2JA7G

Cpd lesion containing rna polymerase ii elongation complex c
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*TP*AP*AP*GP*TP*AP*CP*TP*TP*GP *AP*GP*CP*T)-3'
publication title Cpd Damage Recognition by Transcribing RNA Polymerase II.
pubmed doi rcsb
molecule tags Transferase
total genus 26
structure length 171
sequence length 171
chains with identical sequence S
ec nomenclature
pdb deposition date 2006-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2ja7G02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 2ja7G01
3G71A 4A3JH 2VQEL 1CKOA 2E8GA 1CSQA 1QVCA 4DV6Q 3HOYH 3VDYA 2HIVA 2B29A 4EQ5A 5LMNL 2OCEA 4BY1G 3H15A 1HZCA 1XNRQ 2XTIA 4A3KH 4JOIC 3CCUA 3T1YL 1LTLA 4A3FH 2VY3A 5GQOA 4EX5A 5IWAL 4DR5L 4KHPL 3S1MH 3AQQA 2EQSA 4LFCQ 4O0AA 1HNXL 1VQIA 2N49A 1S72A 1IYJB 1Q7YC 1VQKA 1L2FA 5IP9H 2AWNA 3Q8DA 1YITA 4BA1I 1SE8A 3UE1A 3S2HH 2YV5A 1HNWL 4IPGA 1HJPA 2PMZE 2RHSB 4Y7NH 1VS0A 4KLKA 4OWWB 2ZM6L 1XNQQ 2L15A 3UDIA 1B70B 1MKHA 1OXVA 1XMOQ 1Q86C 4R4CA 4APVA 3A0JA 1BBUA 3BU2A 1L1OB 5FJ8H 4AIMA 2OQKA 4IO9A 1SMXA 2IT1A 4UP8A 3TS0A 5C4XH 4A3KG 2VS1A 3S24A 2ZJQA 4B3RQ 2MO0A 4JV5L 1XPRA 3L0OA 4JI2L 1K0RA 2CWPA 2B63H 3JAMi 4JI4Q 1JB7A 2VZAA 5LMNW 1LYLA 1I6HH 1TWCH 2VL6A 4DR3L 1I3QH 1JT8A 4WJ4A 3KLWA 1X3EA 5IP9G 4NXNQ 2ALYB 4PZ6A 4DK6C 4NXMQ 4TVAB 5HGQA 4KI0A 4GKJL 2E2IH 4UY8C 1G291 1OXSC 3HOVH 3RNUA 3FKIH 2IHFA 1GO3E 3NELA 5FJ8G 1Q8KA 4DV0Q 1KHIA 3G6EA 3MEFA 4A3EH 1KIXA 2I5MX 2JK8A 1B8AA 5C4XG 1H95A 4OONA 4P73A 4DR6L 2B63G 1D7QA 1NE3A 1KRSA 1UEBA 2KHIA 2Z6KC 1KL9A 2R7DA 1I94L 3CD6A 4DR1Q 2BH8A 1K8GA 2F52A 3HOZH 5BR8Q 4JI6Q 4L5SA 4LUZA 3AYHB 1VQGA 4UP7A 4YCWA 4HJAA 1HR0Q 2MFIA 1N32Q 4X65L 4R4QA 