6A 1U78A 4S0HB 2EBIA 4MO7A 4C3JJ 2HYJA 2VUMJ 1G2HA 1AKHA 2R7ZJ 3E7LA 2LTPA 2P81A 5F0CA 2E19A 3TP0A 1GV2A 2L9RA 1A5JA 2W48A 3HOWJ 2L7ZA 5E3NA 1ETVA 4D7NA 4AUXA 2R5ZA 2E1OA 5FKMA 5GPAA 3B6AA 4CYCB 1OCTC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FIS A;  1W0U A;  1JKR C;  4FIS A;  1ETW A;  2CQQ A;  3GTP J;  1FIP A;  5M3M J;  3LNQ A;  1MBE A;  1GV5 A;  4C3H J;  5DTD A;  3GTL J;  5E3M A;  1AKH B;  1IJW C;  4DZP A;  1TWH J;  2JWT A;  4V2F A;  3M4O J;  2ECB A;  4MLO A;  3Q0W A;  5M5Y J;  1OFC X;  3K7A J;  1F36 A;  3FIW A;  1VI0 A;  3HOX J;  2X9D A;  4XRM A;  2R0Q C;  2O8K A;  1GUU A;  5J3L A;  1QVU A;  1MNM C;  3Q0U A;  3OOU A;  3LOC A;  1MBF A;  3GTQ J;  3ZOB A;  1A6I A;  1Y1V J;  1JUM A;  2YUS A;  1WH5 A;  1Z0X A;  4DYC A;  5FKO A;  2FX0 A;  1TC3 C;  3BQY A;  2XSD C;  3HOU J;  3CQZ J;  4A3C J;  1U9N A;  2LLK A;  2EZL A;  5FKL A;  3S2D J;  2NOG A;  2NS7 A;  1X2M A;  4C2M J;  4JX4 A;  1ETQ A;  4JX6 A;  4Y7N J;  4FTH A;  9ANT A;  3JRC A;  3O8G A;  3GTK J;  5E3O A;  4MFD A;  1ZTR A;  3DEW A;  3TED A;  3S16 J;  3WHB A;  2L7F P;  1RET A;  5C44 J;  5IPA A;  1CQT A;  2XB5 A;  3FK6 A;  2DA3 A;  2CUF A;  5F08 A;  3S1R J;  4IHV A;  5M5X J;  2LK2 A;  3GTJ J;  3I4M J;  3PO2 J;  1HF0 A;  2H1K A;  1W0T A;  3C2B A;  4LOC A;  2YS9 A;  1LFU P;  1GT0 C;  2CQX A;  4I6Z A;  3QPL A;  2DMU A;  1GDT A;  5EGO B;  4QSH A;  2DA4 A;  5IP9 J;  1K83 J;  2HOA A;  2ZB9 A;  3SJM A;  1FTT A;  4I76 A;  2JA7 J;  2Y31 A;  3PM1 A;  3MN2 A;  3F0C A;  1TWG J;  4QIW N;  3A03 A;  5E3L A;  2KDZ A;  2EH3 A;  1UMQ A;  1U9O A;  3OSF A;  2O7O A;  3ZQI A;  1QRY A;  4Y52 J;  5FJ8 J;  5M5W J;  5M3F J;  3S1N J;  4AC0 A;  2FD5 A;  3S1M J;  1JKP C;  5J1Y A;  3JRH A;  4M3D A;  1APL C;  3QQA A;  3IH4 A;  2E2J J;  1EF4 A;  5IOY A;  1H8A C;  2L7M P;  3HBL A;  2JK3 A;  2MGQ A;  3BT9 A;  1JKQ C;  1TWC J;  1IC8 A;  2ID6 A;  3OSG A;  3HOV J;  1FEX A;  3H3V K;  4BKX A;  3B6C A;  5FKN A;  2LFB A;  2VPR A;  3BR2 A;  5IOZ A;  1I50 J;  2MG4 A;  3O8H A;  1IDY A;  1XG1 A;  4V2G A;  4XIC A;  3HOZ J;  1GVD A;  1JUS A;  3JRA A;  2XGE A;  1RES A;  4A3L J;  2LD5 A;  2D5V A;  3G1L A;  2EZH A;  2QF7 A;  1OJL A;  2IBD A;  4AYB N;  3RZD J;  3HOY J;  3MKL A;  5FLM J;  3D1N I;  1MSE C;  4XK4 A;  2LKX A;  2IAI A;  4C3I J;  1S7E A;  1YRN A;  3BTI A;  5IYC J;  1UG2 A;  3ZQF A;  2DMQ A;  4JX5 A;  2HI3 A;  2GBY A;  1ITY A;  2CUE A;  2ME0 A;  1T33 A;  5IYD J;  2EZI A;  2XPV A;  4A69 C;  4A3E J;  2M9H A;  2JA8 J;  3MVP A;  1OCP A;  3BR0 A;  4UUT A;  2AO9 A;  4B1R A;  4IHW A;  4X1E A;  1FTZ A;  2K40 A;  4B3A A;  4UUS A;  1R9T J;  1HDP A;  1ENH A;  1P7I A;  3BQZ A;  1H89 C;  4W1U A;  2NVX J;  1I3Q J;  1IRZ A;  4M3E A;  4GFB A;  4A3I J;  3HKZ N;  4FE7 A;  1QPI A;  3BTL A;  1BW5 A;  2OF7 A;  5F04 A;  2TCT A;  2ECC A;  5EDN A;  4IHY A;  2TRT A;  4L5E A;  4NDL A;  1JUP A;  5JLW A;  4A3K J;  4A3B J;  4X6A J;  3H0G J;  5EEA A;  1ZQ3 P;  2EZK A;  2HXI A;  2H8R A;  1NTC A;  5K7F A;  4A93 J;  4A3G J;  3RKQ A;  1JJ6 C;  3HGG A;  4IHX A;  4ABZ A;  1WGX A;  5K7Z A;  2DTZ A;  2OPT A;  2XPU A;  1XC5 A;  1ZR2 A;  1NK3 P;  1I6H J;  1HOM A;  5K7H A;  1RKW A;  2DA6 A;  4EEF G;  1T56 A;  1RPW A;  2XGD A;  3HGY A;  2DA7 A;  3TW6 A;  2Y30 A;  1MSF C;  1BW6 A;  5IYB J;  3GTM J;  5EG0 B;  2R5Z B;  3S17 J;  2Y9Z A;  2ME6 A;  1IV6 A;  1IDZ A;  1E3O C;  2XRL A;  3GBG A;  5GPC A;  1F43 A;  2FQ4 A;  1DU6 A;  2HQ5 A;  3ZQH A;  3DCF A;  1MH4 A;  4D5F A;  1X58 A;  2JMW A;  3CDL A;  1QVT A;  3ZQL A;  5F0H A;  1VF9 A;  1ETO A;  2FJ1 A;  1LFB A;  3BG5 A;  1TWF J;  4BY1 J;  1XS9 A;  1HCR A;  1FIA A;  1Y1W J;  1ETX A;  3BG9 A;  1ETK A;  2E2I J;  2N8G A;  3HB9 A;  4J19 A;  3RQI A;  1P7J A;  3FK7 A;  1MBK A;  2VI6 A;  5EZH A;  4IEJ A;  3JR9 A;  5GP9 A;  1B8I B;  4BY7 J;  3LSP A;  4JYK A;  2WAQ N;  3WHC A;  3CMY A;  1BL0 A;  4BXX J;  3SFI A;  2R5Y B;  1WI3 A;  1MBG A;  4W97 A;  2RAE A;  2M8G X;  5C3E J;  5EYR A;  4DYQ A;  3G1O A;  4D7M A;  4RBO A;  3G1M A;  2DN0 A;  4A3J J;  3IH2 A;  4BBS J;  1FJL A;  4DZJ A;  3SDG A;  4M3F A;  3GTG J;  3JRI A;  3RZO J;  3K2A A;  3BG3 A;  2YU9 J;  2DMP A;  3BR3 A;  2XPW A;  1ORK A;  3W6V A;  5F1J A;  1TWA J;  4XID A;  1MH3 A;  2NVQ J;  2JN6 A;  4HNV A;  2R5Y A;  3QPS A;  5F27 A;  5JLX A;  1LE8 B;  4M6V A;  2JA6 J;  3S2H J;  2XB0 X;  3IV5 A;  2K9N A;  1D5Y A;  3TP3 A;  4QTR A;  1WPK A;  4A3M J;  2E2H J;  4M3G A;  2DA1 A;  1ZK8 A;  2R93 J;  2IEK A;  2DA2 A;  3JRB A;  2VKV A;  4G12 A;  5EZG A;  3Q0V A;  2X6O A;  4D5C A;  1ZKG A;  2AHQ A;  2HXO A;  1VND A;  5FKK A;  4RDU A;  1POG A;  3M3Y J;  2K9S A;  2CJJ A;  2PMZ N;  4MFE A;  4JP0 A;  3PO3 J;  2DMT A;  1JT6 A;  1DU0 A;  1ZR4 A;  5EGO A;  2CU7 A;  1SFO J;  1WCM J;  1O4X A;  2X48 A;  1B72 A;  4DYR A;  5IP7 J;  3JRF A;  1H88 C;  3LSG A;  1JT0 A;  1LE8 A;  3HM5 A;  1JKO C;  3HDD A;  3HEF A;  3ZQC A;  2HDD A;  2Y2Z A;  3IH3 A;  1B8I A;  1MBJ A;  3VPR A;  1B72 B;  2MSY A;  3OIO A;  2WB1 N;  1IUF A;  1MBH A;  1Z77 A;  2JA5 J;  3NAU A;  3JRE A;  2LVS A;  2K9Q A;  2NS8 A;  4MIM A;  1HDD C;  2VKE A;  2ELK A;  1AHD P;  4BBR J;  3BR1 A;  3S14 J;  1ETY A;  1BJZ A;  