2JA6K

Cpd lesion containing rna polymerase ii elongation complex b
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title CPD damage recognition by transcribing RNA polymerase II.
pubmed doi rcsb
molecule tags Transferase
molecule keywords DNA-DIRECTED RNA POLYMERASE II LARGEST SUBUNIT
total genus 24
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2006-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2ja6K00
1BDFA 4JK1A 1WCMC 2JA5C 3H0GC 4A3GK 4BBRC 2B63K 3H3VL 1IW7A 2CW0A 1I6VA 2A6EA 4LK0A 4ZH4A 4G7OA 5C4JC 3K7AC 3GTPK 3S16K 1TWGC 4LJZA 5M5YK 4BBSC 2WAQL 3S1RK 1R9TC 2YU9C 1I6HK 2WB1D 2PMZD 1Y1WC 2VUMK 3GTMK 1I50C 3HOYK 4G7ZA 1TWAC 4A3EK 3K7AK 3GTJC 2NVXK 3S16C 3M3YK 3RZOK 3S14K 2NVQK 3S1QK 2WB1L 3H3VD 3S2HK 2JA6C 2R7ZC 4A3LK 1TWHK 4Y7NC 4YFXA 3GTGC 3EQLA 2E2IK 2NVTC 2B63C 2R92C 1SMYA 1K83C 4QIWD 4A3MC 3GTKK 1WCMK 2JA5K 5C3EC 4A3CK 4A3FK 3GTOK 3M4OC 5IP9C 4AYBL 4OIRA 4BBRK 2PA8D 4MQ9A 5IYDC 4G7HA 3GTMC 4Q5SA 2PMZL 4BY1C 2A6HA 2Y0SD 5C44K 4A3IK 2YU9K 5IP7K 3S2DC 1I6HC 5FLMK 3I4MC 5TMCA 5IYBK 5D4DA 4Q4ZA 3S15K 4QJVB 4C3JK 2O5IA 5C4JK 4A3MK 2A68A 4KMUA 4YG2A 3WODA 4C3HK 5M3MK 4XLNA 4A3CC 2PA8L 5IP9K 3HOUC 1TWFC 4KN4A 4LK1A 5IYCC 2PPBA 2JA8K 4BY7C 4X6AC 4QJVA 5C4XC 5FJ8K 3M3YC 3S14C 3I4NK 4A93K 3S1QC 3FKIK 4QIWL 3GTJK 2NVXC 2JA6K 2R7ZK 1HQMA 4OINA 1ZYRA 3HOWC 4A3BK 2NVQC 4A3LC 4OIOA 1Y1VK 5IYBC 4C2MK 2R93K 3HOYC 1SFOK 4A3JK 4MEXA 3S17C 3PO2C 3S1RC 5FLMC 3I4MK 2O5JA 4YFKA 3HOVK 3S15C 5M3FK 3HOZC 3S1MK 3CQZC 4A3FC 3GTOC 3M4OK 5IYDK 4A3DC 4A93C 2NVTK 4Y52K 4YFNA 2R93C 1TWCC 4BY7K 4NOIA 1Y1VC 1YNJA 5C3EK 2E2JK 4BXXK 4A3DK 4XLPA 3HOUK 4A3JC 2R92K 3GTKC 3S17K 3DXJA 4A3BC 1K83K 4OIPA 2E2HK 3RZDK 4OIQA 4A3KC 3GTQK 2JA8C 3FKIC 1TWFK 3H0GK 3S1NC 4X6AK 5C44C 4KN7A 5IYCK 4C3IK 3HOZK 3S1MC 3PO3C 1TWCK 3CQZK 1R9TK 4AYBD 3HOXC 3GTLK 3PO2K 1SFOC 2NVYK 2Y0SL 2A69A 4XSXA 4A3KK 2JA7K 3GTQC 4GZYA 1TWGK 1YNNA 5C4XK 3RZDC 1XPPA 3I4NC 3HOWK 1TWAK 4A3EC 2E2JC 4BXXC 1TWHC 1I3QK 4MEYA 4Y7NK 2E2HC 3HKZD 3GTGK 1I50K 2E2IC 3RZOC 4A3GC 1Y1WK 2JA7C 2BE5A 3HOVC 4XSZA 4Y52C 2VUMC 2NVYC 3PO3K 5M5WK 4LLGA 4A3IC 3GTPC 3HOXK 3GTLC 3S1NK 5M5XK 3HKZL 5IP7C 3S2DK 4BBSK 1I3QC 5TMFA 3S2HC 4BY1K 2WAQD
chains in the Genus database with same CATH superfamily