1IBML 1IL2A 4X64Q 3CW2C 1B7YB 3F2BA 2NZOA 4NPSA 3HOVG 3FKIG 5C0XG 1EIFA 5J3BA 2E2JH 4YY3L 4BBRH 4A3EG 1N9WA 4X62Q 1PH7A 3GTMH 2R92H 5IYCH 3KDFA 2ZJPA 1CKNA 4DKAC 3ICEA 1E7ZA 4YWKA 1HR0W 3GTPH 1WFQA 3PUWA 5IYDG 4C3JH 1VQ9A 2Y0SG 3UDFA 4IJLA 5M5YH 2K5NA 4X66L 5JJLA 3M4QA 3NEMA 1TWGH 1V43A 4C3HH 3HOZG 1RL2A 4YHHQ 1JMCA 2UXCL 3DM3A 1L0WA 1NY4A 2Y0SE 3S15H 1VQBA 3KF8B 5K36G 4B3ML 4GNXA 1FL0A 2LXJA 4LUVA 1PH9A 1SN8A 1EQQA 1EWIA 2OTJA 4AQYL 3CMEA 4BBRG 5AJ3L 5M3FH 3K8AA 1PH4A 2GVBA 4XIGS 1IZ6A 4HJ9A 1KD1C 2LXKA 1MJEA 1E1OA 5IYCG 4LF5Q 2K50A 2R92G 4DR4Q 2DUDA 4GN5A 4L5RC 5C0XI 1HZAA 4DUYL 1N32L 2UXDQ 2Q2HA 2I0QA 2CCZA 1A0IA 5M3MH 2K5VA 4FDBA 4JOIA 5GAEC 3ER0A 1YBYA 3RLNA 1S3OA 4WJ3M 2AWOA 2V1CC 4BY1H 1EFWA 2NVTH 1X55A 3OYYA 4JCVE 1FJGQ 4A3GH 4QIWE 1Q81C 3UDXA 1BKBA 4LF7Q 4JI5Q 1X9NA 4P74A 1C7YA 4DV6L 4GN3B 3CCEA 1K83H 1KRTA 4POGA 1YI2A 4JBJA 5LMUQ 1XNRL 4A3DH 3CCQA 1SRUA 2KHJA 5M3FG 1HZBA 1YJ9A 2CWAA 2WB1G 4R4OA 1C0AA 3E9IA 1X3FA 2N8NA 5FLMH 3KFUA 4GN4B 4LFCL 3A74A 3GTOH 1VQJA 3A5ZB 4BXXH 2IX1A 2WB1E 3RZDH 1K9MC 3S1NH 1L1OA 1D8LA 1QVFA 5M3MG 4MZ9A 1Y1VH 1PV4A 3K80C 3B6YA 2D0OA 1VQCA 4KHZA 2HT1A 2UUBQ 5C3EH 1Q1BA 2AHOB 1MJCA 1XNQL 4A3GG 3G48A 4JI7Q 1XMOL 3GTQH 3HOWG 4IOAA 3HFZB 1EUJA 1OXTA 1VQ4A 2MNAA 4A3DG 3CCJA 4B3RL 3I7FA 1SR3A 1XPUA 2EXDA 5FLMG 4LF9Q 3NENA 2JA7H 3J81i 1M90C 4JI4L 1R9TH 1GM5A 4BXXG 3RZOH 2NN6G 2JJQA 3PGZA 4GOPB 4IJHA 3RN2A 3PO2H 5JJIA 4A93H 5GAHC 4LF6Q 2H5XA 1MIUA 1Y1VG 4J15A 4NXNL 2CFMA 1GVPA 1PH1A 3CXCA 2JEBI 1IBLL 4LF4Q 1L1OC 1YJWA 4IPDA 2PI2E 4JI8Q 4NXML 5C3EG 3OTOQ 1WCMH 4R4TA 2QA4A 4OWXB 2Z6KA 5C4JH 4PZ7A 1A63A 4DV5Q 3TQYA 1AE3A 3STBC 2HQLA 4DV0L 3TS2A 3TRZA 4JYAQ 1K73C 1X65A 4MNOA 1VQDA 