2JA6K

Cpd lesion containing rna polymerase ii elongation complex b
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title CPD damage recognition by transcribing RNA polymerase II.
pubmed doi rcsb
molecule tags Transferase
molecule keywords DNA-DIRECTED RNA POLYMERASE II LARGEST SUBUNIT
total genus 24
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2006-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2ja6K00
3S1RK 2NVTK 3HOVC 3GTOK 4C2MK 2E2JK 4AYBL 1SFOC 3H3VD 3GTKK 3GTKC 2WB1D 3WODA 1R9TK 1TWCC 2PMZL 2PA8L 3HOVK 4BY7C 5C3EC 3S14C 5IYBK 4A3DK 4OIRA 1YNJA 5IYCK 3RZOC 4XSZA 4BBRK 2NVQC 3S1MK 4Y52K 4C3HK 1HQMA 4MEXA 2R7ZK 1Y1VC 5D4DA 2YU9K 4A3KC 3PO2C 1K83C 2PPBA 3S16C 2WAQD 3M4OK 4A3IC 1I3QK 5C4XK 3GTQK 2JA7K 3HKZL 4X6AC 3RZDC 2E2IC 4LLGA 3PO3K 4YFKA 4A3LC 4G7OA 4C3JK 5FLMK 3S2HK 5IYCC 3RZOK 4A93C 2R93K 4A3GK 3GTMK 3S2DK 2VUMK 4C3IK 2BE5A 5C44C 2NVXK 1TWGC 5TMCA 1I6HC 4QJVB 1YNNA 4YFXA 2JA8K 4A3BC 2NVXC 4YG2A 3K7AC 2JA6K 4MEYA 3GTMC 3RZDK 5C4JK 4A3FC 2R93C 3GTQC 3HOXK 3HOZK 3CQZC 3CQZK 4KN7A 4Y7NK 3I4NC 2A68A 4LK1A 5C4JC 4A3FK 3GTPC 2O5JA 4BXXC 4A3EK 1Y1WK 1K83K 2WAQL 3S16K 4QJVA 5M3FK 5IP9K 4BBSK 2Y0SL 4AYBD 5IP7C 5IP7K 4XLPA 1R9TC 2R92K 2R92C 5TMFA 1SFOK 4YFNA 3I4MK 3I4MC 4BY7K 2NVTC 4A3EC 1Y1WC 2A6HA 4A3JC 2E2JC 1I50K 3EQLA 2A6EA 1TWAC 3GTPK 2JA7C 3I4NK 3S1RC 4Q5SA 2CW0A 1I3QC 2NVYC 4BY1K 4BXXK 1BDFA 4QIWD 5M3MK 2PA8D 4A3KK 2E2IK 3HOZC 3HOYC 3HKZD 3PO2K 4Y7NC 4A93K 4OIPA 1WCMK 2B63C 3GTLC 5C4XC 4XLNA 4NOIA 4OIQA 5M5WK 3HOXC 4A3BK 4A3DC 1I50C 3S15K 4A3JK 1I6HK 3FKIK 5C44K 3DXJA 5IYBC 2VUMC 3S1QC 4A3CC 5M5XK 1TWGK 3S2HC 3S17K 2WB1L 5IP9C 2Y0SD 3S2DC 3PO3C 4QIWL 3GTOC 3H0GK 5FLMC 1SMYA 3S15C 1TWHK 4LK0A 3HOWC 5IYDK 3GTJK 1Y1VK 3H3VL 4ZH4A 4LJZA 4A3IK 3HOYK 3M4OC 4G7ZA 3S1MC 3HOWK 4A3MK 2YU9C 4G7HA 2NVYK 4BY1C 2R7ZC 3HOUC 3S14K 3H0GC 2E2HK 3K7AK 1TWAK 4BBRC 1TWCK 3S1NK 1TWFC 2JA8C 1TWHC 2A69A 3S17C 5C3EK 3M3YK 4A3CK 3S1QK 1IW7A 4Q4ZA 3FKIC 4A3GC 1I6VA 4BBSC 2E2HC 1XPPA 4OIOA 3HOUK 5FJ8K 3GTGC 4KMUA 4KN4A 1TWFK 4XSXA 4A3MC 2PMZD 2O5IA 3M3YC 4A3LK 4JK1A 3S1NC 4X6AK 3GTLK 2JA5C 2JA5K 3GTJC 5M5YK 4MQ9A 1WCMC 2B63K 4GZYA 5IYDC 1ZYRA 4Y52C 2NVQK 4OINA 2JA6C 3GTGK
chains in the Genus database with same CATH superfamily
