2JA6K

Cpd lesion containing rna polymerase ii elongation complex b
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II LARGEST SUBUNIT
publication title CPD damage recognition by transcribing RNA polymerase II.
pubmed doi rcsb
molecule tags Transferase
total genus 24
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2006-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2ja6K00
1TWHK 3S1QC 4BXXC 4A3DK 4X6AK 5IP7C 5IYDC 4A3IK 2B63K 3GTGC 1TWHC 3HOXK 2NVXC 2A6EA 3GTJK 2R7ZK 4A3JC 5FLMK 1SMYA 3GTLK 4YFNA 2WB1L 3DXJA 2O5IA 4QIWL 4C3HK 3GTQK 5IYCK 2PA8D 5FLMC 4A3EC 4Q4ZA 1TWCC 4G7HA 2NVYC 3PO3C 4JK1A 4BY1C 5IP9K 5D4DA 3PO2K 3S15K 3K7AK 3S1NC 3S14C 4YG2A 3S2HC 3S17K 3I4NC 3HOVC 4GZYA 4A3MK 1SFOK 4QJVA 3GTPC 4BXXK 4OIOA 4G7OA 5IP7K 4A93K 5IYDK 2JA7C 4BBSC 1I6HC 2BE5A 4QJVB 1WCMC 4YFXA 4OINA 3GTGK 4A3BC 2NVXK 4OIQA 4A3KC 4A93C 3HOWC 4LLGA 4C3IK 2JA8C 4A3JK 4LK0A 5C44K 2PA8L 2YU9K 5M3FK 4A3GC 3I4MC 5C4XK 4A3EK 5IYBK 3FKIC 5C44C 2NVTC 2WAQD 4NOIA 2YU9C 1TWCK 4XLNA 4A3CC 2R93C 2NVYK 2JA6C 4MEYA 3HOYK 2VUMC 3PO3K 4BY1K 2O5JA 1ZYRA 5IYBC 2PPBA 1TWFC 3S1NK 2E2IK 3S14K 3RZOC 1K83C 4XSXA 3EQLA 4ZH4A 5C3EK 5M5XK 2E2JC 2JA5C 3HOYC 3S2HK 3I4NK 2R92C 2E2IC 3HOVK 5C3EC 3GTPK 1TWGK 4YFKA 2JA7K 3GTMC 3CQZC 3H0GC 4XLPA 3M3YC 4BY7C 4BBSK 3H3VD 1WCMK 4A3BK 1I6HK 1TWGC 5FJ8K 1Y1VK 4A3KK 4Y52C 3HOWK 2JA8K 3S16C 1XPPA 1YNJA 5C4JC 4OIPA 3HKZD 1YNNA 3I4MK 1Y1VC 1TWAC 4A3FK 1R9TC 3HOUK 2E2HK 2PMZD 3M4OK 3FKIK 1I50K 2NVTK 4A3CK 3WODA 3GTOC 2R93K 2JA6K 5C4XC 4KMUA 4A3FC 2VUMK 1I6VA 2E2HC 3HOUC 3M4OC 4KN4A 1TWFK 1I50C 3RZOK 1K83K 2E2JK 2JA5K 2WB1D 4AYBD 4QIWD 4BY7K 2R92K 4Y52K 3S2DC 3RZDC 4Y7NC 3GTMK 4KN7A 3CQZK 2Y0SD 3H0GK 4LJZA 3GTKK 3M3YK 1IW7A 3HOZC 2A6HA 3HKZL 3GTKC 3S16K 2A69A 5M5WK 1BDFA 5C4JK 2PMZL 4A3LC 3S1RC 1TWAK 4XSZA 1Y1WC 1R9TK 4X6AC 4A3DC 4C2MK 3GTOK 2A68A 2WAQL 4A3IC 2B63C 5TMFA 3HOXC 4A3MC 1SFOC 4AYBL 4MEXA 3GTJC 2NVQK 5TMCA 5M3MK 4C3JK 2R7ZC 3GTLC 4G7ZA 1HQMA 3S1MK 4Q5SA 3S2DK 2Y0SL 2NVQC 5IYCC 4BBRK 3RZDK 3GTQC 5M5YK 4Y7NK 3S1MC 1I3QK 4OIRA 4BBRC 5IP9C 3H3VL 3HOZK 3PO2C 3K7AC 2CW0A 4MQ9A 3S15C 4A3GK 1I3QC 3S1QK 3S17C 4A3LK 3S1RK 1Y1WK 4LK1A
chains in the Genus database with same CATH superfamily