5BNG A;  1VFC A;  1JJ8 C;  2ID3 A;  2G0E A;  3CCY A;  5FLV A;  3FKI J;  3BR6 A;  1IG7 A;  3S1Q J;  2WV1 A;  5IP6 A;  4XRS A;  4M3B A;  4XRS G;  3TW7 A;  2M0C A;  3S15 J;  4UUS B;  1UHS A;  2I10 A;  1U8B A;  1WH7 A;  5C4J J;  3BR5 A;  4B4C A;  1NK2 P;  1PUF B;  2JJ7 A;  5HOD A;  2R92 J;  3A01 B;  3GTO J;  3BTC A;  5EG0 A;  1RR7 A;  2MW8 A;  2KT0 A;  5J1R A;  1YRN B;  2EQR A;  2COB A;  3JRD A;  1JTX A;  2LR8 A;  2Y0S N;  5DS9 A;  2NVY J;  1AU7 A;  3ZQG A;  2NVT J;  1JTY A;  2B63 J;  2LY9 A;  1RKT A;  1HLV A;  3JRG A;  1BA5 A;  2GM4 A;  5J1U A;  3LSR A;  2O9L A;  5C4X J;  1X2N A;  3L1P A;  3Q3S A;  2HOS A;  5EF6 A;  1PUF A;  4A3D J;  3LSJ A;  2DJN A;  1Q1V A;  3BTJ A;  5F0F A;  3A01 A;  2DMN A;  2QCO A;  4FCY A;  2M34 A;  1JGG A;  2CRG A;  4A3F J;  4FE4 A;  1IGN A;  1SAN A;  4CYC A;  2XGC A;  2Y9Y A;  1ZGW A;  2HOT A;  2LP0 A;  3UKG A;  2DA5 A;  2GLO A;  2M2E A;  3I4N J;  2L0K A;  3NAR A;  1K61 A;  3A02 A;  4DW6 A;  1U78 A;  4S0H B;  2EBI A;  4MO7 A;  4C3J J;  2HYJ A;  2VUM J;  1G2H A;  1AKH A;  2R7Z J;  3E7L A;  2LTP A;  2P81 A;  5F0C A;  2E19 A;  3TP0 A;  1GV2 A;  2L9R A;  1A5J A;  2W48 A;  3HOW J;  2L7Z A;  5E3N A;  1ETV A;  4D7N A;  4AUX A;  2R5Z A;  2E1O A;  5FKM A;  5GPA A;  3B6A A;  4CYC B;  1OCT C; 
#chains in the Genus database with same CATH topology
 1JKR C;  2DQR A;  1YO5 C;  3CLO A;  1ETW A;  2CQQ A;  3GTP J;  3ESW B;  1QNT A;  2R7T A;  3TO7 A;  4C3H J;  2E36 A;  5DTD A;  2VQH A;  2DU9 A;  1P2F A;  4ETS A;  1A6Q A;  1TWH J;  2JWT A;  1SC7 A;  3M4O J;  4MLO A;  2DT5 A;  2OTL I;  1NHA A;  3MKZ A;  1J0R A;  1Y39 A;  1VI0 A;  3L00 A;  3HOX J;  3BCB A;  5ED4 A;  4EJV A;  5CKT A;  2VON A;  2EA2 A;  1OCR H;  3SZG A;  2R0Q C;  5J3L A;  2XAG A;  5TJJ A;  3GTQ J;  1A6I A;  5KAF C;  2YUS A;  3C2H A;  1Z0X A;  5FKO A;  1ZAO A;  2FX0 A;  3BQY A;  3I59 A;  3HOU J;  2HR3 A;  1QPM A;  2K3P A;  1U9N A;  1BR2 A;  2EZL A;  2P5V A;  5FKL A;  3QPT A;  3S2D J;  1O7F A;  5L3C A;  2NS7 A;  3TO6 A;  2DOE A;  5HS7 A;  4OIP F;  2BHZ A;  5CQE A;  4CA0 A;  3H9G A;  3KEY A;  4LG3 A;  1L0O C;  3T1B A;  5HS8 A;  4FQG A;  4EQQ A;  2XV4 S;  1SFU A;  1U3E M;  5E3O A;  4RB0 A;  3S16 J;  2V9K A;  3KYD B;  3WHB A;  1BM9 A;  1TNT A;  1XGN A;  2QSF X;  2BY0 A;  2OJE D;  3PNV A;  4GO1 A;  3ROU A;  1IN4 A;  5HDN A;  1BI1 A;  2M45 A;  1UCR A;  4X0G A;  1IV8 A;  1FOX A;  1IN8 A;  5ERI A;  1Y0U A;  3F6O A;  2DA3 A;  2EIJ H;  4BAY A;  3PO2 J;  2HTS A;  1HF0 A;  2HDW A;  3C2B A;  4LOC A;  1LDK B;  2YS9 A;  3TL4 X;  2NVU B;  2EIL H;  2DMU A;  4XLN F;  4QSH A;  3NQO A;  3N4M A;  3GZ6 A;  2FBK A;  3OY9 A;  3ONQ A;  1YIT I;  4XOT A;  1YTY A;  1DP3 A;  4BYY A;  4CCO A;  1IAW A;  1RRJ A;  4G94 A;  1WJ5 A;  1TWG J;  2GIV A;  2HQR A;  3ECO A;  3VOE A;  2I8D A;  3OWT A;  5FJ8 J;  4ENJ A;  3FXJ A;  3JSO A;  2BV6 A;  3M1C A;  1S6L A;  3S1M J;  1Z6T A;  4FX4 A;  4XKV A;  4M9X A;  1WWX A;  4BXU A;  2TDX A;  2ZBK A;  3WE2 A;  1CF7 B;  4ZZD A;  1UHM A;  2WY7 Q;  4OWR B;  4IZZ A;  1T08 B;  3ZRG A;  1H8A C;  4XON A;  1R49 A;  1HSJ A;  1IC8 A;  3CCU I;  5CVV A;  1IN6 A;  3IKV A;  3A0B C;  2LFB A;  2VPR A;  1LJ9 A;  4PUS A;  4AM3 A;  1BC7 C;  2CO5 A;  1I50 J;  4RA2 A;  4HNT A;  2H6B A;  2Y0S A;  3FXK A;  2ZME C;  2IXS A;  3RCO A;  1RNL A;  2Z9O A;  4B09 A;  4H0E A;  1I27 A;  2DJI A;  4YG2 F;  2H6C A;  1R5H A;  1ZH5 A;  2XGE A;  2DOD A;  3GCM A;  3ZMD A;  2ZJP F;  4HAM A;  2EZH A;  3EET A;  3VSK A;  4UV9 A;  4L5J A;  2VJ4 A;  4AYB N;  3ZQ7 A;  4L9J A;  3CCS I;  4HQM A;  2EFO A;  4XK4 A;  3JTG A;  4CIC A;  2QZ8 A;  1XPX A;  2A69 F;  1VQ4 I;  2XHK A;  4XLH A;  2HVR A;  3IC7 A;  3ZQF A;  2DMQ A;  2K9L A;  2HI3 A;  2GBY A;  1R71 A;  1ITY A;  3RYR A;  2EV6 A;  1IXR C;  5E1X A;  1L3L A;  2EZI A;  4KT5 C;  2FBH A;  4I0A A;  4EGZ A;  1O3Q A;  4LIV A;  3ZMS A;  1YI2 I;  2VKH A;  3HPG A;  3FWE A;  2GIZ A;  2HGC A;  5L3B A;  1I1G A;  3SEZ A;  4F3Q A;  2XAF A;  3VB2 A;  2DPD A;  2O5R A;  4BEH A;  5IT9 Z;  4A3I J;  4FE7 A;  5K5R A;  1QPI A;  4OMZ A;  4BQQ A;  3CCM I;  2DBB A;  1WZ2 A;  3L2Q A;  3MZH A;  4EM1 A;  2DTR A;  3L2U A;  2KKO A;  4M73 A;  1JUP A;  1ONV A;  1IN7 A;  4X6A J;  2MLG A;  1ZQ3 P;  1X4P A;  5LGN A;  2JT1 A;  4A3G J;  3KP6 A;  2R7O A;  3HIF A;  3O3K A;  3UR3 C;  5HNF A;  4KFC A;  4ABZ A;  4BE1 A;  3E5X A;  1I6H J;  1ZR2 A;  1NK3 P;  3DF8 A;  1R5G A;  2F5F A;  2NS0 A;  4EEF G;  2QVO A;  2XGD A;  3ULQ B;  1MDM B;  1RI7 A;  4XQF A;  5EJC A;  2K3F A;  3BZK A;  5DD8 A;  2F5E A;  3IWF A;  2HPM A;  1D8K A;  1YJN I;  2AXT C;  1VQ8 I;  1FP2 A;  1SFX A;  1RUO A;  4XBF A;  3U2R A;  2R5Z B;  3S17 J;  2OUM A;  2Y9Z A;  2M8E A;  1SD7 A;  3N97 A;  1IDZ A;  1E3O C;  1HQC A;  2XRL A;  3UNG C;  5GPC A;  1F43 A;  3H3U A;  2FQ4 A;  1DU6 A;  3K4C A;  3EUH C;  2HQ5 A;  2VB6 A;  4IHT A;  3T8R A;  1J75 A;  1XMX A;  1X4O A;  2A61 A;  4HBL A;  3OYB A;  4S04 A;  2OD5 A;  2OBP A;  2VIX A;  3BLY A;  1P4W A;  3F8B A;  3R0J A;  2JMW A;  1Q1H A;  1YJW I;  3ZXS A;  5F0H A;  2NRA C;  2VBX A;  3M9A A;  3VSL A;  2IGO A;  5B66 C;  2VOP A;  2VQL A;  2KJC A;  1JE8 A;  1TWF J;  2XUB A;  4LIU A;  4BY1 J;  