3EBEA 2JA7G 2JA9A 2D62A 4IOCA 2ES2A 2UXBQ 2VNUD 4JI1Q 3PO2G 5IT9c 1PFSA 4A93G 4JBWA 4DR1L 4BA2I 2E2HH 1NBWA 3F1ZA 4JI6L 3CMAA 4IPHA 1SLJA 1EOVA 3HOUH 1ASZA 1HR0L 1WCMG 2KCTA 1YHAA 2PQAB 4PZ8A 2JA5G 2UUCQ 4X64L 3M4PA 4JC0A 2A8VA 2DGYA 1X6OA 3GO5A 5IYDH 4NB3A 1OXUA 2ZTEA 1V1QA 4X62L 3FP9A 2MQHA 3K0XA 1P16A 2RHQB 3HOXH 3NBHB 3KJPA 1RIPA 4A76A 2AMCB 1OTCA 1CSPA 5H1SE 3I56A 4A75A 4DV7Q 3M4OH 3U58A 1KQSA 1VQAA 2HHHQ 1Y1WG 3S16H 4YHHL 3HOUG 1J6QA 4YCVA 3I4NH 4A3LG 3T1HQ 1EQRA 5JEAJ 3J80c 2ZJRA 5ELOA 4DUZQ 2ASBA 3HKZG 1YIJA 4LWCA 1E1TA 2K14A 2EIFA 5M5WH 2CKZB 3CQZH 4RG1A 3STBD 4HIOA 1Q46A 4DK3C 1ASYA 4LF8Q 4LFAL 3AFPA 3KF6B 1VQLA 3HKZE 4A3IH 3HOXG 2D0PA 3H0GH 4MTNA 1VQ7A 3A5UA 1N36Q 2UXDL 1A62A 4IFDJ 4UPAA 3I4OA 1KXLA 4UP9A 4DV1L 2R7ZH 5JEAG 3PF5A 4A3CG 1Z47A 1K3RA 3CPFA 1I94Q 4AH6A 3I4NG 1FJGL 1FGUA 5GROA 4LF7L 4JI5L 2AKWB 5E7NA 5HY6A 3BZKA 3ULPA 1W2BA 1YHBA 4ME3A 1IBKQ 4JBKA 4HJ7A 2Q2IA 3PUXA 2JA8G 4OO1G 1VQFA 5LMUL 5IYBH 1JJCB 4HJ8A 3W5OA 2XGTA 4O2DA 3E9HA 1Z9FA 1UE7A 4TQUS 4A3IG 3RLOA 1WOCA 1HNZL 4C2MH 2VQFQ 3H0GG 3HKSA 1UE1A 3D0FA 1XMQQ 1I50H 4B3TQ 2LSSA 2UU9Q 2NVQH 1VQPA 3ZJYC 4DR7Q 4GLVB 3J7ZC 2YTYA 1QVGA 3FHWA 2K4KA 4P72A 1X54A 3CCSA 3HOWH 1LUZA 3I4MH 1QUQB 1BBWA 2IX0A 4LFBQ 4X6AH 3S2DH 1TWFH 2MO1A 4P75A 1PH6A 3GTLH 4JI7L 1U5KA 3TREA 2C35B 4C3IH 4DAMA 3CCMA 4GOPA 4YWLA 2R7ZG 3S1QH 4QQBX 5M5XH 5IYBG 1KAWA 2BA1A 1LM0A 1Y14B 4LNQA 2QEXA 3JAMc 4JBMA 4LF9L 3RN5A 4DV2Q 1U0LA 3M7NA 2Q2UA 4OO1I 4QY7A 4OX9Q 2R7FA 1V9PA 1T9HA 2NZHA 4YCUA 2JE6I 1N34Q 2RCNA 4LF6L 2IY5B 3BZCA 3I4MG 4PG3A 4JI8L 3KJOA 3OTOL 4Y52H 1BVSA 1C9OA 4XTCS 4QJFA 1PH3A 2E5LQ 3GTKH 4JI0Q 2BA0A 3CC2A 1CUKA 4OWTB 1NTGA 2K5HA 4DV5L 3MXNB 1DGSA 