4GTEA 4A3DK 3AD7C 1USMA 3G4CA 3N0CA 3GTJK 4YFNA 5IOQA 2E2HA 3A8JA 3OREA 4Q4ZA 1TWCC 1BJTA 1YX2A 2FQOA 2CFAA 4GZYA 3GTKA 3CQZA 2JA7C 1I6HC 3TFIA 1J6WA 4BLBA 2GSNA 3GTGK 4A3BC 3IPJA 2NVXK 4GTLA 4OIQA 3HOWC 1B4BA 4GT9A 4LLGA 2XCRB 2JA8C 1AB4A 2PA8L 2YU9K 1VJEA 5HL8A 4KB4A 2NVYK 3PO3K 5C4XC 3QX3A 1ZYRA 5IYBC 1K83C 4XSXA 3GEEA 1XXBA 1O2BA 5EGHA 2W7VA 4YFKA 3M3YC 3N3YA 1DCHA 1WCMK 4P9SA 1Y1VK 1WIHA 3BP8C 4Y52C 1DCPA 1XPPA 4RMFA 3I4MK 1R9TC 3JSTA 3FKIK 1I50K 4C45A 2NVTK 3WODA 4A3CK 2R93K 2JA6K 4A3FC 2VUMK 2E2HC 4KN4A 1J6VA 2E2JK 2JA5K 3AD8C 4AYBD 5CHPA 2R92K 4WJ4A 3RZDC 4LQYA 2D6FC 4KN7A 3H0GK 1PJ7A 2Y0SD 4GTAA 4KASA 4J3NA 2A6HA 3HKZL 3GTKC 3S16K 1VH2A 1WCMA 3TFHA 3S1RC 4KB2A 3GIRA 4A3DC 3G4AA 1O28A 2WAQL 3GTOK 5TMFA 4KM9A 3N0BA 3FKIA 3GTJC 5TMCA 2NVQK 1INNA 2R93A 1J6XA 1TWCA 1BS2A 3S1MC 4OIRA 3HOZK 2E2IA 3NUHA 1DCOA 2CW0A 4A3GK 3ADAC 1DD5A 1XZQB 1Y1WK 5EGEA 1TWHK 1WOPA 2JA7A 4KMDA 4A3IK 3GTGC 1ZXOA 2NVXC 2R7ZK 5FLMK 3GTLK 2WB1L 5JFEA 2O5IA 4QIWL 1JVIA 4C3HK 3HXAA 1O26A 2NVYC 3PO3C 4JK1A 5IP9K 5D4DA 3K7AK 1K83A 1XZQA 1ZVUA 4BXXK 5IYDK 1B4AA 2PHCB 4YFXA 1WCMC 4OINA 1EFWA 4A93C 2V6UA 3FOFA 5C44K 1R9TA 3I4MC 1V5VA 3SZYA 3FKIC 2NVTC 4A3CC 4NOIA 1WQFA 2R93C 2JA6C 3HOYK 2P8TA 2VUMC 2O5JA 4BY1K 2PPBA 3S1NK 3S14K 5C3EK 2E2JC 3EQLA 2JA5C 2Y3PA 2GSUA 4KATA 2R92C 2E2IC 3HOVK 3GTPK 2ZUEA 1TWGK 3T01A 3H0GC 4BBSK 3GEIA 1XXAA 1X31C 4XCHA 4XLPA 1F7UA 3GDZA 4A3KK 3S16C 4OIPA 1J98A 1F7VA 3VA7A 1VGXA 3M4OK 3GTOC 1GE9A 4KMUA 3HOUC 1EK8A 1TWFK 3GTJA 3RZOK 3AQOA 1IBAA 3GTMK 4LJZA 1IW7A 3HOZC 4LOWA 5C4JK 3FOEA 1XXCA 4KMHA 1Y1WC 4FM9A 4C2MK 3A8IA 4GTFA 2A68A 4A3IC 3GTGA 2NVXA 1WOOA 4AYBL 4MEXA 2R7ZC 5JVOA 2YU9A 3GTLC 4GTDA 1HQMA 4LR2A 3S2DK 4C3HC 2Y0SL 1TWFA 1F9NA 4BBRK 1O25A 5M5YK 2NVYA 3GSIA 4Y7NK 1I3QK 3AH5A 5IP9C 3H3VL 3K7AC 4KM8A 1PJ6A 4KARA 4LK1A 3S1QC 4BXXC 4M1XA 1F93A 5IYDC 1EH1A 2B63K 3MMLB 3TFJA 4P5AA 1Y1VA 2A6EA 3LAJA 1SMYA 2EBBA 3DXJA 3GTQK 1I50A 1O29A 2JA6A 4G7HA 2VUMA 1JOEA 3TTGA 5IOTA 2V6TA 4BY1C 3S1NC 2JA5A 3S14C 2ZFZA 3S17K 2R92A 3HOVC 4A3MK 1SFOK 4QJVA 3GTPC 1YCLA 4OIOA 4G7OA 5IP7K 3H0GA 5L46A 1IQ0A 4BBSC 1ZBSA 4A3KC 4C3IK 4A3JK 5C4XK 4A3EK 5IYBK 3GTOA 2WAQD 2YU9C 4XLNA 4MEYA 2XCOA 1TWFC 3RZOC 4FZBA 4ZH4A 3S2HK 3I4NK 4BKWA 5IOSA 1O2AA 5TJ3A 3GTMC 3GEHA 4Y52K 2KWAA 5FJ8K 5C4JC 1WSVA 1YNNA 3L4JA 1Y1WA 1Y1VC 