2BW3 B;  1Y1W J;  2V6C A;  2GWR A;  3E6C C;  2PG4 A;  1B6A A;  4Z2Y A;  3T8T A;  3LFU A;  4PFP A;  4EV0 A;  3GFI A;  4AVZ A;  3E6M A;  2JPC A;  5TIS C;  4XMY A;  3B73 A;  5HOO A;  3KX2 A;  3M8F A;  5EZH A;  1D0Z A;  3QPH A;  2XF7 A;  3HXL A;  5CQG A;  4RB1 A;  3S3O A;  4BXX J;  2G9W A;  2IS2 A;  3CJT B;  1WI3 A;  1K7A A;  1DQU A;  4XN3 A;  5D5W B;  1TZL A;  4W97 A;  1Y6I A;  1I6X A;  2M8G X;  2L02 A;  2NNN A;  3A2K A;  3G1O A;  3C1D A;  1RUN A;  4RBO A;  2RRE A;  2DN0 A;  3BC8 A;  4F91 B;  4LD5 A;  2PQ8 A;  2RV8 A;  3FMQ A;  4ON0 A;  3SDG A;  1REP C;  3GTG J;  3I59 B;  2KLO A;  3BG3 A;  4XL9 A;  2B7E A;  3BR3 A;  2VXD A;  2P8T A;  1MKM A;  1R22 A;  1EKE A;  1QU3 A;  3PSF A;  2HZD A;  3RKX A;  1MH3 A;  3HPH A;  3QPS A;  1QA6 A;  3KP7 A;  3MEX A;  2F5V A;  1N78 A;  2K9N A;  4EM0 B;  3TP3 A;  5FRO A;  1WPK A;  1IXS B;  1GLN A;  2VQG A;  1MJB A;  4CCL A;  1F5T A;  2R93 J;  2DA2 A;  5CLS A;  1Z7U A;  1GXQ A;  2VKV A;  2ICW G;  2IPQ X;  2K4J A;  5EZG A;  2JTV A;  5KNL A;  1O57 A;  3AAF A;  1Z1D A;  3HL2 A;  2XDV A;  4CH7 A;  1A36 A;  3BJ6 A;  1PYV A;  3FMR A;  2W82 A;  1BI0 A;  3JAM K;  2VBY A;  4KIS A;  3K69 A;  4CCN A;  4MFE A;  5EGO A;  2CU7 A;  3IAM 2;  1K78 A;  2X48 A;  2LBF B;  3TBI A;  4DYR A;  4HDV A;  2ETH A;  1B72 A;  1LE8 A;  1PUE E;  3HEF A;  1CF7 A;  2OAZ A;  4XRF A;  3SFZ A;  3VPR A;  3DXJ F;  2LBF A;  1B72 B;  5GTH C;  1MBH A;  2R7Q A;  1SMT A;  3LMM A;  3MZY A;  3NAU A;  3HRT A;  2V6E A;  1LNW A;  4KIF A;  1KZH A;  3T5X A;  2L2O A;  3CMM A;  4MIM A;  4XKW A;  2ELK A;  4YEJ A;  3LSH A;  3ABK H;  3W2W A;  1ETY A;  4O6J A;  5BNG A;  5FD6 A;  1XGS A;  2VC0 A;  3CCY A;  5FLV A;  1IG7 A;  3I0T A;  4XRS G;  3D5S C;  2M0C A;  1FBS A;  4Y33 A;  4YEL A;  2AQF A;  3S3N A;  1XGM A;  3CZ6 A;  2EFQ A;  5L3F A;  3BR5 A;  2KL4 A;  2IS1 A;  2BY1 A;  2XF5 A;  4ENM A;  1TQI A;  3KEQ A;  3ZN0 A;  3GTO J;  1TBX A;  1X1B A;  3F23 A;  2G7H A;  2VKD A;  3BTC A;  3CO7 C;  1OKR A;  2MW8 A;  5LGT A;  5CPR B;  3HG9 A;  2JPB A;  3V42 A;  2W00 A;  4N9I A;  5FLX Z;  4TV7 A;  1K78 B;  4L0Y B;  3RJP A;  3RPU A;  4B8X A;  4U7D A;  3JRD A;  1U5T C;  1WQ2 A;  1JTX A;  4M9S A;  4OAZ A;  4RAY A;  2R7D A;  4D0P A;  3FKJ A;  4GGG A;  1AU7 A;  1JTY A;  2DDB A;  1KQ0 A;  2MA3 A;  2B63 J;  4R1H A;  3BG6 A;  4Y15 A;  3GZN B;  4Y4R A;  1BA5 A;  2HFH A;  5J1U A;  5ILV A;  1U2W A;  1ZG5 A;  4HRI A;  4MQV A;  2PMU A;  4OU0 A;  4F93 B;  2PJR B;  2HOS A;  1AWC A;  1WVR A;  1YS6 A;  3QP5 A;  3LSJ A;  4CDG A;  3A01 A;  1ZAR A;  1R36 A;  3CUO A;  4PGG A;  3VDX A;  2QGU A;  2IA0 A;  4JOM A;  5DUK A;  1T0F A;  1UEL B;  4XLE A;  2Y9Y A;  2HOT A;  3E6D A;  1KA8 A;  5ILS A;  3TKY A;  2NNY A;  4YIF A;  1UST A;  3L2R A;  3WG7 H;  2L0K A;  4J00 A;  4S0H B;  1VQ6 I;  1LVA A;  4EJU A;  2K5C A;  3G6E I;  1FBQ A;  2IA2 A;  4LK0 F;  1ZRF A;  3TP0 A;  2L9R A;  2L9V A;  2XAU A;  3QOE A;  4RM3 A;  1T0F C;  1F4K A;  2NOJ B;  5K1Y A;  1G3S A;  4AUX A;  3U9G A;  3VEP A;  1NH3 A;  2ZSI B;  3ELK A;  4HV5 A;  4E6K G;  3FIS A;  2GXA A;  1QO0 D;  3EDP A;  5E79 C;  3C18 A;  1FIP A;  3MWM A;  1LVK A;  2GXG A;  4RLQ A;  2B9S A;  1MBE A;  2DXI A;  1SD5 A;  4Y17 A;  2D2W A;  2K7L A;  5E3M A;  4F52 A;  3SHF A;  2V1X A;  2E1M C;  2CYY A;  1QGP A;  2ECB A;  1WJC A;  2GA2 A;  3K7A J;  1KU7 A;  5ILU A;  2X9D A;  2CV0 A;  5LRS A;  4XRM A;  2HU9 A;  3ECH A;  1MNM C;  3OOU A;  3E5U A;  4KIB A;  3ZOB A;  3CMA I;  2H8W A;  1JUM A;  2JVH A;  4NNJ A;  4XN0 A;  4DYC A;  3CQZ J;  1PJR A;  3DBR B;  1OYY A;  3EUK L;  4O3M A;  2LLK A;  3LQQ A;  3PNY A;  1MMN A;  5J47 A;  4BJ6 C;  4LLN A;  2CWE A;  2PMH A;  4U0V A;  2ZFU A;  3HRU A;  1SMY F;  3QOP A;  3CP8 A;  1BC8 C;  3I64 A;  3K0L A;  4FTH A;  4LB5 A;  2L54 A;  1KU2 A;  9ANT A;  3O8G A;  2HEO A;  2O6G E;  1WFX A;  1X1A A;  1FNN A;  3DEW A;  3TED A;  3FHZ A;  2OCE A;  1YW7 A;  2CGP A;  1X1P A;  5IPA A;  1CQT A;  4U0Y A;  2XB5 A;  2RQQ A;  3V7C A;  3LQR A;  5F08 A;  3S1R J;  4OAY A;  2CS3 A;  5M5X J;  3GTJ J;  3RI4 A;  2FQ3 A;  3FXL A;  1PP8 F;  2HS5 A;  1EH6 A;  3K10 A;  1I3A A;  4EMS A;  5FLX K;  3KIO A;  1SD6 A;  1E17 A;  2VXZ A;  2RVC A;  1W5S A;  2ZB9 A;  2CW7 A;  4BE2 A;  1LEB A;  2BY2 A;  2E1N A;  4CHU A;  3K4N A;  3PM1 A;  2BZT A;  3M7G A;  1S7A A;  5AON A;  1MMA A;  4QIW N;  3EPZ A;  3SZT A;  3OSF A;  2O7O A;  3I54 A;  3HZJ A;  3ZQI A;  4XLA A;  2DYS H;  4PK4 A;  5FFZ A;  5M3F J;  1FYL A;  2HOE A;  4A6E A;  1JKP C;  5J1Y A;  4ZC3 A;  5D5U B;  3CC7 I;  2KQR A;  2E2J J;  4M71 A;  4UNO A;  4IRI A;  1ZRD A;  1ZGJ A;  1SAU A;  4MTD A;  2WA0 A;  2JK3 A;  4OIQ F;  2DFE A;  2FNA A;  2LOO A;  2ID6 A;  3V8J A;  3OSG A;  1PDN C;  1V4R A;  4IF4 A;  4DJA A;  5J4Y A;  4G6D A;  2A6E F;  1H9T A;  3B6C A;  1XCV A;  2F4O B;  2X6Y A;  1HA8 A;  4A0X A;  5IOZ A;  3LAJ A;  2QKM B;  1FLI A;  3FXQ A;  1UFM A;  1ZG3 A;  5FD5 A;  1OYW A;  2DAO A;  3O8H A;  2QBY A;  1XG1 A;  3OL3 A;  4V2G A;  2WC2 A;  3TQN A;  1D5V A;  3JSP A;  1GVD A;  1IO2 A;  4I98 B;  2D1H A;  2JSP A;  1OCC H;  2VOO A;  4A3L J;  2XKO A;  1TNS A;  2D5V A;  2ZKZ A;  4RAG A;  3TOA A;  2RC4 A;  2HQA A;  1OJL