3S1RK 4KATA 2NVTK 3GTOK 2V6TA 1JVIA 1JOEA 3GTKC 3WODA 2B63A 1JQWA 1TWCC 1VH2A 2PHCB 3TFIA 5IYBK 4XSZA 3S1MK 3A8JA 3GEIA 1HQMA 4MEXA 5EGHA 2ZUEA 3PO2C 5IOQA 3S16C 3TFJA 3GTQK 2R93A 1WQHA 5IYCC 4LOWA 4A3GK 3GTMK 5C44C 1TWGC 1XZPA 4YFXA 1L0WA 1ISEA 4A3BC 2JA6K 1DCHA 3GTMC 4KASA 2R93C 3HOXK 3HXAA 4GTFA 1O2FB 1TWGA 4A3EK 4WJ4A 3OREA 1B4BA 1XZQB 1WQFA 5IP7K 4XLPA 1R9TC 3GTJA 1WIHA 2RGRA 4BLAA 4A3EC 2XCRB 1WQGA 2E2JC 3EQLA 3I4NK 2ZFZA 1O27A 2P5MA 2NVYC 4BY1K 1X31C 1BDFA 4QIWD 3HOZC 2PA8D 4A93C 3HOYC 2GAGC 4OIPA 1WCMK 3GEHA 3GTOA 4NOIA 5M5WK 1C0AA 1VGXA 4FM9A 3N3YA 3S2HC 5IP9C 2Y0SD 3PO3C 5HL8A 3GTOC 3H0GK 4LQYA 1TWHK 4LK0A 1DD5A 4LJZA 4DDQA 3A8KA 3M4OC 3S1MC 4G7HA 4BY1C 4GTBA 3H0GC 4KARA 1TWAK 3GTMA 3OPFA 2JA8C 4LR2A 3S1QK 1USOA 4A3GC 2JA6A 3IPJA 1BJTA 4X6AK 3SZZA 1O24A 2JA5C 1R9TA 2R92A 3GTJC 4MQ9A 1F9NA 1ZYRA 3AD8C 4KC6A 4OINA 2JA6C 2NVYA 4O2DA 1IQ0A 4AYBL 3H3VD 3GTKK 2JA5A 2PA8L 4P5BA 4A3DK 4OIRA 2XCOA 5IYCK 2NVQC 4Y52K 4C3HK 4P5AA 2R7ZK 1Y1VC 2YU9K 1O2BA 4A3KC 1ZXOA 4A3IC 1I3QK 5CJ9A 1F7UA 2E2IC 4G0WA 4C3JK 3A8IA 3RZOK 2R93K 2VUMK 4C3IK 1XZPB 2BE5A 1Y1VA 4QJVB 3H0GA 2R7ZA 1ZVUA 3K7AC 3OEPA 4MEYA 3RZDK 3CQZK 3I4NC 2A68A 3SZYA 1TWAA 2V6SA 3LAJA 1K83K 2WAQL 3FOFA 1Y1WK 4QJVA 4BBSK 2Y0SL 5IP7C 2R92C 4GTLA 1SFOK 4YFNA 3I4MK 4BY7K 4BKWA 3BUEA 2NVTC 1Y1WC 2A6HA 2A6EA 1TWAC 2JA7C 1J98A 4BXXK 3GEEA 5M3MK 1EK8A 3FOEA 4A93K 5C4XC 4Y7NC 1USMA 4FZBA 3GTLC 4OIQA 1EI6A 1Y1WA 4A3JK 1VRQC 1I6HK 3FKIK 2JA7A 2WB1L 2E2IA 1XXCA 1TWFA 5FLMC 3S15C 3GIRA 3ERED 3CAGA 4KDDA 2P8TA 2R7ZC 3G4AA 4BLBA 2E2HK 1TWCK 3G4CA 1TWFC 4A3CK 3GDZA 3FKIC 2E2HC 4OIOA 3HOUK 2O5IA 1TWFK 4XSXA 4A3MC 5IOTA 1J6XA 1WORA 2CFAB 2B63K 4GZYA 4Y52C 2NVQK 2E2HA 3GTGK 3S1NK 5L46A 3HOVC 2EBBA 3BP3A 1R9TK 2KWAA 3GTLA 3HOVK 5C3EC 5TJ3A 3RZOC 3TFHA 1KQ4A 5D4DA 1YX2A 1DCOA 3V4GA 2JA7K 3RZDC 2RH6A 3L4KA 3PO3K 4YFKA 5CHPA 1EH1A 4A3LC 4G7OA 4KB2A 1HI9A 1VJEA 3S2DK 1WSRA 4XCHA 1IBAA 5TMCA 2JA8K 3MMLB 5C4JK 3HOZK 5EGEA 3CQZC 4LK1A 5C4JC 3FKIA 4BXXC 1WOOA 2W7VA 1WOPA 3S16K 5M3FK 5IP9K 2R92K 3AH5A 4AYBD 5TMFA 3I4MC 1EFWA 2CFAA 3CQZA 4RMFA 4GTDA 4A3JC 1PJ6A 1O25A 3GTPK 4Q5SA 3S1RC 2CW0A 1ZBSA 4GTCA 3PO2K 4GTEA 3HOXC 1BS2A 4A3DC 3S15K 4G0VA 2JH3A 5C44K 3DXJA 5IYBC 3S1QC 3GSIA 1TWGK 2GSUA 1EQRA 1B4AA 4GTAA 4C3JC 1SMYA 1IS1A 3GTJK 1Y1VK 3H3VL 