1TWHA 4A3FK 1JQWA 2E2HK 2PMZD 4C2MC 4KAWX 1I6VA 1UV7A 1I50C 4GTBA 2R7ZA 1WSRA 3GTLA 2WB1D 4QIWD 3S2DC 4BLAA 4Y7NC 4BY7K 3GTKK 3T00A 3CQZK 3S0XA 4G0VA 4G0WA 2A69A 5M5WK 1BDFA 3Q3QA 1TWAK 4XSZA 1EQRA 3CAGA 5IORA 2B63C 2V6SA 3LPXA 1IE0A 4DDQA 2GAGC 4C3JK 4G7ZA 3S1MK 3GTQC 2NVQC 1RU0A 4MQ9A 3S17C 4A3LK 3GTPA 4A3GC 4A3MC 1SFOC 1TWGA 4X6AK 5IP7C 1L0WA 1TWHC 3HOXK 1TWAA 3T02A 4C3IC 4A3JC 3BP3A 4WJ3M 1BGWA 2FQTA 5IYCK 2PA8D 5FLMC 4A3EC 4KMAA 3PO2K 3S15K 4YG2A 4P5BA 3S2HC 1PJ5A 3I4NC 3ERED 1O27A 3L4KA 3GTMA 4A93K 1HI9A 2ZUFA 2BE5A 4QJVB 2XCQA 4LK0A 2RGRA 2RH6A 5M3FK 4PABA 1EI6A 5C44C 1TWCK 1WOSA 1VRQC 5E68A 3BUEA 4KC6A 2E2IK 1USOA 3A8KA 2GSOA 5M5XK 3HOYC 1WQGA 3OPFA 5C3EC 1I3QA 4BY7C 2JA7K 3CQZC 1I6HK 3H3VD 1VLOA 4A3BK 1TWGC 3HOWK 2JA8K 1YNJA 3HKZD 3V4GA 1TWAC 1IL2A 3HOUK 4GTCA 1C0AA 2B63A 1XZPB 4KDDA 3M4OC 1K83K 3FHZA 4C3JC 4PAAA 3GTQA 1IS1A 1WORA 3M3YK 1O24A 1G51A 4G0UA 2P5MA 2PMZL 4ILDA 4A3LC 3AD9C 1SFOA 3LAPA 4GFQA 1R9TK 2GAHC 4X6AC 1KQ4A 1XZPA 3OEPA 3HOXC 1O2FB 1ZQ1C 2JH3A 4AH6A 1WQHA 5M3MK 4Q5SA 5IYCC 3RZDK 3SZZA 5CJ9A 4BBRC 1ISEA 3AQPA 3PO2C 3S15C 4O2DA 1I3QC 3S1QK 2CFAB 4WILA 3S1RK
chains in the Genus database with same CATH topology
1TWHK 3S1QC 4BXXC 4A3DK 4X6AK 5IP7C 5IYDC 4A3IK 2B63K 3GTGC 1TWHC 3HOXK 2NVXC 2A6EA 3GTJK 2R7ZK 4A3JC 5FLMK 1SMYA 3GTLK 4YFNA 2WB1L 3DXJA 2O5IA 4QIWL 4C3HK 3GTQK 5IYCK 2PA8D 5FLMC 4A3EC 4Q4ZA 1TWCC 4G7HA 2NVYC 3PO3C 4JK1A 4BY1C 5IP9K 5D4DA 3PO2K 3S15K 3K7AK 3S1NC 3S14C 4YG2A 3S2HC 3S17K 3I4NC 3HOVC 4GZYA 4A3MK 1SFOK 4QJVA 3GTPC 4BXXK 4OIOA 4G7OA 5IP7K 4A93K 5IYDK 2JA7C 4BBSC 1I6HC 2BE5A 4QJVB 1WCMC 4YFXA 4OINA 3GTGK 4A3BC 2NVXK 4OIQA 4A3KC 4A93C 3HOWC 4LLGA 4C3IK 2JA8C 4A3JK 4LK0A 5C44K 2PA8L 2YU9K 5M3FK 4A3GC 3I4MC 5C4XK 4A3EK 5IYBK 3FKIC 5C44C 2NVTC 2WAQD 4NOIA 2YU9C 1TWCK 4XLNA 4A3CC 2R93C 2NVYK 2JA6C 4MEYA 3HOYK 2VUMC 3PO3K 4BY1K 2O5JA 1ZYRA 5IYBC 2PPBA 1TWFC 3S1NK 2E2IK 3S14K 3RZOC 1K83C 4XSXA 3EQLA 4ZH4A 5C3EK 5M5XK 2E2JC 2JA5C 3HOYC 3S2HK 3I4NK 2R92C 2E2IC 3HOVK 5C3EC 3GTPK 1TWGK 4YFKA 2JA7K 3GTMC 3CQZC 3H0GC 4XLPA 3M3YC 4BY7C 4BBSK 3H3VD 1WCMK 4A3BK 1I6HK 1TWGC 5FJ8K 1Y1VK 4A3KK 4Y52C 3HOWK 2JA8K 3S16C 1XPPA 1YNJA 5C4JC 4OIPA 3HKZD 1YNNA 3I4MK 1Y1VC 1TWAC 4A3FK 1R9TC 3HOUK 2E2HK 2PMZD 3M4OK 3FKIK 1I50K 