3QX3A 2FQOA 1IW7A 3BUEA 2A6EA 4ZH4A 4KB4A 5C4JC 1O2BA 3K7AC 3AQOA 5M5YK 3S1RK 1XXBA 2PMZD 3G4CA 1IBAA 1J6WA 1O29A 1C0AA 3BP3A 4BLBA 1TWAC 1X31C 2RGRA 1XZQA 2NVXK 4C2MC 3S1QK 3GIRA 1VH2A 2R7ZC 1XZQB 1TWHK 4Y7NC 3H0GA 2V6TA 1VGXA 4KM8A 5L46A 4OIRA 4BBRK 1JQWA 1WQFA 3L4JA 3GTMC 3T00A 4PABA 1EH1A 4Q4ZA 1O2FB 4O2DA 3S15K 4QJVB 3GTKA 4KMUA 4G0UA 3HOUC 4GTBA 4LR2A 1ZXOA 4X6AC 3S1QC 3FKIK 4QIWL 5CHPA 2NVXC 2R7ZK 1ZYRA 2GAHC 3CQZA 3HOYC 2Y3PA 3PO2C 4C3HC 5FLMC 3I4MK 2O5JA 5M3FK 3HOZC 3CQZC 3GTOC 4FZBA 4A93C 2R93C 1TWCC 4NOIA 1F93A 4WJ3M 3HOUK 4P9SA 3LPXA 1USOA 3L4KA 3RZDK 4OIQA 2JA7A 1PJ5A 3GTQK 2JA8C 5JFEA 3FKIC 3GEHA 4X6AK 1B4BA 3GSIA 3S1MC 2NVXA 1R9TK 2NVYK 3AD7C 4P5BA 4A3KK 2GSUA 1BJTA 3FOFA 3AD9C 4KM9A 5C4XK 1XPPA 1XXAA 1B4AA 3V4GA 1VLOA 1DCPA 1TWAK 3HKZD 5EGEA 2E2IC 5JVOA 3MMLB 1J98A 1Y1WK 4XSZA 4Y52C 1J6VA 3HKZL 3FKIA 5TMFA 1EQRA 2WAQD 4JK1A 5HL8A 3OEPA 1WSVA 3OPFA 1K83A 2JH3A 4LJZA 1WQGA 1O25A 2GSOA 2YU9C 1I6HK 1Y1WC 1PJ6A 3N0BA 1WIHA 3HOYK 4G7ZA 1AB4A 4WILA 4A3EK 3M3YK 2NVQK 2WB1L 4GFQA 1XXCA 4YFXA 3G4AA 3EQLA 2E2IK 2NVTC 2R92C 5IOQA 1K83C 3ERED 1WCMK 2PHCB 4A3FK 5IP9C 4AYBL 3HXAA 4MQ9A 5IYDC 4G7HA 2A6HA 2Y0SD 5C44K 4A3IK 1I6HC 5FLMK 3I4MC 4DDQA 4BLAA 2O5IA 4AH6A 5C4JK 2A68A 3GDZA 3WODA 1TWFC 1J6XA 4GZYA 4A93K 3GTJK 2JA6K 4OINA 3HOWC 1V5VA 4OIOA 5IYBC 1SFOK 4GTEA 4KASA 1PJ7A 1TWFA 3S1MK 3GEEA 1WOOA 2FQTA 3M4OK 5IYDK 4Y52K 1EI6A 2XCOA 1TWAA 4A3DK 4XLPA 1JVIA 2R92K 3DXJA 1SFOA 1RU0A 3T01A 1TWFK 3AQPA 3H0GK 5TJ3A 1XZPB 1O27A 1WORA 3A8JA 4FM9A 3GTLA 1EK8A 3HOZK 1Y1VA 2XCQA 1SFOC 3LAJA 4KB2A 2JA7K 1YX2A 1YNNA 3GTGA 4LOWA 3RZDC 1TWGA 3NUHA 3HOWK 1TWHC 4Y7NK 2E2HC 1I50K 1KQ4A 2BE5A 4GTDA 3HOVC 2VUMC 4LLGA 4C3IC 3GTPC 5IP7C 3S2DK 1WSRA 4ILDA 3S2HC 2VUMA 2JA5C 3GTMA 4A3GK 5EGHA 2B63K 3H3VL 3FOEA 3FHZA 1I6VA 4BBSC 3N3YA 1I3QA 4KDDA 1WOSA 2VUMK 4GTLA 3S16C 3S14K 3S2HK 4A3LK 2B63C 2CFAA 4A3CK 2JA5K 5C3EC 3M4OC 5IOSA 2EBBA 4GT9A 2PA8D 4PAAA 4Q5SA 2PMZL 2ZUEA 5IP7K 3S2DC 5IYBK 3CAGA 5D4DA 3TFHA 1IQ0A 2V6UA 4XCHA 4C3JK 4A3MK 2GAGC 5M3MK 2PA8L 5IP9K 4KN4A 2R7ZA 2PPBA 2JA8K 4BY7C 5C4XC 3S14C 1L0WA 5IORA 3I4NK 1INNA 4A3DC 4A3BK 4A3LC 4BKWA 1Y1VK 1VJEA 3T02A 4A3JK 1WOPA 3A8IA 1IS1A 1VRQC 3N0CA 2CFAB 4A3FC 1ZQ1C 1Y1WA 5E68A 2NVTK 4YFNA 1IL2A 1YNJA 1DCOA 3S17K 4G0VA 3SZZA 2P5MA 3A8KA 1TWCA 