4J3NA 4A3IK 3HOYK 4A3MK 2YU9C 2NVYK 3HOUC 5JVOA 2ZUFA 1G51A 1WOSA 3S17C 5JFEA 1WCMA 1IW7A 4Q4ZA 3GTPA 1I6VA 4BBSC 1XPPA 3T00A 2YU9A 5FJ8K 3GTGC 4A3LK 3S1NC 1AB4A 2PMZD 4KAWX 4JK1A 1PJ7A 1XXBA 3T01A 3NUHA 1XXAA 1WCMC 1BGWA 3M3YK 3JSTA 3GTGA 1VLOA 4GT9A 1I3QA 4C2MK 2E2JK 1SFOC 1J6WA 1DCPA 2WB1D 1XZQA 2PMZL 4BY7C 3S14C 4P9SA 1V5VA 2Y3PA 1F7VA 1YNJA 2XCQA 4BBRK 2GAHC 2FQTA 3AQOA 4KM9A 1K83C 2PPBA 2VUMA 2WAQD 3M4OK 5C4XK 3HKZL 4X6AC 4LLGA 3ADAC 5FLMK 3L4JA 3S2HK 3GTQA 3LAPA 5IORA 3VA7A 2NVXK 1O26A 3LPXA 1I6HC 1IL2A 1YNNA 1RU0A 2NVXC 4YG2A 3QX3A 4M1XA 4A3FC 4KMAA 3GTQC 4KN7A 3T02A 4Y7NK 4A3FK 3GTPC 2O5JA 5IOSA 3AD9C 4KMHA 1INNA 2GSNA 1PJ5A 3TTGA 5E68A 2GSOA 3AQPA 1O28A 4C3IC 4KM8A 1I50K 3FHZA 1I3QC 4PABA 1SFOA 2E2IK 4A3KK 3HKZD 3GTKA 2B63C 1TWCA 4XLNA 4A3BK 4KB4A 2FQOA 1I50C 4C3HC 1YCLA 1ZQ1C 1K83A 2D6FC 2VUMC 3S0XA 4A3CC 4GFQA 5M5XK 3S17K 3S2DC 4ILDA 4QIWL 1TWHA 1I50A 3HOWC 5IYDK 4ZH4A 4G7ZA 1IE0A 3HOWK 4WJ3M 4KMDA 2NVXA 3AD7C 3S14K 3K7AK 3N0CA 3Q3QA 4BBRC 1F93A 1UV7A 1TWHC 2A69A 5C3EK 4C45A 4AH6A 2V6UA 4C2MC 4PAAA 3M3YC 4KMUA 4KN4A 4G0UA 3N0BA 1O2AA 4WILA 3GTLK 2JA5K 5M5YK 1J6VA 5IYDC 1O29A 1GE9A 3BP8C 1WSVA
chains in the Genus database with same CATH topology
3S1RK 2NVTK 3HOVC 3GTOK 4C2MK 2E2JK 4AYBL 1SFOC 3H3VD 3GTKK 3GTKC 2WB1D 3WODA 1R9TK 1TWCC 2PMZL 2PA8L 3HOVK 4BY7C 5C3EC 3S14C 5IYBK 4A3DK 4OIRA 1YNJA 5IYCK 3RZOC 4XSZA 4BBRK 2NVQC 3S1MK 4Y52K 4C3HK 1HQMA 4MEXA 2R7ZK 1Y1VC 5D4DA 2YU9K 4A3KC 3PO2C 1K83C 2PPBA 3S16C 2WAQD 3M4OK 4A3IC 1I3QK 5C4XK 3GTQK 2JA7K 3HKZL 4X6AC 3RZDC 2E2IC 4LLGA 3PO3K 4YFKA 4A3LC 4G7OA 4C3JK 5FLMK 3S2HK 5IYCC 3RZOK 4A93C 2R93K 4A3GK 3GTMK 3S2DK 2VUMK 4C3IK 2BE5A 5C44C 2NVXK 1TWGC 5TMCA 1I6HC 4QJVB 1YNNA 4YFXA 2JA8K 4A3BC 2NVXC 4YG2A 3K7AC 2JA6K 4MEYA 3GTMC 3RZDK 5C4JK 4A3FC 2R93C 3GTQC 3HOXK 3HOZK 3CQZC 3CQZK 4KN7A 4Y7NK 3I4NC 2A68A 4LK1A 5C4JC 4A3FK 3GTPC 2O5JA 4BXXC 4A3EK 1Y1WK 1K83K 2WAQL 3S16K 4QJVA 5M3FK 5IP9K 4BBSK 2Y0SL 4AYBD 5IP7C 5IP7K 4XLPA 1R9TC 2R92K 2R92C 5TMFA 1SFOK 4YFNA 3I4MK 3I4MC 4BY7K 2NVTC 4A3EC 1Y1WC 2A6HA 4A3JC 2E2JC 1I50K 3EQLA 2A6EA 1TWAC 3GTPK 2JA7C 3I4NK 3S1RC 4Q5SA 2CW0A 1I3QC 2NVYC 4BY1K 4BXXK 1BDFA 4QIWD 5M3MK 2PA8D 4A3KK 2E2IK 3HOZC 3HOYC 3HKZD 3PO2K 4Y7NC 4A93K 4OIPA 1WCMK 2B63C 3GTLC 5C4XC 