2NVTK 4A3CK 3WODA 3GTOC 2R93K 2JA6K 5C4XC 4KMUA 4A3FC 2VUMK 1I6VA 2E2HC 3HOUC 3M4OC 4KN4A 1TWFK 1I50C 3RZOK 1K83K 2E2JK 2JA5K 2WB1D 4AYBD 4QIWD 4BY7K 2R92K 4Y52K 3S2DC 3RZDC 4Y7NC 3GTMK 4KN7A 3CQZK 2Y0SD 3H0GK 4LJZA 3GTKK 3M3YK 1IW7A 3HOZC 2A6HA 3HKZL 3GTKC 3S16K 2A69A 5M5WK 1BDFA 5C4JK 2PMZL 4A3LC 3S1RC 1TWAK 4XSZA 1Y1WC 1R9TK 4X6AC 4A3DC 4C2MK 3GTOK 2A68A 2WAQL 4A3IC 2B63C 5TMFA 3HOXC 4A3MC 1SFOC 4AYBL 4MEXA 3GTJC 2NVQK 5TMCA 5M3MK 4C3JK 2R7ZC 3GTLC 4G7ZA 1HQMA 3S1MK 4Q5SA 3S2DK 2Y0SL 2NVQC 5IYCC 4BBRK 3RZDK 3GTQC 5M5YK 4Y7NK 3S1MC 1I3QK 4OIRA 4BBRC 5IP9C 3H3VL 3HOZK 3PO2C 3K7AC 2CW0A 4MQ9A 3S15C 4A3GK 1I3QC 3S1QK 3S17C 4A3LK 3S1RK 1Y1WK 4LK1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TWH K;  3S1Q C;  4BXX C;  4A3D K;  4X6A K;  5IP7 C;  5IYD C;  4A3I K;  2B63 K;  3GTG C;  1TWH C;  3HOX K;  2NVX C;  2A6E A;  3GTJ K;  2R7Z K;  4A3J C;  5FLM K;  1SMY A;  3GTL K;  4YFN A;  2WB1 L;  3DXJ A;  2O5I A;  4QIW L;  4C3H K;  3GTQ K;  5IYC K;  2PA8 D;  5FLM C;  4A3E C;  4Q4Z A;  1TWC C;  4G7H A;  2NVY C;  3PO3 C;  4JK1 A;  4BY1 C;  5IP9 K;  5D4D A;  3PO2 K;  3S15 K;  3K7A K;  3S1N C;  3S14 C;  4YG2 A;  3S2H C;  3S17 K;  3I4N C;  3HOV C;  4GZY A;  4A3M K;  1SFO K;  4QJV A;  3GTP C;  4BXX K;  4OIO A;  4G7O A;  5IP7 K;  4A93 K;  5IYD K;  2JA7 C;  4BBS C;  1I6H C;  2BE5 A;  4QJV B;  1WCM C;  4YFX A;  4OIN A;  3GTG K;  4A3B C;  2NVX K;  4OIQ A;  4A3K C;  4A93 C;  3HOW C;  4LLG A;  4C3I K;  2JA8 C;  4A3J K;  4LK0 A;  5C44 K;  2PA8 L;  2YU9 K;  5M3F K;  4A3G C;  3I4M C;  5C4X K;  4A3E K;  5IYB K;  3FKI C;  5C44 C;  2NVT C;  2WAQ D;  4NOI A;  2YU9 C;  1TWC K;  4XLN A;  4A3C C;  2R93 C;  2NVY K;  2JA6 C;  4MEY A;  3HOY K;  2VUM C;  3PO3 K;  4BY1 K;  2O5J A;  1ZYR A;  5IYB C;  2PPB A;  1TWF C;  3S1N K;  2E2I K;  3S14 K;  3RZO C;  1K83 C;  4XSX A;  3EQL A;  4ZH4 A;  5C3E K;  5M5X K;  2E2J C;  2JA5 C;  3HOY C;  3S2H K;  3I4N K;  2R92 C;  2E2I C;  3HOV K;  5C3E C;  3GTP K;  1TWG K;  4YFK A;  2JA7 K;  3GTM C;  3CQZ C;  3H0G C;  4XLP A;  3M3Y C;  4BY7 C;  4BBS K;  3H3V D;  1WCM K;  4A3B K;  1I6H K;  1TWG C;  5FJ8 K;  1Y1V K;  4A3K K;  4Y52 C;  3HOW K;  2JA8 K;  3S16 C;  1XPP A;  1YNJ A;  5C4J C;  4OIP A;  3HKZ D;  1YNN A;  3I4M K;  1Y1V C;  1TWA C;  4A3F K;  