2KWAA 4P5AA 2E2IA 2RH6A 3S1NC 5IYCK 2R93A 3OREA 3PO3C 4LQYA 4AYBD 3PO2K 4C3JC 2Y0SL 4XSXA 1GE9A 2YU9A 3I4NC 1JOEA 4KARA 1I3QK 3GTGK 1YCLA 5IOTA 4A3GC 3TTGA 2V6SA 1ISEA 2JA7C 3BP8C 2P8TA 3PO3K 1WCMA 4GTCA 3SZYA 4A3IC 3S1NK 1G51A 4BBSK 3S1RC 1BDFA 1WCMC 3H0GC 4BBRC 2CW0A 1F7UA 4G7OA 1BS2A 4LK0A 2R92A 3GTPK 3S16K 1TWGC 1UV7A 4KC6A 2WAQL 1R9TC 2WB1D 3GTOA 2XCRB 3GTMK 3S0XA 1I50C 3AH5A 3K7AK 3GTJC 1DD5A 2D6FC 3RZOK 1EFWA 3H3VD 1XZPA 2JA6C 3GTGC 4KAWX 3GTKK 1SMYA 4QIWD 4A3MC 3GTOK 1O2AA 4GTAA 1ZVUA 4BY1C 2YU9K 3IPJA 5TMCA 1WQHA 4A3CC 4M1XA 4YG2A 4J3NA 4XLNA 4C3HK 3TFJA 4LK1A 1O28A 5IYCC 2JA6A 4KATA 4QJVA 5FJ8K 3M3YC 1HQMA 2R93K 1TWHA 2NVQC 1DCHA 4C2MK 2ZFZA 3GTJA 4MEXA 3S17C 1F9NA 3GTQA 1BGWA 4YFKA 3HOVK 3S15C 1I50A 1F7VA 4RMFA 3ADAC 4GTFA 4BY7K 5C3EK 1Y1VC 2E2JK 4BXXK 2NVYA 4A3JC 3GTKC 4A3BC 1K83K 4OIPA 2E2HK 4KMHA 4A3KC 1R9TA 3TFIA 2B63A 5C44C 4KN7A 4C3IK 1TWCK 3CQZK 1ZBSA 3HOXC 3GTLK 2GSNA 2ZUFA 3VA7A 1O24A 2A69A 3GTQC 2E2HA 1TWGK 4C45A 3Q3QA 4KMAA 3GTPA 3JSTA 4A3EC 5CJ9A 1HI9A 2E2JC 4MEYA 4BXXC 3LAPA 3RZOC 4WJ4A 3AD8C 4KMDA 4G0WA 2NVYC 2JA5A 5M5WK 3GEIA 3HOXK 3GTLC 2W7VA 5M5XK 1IE0A 1I3QC 1USMA 1O26A 4BY1K
chains in the Genus database with same CATH topology
1BDFA 4JK1A 1WCMC 2JA5C 3H0GC 4A3GK 4BBRC 2B63K 3H3VL 1IW7A 2CW0A 1I6VA 2A6EA 4LK0A 4ZH4A 4G7OA 5C4JC 3K7AC 3GTPK 3S16K 1TWGC 4LJZA 5M5YK 4BBSC 2WAQL 3S1RK 1R9TC 2YU9C 1I6HK 2WB1D 2PMZD 1Y1WC 2VUMK 3GTMK 1I50C 3HOYK 4G7ZA 1TWAC 4A3EK 3K7AK 3GTJC 2NVXK 3S16C 3M3YK 3RZOK 3S14K 2NVQK 3S1QK 2WB1L 3H3VD 3S2HK 2JA6C 2R7ZC 4A3LK 1TWHK 4Y7NC 4YFXA 3GTGC 3EQLA 2E2IK 2NVTC 2B63C 2R92C 1SMYA 1K83C 4QIWD 4A3MC 3GTKK 1WCMK 2JA5K 5C3EC 4A3CK 4A3FK 3GTOK 3M4OC 5IP9C 4AYBL 4OIRA 4BBRK 2PA8D 4MQ9A 5IYDC 4G7HA 3GTMC 4Q5SA 2PMZL 4BY1C 2A6HA 2Y0SD 5C44K 4A3IK 2YU9K 5IP7K 3S2DC 1I6HC 5FLMK 3I4MC 5TMCA 5IYBK 5D4DA 4Q4ZA 3S15K 4QJVB 4C3JK 2O5IA 5C4JK 4A3MK 2A68A 4KMUA 4YG2A 3WODA 4C3HK 5M3MK 4XLNA 4A3CC 2PA8L 5IP9K 3HOUC 1TWFC 4KN4A 4LK1A 5IYCC 2PPBA 2JA8K 4BY7C 4X6AC 4QJVA 5C4XC 5FJ8K 3M3YC 3S14C 3I4NK 4A93K 3S1QC 3FKIK 4QIWL 3GTJK 2NVXC 2JA6K 2R7ZK 1HQMA 4OINA 1ZYRA 3HOWC 4A3BK 2NVQC 4A3LC 4OIOA 1Y1VK 5IYBC 4C2MK 2R93K 3HOYC 1SFOK 4A3JK 4MEXA 3S17C 3PO2C 3S1RC 5FLMC 3I4MK 2O5JA 4YFKA 3HOVK 3S15C 5M3FK 3HOZC 3S1MK 