4XLNA 4NOIA 4OIQA 5M5WK 3HOXC 4A3BK 4A3DC 1I50C 3S15K 4A3JK 1I6HK 3FKIK 5C44K 3DXJA 5IYBC 2VUMC 3S1QC 4A3CC 5M5XK 1TWGK 3S2HC 3S17K 2WB1L 5IP9C 2Y0SD 3S2DC 3PO3C 4QIWL 3GTOC 3H0GK 5FLMC 1SMYA 3S15C 1TWHK 4LK0A 3HOWC 5IYDK 3GTJK 1Y1VK 3H3VL 4ZH4A 4LJZA 4A3IK 3HOYK 3M4OC 4G7ZA 3S1MC 3HOWK 4A3MK 2YU9C 4G7HA 2NVYK 4BY1C 2R7ZC 3HOUC 3S14K 3H0GC 2E2HK 3K7AK 1TWAK 4BBRC 1TWCK 3S1NK 1TWFC 2JA8C 1TWHC 2A69A 3S17C 5C3EK 3M3YK 4A3CK 3S1QK 1IW7A 4Q4ZA 3FKIC 4A3GC 1I6VA 4BBSC 2E2HC 1XPPA 4OIOA 3HOUK 5FJ8K 3GTGC 4KMUA 4KN4A 1TWFK 4XSXA 4A3MC 2PMZD 2O5IA 3M3YC 4A3LK 4JK1A 3S1NC 4X6AK 3GTLK 2JA5C 2JA5K 3GTJC 5M5YK 4MQ9A 1WCMC 2B63K 4GZYA 5IYDC 1ZYRA 4Y52C 2NVQK 4OINA 2JA6C 3GTGK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S1R K;  2NVT K;  3HOV C;  3GTO K;  4C2M K;  2E2J K;  4AYB L;  1SFO C;  3H3V D;  3GTK K;  3GTK C;  2WB1 D;  3WOD A;  1R9T K;  1TWC C;  2PMZ L;  2PA8 L;  3HOV K;  4BY7 C;  5C3E C;  3S14 C;  5IYB K;  4A3D K;  4OIR A;  1YNJ A;  5IYC K;  3RZO C;  4XSZ A;  4BBR K;  2NVQ C;  3S1M K;  4Y52 K;  4C3H K;  1HQM A;  4MEX A;  2R7Z K;  1Y1V C;  5D4D A;  2YU9 K;  4A3K C;  3PO2 C;  1K83 C;  2PPB A;  3S16 C;  2WAQ D;  3M4O K;  4A3I C;  1I3Q K;  5C4X K;  3GTQ K;  2JA7 K;  3HKZ L;  4X6A C;  3RZD C;  2E2I C;  4LLG A;  3PO3 K;  4YFK A;  4A3L C;  4G7O A;  4C3J K;  5FLM K;  3S2H K;  5IYC C;  3RZO K;  4A93 C;  2R93 K;  4A3G K;  3GTM K;  3S2D K;  2VUM K;  4C3I K;  2BE5 A;  5C44 C;  2NVX K;  1TWG C;  5TMC A;  1I6H C;  4QJV B;  1YNN A;  4YFX A;  2JA8 K;  4A3B C;  2NVX C;  4YG2 A;  3K7A C;  2JA6 K;  4MEY A;  3GTM C;  3RZD K;  5C4J K;  4A3F C;  2R93 C;  3GTQ C;  3HOX K;  3HOZ K;  3CQZ C;  3CQZ K;  4KN7 A;  4Y7N K;  3I4N C;  2A68 A;  4LK1 A;  5C4J C;  4A3F K;  3GTP C;  2O5J A;  4BXX C;  4A3E K;  1Y1W K;  1K83 K;  2WAQ L;  3S16 K;  4QJV A;  5M3F K;  5IP9 K;  4BBS K;  2Y0S L;  4AYB D;  5IP7 C;  5IP7 K;  4XLP A;  1R9T C;  2R92 K;  2R92 C;  5TMF A;  1SFO K;  4YFN A;  3I4M K;  3I4M C;  4BY7 K;  2NVT C;  4A3E C;  1Y1W C;  2A6H A;  4A3J C;  2E2J C;  1I50 K;  3EQL A;  2A6E A;  1TWA C;  3GTP K;  2JA7 C;  3I4N K;  3S1R C;  4Q5S A;  2CW0 A;  1I3Q C;  2NVY C;  4BY1 K;  4BXX K;  1BDF A;  4QIW D;  5M3M K;  2PA8 D;  4A3K K;  2E2I K;  3HOZ C;  3HOY C;  3HKZ D;  3PO2 K;  4Y7N C;  4A93 