A;  2IBD A;  4CZC A;  5GTI C;  3HOY J;  2LF8 A;  3MKL A;  3G73 A;  1UB9 A;  4BDZ A;  2EPF A;  3D1N I;  1S29 A;  3J7Z I;  2C6Y A;  3WGI A;  2LKX A;  3SYT A;  3PFI A;  1V54 H;  2Q2E A;  1WJF A;  3BTI A;  2KZV A;  5FGM A;  4Q47 A;  5IYC J;  5D8K B;  5DM6 F;  2L01 A;  2F5C A;  3ISP A;  1IW7 F;  2HTJ A;  2X6X A;  2XPV A;  3F3X A;  3H9Q A;  3ZN1 A;  2M1B A;  4A69 C;  4A3E J;  4BGD A;  1IN5 A;  5BS6 A;  1VQL I;  3K1M A;  4UUT A;  2AO9 A;  4BHB A;  3DV8 A;  4IKF A;  2AS5 F;  1S9H A;  4I99 C;  4IHW A;  2GOM A;  2FA5 A;  2G7U A;  4II2 A;  1P7I A;  1R9T J;  4ZTF A;  3QRF F;  2BGC A;  4PJJ A;  1IRG A;  1MJ9 A;  3OYD A;  1I3Q J;  2IT0 A;  1IRZ A;  3R0A A;  1FMV A;  4M3E A;  2FML A;  2ISY A;  3W2V A;  4GFB A;  5A2Q K;  3I71 A;  5E17 F;  2M0M A;  2OF7 A;  2J5O A;  3CUQ B;  5LGU A;  1QQI A;  3WTS C;  2J5P A;  3H92 A;  2TRT A;  4IHY A;  1S7O A;  1VQ9 I;  1AA7 A;  4NDL A;  1DPR A;  5JLW A;  5BMZ A;  2BY3 A;  3MKY B;  1D8J A;  6PAX A;  5DV5 A;  4PSX A;  1FMW A;  2HXI A;  2QA4 I;  2H8R A;  5LBQ A;  3QOD A;  4AIK A;  2ACJ A;  5E1W A;  4MTE A;  2H1L A;  3DP7 A;  1OMI A;  3FXR A;  2L4A A;  1JJ6 C;  4O5V A;  3PIP F;  4NQW B;  4CXF A;  2XPU A;  1XC5 A;  2ZXI A;  3H5R A;  4XNF A;  5LLQ A;  1TTY A;  4P96 A;  2D45 A;  3MZ8 A;  1MW7 A;  5K7H A;  3OV8 A;  1T56 A;  1GHC A;  1R4M B;  2HKX A;  3HYI A;  3HGY A;  3TW6 A;  2Y30 A;  3F8F A;  4HF1 A;  3J81 K;  4L5I A;  3Q9S A;  3CUQ A;  2V1D A;  3HSE A;  2H27 A;  1BW6 A;  2QQA A;  3LA2 A;  4IPA A;  3E97 A;  5AIP A;  5IYB J;  2V1N A;  5EG0 B;  2E5N A;  2Z1D A;  2NXN B;  2PN6 A;  3BPV A;  1YOV B;  4WWC A;  4PCQ A;  3CJR B;  2L9N A;  1LKX A;  4IRH A;  2MD0 A;  3E6B A;  3DCF A;  1EV7 A;  3A4C A;  4D5F A;  4LFU A;  1G3T A;  4PDK A;  2F5D A;  2MBF A;  2OV7 A;  4KYW A;  1X3U A;  1QVT A;  5D4R A;  4HNU A;  1U5T B;  3CC4 I;  1OR7 C;  2FJ1 A;  3OYF A;  4Z6Y A;  4JK1 X;  2DK8 A;  3BZC A;  1MDM A;  4BUP A;  1XS9 A;  2KIF A;  1ETX A;  3BG9 A;  3ASN H;  2KRC A;  2KRH A;  1ETK A;  3CCV I;  1GXP A;  4BEH B;  5LFA A;  5HLH A;  4J19 A;  2GAU A;  1YYV A;  2DFI A;  2OTJ I;  3FK7 A;  3PFY A;  2EK5 A;  2DOA A;  4ENN A;  2HQN A;  1MBK A;  3WTT C;  1R7J A;  1B8I B;  4JBA A;  1ZRE A;  4H4K C;  2WAQ N;  3CMY A;  5LD2 C;  2Y69 H;  4GYI A;  1EH7 A;  2A6T A;  2XRO A;  3NRV A;  1FSH A;  1MBG A;  2PX9 A;  3KCC A;  3B02 A;  2ZME A;  4DYQ A;  2ELH A;  5JVT A;  2Z2S B;  3OYE A;  2L5Q A;  3OYG A;  1U8R A;  4RM2 A;  3TOB A;  3JRI A;  1I39 A;  2AXL A;  4HA8 A;  3K2A A;  2YU9 J;  2DMP A;  3CJQ B;  4F7Z A;  2XPW A;  3RPU D;  4XM3 A;  2LY1 A;  2KIM A;  2Q0O A;  4XID A;  2NVQ J;  4EVI A;  2JN6 A;  4RMN A;  1E2X A;  1LQ1 A;  2R5Y A;  1LE8 B;  1UZC A;  5KVR A;  5HLT A;  3WTW C;  4HPQ A;  3DU6 A;  1KYZ A;  4B47 A;  2XB0 X;  4AD9 A;  1XMA A;  4MGR A;  3GF2 A;  4QTR A;  3J7A O;  4A3M J;  2ISZ A;  4M3G A;  1UAA A;  1ZK8 A;  1YQA A;  3JRB A;  3L7W A;  1P92 A;  3LSM A;  3M8E A;  3Q0V A;  5E8I A;  1BIA A;  2AHQ A;  2HXO A;  3KZI C;  1ZG1 A;  1V5F A;  3F72 A;  5FKK A;  1WJA A;  1Z6R A;  4KIG A;  2K9S A;  2W1O A;  3WTY C;  2CJJ A;  2MC4 A;  2FE3 A;  4ZYH A;  4JP0 A;  4XOR A;  3HSR A;  1SFO J;  1XSX A;  1X1C A;  1O4X A;  2EIK H;  4BHP A;  5IP7 J;  3JRF A;  1JT0 A;  3LSG A;  2W4S A;  2W57 A;  2UV1 A;  3HM5 A;  1JKO C;  1ZYR F;  4ESB A;  2E1C A;  1H9G A;  2RN7 A;  1R58 A;  2Y2Z A;  1Z91 A;  4C30 A;  4AID A;  1ZN2 A;  3KE2 A;  5B5E C;  2MYS A;  1IUF A;  1Z77 A;  2JA5 J;  4EJO A;  4B43 A;  4U0W A;  1JHH A;  1F9N A;  5KHD A;  2PLY A;  3E3V A;  1LDJ A;  4MNU A;  3RDI A;  1DPU A;  3PQK A;  1SFK A;  3C3W A;  2K9Q A;  1UHW A;  1HDD C;  4DOZ A;  1FWZ A;  4UV8 A;  2MC3 A;  1OCO H;  3S14 J;  1KQ8 A;  4E70 A;  3ERM A;  1Z3X A;  5IY5 H;  2G0E A;  3ERE D;  5F1R A;  3BR6 A;  1MMG A;  4XRS A;  1FOK A;  3M07 A;  2HVQ A;  4RB3 C;  2Y75 A;  1U8B A;  5C4J J;  3OS1 A;  2DPU A;  1G8X A;  4LB6 B;  2BXZ A;  4Q4Z F;  1YFH A;  1PUF B;  2A68 F;  4Y13 A;  2R92 J;  3A01 B;  3RPQ A;  1N75 A;  4CCK A;  2KT0 A;  5J1R A;  2HPI A;  2MFZ A;  3FM5 A;  3WTU C;  4V19 K;  2KMU A;  3W3C A;  1KQ9 A;  4OOI A;  3RYP A;  1LUJ B;  3SXY A;  4HOB A;  5DYM A;  3CCR I;  5DS9 A;  2NVY J;  3NEU A;  3DTK A;  3ZMZ A;  2NVT J;  3CME I;  1YX3 A;  3P9K A;  4M72 A;  3JRG A;  2CG4 A;  3CF2 A;  2GM4 A;  3GLL A;  5D5X B;  4WXC A;  3GUD A;  2Y0M A;  1X2N A;  2BYV E;  3Q3S A;  4E7I A;  2CQ7 A;  4P55 A;  4LMY A;  2P7V B;  1PUF A;  3CTA A;  3C2G A;  5J8C A;  3BTJ A;  3LWF A;  4I7H A;  2DMN A;  3GME A;  2QCO A;  1J09 A;  1V3F A;  2UUZ A;  4G6T B;  3R6S A;  4Q5S F;  2CRG A;  3OYM A;  4CCM A;  3OYI A;  1IGN A;  1SAN A;  1HKQ A;  5H20 A;  2PJR A;  3D0S A;  3S3M A;  1FBU A;  2STT A;  4E7H A;  3D5R C;  3UKG A;  4BJ5 C;  2DA5 A;  2GLO A;  2ZXJ A;  1SAX A;  3NAR A;  2VLA A;  3QYE A;  4BQO A;  4CCJ A;  4NBQ A;  1SEU A;  1BR1 A;  1IRX A;  5J6X A;  2EBI A;  2K02 A;  4E7S A;  3F21 A;  1G2H A;  3PNT A;  2ESH A;  2LTP A;  5F0C A;  4L9V A;  4C2T A;  4L0Z B;  5GAG J;  3O2P E;  1N77 A;  1R1V A;  5E3N A;  4OIR F;  1ZLK A;  1ETV A;  5GPA A;  3B6A A;  1DDN A;  2WAE A;  3Q9V A;  1Y56 A;  2FNP A;  3TDZ C;  1Z9C A;  3HKZ A;  2CW0 F;  5B1A