3CQZC 4A3FC 3GTOC 3M4OK 5IYDK 4A3DC 4A93C 2NVTK 4Y52K 4YFNA 2R93C 1TWCC 4BY7K 4NOIA 1Y1VC 1YNJA 5C3EK 2E2JK 4BXXK 4A3DK 4XLPA 3HOUK 4A3JC 2R92K 3GTKC 3S17K 3DXJA 4A3BC 1K83K 4OIPA 2E2HK 3RZDK 4OIQA 4A3KC 3GTQK 2JA8C 3FKIC 1TWFK 3H0GK 3S1NC 4X6AK 5C44C 4KN7A 5IYCK 4C3IK 3HOZK 3S1MC 3PO3C 1TWCK 3CQZK 1R9TK 4AYBD 3HOXC 3GTLK 3PO2K 1SFOC 2NVYK 2Y0SL 2A69A 4XSXA 4A3KK 2JA7K 3GTQC 4GZYA 1TWGK 1YNNA 5C4XK 3RZDC 1XPPA 3I4NC 3HOWK 1TWAK 4A3EC 2E2JC 4BXXC 1TWHC 1I3QK 4MEYA 4Y7NK 2E2HC 3HKZD 3GTGK 1I50K 2E2IC 3RZOC 4A3GC 1Y1WK 2JA7C 2BE5A 3HOVC 4XSZA 4Y52C 2VUMC 2NVYC 3PO3K 5M5WK 4LLGA 4A3IC 3GTPC 3HOXK 3GTLC 3S1NK 5M5XK 3HKZL 5IP7C 3S2DK 4BBSK 1I3QC 5TMFA 3S2HC 4BY1K 2WAQD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BDF A;  4JK1 A;  1WCM C;  2JA5 C;  3H0G C;  4A3G K;  4BBR C;  2B63 K;  3H3V L;  1IW7 A;  2CW0 A;  1I6V A;  2A6E A;  4LK0 A;  4ZH4 A;  4G7O A;  5C4J C;  3K7A C;  3GTP K;  3S16 K;  1TWG C;  4LJZ A;  5M5Y K;  4BBS C;  2WAQ L;  3S1R K;  1R9T C;  2YU9 C;  1I6H K;  2WB1 D;  2PMZ D;  1Y1W C;  2VUM K;  3GTM K;  1I50 C;  3HOY K;  4G7Z A;  1TWA C;  4A3E K;  3K7A K;  3GTJ C;  2NVX K;  3S16 C;  3M3Y K;  3RZO K;  3S14 K;  2NVQ K;  3S1Q K;  2WB1 L;  3H3V D;  3S2H K;  2JA6 C;  2R7Z C;  4A3L K;  1TWH K;  4Y7N C;  4YFX A;  3GTG C;  3EQL A;  2E2I K;  2NVT C;  2B63 C;  2R92 C;  1SMY A;  1K83 C;  4QIW D;  4A3M C;  3GTK K;  1WCM K;  2JA5 K;  5C3E C;  4A3C K;  4A3F K;  3GTO K;  3M4O C;  5IP9 C;  4AYB L;  4OIR A;  4BBR K;  2PA8 D;  4MQ9 A;  5IYD C;  4G7H A;  3GTM C;  4Q5S A;  2PMZ L;  4BY1 C;  2A6H A;  2Y0S D;  5C44 K;  4A3I K;  2YU9 K;  5IP7 K;  3S2D C;  1I6H C;  5FLM K;  3I4M C;  5TMC A;  5IYB K;  5D4D A;  4Q4Z A;  3S15 K;  4QJV B;  4C3J K;  2O5I A;  5C4J K;  4A3M K;  2A68 A;  4KMU A;  4YG2 A;  3WOD A;  4C3H K;  5M3M K;  4XLN A;  4A3C C;  2PA8 L;  5IP9 K;  3HOU C;  1TWF C;  4KN4 A;  4LK1 A;  5IYC C;  2PPB A;  2JA8 K;  4BY7 C;  4X6A C;  4QJV A;  5C4X C;  5FJ8 K;  3M3Y C;  3S14 C;  3I4N K;  4A93 K;  3S1Q C;  3FKI K;  4QIW L;  3GTJ K;  2NVX C;  2JA6 K;  2R7Z K;  1HQM A;  4OIN A;  1ZYR A;  3HOW C;  4A3B K;  2NVQ C;  4A3L C;  4OIO A;  1Y1V K;  5IYB C;  4C2M K;  2R93 K;  3HOY C;  1SFO K;  4A3J K;  4MEX A;  3S17 C;  3PO2 C;  3S1R C;  5FLM C;  3I4M K;  2O5J A;  4YFK