K;  4OIP A;  1WCM K;  2B63 C;  3GTL C;  5C4X C;  4XLN A;  4NOI A;  4OIQ A;  5M5W K;  3HOX C;  4A3B K;  4A3D C;  1I50 C;  3S15 K;  4A3J K;  1I6H K;  3FKI K;  5C44 K;  3DXJ A;  5IYB C;  2VUM C;  3S1Q C;  4A3C C;  5M5X K;  1TWG K;  3S2H C;  3S17 K;  2WB1 L;  5IP9 C;  2Y0S D;  3S2D C;  3PO3 C;  4QIW L;  3GTO C;  3H0G K;  5FLM C;  1SMY A;  3S15 C;  1TWH K;  4LK0 A;  3HOW C;  5IYD K;  3GTJ K;  1Y1V K;  3H3V L;  4ZH4 A;  4LJZ A;  4A3I K;  3HOY K;  3M4O C;  4G7Z A;  3S1M C;  3HOW K;  4A3M K;  2YU9 C;  4G7H A;  2NVY K;  4BY1 C;  2R7Z C;  3HOU C;  3S14 K;  3H0G C;  2E2H K;  3K7A K;  1TWA K;  4BBR C;  1TWC K;  3S1N K;  1TWF C;  2JA8 C;  1TWH C;  2A69 A;  3S17 C;  5C3E K;  3M3Y K;  4A3C K;  3S1Q K;  1IW7 A;  4Q4Z A;  3FKI C;  4A3G C;  1I6V A;  4BBS C;  2E2H C;  1XPP A;  4OIO A;  3HOU K;  5FJ8 K;  3GTG C;  4KMU A;  4KN4 A;  1TWF K;  4XSX A;  4A3M C;  2PMZ D;  2O5I A;  3M3Y C;  4A3L K;  4JK1 A;  3S1N C;  4X6A K;  3GTL K;  2JA5 C;  2JA5 K;  3GTJ C;  5M5Y K;  4MQ9 A;  1WCM C;  2B63 K;  4GZY A;  5IYD C;  1ZYR A;  4Y52 C;  2NVQ K;  4OIN A;  2JA6 C;  3GTG K; 
#chains in the Genus database with same CATH topology
 3S1R K;  4KAT A;  2NVT K;  3GTO K;  2V6T A;  1JVI A;  1JOE A;  3GTK C;  3WOD A;  2B63 A;  1JQW A;  1TWC C;  1VH2 A;  2PHC B;  3TFI A;  5IYB K;  4XSZ A;  3S1M K;  3A8J A;  3GEI A;  1HQM A;  4MEX A;  5EGH A;  2ZUE A;  3PO2 C;  5IOQ A;  3S16 C;  3TFJ A;  3GTQ K;  2R93 A;  1WQH A;  5IYC C;  4LOW A;  4A3G K;  3GTM K;  5C44 C;  1TWG C;  1XZP A;  4YFX A;  1L0W A;  1ISE A;  4A3B C;  2JA6 K;  1DCH A;  3GTM C;  4KAS A;  2R93 C;  3HOX K;  3HXA A;  4GTF A;  1O2F B;  1TWG A;  4A3E K;  4WJ4 A;  3ORE A;  1B4B A;  1XZQ B;  1WQF A;  5IP7 K;  4XLP A;  1R9T C;  3GTJ A;  1WIH A;  2RGR A;  4BLA A;  4A3E C;  2XCR B;  1WQG A;  2E2J C;  3EQL A;  3I4N K;  2ZFZ A;  1O27 A;  2P5M A;  2NVY C;  4BY1 K;  1X31 C;  1BDF A;  4QIW D;  3HOZ C;  2PA8 D;  4A93 C;  3HOY C;  2GAG C;  4OIP A;  1WCM K;  3GEH A;  3GTO A;  4NOI A;  5M5W K;  1C0A A;  1VGX A;  4FM9 A;  3N3Y A;  3S2H C;  5IP9 C;  2Y0S D;  3PO3 C;  5HL8 A;  3GTO C;  3H0G K;  4LQY A;  1TWH K;  4LK0 A;  1DD5 A;  4LJZ A;  4DDQ A;  3A8K A;  3M4O C;  3S1M C;  4G7H A;  4BY1 C;  4GTB A;  3H0G C;  4KAR A;  1TWA K;  3GTM A;  3OPF A;  2JA8 C;  