H;  5M3M J;  3HC7 A;  2L3D A;  2UXX A;  2O3F A;  4G8X A;  3GTL J;  1AKH B;  2LMD A;  1IJW C;  5M5Y J;  2QLZ A;  1P4A A;  1OFC X;  4BH9 A;  1F36 A;  4HSR A;  2Y48 A;  4R79 A;  2GOX B;  1HW5 A;  1TW2 A;  3DWL E;  4NB5 A;  4ASN A;  4I2O A;  2PJP A;  4ESF A;  5K5O A;  1QHG A;  3DEE A;  4HF0 A;  4FAS D;  3W2A A;  1K4S A;  1GUU A;  3F8C A;  2FU4 A;  3Q0U A;  1VQN I;  5FFX A;  3LOC A;  1MBF A;  1Y1V J;  3K6G A;  3OIP A;  5DDG A;  1WH5 A;  1TC3 C;  2QQ9 A;  2WB1 A;  3GW2 A;  2XSD C;  3E5Q A;  3QP6 A;  2LC2 A;  4LJZ F;  3KLN A;  3ZGK A;  3VFZ A;  4UVA A;  2NOG A;  4AYB A;  3PSI A;  1X2M A;  3C7J A;  3G3Z A;  4BDY A;  1WI9 A;  5JR3 A;  3BP8 A;  4JX6 A;  4YII A;  4Y7N J;  3OYC A;  1MIJ A;  1WJB A;  2XVC A;  2M7A A;  1NG6 A;  1YS7 A;  2FOK A;  1ZTR A;  1KYW A;  4NC6 A;  2FMY A;  2L7F P;  3LSI A;  1D1B A;  1OQY A;  1RET A;  1WJD A;  3GFM A;  1V55 H;  2RNJ A;  5ICC A;  5E8G A;  4IL6 C;  3I55 I;  1RC9 A;  4IHV A;  1Y8Q B;  4PFO A;  1HKT A;  3I4M J;  4GXO A;  2A5Y B;  2VT3 A;  1A04 A;  4BL0 B;  3IL2 A;  1LFU P;  4L9T A;  2V1U A;  4WF2 A;  2AQE A;  2H94 A;  2CQX A;  2LF7 A;  4I6Z A;  2CV2 A;  3QPL A;  1GDT A;  1ODD A;  5IP9 J;  1T38 A;  2HOA A;  1HBX G;  2F6C A;  1STZ A;  3SJM A;  4KJZ A;  2X51 A;  4UB6 C;  1YHQ I;  1HC8 A;  3IUO A;  4DNC A;  2Z99 A;  3CLQ A;  3GZ5 A;  2JA7 J;  2DDA A;  2Y31 A;  4G9Y A;  3ZMT A;  5CVR A;  1FOY A;  1J2X A;  2O0Y A;  1D3Y A;  5DEQ A;  3A03 A;  2PMZ A;  2EH3 A;  4HEA 2;  1ERD A;  5J8F A;  3GFJ A;  3S1N J;  1UJ8 A;  2FD5 A;  4LGW A;  2E60 A;  2KZG A;  3JRH A;  1APL C;  1YW8 A;  3QQA A;  2A6H F;  2HZT A;  1EF4 A;  2XAJ A;  5D6F A;  3TMO A;  4EM2 A;  5IOY A;  3GO5 A;  3OIQ A;  3ABL H;  3HBL A;  4DGW B;  2LKS A;  1JKQ C;  4D9J A;  2E35 A;  2LDU A;  4ESJ A;  3BJA A;  3HOV J;  1FEX A;  2ZCW A;  2Z33 A;  2E71 A;  3H3V K;  1K6O A;  2W24 A;  5FKN A;  2QM3 A;  4P9F A;  3LFK A;  4ZTJ A;  2VQC A;  1R1T A;  2A05 A;  2MG4 A;  1TQM A;  4M74 A;  4IJA A;  1IDY A;  1R1U A;  4XLF A;  2EFP A;  3GXO A;  3JW4 A;  3I5U A;  3K4K A;  2Z16 A;  1OLT A;  2DFF A;  2M4G A;  1JXS A;  3IWZ A;  2XAQ A;  3DKY A;  3R60 A;  2LD5 A;  2JZY A;  2HNH A;  2KPM A;  2IVM A;  1O3T A;  1R00 A;  4FET A;  1LFP A;  3LST A;  3K4B A;  3CDI A;  4KN4 X;  3DBL B;  3RSN A;  1MD0 A;  4II3 A;  1S7E A;  2OZ6 A;  1YRN A;  2XC7 A;  3F22 A;  3FBI B;  3DTE A;  3QYF A;  2XAS A;  2LYC A;  4E7Z A;  1KU3 A;  1IZ1 A;  2ZFW A;  4JX5 A;  2IGM A;  3ABU A;  5KAI C;  3HJE A;  1LB2 A;  1QZZ A;  2CUE A;  1BOA A;  3L2W A;  4N4O B;  5IYD J;  3MFK A;  1XSD A;  4ZZL A;  1R5I D;  2HWV A;  2JA8 J;  3MVP A;  1OCP A;  3BR0 A;  5JVG F;  2VOD A;  2GQQ A;  1WSU A;  3P9I A;  1FTZ A;  4B3A A;  1ENH A;  2FOW A;  2E7W A;  4XOP A;  3U1K A;  1H89 C;  4W1U A;  2R3S A;  2KIU A;  3RKW A;  2LNB A;  4S05 A;  4XLP F;  2W25 A;  1Z05 A;  4PJL A;  3OS0 A;  5A2Q Z;  3CD6 I;  2KDO A;  5FRN A;  3HKZ N;  4N0B A;  2XRN A;  3BTL A;  1X1D A;  3VYR B;  1BW5 A;  4ZDP A;  1KGS A;  2ECC A;  2TCT A;  3DFG A;  2FF4 A;  2WAD A;  1JHF A;  5LHG A;  4NQW A;  4RB2 C;  5EEA A;  5JI6 A;  3OYK A;  2CFX A;  5K7F A;  1JI8 A;  4IHX A;  3AG1 H;  1WGX A;  5K7Z A;  2R7V A;  2JUC A;  5K5Q A;  5D5V B;  1DUX C;  2K9M A;  1MZB A;  3LA7 A;  3MKW B;  3FF5 A;  1LEA A;  1P9Q C;  3H5A A;  3SDB A;  2DA6 A;  4I02 A;  3RTR A;  2GXB A;  1RPW A;  4RGR A;  3BRO A;  4B44 A;  2V7F A;  4I0B A;  5D8L B;  3MAJ A;  4ZH4 F;  3ASO H;  2LRD A;  1W5T A;  5HDK A;  4WCG A;  1W7P A;  2L7K A;  3PL8 A;  2CMP A;  2ME6 A;  5LEJ A;  3CCQ I;  3ZCO A;  4YFK F;  5HVQ C;  1XDS A;  4N9H A;  3ZQH A;  1CGP A;  1R6R A;  3BJO A;  3H36 A;  4A6D A;  3DBH B;  4YRV A;  3ZQQ A;  2KIS A;  3ZQL A;  2OU2 A;  2EA4 A;  2R7U A;  1IXC A;  2OCC H;  1BBY A;  1HCR A;  3NWT A;  3MQ0 A;  2LH9 A;  1OPC A;  3F8N A;  2VJ5 A;  4KDP A;  1W1W E;  2EIN H;  2K86 A;  3HB9 A;  3ZR8 X;  5J4V A;  3RQI A;  5F6F A;  1C0W A;  3SEQ A;  1G4D A;  2VPL A;  3BG7 A;  4HX4 A;  4I09 A;  5GP9 A;  4BY7 J;  3LSP A;  2IRF G;  3FM3 A;  3V8L A;  2V26 A;  1BL0 A;  3SFI A;  3BCA A;  2R5Y B;  2CUJ A;  4M6Y A;  3EYI A;  2YX7 A;  2KRF A;  2DT7 B;  2F4I A;  4WXD A;  4YIR X;  3FDY A;  1XMK A;  4PZJ A;  3WTZ A;  2QYO A;  5EYR A;  4D7M A;  3U1D A;  2V4J C;  4BBS J;  2LSO A;  4UVC A;  4DZJ A;  2JRT A;  3FBN B;  4L9N A;  3IAS 2;  3I56 I;  1SVL A;  2X4H A;  4YFX F;  1ORK A;  1HW1 A;  3W6V A;  4CZZ A;  3H1C A;  4KMU X;  3PIO F;  2LY2 A;  4RAF A;  3CCE I;  2BE5 F;  2R7R A;  1BR4 A;  3KPH A;  3IP4 B;  2WAF A;  1P6R A;  2EV5 A;  5JLX A;  4M6V A;  2JSC A;  5CVI A;  3I58 A;  3S2H J;  3AG3 H;  5BPD A;  1D5Y A;  2CQN A;  2E2H J;  2DA1 A;  3I4P A;  3DPT A;  3CES A;  1ON1 A;  2IEK A;  1EJ9 A;  5HLG A;  2KIQ A;  2W85 A;  1ZRC A;  1TLH B;  1LDD A;  2DYR H;  3K9T A;  4ZDO A;  2X6O A;  2ZNZ A;  4D5C A;  1ZKG A;  4BAC A;  1VND A;  3CUQ C;  2CV1 A;  4KMF A;  1POG A;  3H5N A;  3M3Y J;  5H2F C;  1R4N B;  2NAZ A;  3JAM Z;  2M30 A;  2O8X A;  2OQR A;  4G7O F;  1VQP I;  2MAB A;  1Y8R B;  2DMT A;  1JT6 A;  1DU0 A;  1ZR4 A;  4PSW A;  1DGR M;  3U21 A;  1BIB A;  2VC1 A;  1H88 C;  3K4M A;  4DBQ A;  4KA4 A;  3HDD A;  3ZQC A;  2LRE A;  3KEO A;  4E7L