A;  3HOV K;  3S15 C;  5M3F K;  3HOZ C;  3S1M K;  3CQZ C;  4A3F C;  3GTO C;  3M4O K;  5IYD K;  4A3D C;  4A93 C;  2NVT K;  4Y52 K;  4YFN A;  2R93 C;  1TWC C;  4BY7 K;  4NOI A;  1Y1V C;  1YNJ A;  5C3E K;  2E2J K;  4BXX K;  4A3D K;  4XLP A;  3HOU K;  4A3J C;  2R92 K;  3GTK C;  3S17 K;  3DXJ A;  4A3B C;  1K83 K;  4OIP A;  2E2H K;  3RZD K;  4OIQ A;  4A3K C;  3GTQ K;  2JA8 C;  3FKI C;  1TWF K;  3H0G K;  3S1N C;  4X6A K;  5C44 C;  4KN7 A;  5IYC K;  4C3I K;  3HOZ K;  3S1M C;  3PO3 C;  1TWC K;  3CQZ K;  1R9T K;  4AYB D;  3HOX C;  3GTL K;  3PO2 K;  1SFO C;  2NVY K;  2Y0S L;  2A69 A;  4XSX A;  4A3K K;  2JA7 K;  3GTQ C;  4GZY A;  1TWG K;  1YNN A;  5C4X K;  3RZD C;  1XPP A;  3I4N C;  3HOW K;  1TWA K;  4A3E C;  2E2J C;  4BXX C;  1TWH C;  1I3Q K;  4MEY A;  4Y7N K;  2E2H C;  3HKZ D;  3GTG K;  1I50 K;  2E2I C;  3RZO C;  4A3G C;  1Y1W K;  2JA7 C;  2BE5 A;  3HOV C;  4XSZ A;  4Y52 C;  2VUM C;  2NVY C;  3PO3 K;  5M5W K;  4LLG A;  4A3I C;  3GTP C;  3HOX K;  3GTL C;  3S1N K;  5M5X K;  3HKZ L;  5IP7 C;  3S2D K;  4BBS K;  1I3Q C;  5TMF A;  3S2H C;  4BY1 K;  2WAQ D; 
#chains in the Genus database with same CATH topology
 3QX3 A;  2FQO A;  1IW7 A;  3BUE A;  2A6E A;  4ZH4 A;  4KB4 A;  5C4J C;  1O2B A;  3K7A C;  3AQO A;  5M5Y K;  3S1R K;  1XXB A;  2PMZ D;  3G4C A;  1IBA A;  1J6W A;  1O29 A;  1C0A A;  3BP3 A;  4BLB A;  1TWA C;  1X31 C;  2RGR A;  1XZQ A;  2NVX K;  4C2M C;  3S1Q K;  3GIR A;  1VH2 A;  2R7Z C;  1XZQ B;  1TWH K;  4Y7N C;  3H0G A;  2V6T A;  1VGX A;  4KM8 A;  5L46 A;  4OIR A;  4BBR K;  1JQW A;  1WQF A;  3L4J A;  3GTM C;  3T00 A;  4PAB A;  1EH1 A;  4Q4Z A;  1O2F B;  4O2D A;  3S15 K;  4QJV B;  3GTK A;  4KMU A;  4G0U A;  3HOU C;  4GTB A;  4LR2 A;  1ZXO A;  4X6A C;  3S1Q C;  3FKI K;  4QIW L;  5CHP A;  2NVX C;  2R7Z K;  1ZYR A;  2GAH C;  3CQZ A;  3HOY C;  2Y3P A;  3PO2 C;  4C3H C;  5FLM C;  3I4M K;  2O5J A;  5M3F K;  3HOZ C;  3CQZ C;  3GTO C;  4FZB A;  4A93 C;  2R93 C;  1TWC C;  4NOI A;  1F93 A;  4WJ3 M;  3HOU K;  4P9S A;  3LPX A;  1USO A;  3L4K A;  3RZD K;  4OIQ A;  2JA7 A;  1PJ5 A;  3GTQ K;  2JA8 C;  5JFE A;  3FKI C;  3GEH A;  4X6A K;  1B4B A;  3GSI A;  3S1M C;  2NVX A;  1R9T K;  2NVY K;  3AD7 C;  4P5B A;  4A3K K;  2GSU A;  1BJT A;  3FOF A;  3AD9 C;  4KM9 A;  5C4X K;  