4LR2 A;  3S1Q K;  1USO A;  4A3G C;  2JA6 A;  3IPJ A;  1BJT A;  4X6A K;  3SZZ A;  1O24 A;  2JA5 C;  1R9T A;  2R92 A;  3GTJ C;  4MQ9 A;  1F9N A;  1ZYR A;  3AD8 C;  4KC6 A;  4OIN A;  2JA6 C;  2NVY A;  4O2D A;  1IQ0 A;  4AYB L;  3H3V D;  3GTK K;  2JA5 A;  2PA8 L;  4P5B A;  4A3D K;  4OIR A;  2XCO A;  5IYC K;  2NVQ C;  4Y52 K;  4C3H K;  4P5A A;  2R7Z K;  1Y1V C;  2YU9 K;  1O2B A;  4A3K C;  1ZXO A;  4A3I C;  1I3Q K;  5CJ9 A;  1F7U A;  2E2I C;  4G0W A;  4C3J K;  3A8I A;  3RZO K;  2R93 K;  2VUM K;  4C3I K;  1XZP B;  2BE5 A;  1Y1V A;  4QJV B;  3H0G A;  2R7Z A;  1ZVU A;  3K7A C;  3OEP A;  4MEY A;  3RZD K;  3CQZ K;  3I4N C;  2A68 A;  3SZY A;  1TWA A;  2V6S A;  3LAJ A;  1K83 K;  2WAQ L;  3FOF A;  1Y1W K;  4QJV A;  4BBS K;  2Y0S L;  5IP7 C;  2R92 C;  4GTL A;  1SFO K;  4YFN A;  3I4M K;  4BY7 K;  4BKW A;  3BUE A;  2NVT C;  1Y1W C;  2A6H A;  2A6E A;  1TWA C;  2JA7 C;  1J98 A;  4BXX K;  3GEE A;  5M3M K;  1EK8 A;  3FOE A;  4A93 K;  5C4X C;  4Y7N C;  1USM A;  4FZB A;  3GTL C;  4OIQ A;  1EI6 A;  1Y1W A;  4A3J K;  1VRQ C;  1I6H K;  3FKI K;  2JA7 A;  2WB1 L;  2E2I A;  1XXC A;  1TWF A;  5FLM C;  3S15 C;  3GIR A;  3ERE D;  3CAG A;  4KDD A;  2P8T A;  2R7Z C;  3G4A A;  4BLB A;  2E2H K;  1TWC K;  3G4C A;  1TWF C;  4A3C K;  3GDZ A;  3FKI C;  2E2H C;  4OIO A;  3HOU K;  2O5I A;  1TWF K;  4XSX A;  4A3M C;  5IOT A;  1J6X A;  1WOR A;  2CFA B;  2B63 K;  4GZY A;  4Y52 C;  2NVQ K;  2E2H A;  3GTG K;  3S1N K;  5L46 A;  3HOV C;  2EBB A;  3BP3 A;  1R9T K;  2KWA A;  3GTL A;  3HOV K;  5C3E C;  5TJ3 A;  3RZO C;  3TFH A;  1KQ4 A;  5D4D A;  1YX2 A;  1DCO A;  3V4G A;  2JA7 K;  3RZD C;  2RH6 A;  3L4K A;  3PO3 K;  4YFK A;  5CHP A;  1EH1 A;  4A3L C;  4G7O A;  4KB2 A;  1HI9 A;  1VJE A;  3S2D K;  1WSR A;  4XCH A;  1IBA A;  5TMC A;  2JA8 K;  3MML B;  5C4J K;  3HOZ K;  5EGE A;  3CQZ C;  4LK1 A;  5C4J C;  3FKI A;  4BXX C;  1WOO A;  2W7V A;  1WOP A;  3S16 K;  5M3F K;  5IP9 K;  2R92 K;  3AH5 A;  4AYB D;  5TMF A;  3I4M C;  1EFW A;  2CFA A;  3CQZ A;  4RMF A;  4GTD A;  4A3J C;  1PJ6 A;  1O25 A;  3GTP K;  4Q5S A;  3S1R C;  2CW0 A;  1ZBS A;  4GTC A;  3PO2 K;  4GTE A;  3HOX C;  1BS2 A;  4A3D C;  3S15 K;  4G0V A;  2JH3 A;  5C44 K;  3DXJ A;  5IYB C;  3S1Q C;  3GSI A;  1TWG K;  2GSU A;  1EQR A;  1B4A A;  4GTA