A;  1B8I A;  4A2U A;  4HG2 A;  2MSY A;  1J5Y A;  3CDH A;  4RS8 A;  1T6S A;  2FRH A;  1JGS A;  2R7X A;  2KHM A;  3O6B B;  2WTE A;  1EA3 A;  2R4G A;  1G3W A;  2Q1Z B;  3R61 A;  1J59 A;  1AHD P;  1MGT A;  1YJ9 I;  2ZC2 A;  5HDG A;  4BBR J;  5D4S A;  1BJZ A;  2D1V A;  3J80 K;  4UB8 C;  2LKP A;  2PI0 A;  2OZU A;  2WV1 A;  5IP6 A;  4P5O A;  4M3B A;  5ICF A;  2UWM A;  3S15 J;  4UUS B;  2I10 A;  2OA4 A;  3Q5F A;  1HW2 A;  1FC3 A;  1WH7 A;  4NUB A;  4B4C A;  3DPU A;  2XKP A;  4YFN F;  2DK5 A;  1J9I A;  2O03 A;  1TL8 A;  5D6E A;  3HUG B;  1NG7 A;  2M4K A;  1ZEL A;  4XSX F;  3KP5 A;  3HRS A;  2QBY B;  1Z67 A;  1YRN B;  4E7J A;  3OYL A;  5ICG A;  4OMY A;  2COB A;  2LR8 A;  3DTI A;  3PUF A;  5L3D A;  2Y0S N;  2P4W A;  2EWN A;  3ZQG A;  1PVE A;  3RQ4 A;  4L18 B;  1VZ0 A;  3V7R A;  2RKH A;  2IS4 A;  1RKT A;  3OOP A;  1A35 A;  2IS6 A;  5C4X J;  3L1P A;  1X3Z B;  1G3Y A;  3OR2 C;  5EF6 A;  3COA C;  1G59 A;  4A3D J;  2DJN A;  3EUH A;  3KLO A;  5F0F A;  2F4M B;  2QKL B;  4FCY A;  1JGG A;  1S8N A;  2DW4 A;  3HUG A;  3BOQ A;  3A1Y A;  2ZJQ F;  3N05 A;  3VYU B;  2VJJ A;  4Y3O A;  3OYH A;  4BE0 A;  5CVU A;  4XLC A;  1ZGW A;  4AWX B;  2LP0 A;  3HSF A;  1B1B A;  1D1C A;  2M2E A;  2BVL A;  1YW9 A;  2CW8 A;  3P7N A;  1S72 I;  2O61 A;  1MND A;  1K61 A;  3A02 A;  3MD2 A;  2QWW A;  1XDU A;  2HYJ A;  1AKH A;  2EB7 A;  3BPX A;  3E7L A;  2R7Z J;  2Q8K A;  2P81 A;  4B48 A;  3T0Y A;  4RGU A;  1GV2 A;  3GLX A;  1KON A;  2DLL A;  1HXD A;  1QZY A;  2L7Z A;  2YR2 A;  2M3A A;  3LL7 A;  4D7N A;  3J7A Y;  2R5Z A;  2E1O A;  5FKM A;  2VL8 A;  3TDU C;  4CYC B;  1XSV A;  5F64 A;  4GRI A;  5KCM A;  2ZSH B;  3CCL I;  1ACI A;  2X0L A;  1W0U A;  4FIS A;  3REO A;  2WAQ A;  3AKZ A;  1O7L A;  3HRM A;  3WE3 A;  3LNQ A;  1GV5 A;  4EJW A;  4G7Z F;  1RR8 C;  4J01 A;  4AVP A;  4DZP A;  3EYY A;  2PBI A;  4U88 A;  4V2F A;  3S93 A;  4DIQ A;  1QZE A;  2P0W A;  3KP4 A;  3Q0W A;  3SZP A;  4FX0 A;  2X85 A;  5DCM A;  4HV6 A;  5B1B H;  2CUZ A;  3FIW A;  3WOD F;  1VQM I;  2IGN A;  2X6W A;  2HYF A;  2GZW A;  2O8K A;  1E3H A;  3DQV C;  3IKT A;  1K6Y A;  1QVU A;  1W5C C;  4I01 A;  4HDU A;  4XR6 A;  1B59 A;  1X3W B;  1ZGA A;  5TGT A;  2GA1 A;  4NC7 A;  3H3Z A;  1ON2 A;  1XTA A;  1W7P B;  2IGK A;  3P9C A;  4A3C J;  4LLG F;  3KZZ A;  3ABM H;  1SFE A;  1XN7 A;  1WHU A;  1T8I A;  3F8M A;  1BJA A;  1XD7 A;  4P1W A;  1MNE A;  4C2M J;  3BZ6 A;  3HOT A;  3AL0 B;  4JX4 A;  1ETQ A;  2JRM A;  2MD5 A;  1S5L C;  4QWQ A;  5HNH A;  3OL4 A;  2Z5U A;  2ADU A;  3WU0 A;  2X1C A;  3JRC A;  4BQA A;  3IHU A;  3FXM A;  3CC2 I;  3GTK J;  4BU2 A;  4MFD A;  1UG0 A;  4BNC A;  4CGZ A;  1D0Y A;  2VE9 A;  1S3J A;  1VTN C;  5C44 J;  3FK6 A;  1D1A A;  4IVN A;  2CUF A;  2BBY A;  3KYL A;  1DGW Y;  2LK2 A;  3LAP A;  2H1K A;  1W0T A;  3KZY A;  4HLY A;  3HHG A;  1GT0 C;  1VQO I;  5EGO B;  1YLF A;  2DA4 A;  5E20 A;  3AL0 C;  1K83 J;  3K4L A;  4HQE A;  2BW3 A;  1SVO A;  1FTT A;  4I76 A;  3MN2 A;  3F0C A;  2RNG A;  4AU7 A;  4RLF A;  5E3L A;  3VYT B;  1UMQ A;  2DQL A;  3H0D A;  2KDZ A;  2EFW A;  1U9O A;  4LIT A;  4G6Q A;  2EIM H;  1QRY A;  3ZMU A;  1VQ5 I;  4Y52 J;  1D0X A;  5M5W J;  3GX4 X;  4OIO F;  3CP2 A;  4AC0 A;  2XAH A;  4M3D A;  3IH4 A;  2DOF A;  1Z21 A;  1XCB A;  1T95 A;  4WXH A;  3FXU A;  2WBM A;  4F92 B;  3MMY B;  3H35 A;  2L7M P;  3HHH A;  2MGQ A;  3BT9 A;  3OMY A;  1TWC J;  4XSZ F;  1XGO A;  3X2Q H;  4XKC A;  1O3S A;  4IHS A;  1ULY A;  4QPO A;  4BKX A;  1Y0N A;  4EGY A;  3A0H C;  4MQ9 F;  3BR2 A;  3RIR A;  4UXN A;  3QU3 A;  2ESN A;  2A07 F;  1K4T A;  4E4H A;  1KU9 A;  4A0Z A;  1RIO H;  4KNY A;  3KFW X;  5FRM A;  4XIC A;  3HOZ J;  2STW A;  4F55 A;  3TGN A;  3PQJ A;  2QQB A;  1JUS A;  4PJN A;  3DEU A;  3ZMV A;  3JRA A;  2K27 A;  1M1E B;  1RES A;  3G1L A;  2QF7 A;  3AG4 H;  2VT2 A;  4RGS A;  2P5K A;  2Q2E B;  3D5L A;  2H09 A;  3RZD J;  2F2E A;  2ZJR F;  2OC6 A;  3E0J B;  2E7X A;  5FLM J;  3FXO A;  3L2V A;  1MSE C;  4A5N A;  2EJR A;  2IAI A;  4C3I J;  2CH0 A;  5GAH J;  3M8J A;  3PJR A;  2EFN A;  2RDP A;  5BOX A;  3QWL A;  2FBI A;  1UG2 A;  2M7B A;  3K1P A;  3WU1 B;  4CYD A;  1U0J A;  4ZYG A;  5GAE J;  1FYM A;  2PEX A;  2ME0 A;  4HF2 A;  1T33 A;  1T98 A;  4AIJ A;  3WGG A;  4KT6 A;  4IX7 A;  2DT6 A;  3GFL A;  2M9H A;  1U6G A;  4B1R A;  3WTX C;  1I5Z A;  4X1E A;  3TO9 A;  2K40 A;  2I5U A;  1TP4 A;  2FSW A;  4UUS A;  1HDP A;  3H9J A;  5HLI A;  3CCJ I;  4XKB A;  3BQZ A;  3RKY A;  2VJI A;  1QBJ A;  5EEG A;  1AOY A;  2IA1 A;  3W6J B;  2QUF A;  2P6T A;  2NVX J;  1YX5 A;  1Z7L A;  3DU5 A;  1FY7 A;  3I3L A;  3VYS B;  4M9Z A;  5F04 A;  4QPQ A;  5EDN A;  4ANJ A;  3L09 A;  4L5E A;  4P9U A;  4ZDL A;  2ZNY A;  1FX7 A;  4A3K J;  2RQP A;  4IRG A;  4U87 A;  4A3B J;  3H0G J;  2EZK A;  2QSG X;  3ABT A;  4IO9 F;  2CSO A;  1NTC A;  3QAH A;  1W36 D;  4A93 J;  3RKQ A;  5H6R A;  3HGG A;  4IQJ A;  3P5J A;  4MEX F;  3DKW A;  1HKS A;  1TT5 B;  2L4M A;  2QEX I;  2DTZ A;  2OPT A;  1HOM A;  3WTV C;  1RKW A;  3BY6 A;  3HOS A;  2DA7 A;  2YX4 A;  3ZPL A;  1P4X A;  4AIH A;  3KET A;  3CO6 C;  1MSF C;  2F48 A;  2XIG A;  3L9F A;  3V4G A;  3BWG A;  5B3S