1R9T C;  3HOU K;  2E2H K;  2PMZ D;  3M4O K;  3FKI K;  1I50 K;  2NVT K;  4A3C K;  3WOD A;  3GTO C;  2R93 K;  2JA6 K;  5C4X C;  4KMU A;  4A3F C;  2VUM K;  1I6V A;  2E2H C;  3HOU C;  3M4O C;  4KN4 A;  1TWF K;  1I50 C;  3RZO K;  1K83 K;  2E2J K;  2JA5 K;  2WB1 D;  4AYB D;  4QIW D;  4BY7 K;  2R92 K;  4Y52 K;  3S2D C;  3RZD C;  4Y7N C;  3GTM K;  4KN7 A;  3CQZ K;  2Y0S D;  3H0G K;  4LJZ A;  3GTK K;  3M3Y K;  1IW7 A;  3HOZ C;  2A6H A;  3HKZ L;  3GTK C;  3S16 K;  2A69 A;  5M5W K;  1BDF A;  5C4J K;  2PMZ L;  4A3L C;  3S1R C;  1TWA K;  4XSZ A;  1Y1W C;  1R9T K;  4X6A C;  4A3D C;  4C2M K;  3GTO K;  2A68 A;  2WAQ L;  4A3I C;  2B63 C;  5TMF A;  3HOX C;  4A3M C;  1SFO C;  4AYB L;  4MEX A;  3GTJ C;  2NVQ K;  5TMC A;  5M3M K;  4C3J K;  2R7Z C;  3GTL C;  4G7Z A;  1HQM A;  3S1M K;  4Q5S A;  3S2D K;  2Y0S L;  2NVQ C;  5IYC C;  4BBR K;  3RZD K;  3GTQ C;  5M5Y K;  4Y7N K;  3S1M C;  1I3Q K;  4OIR A;  4BBR C;  5IP9 C;  3H3V L;  3HOZ K;  3PO2 C;  3K7A C;  2CW0 A;  4MQ9 A;  3S15 C;  4A3G K;  1I3Q C;  3S1Q K;  3S17 C;  4A3L K;  3S1R K;  1Y1W K;  4LK1 A; 
#chains in the Genus database with same CATH topology
 4GTE A;  4A3D K;  3AD7 C;  1USM A;  3G4C A;  3N0C A;  3GTJ K;  4YFN A;  5IOQ A;  2E2H A;  3A8J A;  3ORE A;  4Q4Z A;  1TWC C;  1BJT A;  1YX2 A;  2FQO A;  2CFA A;  4GZY A;  3GTK A;  3CQZ A;  2JA7 C;  1I6H C;  3TFI A;  1J6W A;  4BLB A;  2GSN A;  3GTG K;  4A3B C;  3IPJ A;  2NVX K;  4GTL A;  4OIQ A;  3HOW C;  1B4B A;  4GT9 A;  4LLG A;  2XCR B;  2JA8 C;  1AB4 A;  2PA8 L;  2YU9 K;  1VJE A;  5HL8 A;  4KB4 A;  2NVY K;  3PO3 K;  5C4X C;  3QX3 A;  1ZYR A;  5IYB C;  1K83 C;  4XSX A;  3GEE A;  1XXB A;  1O2B A;  5EGH A;  2W7V A;  4YFK A;  3M3Y C;  3N3Y A;  1DCH A;  1WCM K;  4P9S A;  1Y1V K;  1WIH A;  3BP8 C;  4Y52 C;  1DCP A;  1XPP A;  4RMF A;  3I4M K;  1R9T C;  3JST A;  3FKI K;  1I50 K;  4C45 A;  2NVT K;  3WOD A;  4A3C K;  2R93 K;  2JA6 K;  4A3F C;  2VUM K;  2E2H C;  4KN4 A;  1J6V A;  2E2J K;  2JA5 K;  3AD8 C;  4AYB D;  5CHP A;  2R92 K;  4WJ4 A;  3RZD C;  4LQY A;  2D6F C;  4KN7 A;  3H0G K;  1PJ7 A;  2Y0S D;  4GTA A;  4KAS A;  4J3N A;  2A6H A;  3HKZ L;  3GTK C;  3S16 K;  1VH2 A;  1WCM A;  3TFH A;  3S1R C;  4KB2 A;  3GIR A;  4A3D C;  3G4A A;  1O28 A;  2WAQ L;  3GTO K;  5TMF A;  