A;  4C3J C;  1SMY A;  1IS1 A;  3GTJ K;  1Y1V K;  3H3V L;  4J3N A;  4A3I K;  3HOY K;  4A3M K;  2YU9 C;  2NVY K;  3HOU C;  5JVO A;  2ZUF A;  1G51 A;  1WOS A;  3S17 C;  5JFE A;  1WCM A;  1IW7 A;  4Q4Z A;  3GTP A;  1I6V A;  4BBS C;  1XPP A;  3T00 A;  2YU9 A;  5FJ8 K;  3GTG C;  4A3L K;  3S1N C;  1AB4 A;  2PMZ D;  4KAW X;  4JK1 A;  1PJ7 A;  1XXB A;  3T01 A;  3NUH A;  1XXA A;  1WCM C;  1BGW A;  3M3Y K;  3JST A;  3GTG A;  1VLO A;  4GT9 A;  1I3Q A;  4C2M K;  2E2J K;  1SFO C;  1J6W A;  1DCP A;  2WB1 D;  1XZQ A;  2PMZ L;  4BY7 C;  3S14 C;  4P9S A;  1V5V A;  2Y3P A;  1F7V A;  1YNJ A;  2XCQ A;  4BBR K;  2GAH C;  2FQT A;  3AQO A;  4KM9 A;  1K83 C;  2PPB A;  2VUM A;  2WAQ D;  3M4O K;  5C4X K;  3HKZ L;  4X6A C;  4LLG A;  3ADA C;  5FLM K;  3L4J A;  3S2H K;  3GTQ A;  3LAP A;  5IOR A;  3VA7 A;  2NVX K;  1O26 A;  3LPX A;  1I6H C;  1IL2 A;  1YNN A;  1RU0 A;  2NVX C;  4YG2 A;  3QX3 A;  4M1X A;  4A3F C;  4KMA A;  3GTQ C;  4KN7 A;  3T02 A;  4Y7N K;  4A3F K;  3GTP C;  2O5J A;  5IOS A;  3AD9 C;  4KMH A;  1INN A;  2GSN A;  1PJ5 A;  3TTG A;  5E68 A;  2GSO A;  3AQP A;  1O28 A;  4C3I C;  4KM8 A;  1I50 K;  3FHZ A;  1I3Q C;  4PAB A;  1SFO A;  2E2I K;  4A3K K;  3HKZ D;  3GTK A;  2B63 C;  1TWC A;  4XLN A;  4A3B K;  4KB4 A;  2FQO A;  1I50 C;  4C3H C;  1YCL A;  1ZQ1 C;  1K83 A;  2D6F C;  2VUM C;  3S0X A;  4A3C C;  4GFQ A;  5M5X K;  3S17 K;  3S2D C;  4ILD A;  4QIW L;  1TWH A;  1I50 A;  3HOW C;  5IYD K;  4ZH4 A;  4G7Z A;  1IE0 A;  3HOW K;  4WJ3 M;  4KMD A;  2NVX A;  3AD7 C;  3S14 K;  3K7A K;  3N0C A;  3Q3Q A;  4BBR C;  1F93 A;  1UV7 A;  1TWH C;  2A69 A;  5C3E K;  4C45 A;  4AH6 A;  2V6U A;  4C2M C;  4PAA A;  3M3Y C;  4KMU A;  4KN4 A;  4G0U A;  3N0B A;  1O2A A;  4WIL A;  3GTL K;  2JA5 K;  5M5Y K;  1J6V A;  5IYD C;  1O29 A;  1GE9 A;  3BP8 C;  1WSV A; 
#chains in the Genus database with same CATH homology
 3S1R K;  2NVT K;  3HOV C;  3GTO K;  4C2M K;  2E2J K;  4AYB L;  1SFO C;  3H3V D;  3GTK K;  3GTK C;  2WB1 D;  3WOD A;  1R9T K;  1TWC C;  2PMZ L;  2PA8 L;  3HOV K;  4BY7 C;  5C3E C;  3S14 C;  5IYB K;  4A3D K;  4OIR A;  1YNJ A;  5IYC K;  3RZO C;  4XSZ A;  4BBR K;  2NVQ C;  3S1M K;  4Y52 K;  4C3H K;  1HQM A;  4MEX A;  2R7Z K;  1Y1V C;  5D4D A;  2YU9 K;  4A3K C;  3PO2 C;  1K83 C;  2PPB A;  