H;  3K4J A;  2QQ8 A;  4LG0 B;  2UXN A;  3V7S A;  4IQ4 A;  4ZYE A;  3GTM J;  4N4N B;  4LLL A;  4UUV A;  5H6Q A;  1IV6 A;  3GBG A;  2PFB A;  3W6K B;  1MH4 A;  3HTU A;  1BI3 A;  2L9S A;  4HYE A;  2JUG A;  1X58 A;  1V5E A;  2BOL A;  4BQN A;  4B3X A;  3CDL A;  3OR1 C;  3DLL F;  1LPQ A;  4GDF A;  1A31 A;  2A5W A;  1O3R A;  1IF1 A;  1WKM A;  1IRF A;  1VF9 A;  1T2K A;  1ETO A;  2JVG A;  4C9Y A;  1LFB A;  4JQF A;  3BG5 A;  1WJE A;  4KIC A;  1FIA A;  5AIQ A;  4QLC U;  5JHU A;  2E2I J;  3R4K A;  2N8G A;  2WY8 Q;  4M6X A;  1VQK I;  3OS2 A;  5IT9 K;  4PGH A;  1OR7 A;  1YG2 A;  2BVM A;  3I53 A;  1P7J A;  2UZK A;  2ZO4 A;  4HST A;  4KN7 X;  4Q48 A;  2YU3 A;  1OIS A;  4K2E A;  2VI6 A;  2KJB A;  5CYV A;  4IEJ A;  3JR9 A;  3F6V A;  1XB4 A;  4R8H A;  2WWY A;  2YSR A;  3DLA A;  3LSK A;  5LHH A;  2R7W A;  3VOD A;  3PUB A;  4JYK A;  2ZME B;  3WHC A;  1VQ7 I;  2VBW A;  4KIT B;  4HX8 A;  3ML6 A;  4IOA F;  2V9P A;  3F9K A;  1TW3 A;  2XGX A;  1FSE A;  2RAE A;  5DCF A;  3HTS B;  1E0E A;  5C3E J;  3FMS A;  2RGV A;  4LG0 A;  5JFR A;  3GWZ A;  1IUY A;  3CF5 F;  4FHT A;  3AFH A;  3G1M A;  3K70 D;  4A3J J;  3IH2 A;  1FJL A;  3AG2 H;  4RGX A;  1XX5 A;  1HST A;  3KP3 A;  3J81 Z;  4ZYA A;  4IOC F;  1RZ4 A;  3S32 A;  4M3F A;  1PP7 U;  1H0M A;  4NHJ A;  3RZO J;  1R23 A;  5GAD J;  5F1J A;  1USS A;  3L2C A;  1FYK A;  1G6N A;  2K4B A;  1TWA J;  2R7F A;  3GYH X;  3FHN A;  4HNV A;  1ZLJ A;  4IXA A;  2FXA A;  5F27 A;  1K79 A;  3KYC B;  3WG9 A;  2QSH X;  4D1Q A;  4DQ2 A;  2JA6 J;  2P6S A;  3IV5 A;  5L3E A;  3E1S A;  1FP1 D;  4BJT A;  5DD4 A;  2CFO A;  3M1E A;  2ELJ A;  4G12 A;  3GVA A;  5LRR A;  2BXY A;  5DCM B;  4BHC A;  3G71 I;  1FOW A;  2K85 A;  4BXF A;  2FUG 2;  1YIJ I;  4ITV A;  4RDU A;  1FZP B;  1MJA A;  1SVM A;  5ICE A;  3I9V 2;  2JA2 A;  3OYA A;  2PMZ N;  4CSW A;  2MH2 A;  1SD4 A;  3PO3 J;  2E1M B;  3G2B A;  5CVJ A;  1WCM J;  5TRD A;  2P7C B;  4GCV A;  1E3P A;  4ZYD A;  3KP2 A;  3S2W A;  2VAS A;  5KK1 A;  1X19 A;  2KP6 A;  2P5L C;  5LHI A;  2HDD A;  5E1Z B;  2V79 A;  3IH3 A;  1MBJ A;  3BDD A;  1ZHF A;  2XF6 A;  3S8P A;  3OIO A;  2WB1 N;  4EJT A;  5HS9 A;  2NYX A;  1MMS A;  1T39 A;  1B4A A;  2DI3 A;  1F1Z A;  3WU2 C;  1FT9 A;  2KFD A;  2OQG A;  2MLK A;  4HLX A;  2HKO A;  4G7H F;  4U7B A;  3JRE A;  1GVJ A;  1YIO A;  2LVS A;  2X1E A;  2NS8 A;  1BI2 A;  1MMD A;  4PJM A;  2M87 A;  3K70 C;  2VKE A;  3J7Y J;  3IRQ A;  3QU6 A;  5LEK A;  3BR1 A;  3J80 Z;  3SQN A;  2BEO A;  4UY8 I;  1WRJ A;  1VFC A;  1JJ8 C;  2ID3 A;  3ZP5 A;  3FKI J;  3S1Q J;  1FPQ A;  4CO8 A;  3TW7 A;  2EV0 A;  2VN2 A;  1UHS A;  5BQT A;  1B9N A;  2DCE A;  3FX3 A;  4WX9 A;  1NK2 P;  5EEH A;  5CJ9 A;  4ZJZ A;  1TT0 A;  1YE9 A;  4NC8 A;  2JJ7 A;  5HOD A;  5L3G A;  4EAT A;  3IRR A;  1OYI A;  4HZF A;  2YPR A;  5EG0 A;  1RR7 A;  4OIN F;  1QHH D;  2Z3Y A;  3QYB A;  3VWB A;  4A12 A;  3G4S I;  5FO5 A;  5DUI A;  2W84 A;  2VE8 A;  2EQR A;  4HX7 A;  1W36 C;  3NWS A;  2R7S A;  4LK1 F;  5E18 F;  3LA3 A;  4C2U A;  2COM A;  2DFH A;  2E5Z A;  1BN5 A;  1B9M A;  4CUG A;  2W7N A;  3DKX A;  2IP2 A;  2M5W A;  2V9V A;  1W4M A;  5J40 A;  2LY9 A;  1U5T A;  4A0Y A;  1V5G A;  3V8K A;  4A5M A;  1HLV A;  3EUA A;  2IW5 A;  3MCZ A;  4MHG A;  2ZXH A;  3GEZ A;  1DP7 P;  2XSJ C;  3LSR A;  2O9L A;  2ZJ2 A;  4UHT A;  1TQP A;  5BPI A;  5JHF A;  1Q1V A;  4PJ0 C;  3DPL C;  1N25 A;  2M34 A;  4A3F J;  3JCU C;  4FE4 A;  4CYC A;  1J7K A;  2HYG D;  2FEZ A;  2XGC A;  3OYJ A;  2HVS A;  2E34 A;  2JQ7 A;  3I4N J;  3OYN A;  3CJN A;  3EQL F;  4KUM A;  2BHY A;  4BS9 A;  4GYG A;  4FT8 A;  4DW6 A;  1U78 A;  1W7P D;  2VBZ A;  2DO7 A;  4MO7 A;  5DM7 F;  4C3J J;  2WV0 A;  4WK8 F;  2VUM J;  4E7K A;  2X1D A;  2B0L A;  4RAZ A;  2QEN A;  2E19 A;  4MEY F;  4HW0 A;  3JTH A;  4DBR A;  2HDC A;  1OCZ H;  4ENK A;  2ZXW H;  3FZV A;  2CQK A;  5IT3 A;  1A5J A;  3K1N A;  2LG4 A;  1BOB A;  2W48 A;  3HOW J;  2MH9 A;  1I1S A;  1Z3Y A;  2IJL A;  3K2Z A;  3WGH A;  1OCT C;  4UVB A;  2A3S A;  1EH8 A;  5FB2 A; 
#chains in the Genus database with same CATH homology
 3FIS A;  1W0U A;  1JKR C;  4FIS A;  1ETW A;  2CQQ A;  3GTP J;  1FIP A;  5M3M J;  3LNQ A;  1MBE A;  1GV5 A;  4C3H J;  5DTD A;  3GTL J;  5E3M A;  1AKH B;  1IJW C;  4DZP A;  1TWH J;  2JWT A;  4V2F A;  3M4O J;  2ECB A;  4MLO A;  3Q0W A;  5M5Y J;  1OFC X;  3K7A J;  1F36 A;  3FIW A;  1VI0 A;  3HOX J;  2X9D A;  4XRM A;  2R0Q C;  2O8K A;  1GUU A;  5J3L A;  1QVU A;  1MNM C;  3Q0U A;  3OOU A;  3LOC A;  1MBF A;  3GTQ J;  3ZOB A;  1A6I A;  1Y1V J;  1JUM A;  2YUS A;  1WH5 A;  1Z0X A;  4DYC A;  5FKO A;  2FX0 A;  1TC3 C;  3BQY A;  2XSD C;  3HOU J;  3CQZ J;  4A3C J;  1U9N A;  2LLK A;  2EZL A;  5FKL A;  3S2D J;  2NOG A;  2NS7 A;  1X2M A;  4C2M J;  4JX4 A;  1ETQ A;  4JX6 A;  4Y7N J;  4FTH A;  9ANT A;  3JRC A;  3O8G A;  3GTK J;  5E3O A;  4MFD A;  1ZTR A;  3DEW A;  3TED A;  3S16 J;  3WHB A;  2L7F P;  1RET A;  5C44 J;  5IPA A;  1CQT A;  2XB5 A;  3FK6 A;  2DA3 A;  2CUF A;  5F08 A;  3S1R J;  4IHV A;  5M5X J;  2LK2 A;  3GTJ J;  3I4M J;  3PO2 J;  1HF0 A;  2H1K A;  1W0T A;  3C2B A;  4LOC A;  2YS9 A;  1LFU P;  1GT0 C;  2CQX A;  4I6Z