1XPP A;  1XXA A;  1B4A A;  3V4G A;  1VLO A;  1DCP A;  1TWA K;  3HKZ D;  5EGE A;  2E2I C;  5JVO A;  3MML B;  1J98 A;  1Y1W K;  4XSZ A;  4Y52 C;  1J6V A;  3HKZ L;  3FKI A;  5TMF A;  1EQR A;  2WAQ D;  4JK1 A;  5HL8 A;  3OEP A;  1WSV A;  3OPF A;  1K83 A;  2JH3 A;  4LJZ A;  1WQG A;  1O25 A;  2GSO A;  2YU9 C;  1I6H K;  1Y1W C;  1PJ6 A;  3N0B A;  1WIH A;  3HOY K;  4G7Z A;  1AB4 A;  4WIL A;  4A3E K;  3M3Y K;  2NVQ K;  2WB1 L;  4GFQ A;  1XXC A;  4YFX A;  3G4A A;  3EQL A;  2E2I K;  2NVT C;  2R92 C;  5IOQ A;  1K83 C;  3ERE D;  1WCM K;  2PHC B;  4A3F K;  5IP9 C;  4AYB L;  3HXA A;  4MQ9 A;  5IYD C;  4G7H A;  2A6H A;  2Y0S D;  5C44 K;  4A3I K;  1I6H C;  5FLM K;  3I4M C;  4DDQ A;  4BLA A;  2O5I A;  4AH6 A;  5C4J K;  2A68 A;  3GDZ A;  3WOD A;  1TWF C;  1J6X A;  4GZY A;  4A93 K;  3GTJ K;  2JA6 K;  4OIN A;  3HOW C;  1V5V A;  4OIO A;  5IYB C;  1SFO K;  4GTE A;  4KAS A;  1PJ7 A;  1TWF A;  3S1M K;  3GEE A;  1WOO A;  2FQT A;  3M4O K;  5IYD K;  4Y52 K;  1EI6 A;  2XCO A;  1TWA A;  4A3D K;  4XLP A;  1JVI A;  2R92 K;  3DXJ A;  1SFO A;  1RU0 A;  3T01 A;  1TWF K;  3AQP A;  3H0G K;  5TJ3 A;  1XZP B;  1O27 A;  1WOR A;  3A8J A;  4FM9 A;  3GTL A;  1EK8 A;  3HOZ K;  1Y1V A;  2XCQ A;  1SFO C;  3LAJ A;  4KB2 A;  2JA7 K;  1YX2 A;  1YNN A;  3GTG A;  4LOW A;  3RZD C;  1TWG A;  3NUH A;  3HOW K;  1TWH C;  4Y7N K;  2E2H C;  1I50 K;  1KQ4 A;  2BE5 A;  4GTD A;  3HOV C;  2VUM C;  4LLG A;  4C3I C;  3GTP C;  5IP7 C;  3S2D K;  1WSR A;  4ILD A;  3S2H C;  2VUM A;  2JA5 C;  3GTM A;  4A3G K;  5EGH A;  2B63 K;  3H3V L;  3FOE A;  3FHZ A;  1I6V A;  4BBS C;  3N3Y A;  1I3Q A;  4KDD A;  1WOS A;  2VUM K;  4GTL A;  3S16 C;  3S14 K;  3S2H K;  4A3L K;  2B63 C;  2CFA A;  4A3C K;  2JA5 K;  5C3E C;  3M4O C;  5IOS A;  2EBB A;  4GT9 A;  2PA8 D;  4PAA A;  4Q5S A;  2PMZ L;  2ZUE A;  5IP7 K;  3S2D C;  5IYB K;  3CAG A;  5D4D A;  3TFH A;  1IQ0 A;  2V6U A;  4XCH A;  4C3J K;  4A3M K;  2GAG C;  5M3M K;  2PA8 L;  5IP9 K;  4KN4 A;  2R7Z A;  2PPB A;  2JA8 K;  4BY7 C;  5C4X C;  3S14 C;  1L0W A;  5IOR A;  3I4N K;  1INN A;  4A3D C;  4A3B K;  4A3L C;  4BKW A;  1Y1V K;  1VJE A;  3T02 A;  4A3J K;  1WOP A;  3A8I A;  1IS1 A;  1VRQ C;  3N0C A;  2CFA B;  4A3F C;  1ZQ1 C;  1Y1W A;  5E68 A;  2NVT K;  4YFN A;  1IL2 A;  1YNJ A;  1DCO