4KM9 A;  3N0B A;  3FKI A;  3GTJ C;  5TMC A;  2NVQ K;  1INN A;  2R93 A;  1J6X A;  1TWC A;  1BS2 A;  3S1M C;  4OIR A;  3HOZ K;  2E2I A;  3NUH A;  1DCO A;  2CW0 A;  4A3G K;  3ADA C;  1DD5 A;  1XZQ B;  1Y1W K;  5EGE A;  1TWH K;  1WOP A;  2JA7 A;  4KMD A;  4A3I K;  3GTG C;  1ZXO A;  2NVX C;  2R7Z K;  5FLM K;  3GTL K;  2WB1 L;  5JFE A;  2O5I A;  4QIW L;  1JVI A;  4C3H K;  3HXA A;  1O26 A;  2NVY C;  3PO3 C;  4JK1 A;  5IP9 K;  5D4D A;  3K7A K;  1K83 A;  1XZQ A;  1ZVU A;  4BXX K;  5IYD K;  1B4A A;  2PHC B;  4YFX A;  1WCM C;  4OIN A;  1EFW A;  4A93 C;  2V6U A;  3FOF A;  5C44 K;  1R9T A;  3I4M C;  1V5V A;  3SZY A;  3FKI C;  2NVT C;  4A3C C;  4NOI A;  1WQF A;  2R93 C;  2JA6 C;  3HOY K;  2P8T A;  2VUM C;  2O5J A;  4BY1 K;  2PPB A;  3S1N K;  3S14 K;  5C3E K;  2E2J C;  3EQL A;  2JA5 C;  2Y3P A;  2GSU A;  4KAT A;  2R92 C;  2E2I C;  3HOV K;  3GTP K;  2ZUE A;  1TWG K;  3T01 A;  3H0G C;  4BBS K;  3GEI A;  1XXA A;  1X31 C;  4XCH A;  4XLP A;  1F7U A;  3GDZ A;  4A3K K;  3S16 C;  4OIP A;  1J98 A;  1F7V A;  3VA7 A;  1VGX A;  3M4O K;  3GTO C;  1GE9 A;  4KMU A;  3HOU C;  1EK8 A;  1TWF K;  3GTJ A;  3RZO K;  3AQO A;  1IBA A;  3GTM K;  4LJZ A;  1IW7 A;  3HOZ C;  4LOW A;  5C4J K;  3FOE A;  1XXC A;  4KMH A;  1Y1W C;  4FM9 A;  4C2M K;  3A8I A;  4GTF A;  2A68 A;  4A3I C;  3GTG A;  2NVX A;  1WOO A;  4AYB L;  4MEX A;  2R7Z C;  5JVO A;  2YU9 A;  3GTL C;  4GTD A;  1HQM A;  4LR2 A;  3S2D K;  4C3H C;  2Y0S L;  1TWF A;  1F9N A;  4BBR K;  1O25 A;  5M5Y K;  2NVY A;  3GSI A;  4Y7N K;  1I3Q K;  3AH5 A;  5IP9 C;  3H3V L;  3K7A C;  4KM8 A;  1PJ6 A;  4KAR A;  4LK1 A;  3S1Q C;  4BXX C;  4M1X A;  1F93 A;  5IYD C;  1EH1 A;  2B63 K;  3MML B;  3TFJ A;  4P5A A;  1Y1V A;  2A6E A;  3LAJ A;  1SMY A;  2EBB A;  3DXJ A;  3GTQ K;  1I50 A;  1O29 A;  2JA6 A;  4G7H A;  2VUM A;  1JOE A;  3TTG A;  5IOT A;  2V6T A;  4BY1 C;  3S1N C;  2JA5 A;  3S14 C;  2ZFZ A;  3S17 K;  2R92 A;  3HOV C;  4A3M K;  1SFO K;  4QJV A;  3GTP C;  1YCL A;  4OIO A;  4G7O A;  5IP7 K;  3H0G A;  5L46 A;  1IQ0 A;  4BBS C;  1ZBS A;  4A3K C;  4C3I K;  4A3J K;  5C4X K;  4A3E K;  5IYB K;  3GTO A;  2WAQ D;  2YU9 C;  4XLN A;  4MEY A;  2XCO A;  1TWF C;  3RZO C;  4FZB A;  4ZH4 A;  3S2H K;  3I4N K;  4BKW A;  5IOS A;  1O2A A;  5TJ3 A;  3GTM C;  3GEH