3S16 C;  2WAQ D;  3M4O K;  4A3I C;  1I3Q K;  5C4X K;  3GTQ K;  2JA7 K;  3HKZ L;  4X6A C;  3RZD C;  2E2I C;  4LLG A;  3PO3 K;  4YFK A;  4A3L C;  4G7O A;  4C3J K;  5FLM K;  3S2H K;  5IYC C;  3RZO K;  4A93 C;  2R93 K;  4A3G K;  3GTM K;  3S2D K;  2VUM K;  4C3I K;  2BE5 A;  5C44 C;  2NVX K;  1TWG C;  5TMC A;  1I6H C;  4QJV B;  1YNN A;  4YFX A;  2JA8 K;  4A3B C;  2NVX C;  4YG2 A;  3K7A C;  2JA6 K;  4MEY A;  3GTM C;  3RZD K;  5C4J K;  4A3F C;  2R93 C;  3GTQ C;  3HOX K;  3HOZ K;  3CQZ C;  3CQZ K;  4KN7 A;  4Y7N K;  3I4N C;  2A68 A;  4LK1 A;  5C4J C;  4A3F K;  3GTP C;  2O5J A;  4BXX C;  4A3E K;  1Y1W K;  1K83 K;  2WAQ L;  3S16 K;  4QJV A;  5M3F K;  5IP9 K;  4BBS K;  2Y0S L;  4AYB D;  5IP7 C;  5IP7 K;  4XLP A;  1R9T C;  2R92 K;  2R92 C;  5TMF A;  1SFO K;  4YFN A;  3I4M K;  3I4M C;  4BY7 K;  2NVT C;  4A3E C;  1Y1W C;  2A6H A;  4A3J C;  2E2J C;  1I50 K;  3EQL A;  2A6E A;  1TWA C;  3GTP K;  2JA7 C;  3I4N K;  3S1R C;  4Q5S A;  2CW0 A;  1I3Q C;  2NVY C;  4BY1 K;  4BXX K;  1BDF A;  4QIW D;  5M3M K;  2PA8 D;  4A3K K;  2E2I K;  3HOZ C;  3HOY C;  3HKZ D;  3PO2 K;  4Y7N C;  4A93 K;  4OIP A;  1WCM K;  2B63 C;  3GTL C;  5C4X C;  4XLN A;  4NOI A;  4OIQ A;  5M5W K;  3HOX C;  4A3B K;  4A3D C;  1I50 C;  3S15 K;  4A3J K;  1I6H K;  3FKI K;  5C44 K;  3DXJ A;  5IYB C;  2VUM C;  3S1Q C;  4A3C C;  5M5X K;  1TWG K;  3S2H C;  3S17 K;  2WB1 L;  5IP9 C;  2Y0S D;  3S2D C;  3PO3 C;  4QIW L;  3GTO C;  3H0G K;  5FLM C;  1SMY A;  3S15 C;  1TWH K;  4LK0 A;  3HOW C;  5IYD K;  3GTJ K;  1Y1V K;  3H3V L;  4ZH4 A;  4LJZ A;  4A3I K;  3HOY K;  3M4O C;  4G7Z A;  3S1M C;  3HOW K;  4A3M K;  2YU9 C;  4G7H A;  2NVY K;  4BY1 C;  2R7Z C;  3HOU C;  3S14 K;  3H0G C;  2E2H K;  3K7A K;  1TWA K;  4BBR C;  1TWC K;  3S1N K;  1TWF C;  2JA8 C;  1TWH C;  2A69 A;  3S17 C;  5C3E K;  3M3Y K;  4A3C K;  3S1Q K;  1IW7 A;  4Q4Z A;  3FKI C;  4A3G C;  1I6V A;  4BBS C;  2E2H C;  1XPP A;  4OIO A;  3HOU K;  5FJ8 K;  3GTG C;  4KMU A;  4KN4 A;  1TWF K;  4XSX A;  4A3M C;  2PMZ D;  2O5I A;  3M3Y C;  4A3L K;  4JK1 A;  3S1N C;  4X6A K;  3GTL K;  2JA5 C;  2JA5 K;  3GTJ C;  5M5Y K;  4MQ9 A;  1WCM C;  2B63 K;  4GZY A;  5IYD C;  1ZYR A;  4Y52 C;  2NVQ K;  4OIN A;  2JA6 C;  3GTG K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...