A;  3S17 K;  4G0V A;  3SZZ A;  2P5M A;  3A8K A;  1TWC A;  2KWA A;  4P5A A;  2E2I A;  2RH6 A;  3S1N C;  5IYC K;  2R93 A;  3ORE A;  3PO3 C;  4LQY A;  4AYB D;  3PO2 K;  4C3J C;  2Y0S L;  4XSX A;  1GE9 A;  2YU9 A;  3I4N C;  1JOE A;  4KAR A;  1I3Q K;  3GTG K;  1YCL A;  5IOT A;  4A3G C;  3TTG A;  2V6S A;  1ISE A;  2JA7 C;  3BP8 C;  2P8T A;  3PO3 K;  1WCM A;  4GTC A;  3SZY A;  4A3I C;  3S1N K;  1G51 A;  4BBS K;  3S1R C;  1BDF A;  1WCM C;  3H0G C;  4BBR C;  2CW0 A;  1F7U A;  4G7O A;  1BS2 A;  4LK0 A;  2R92 A;  3GTP K;  3S16 K;  1TWG C;  1UV7 A;  4KC6 A;  2WAQ L;  1R9T C;  2WB1 D;  3GTO A;  2XCR B;  3GTM K;  3S0X A;  1I50 C;  3AH5 A;  3K7A K;  3GTJ C;  1DD5 A;  2D6F C;  3RZO K;  1EFW A;  3H3V D;  1XZP A;  2JA6 C;  3GTG C;  4KAW X;  3GTK K;  1SMY A;  4QIW D;  4A3M C;  3GTO K;  1O2A A;  4GTA A;  1ZVU A;  4BY1 C;  2YU9 K;  3IPJ A;  5TMC A;  1WQH A;  4A3C C;  4M1X A;  4YG2 A;  4J3N A;  4XLN A;  4C3H K;  3TFJ A;  4LK1 A;  1O28 A;  5IYC C;  2JA6 A;  4KAT A;  4QJV A;  5FJ8 K;  3M3Y C;  1HQM A;  2R93 K;  1TWH A;  2NVQ C;  1DCH A;  4C2M K;  2ZFZ A;  3GTJ A;  4MEX A;  3S17 C;  1F9N A;  3GTQ A;  1BGW A;  4YFK A;  3HOV K;  3S15 C;  1I50 A;  1F7V A;  4RMF A;  3ADA C;  4GTF A;  4BY7 K;  5C3E K;  1Y1V C;  2E2J K;  4BXX K;  2NVY A;  4A3J C;  3GTK C;  4A3B C;  1K83 K;  4OIP A;  2E2H K;  4KMH A;  4A3K C;  1R9T A;  3TFI A;  2B63 A;  5C44 C;  4KN7 A;  4C3I K;  1TWC K;  3CQZ K;  1ZBS A;  3HOX C;  3GTL K;  2GSN A;  2ZUF A;  3VA7 A;  1O24 A;  2A69 A;  3GTQ C;  2E2H A;  1TWG K;  4C45 A;  3Q3Q A;  4KMA A;  3GTP A;  3JST A;  4A3E C;  5CJ9 A;  1HI9 A;  2E2J C;  4MEY A;  4BXX C;  3LAP A;  3RZO C;  4WJ4 A;  3AD8 C;  4KMD A;  4G0W A;  2NVY C;  2JA5 A;  5M5W K;  3GEI A;  3HOX K;  3GTL C;  2W7V A;  5M5X K;  1IE0 A;  1I3Q C;  1USM A;  1O26 A;  4BY1 K; 
#chains in the Genus database with same CATH homology
 1BDF A;  4JK1 A;  1WCM C;  2JA5 C;  3H0G C;  4A3G K;  4BBR C;  2B63 K;  3H3V L;  1IW7 A;  2CW0 A;  1I6V A;  2A6E A;  4LK0 A;  4ZH4 A;  4G7O A;  5C4J C;  3K7A C;  3GTP K;  3S16 K;  1TWG C;  4LJZ A;  5M5Y K;  4BBS C;  2WAQ L;  3S1R K;  1R9T C;  2YU9 C;  1I6H K;  2WB1 D;  2PMZ D;  1Y1W C;  2VUM K;  3GTM K;  1I50 C;  3HOY K;  4G7Z A;  1TWA C;  4A3E K;  3K7A K;  3GTJ C;  2NVX K;  3S16 C;  