A;  3QPL A;  2DMU A;  1GDT A;  5EGO B;  4QSH A;  2DA4 A;  5IP9 J;  1K83 J;  2HOA A;  2ZB9 A;  3SJM A;  1FTT A;  4I76 A;  2JA7 J;  2Y31 A;  3PM1 A;  3MN2 A;  3F0C A;  1TWG J;  4QIW N;  3A03 A;  5E3L A;  2KDZ A;  2EH3 A;  1UMQ A;  1U9O A;  3OSF A;  2O7O A;  3ZQI A;  1QRY A;  4Y52 J;  5FJ8 J;  5M5W J;  5M3F J;  3S1N J;  4AC0 A;  2FD5 A;  3S1M J;  1JKP C;  5J1Y A;  3JRH A;  4M3D A;  1APL C;  3QQA A;  3IH4 A;  2E2J J;  1EF4 A;  5IOY A;  1H8A C;  2L7M P;  3HBL A;  2JK3 A;  2MGQ A;  3BT9 A;  1JKQ C;  1TWC J;  1IC8 A;  2ID6 A;  3OSG A;  3HOV J;  1FEX A;  3H3V K;  4BKX A;  3B6C A;  5FKN A;  2LFB A;  2VPR A;  3BR2 A;  5IOZ A;  1I50 J;  2MG4 A;  3O8H A;  1IDY A;  1XG1 A;  4V2G A;  4XIC A;  3HOZ J;  1GVD A;  1JUS A;  3JRA A;  2XGE A;  1RES A;  4A3L J;  2LD5 A;  2D5V A;  3G1L A;  2EZH A;  2QF7 A;  1OJL A;  2IBD A;  4AYB N;  3RZD J;  3HOY J;  3MKL A;  5FLM J;  3D1N I;  1MSE C;  4XK4 A;  2LKX A;  2IAI A;  4C3I J;  1S7E A;  1YRN A;  3BTI A;  5IYC J;  1UG2 A;  3ZQF A;  2DMQ A;  4JX5 A;  2HI3 A;  2GBY A;  1ITY A;  2CUE A;  2ME0 A;  1T33 A;  5IYD J;  2EZI A;  2XPV A;  4A69 C;  4A3E J;  2M9H A;  2JA8 J;  3MVP A;  1OCP A;  3BR0 A;  4UUT A;  2AO9 A;  4B1R A;  4IHW A;  4X1E A;  1FTZ A;  2K40 A;  4B3A A;  4UUS A;  1R9T J;  1HDP A;  1ENH A;  1P7I A;  3BQZ A;  1H89 C;  4W1U A;  2NVX J;  1I3Q J;  1IRZ A;  4M3E A;  4GFB A;  4A3I J;  3HKZ N;  4FE7 A;  1QPI A;  3BTL A;  1BW5 A;  2OF7 A;  5F04 A;  2TCT A;  2ECC A;  5EDN A;  4IHY A;  2TRT A;  4L5E A;  4NDL A;  1JUP A;  5JLW A;  4A3K J;  4A3B J;  4X6A J;  3H0G J;  5EEA A;  1ZQ3 P;  2EZK A;  2HXI A;  2H8R A;  1NTC A;  5K7F A;  4A93 J;  4A3G J;  3RKQ A;  1JJ6 C;  3HGG A;  4IHX A;  4ABZ A;  1WGX A;  5K7Z A;  2DTZ A;  2OPT A;  2XPU A;  1XC5 A;  1ZR2 A;  1NK3 P;  1I6H J;  1HOM A;  5K7H A;  1RKW A;  2DA6 A;  4EEF G;  1T56 A;  1RPW A;  2XGD A;  3HGY A;  2DA7 A;  3TW6 A;  2Y30 A;  1MSF C;  1BW6 A;  5IYB J;  3GTM J;  5EG0 B;  2R5Z B;  3S17 J;  2Y9Z A;  2ME6 A;  1IV6 A;  1IDZ A;  1E3O C;  2XRL A;  3GBG A;  5GPC A;  1F43 A;  2FQ4 A;  1DU6 A;  2HQ5 A;  3ZQH A;  3DCF A;  1MH4 A;  4D5F A;  1X58 A;  2JMW A;  3CDL A;  1QVT A;  3ZQL A;  5F0H A;  1VF9 A;  1ETO A;  2FJ1 A;  1LFB A;  3BG5 A;  1TWF J;  4BY1 J;  1XS9 A;  1HCR A;  1FIA A;  1Y1W J;  1ETX A;  3BG9 A;  1ETK A;  2E2I J;  2N8G A;  3HB9 A;  4J19 A;  3RQI A;  1P7J A;  3FK7 A;  1MBK A;  2VI6 A;  5EZH A;  4IEJ A;  3JR9 A;  5GP9 A;  1B8I B;  4BY7 J;  3LSP A;  4JYK A;  2WAQ N;  3WHC A;  3CMY A;  1BL0 A;  4BXX J;  3SFI A;  2R5Y B;  1WI3 A;  1MBG A;  4W97 A;  2RAE A;  2M8G X;  5C3E J;  5EYR A;  4DYQ A;  3G1O A;  4D7M A;  4RBO A;  3G1M A;  2DN0 A;  4A3J J;  3IH2 A;  4BBS J;  1FJL A;  4DZJ A;  3SDG A;  4M3F A;  3GTG J;  3JRI A;  3RZO J;  3K2A A;  3BG3 A;  2YU9 J;  2DMP A;  3BR3 A;  2XPW A;  1ORK A;  3W6V A;  5F1J A;  1TWA J;  4XID A;  1MH3 A;  2NVQ J;  2JN6 A;  4HNV A;  2R5Y A;  3QPS A;  5F27 A;  5JLX A;  1LE8 B;  4M6V A;  2JA6 J;  3S2H J;  2XB0 X;  3IV5 A;  2K9N A;  1D5Y A;  3TP3 A;  4QTR A;  1WPK A;  4A3M J;  2E2H J;  4M3G A;  2DA1 A;  1ZK8 A;  2R93 J;  2IEK A;  2DA2 A;  3JRB A;  2VKV A;  4G12 A;  5EZG A;  3Q0V A;  2X6O A;  4D5C A;  1ZKG A;  2AHQ A;  2HXO A;  1VND A;  5FKK A;  4RDU A;  1POG A;  3M3Y J;  2K9S A;  2CJJ A;  2PMZ N;  4MFE A;  4JP0 A;  3PO3 J;  2DMT A;  1JT6 A;  1DU0 A;  1ZR4 A;  5EGO A;  2CU7 A;  1SFO J;  1WCM J;  1O4X A;  2X48 A;  1B72 A;  4DYR A;  5IP7 J;  3JRF A;  1H88 C;  3LSG A;  1JT0 A;  1LE8 A;  3HM5 A;  1JKO C;  3HDD A;  3HEF A;  3ZQC A;  2HDD A;  2Y2Z A;  3IH3 A;  1B8I A;  1MBJ A;  3VPR A;  1B72 B;  2MSY A;  3OIO A;  2WB1 N;  1IUF A;  1MBH A;  1Z77 A;  2JA5 J;  3NAU A;  3JRE A;  2LVS A;  2K9Q A;  2NS8 A;  4MIM A;  1HDD C;  2VKE A;  2ELK A;  1AHD P;  4BBR J;  3BR1 A;  3S14 J;  1ETY A;  1BJZ A;  5BNG A;  1VFC A;  1JJ8 C;  2ID3 A;  2G0E A;  3CCY A;  5FLV A;  3FKI J;  3BR6 A;  1IG7 A;  3S1Q J;  2WV1 A;  5IP6 A;  4XRS A;  4M3B A;  4XRS G;  3TW7 A;  2M0C A;  3S15 J;  4UUS B;  1UHS A;  2I10 A;  1U8B A;  1WH7 A;  5C4J J;  3BR5 A;  4B4C A;  1NK2 P;  1PUF B;  2JJ7 A;  5HOD A;  2R92 J;  3A01 B;  3GTO J;  3BTC A;  5EG0 A;  1RR7 A;  2MW8 A;  2KT0 A;  5J1R A;  1YRN B;  2EQR A;  2COB A;  3JRD A;  1JTX A;  2LR8 A;  2Y0S N;  5DS9 A;  2NVY J;  1AU7 A;  3ZQG A;  2NVT J;  1JTY A;  2B63 J;  2LY9 A;  1RKT A;  1HLV A;  3JRG A;  1BA5 A;  2GM4 A;  5J1U A;  3LSR A;  2O9L A;  5C4X J;  1X2N A;  3L1P A;  3Q3S A;  2HOS A;  5EF6 A;  1PUF A;  4A3D J;  3LSJ A;  2DJN A;  1Q1V A;  3BTJ A;  5F0F A;  3A01 A;  2DMN A;  2QCO A;  4FCY A;  2M34 A;  1JGG A;  2CRG A;  4A3F J;  4FE4 A;  1IGN A;  1SAN A;  4CYC A;  2XGC A;  2Y9Y A;  1ZGW A;  2HOT A;  2LP0 A;  3UKG A;  2DA5 A;  2GLO A;  2M2E A;  3I4N J;  2L0K A;  3NAR A;  1K61 A;  3A02 A;  4DW6 A;  1U78 A;  4S0H B;  2EBI A;  4MO7 A;  4C3J J;  2HYJ A;  2VUM J;  1G2H A;  1AKH A;  2R7Z J;  3E7L A;  2LTP A;  2P81 A;  5F0C A;  2E19 A;  3TP0 A;  1GV2 A;  2L9R A;  1A5J A;  2W48 A;  3HOW J;  2L7Z A;  5E3N A;  1ETV A;  4D7N A;  4AUX A;  2R5Z A;  2E1O A;  5FKM A;  5GPA A;  3B6A A;  4CYC B;  1OCT C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...