A;  4Y52 K;  2KWA A;  5FJ8 K;  5C4J C;  1WSV A;  1YNN A;  3L4J A;  1Y1W A;  1Y1V C;  1TWH A;  4A3F K;  1JQW A;  2E2H K;  2PMZ D;  4C2M C;  4KAW X;  1I6V A;  1UV7 A;  1I50 C;  4GTB A;  2R7Z A;  1WSR A;  3GTL A;  2WB1 D;  4QIW D;  3S2D C;  4BLA A;  4Y7N C;  4BY7 K;  3GTK K;  3T00 A;  3CQZ K;  3S0X A;  4G0V A;  4G0W A;  2A69 A;  5M5W K;  1BDF A;  3Q3Q A;  1TWA K;  4XSZ A;  1EQR A;  3CAG A;  5IOR A;  2B63 C;  2V6S A;  3LPX A;  1IE0 A;  4DDQ A;  2GAG C;  4C3J K;  4G7Z A;  3S1M K;  3GTQ C;  2NVQ C;  1RU0 A;  4MQ9 A;  3S17 C;  4A3L K;  3GTP A;  4A3G C;  4A3M C;  1SFO C;  1TWG A;  4X6A K;  5IP7 C;  1L0W A;  1TWH C;  3HOX K;  1TWA A;  3T02 A;  4C3I C;  4A3J C;  3BP3 A;  4WJ3 M;  1BGW A;  2FQT A;  5IYC K;  2PA8 D;  5FLM C;  4A3E C;  4KMA A;  3PO2 K;  3S15 K;  4YG2 A;  4P5B A;  3S2H C;  1PJ5 A;  3I4N C;  3ERE D;  1O27 A;  3L4K A;  3GTM A;  4A93 K;  1HI9 A;  2ZUF A;  2BE5 A;  4QJV B;  2XCQ A;  4LK0 A;  2RGR A;  2RH6 A;  5M3F K;  4PAB A;  1EI6 A;  5C44 C;  1TWC K;  1WOS A;  1VRQ C;  5E68 A;  3BUE A;  4KC6 A;  2E2I K;  1USO A;  3A8K A;  2GSO A;  5M5X K;  3HOY C;  1WQG A;  3OPF A;  5C3E C;  1I3Q A;  4BY7 C;  2JA7 K;  3CQZ C;  1I6H K;  3H3V D;  1VLO A;  4A3B K;  1TWG C;  3HOW K;  2JA8 K;  1YNJ A;  3HKZ D;  3V4G A;  1TWA C;  1IL2 A;  3HOU K;  4GTC A;  1C0A A;  2B63 A;  1XZP B;  4KDD A;  3M4O C;  1K83 K;  3FHZ A;  4C3J C;  4PAA A;  3GTQ A;  1IS1 A;  1WOR A;  3M3Y K;  1O24 A;  1G51 A;  4G0U A;  2P5M A;  2PMZ L;  4ILD A;  4A3L C;  3AD9 C;  1SFO A;  3LAP A;  4GFQ A;  1R9T K;  2GAH C;  4X6A C;  1KQ4 A;  1XZP A;  3OEP A;  3HOX C;  1O2F B;  1ZQ1 C;  2JH3 A;  4AH6 A;  1WQH A;  5M3M K;  4Q5S A;  5IYC C;  3RZD K;  3SZZ A;  5CJ9 A;  4BBR C;  1ISE A;  3AQP A;  3PO2 C;  3S15 C;  4O2D A;  1I3Q C;  3S1Q K;  2CFA B;  4WIL A;  3S1R K; 
#chains in the Genus database with same CATH homology
 1TWH K;  3S1Q C;  4BXX C;  4A3D K;  4X6A K;  5IP7 C;  5IYD C;  4A3I K;  2B63 K;  3GTG C;  1TWH C;  3HOX K;  2NVX C;  2A6E A;  3GTJ K;  2R7Z K;  4A3J C;  5FLM K;  1SMY A;  3GTL K;  4YFN A;  2WB1 L;  3DXJ A;  2O5I A;  4QIW L;  4C3H K;  3GTQ K;  5IYC K;  2PA8 D;  5FLM C;  4A3E C;  4Q4Z A;  1TWC C;  4G7H A;  2NVY C;  3PO3 C;  4JK1 A;  4BY1 C;  5IP9 K;  5D4D A;  3PO2 K;  3S15 K;  3K7A K;  3S1N