3M3Y K;  3RZO K;  3S14 K;  2NVQ K;  3S1Q K;  2WB1 L;  3H3V D;  3S2H K;  2JA6 C;  2R7Z C;  4A3L K;  1TWH K;  4Y7N C;  4YFX A;  3GTG C;  3EQL A;  2E2I K;  2NVT C;  2B63 C;  2R92 C;  1SMY A;  1K83 C;  4QIW D;  4A3M C;  3GTK K;  1WCM K;  2JA5 K;  5C3E C;  4A3C K;  4A3F K;  3GTO K;  3M4O C;  5IP9 C;  4AYB L;  4OIR A;  4BBR K;  2PA8 D;  4MQ9 A;  5IYD C;  4G7H A;  3GTM C;  4Q5S A;  2PMZ L;  4BY1 C;  2A6H A;  2Y0S D;  5C44 K;  4A3I K;  2YU9 K;  5IP7 K;  3S2D C;  1I6H C;  5FLM K;  3I4M C;  5TMC A;  5IYB K;  5D4D A;  4Q4Z A;  3S15 K;  4QJV B;  4C3J K;  2O5I A;  5C4J K;  4A3M K;  2A68 A;  4KMU A;  4YG2 A;  3WOD A;  4C3H K;  5M3M K;  4XLN A;  4A3C C;  2PA8 L;  5IP9 K;  3HOU C;  1TWF C;  4KN4 A;  4LK1 A;  5IYC C;  2PPB A;  2JA8 K;  4BY7 C;  4X6A C;  4QJV A;  5C4X C;  5FJ8 K;  3M3Y C;  3S14 C;  3I4N K;  4A93 K;  3S1Q C;  3FKI K;  4QIW L;  3GTJ K;  2NVX C;  2JA6 K;  2R7Z K;  1HQM A;  4OIN A;  1ZYR A;  3HOW C;  4A3B K;  2NVQ C;  4A3L C;  4OIO A;  1Y1V K;  5IYB C;  4C2M K;  2R93 K;  3HOY C;  1SFO K;  4A3J K;  4MEX A;  3S17 C;  3PO2 C;  3S1R C;  5FLM C;  3I4M K;  2O5J A;  4YFK A;  3HOV K;  3S15 C;  5M3F K;  3HOZ C;  3S1M K;  3CQZ C;  4A3F C;  3GTO C;  3M4O K;  5IYD K;  4A3D C;  4A93 C;  2NVT K;  4Y52 K;  4YFN A;  2R93 C;  1TWC C;  4BY7 K;  4NOI A;  1Y1V C;  1YNJ A;  5C3E K;  2E2J K;  4BXX K;  4A3D K;  4XLP A;  3HOU K;  4A3J C;  2R92 K;  3GTK C;  3S17 K;  3DXJ A;  4A3B C;  1K83 K;  4OIP A;  2E2H K;  3RZD K;  4OIQ A;  4A3K C;  3GTQ K;  2JA8 C;  3FKI C;  1TWF K;  3H0G K;  3S1N C;  4X6A K;  5C44 C;  4KN7 A;  5IYC K;  4C3I K;  3HOZ K;  3S1M C;  3PO3 C;  1TWC K;  3CQZ K;  1R9T K;  4AYB D;  3HOX C;  3GTL K;  3PO2 K;  1SFO C;  2NVY K;  2Y0S L;  2A69 A;  4XSX A;  4A3K K;  2JA7 K;  3GTQ C;  4GZY A;  1TWG K;  1YNN A;  5C4X K;  3RZD C;  1XPP A;  3I4N C;  3HOW K;  1TWA K;  4A3E C;  2E2J C;  4BXX C;  1TWH C;  1I3Q K;  4MEY A;  4Y7N K;  2E2H C;  3HKZ D;  3GTG K;  1I50 K;  2E2I C;  3RZO C;  4A3G C;  1Y1W K;  2JA7 C;  2BE5 A;  3HOV C;  4XSZ A;  4Y52 C;  2VUM C;  2NVY C;  3PO3 K;  5M5W K;  4LLG A;  4A3I C;  3GTP C;  3HOX K;  3GTL C;  3S1N K;  5M5X K;  3HKZ L;  5IP7 C;  3S2D K;  4BBS K;  1I3Q C;  5TMF A;  3S2H C;  4BY1 K;  2WAQ D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...