C;  3S14 C;  4YG2 A;  3S2H C;  3S17 K;  3I4N C;  3HOV C;  4GZY A;  4A3M K;  1SFO K;  4QJV A;  3GTP C;  4BXX K;  4OIO A;  4G7O A;  5IP7 K;  4A93 K;  5IYD K;  2JA7 C;  4BBS C;  1I6H C;  2BE5 A;  4QJV B;  1WCM C;  4YFX A;  4OIN A;  3GTG K;  4A3B C;  2NVX K;  4OIQ A;  4A3K C;  4A93 C;  3HOW C;  4LLG A;  4C3I K;  2JA8 C;  4A3J K;  4LK0 A;  5C44 K;  2PA8 L;  2YU9 K;  5M3F K;  4A3G C;  3I4M C;  5C4X K;  4A3E K;  5IYB K;  3FKI C;  5C44 C;  2NVT C;  2WAQ D;  4NOI A;  2YU9 C;  1TWC K;  4XLN A;  4A3C C;  2R93 C;  2NVY K;  2JA6 C;  4MEY A;  3HOY K;  2VUM C;  3PO3 K;  4BY1 K;  2O5J A;  1ZYR A;  5IYB C;  2PPB A;  1TWF C;  3S1N K;  2E2I K;  3S14 K;  3RZO C;  1K83 C;  4XSX A;  3EQL A;  4ZH4 A;  5C3E K;  5M5X K;  2E2J C;  2JA5 C;  3HOY C;  3S2H K;  3I4N K;  2R92 C;  2E2I C;  3HOV K;  5C3E C;  3GTP K;  1TWG K;  4YFK A;  2JA7 K;  3GTM C;  3CQZ C;  3H0G C;  4XLP A;  3M3Y C;  4BY7 C;  4BBS K;  3H3V D;  1WCM K;  4A3B K;  1I6H K;  1TWG C;  5FJ8 K;  1Y1V K;  4A3K K;  4Y52 C;  3HOW K;  2JA8 K;  3S16 C;  1XPP A;  1YNJ A;  5C4J C;  4OIP A;  3HKZ D;  1YNN A;  3I4M K;  1Y1V C;  1TWA C;  4A3F K;  1R9T C;  3HOU K;  2E2H K;  2PMZ D;  3M4O K;  3FKI K;  1I50 K;  2NVT K;  4A3C K;  3WOD A;  3GTO C;  2R93 K;  2JA6 K;  5C4X C;  4KMU A;  4A3F C;  2VUM K;  1I6V A;  2E2H C;  3HOU C;  3M4O C;  4KN4 A;  1TWF K;  1I50 C;  3RZO K;  1K83 K;  2E2J K;  2JA5 K;  2WB1 D;  4AYB D;  4QIW D;  4BY7 K;  2R92 K;  4Y52 K;  3S2D C;  3RZD C;  4Y7N C;  3GTM K;  4KN7 A;  3CQZ K;  2Y0S D;  3H0G K;  4LJZ A;  3GTK K;  3M3Y K;  1IW7 A;  3HOZ C;  2A6H A;  3HKZ L;  3GTK C;  3S16 K;  2A69 A;  5M5W K;  1BDF A;  5C4J K;  2PMZ L;  4A3L C;  3S1R C;  1TWA K;  4XSZ A;  1Y1W C;  1R9T K;  4X6A C;  4A3D C;  4C2M K;  3GTO K;  2A68 A;  2WAQ L;  4A3I C;  2B63 C;  5TMF A;  3HOX C;  4A3M C;  1SFO C;  4AYB L;  4MEX A;  3GTJ C;  2NVQ K;  5TMC A;  5M3M K;  4C3J K;  2R7Z C;  3GTL C;  4G7Z A;  1HQM A;  3S1M K;  4Q5S A;  3S2D K;  2Y0S L;  2NVQ C;  5IYC C;  4BBR K;  3RZD K;  3GTQ C;  5M5Y K;  4Y7N K;  3S1M C;  1I3Q K;  4OIR A;  4BBR C;  5IP9 C;  3H3V L;  3HOZ K;  3PO2 C;  3K7A C;  2CW0 A;  4MQ9 A;  3S15 C;  4A3G K;  1I3Q C;  3S1Q K;  3S17 C;  4A3L K;  3S1R K;  1Y1W K;  4LK1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...