1VQHA 4GOPC 2UUAQ 2JEAI 4JYAL 1W3SA 1J5EQ 4DAYB 2K52A 1N33Q 4B3SQ 4DR2Q 3RR5A 4DV3Q 2KCMA 2PQAA 1EIYB 1WJJA 4A3MG 2UXBL 1O7IA 4JI1L 1UE5A 1QZGA 2R93H 3F8TA 2F4VQ 2JA5H 4JI3Q 1YEZA 1PYBA 4K0KQ 2OWOA 4GKKQ 4DV4Q 3K81C 1AE2A 5EAYA 4PMWA 4DNIA 1SFOH 1Q12A 1N8RC 2VQEQ 2UUCL 4YWMA 1PVOA 5DLQE 4P71A 1VQ6A 5LMNQ 5C44G 1FVIA 2OTLA 2KBNA 3AEVA 3T1YQ 4A3BH 1VQEA 3I55A 2BH2A 5IWAQ 4DR5Q 4A3JG 4KHPQ 1YJNA 3HOYG 1Y1WH 1HNXQ 2CQOA 5BR8L 3CP0A 1JJ2A 3ERSX 1EYGA 2NN6I 1PYSB 3PCOB 2YTXA 2WAQG 3PIOA 4DV7L 4A3FG 5IP7H 4A3LH 1GD7A 2K75A 2R93G 5ELNA 3M3YH 3PV0A 1UE6A 2YTVA 1E22A 1TXYA 3KF6A 5GAGC 2HHHL 1HNWQ 2A1AA 4H02A 2ZM6Q 4QGUA 2WAQE 2WFWA 3T1HL 2JA6H 4DUZL 1NMFA 2IHEA 1IBLQ 3PO3H 4L5TA 1K8AC 1IXRA 1YVCA 2PI2A 1P8LA 2HIXA 2NVYH 4L5QA 1VQ5A 4LF8L 4A3BG 4JV5Q 4OXPA 2Z0SA 3K7AH 2RF4A 4JI2Q 1E24A 3L7ZC 2ZTCA 3CCLA 4A3CH 4DR3Q 1UWVA 1G51A 2ZTDA 2NVXH 2B3GA 3RLFA 1N36L 5C0XJ 2ID0A 4A4IA 5IY0A 5IP7G 2QGQA 3SGIA 1HH2P 3AFQA 1PHJA 2JA8H 3CC7A 3W1BA 3CAMA 3W1GA 2F3IA 1CKMA 1A8VA 3IRBA 1WI5A 1XTDA 3PUZA 4IPCA 3U4VA 1XPOA 1QZHA 4GKJQ 1VQ8A 3EIVA 2JA6G 2OQ0A 3PIPA 1OXXK 3DLLA 3PUVA 1IBKL 3PO3G 1JE5A 1M1KC 4LF5L 4DR4L 3BJUA 1TWHH 3H3VH 1AH9A 3U4ZA 1I5FA 1QUQA 3K7UC 4GLXA 3M85A 4DR6Q 3S17H 1S40A 1YZ6A 2VQFL 2VUMH 1XMQL 4B3TL 1GKHA 3EN2A 2UU9L 2JQOA 4LW1A 1X3GA 5GADC 3PF4A 4BY7H 4DR7L 2PNHA 4LUOA 3S14H 1HZ9A 3JC66 5IE8A 3WWVA 4BBSH 4LFBL 1G6PA 3ULLA 3CCRA 4HIMA 3I2ZA 4X65Q 4JG2A 1IBMQ 1Q1EA 4HJ5A 3KYHC 2N3SA 2YYZA 3KOJA 2I5LX 4HIDA 1PH5A 3UE0A 3E0EA 3PUYA 4IFDG 1YNXA 1TWAH 4YY3Q 5JJKA 1SROA 3LGJA 3CF5A 3OW2A 3J81c 4GS3A 3U50C 1XJVA 2R6GA 2YU9H 2VW9A 3D31A 4DV2L 2VUMG 2UUBL 4AYBG 2GVAA 4LFAQ 1X56A 3L2PA 1VQMA 2WP8J 4OX9L 4BY7G 1N34L 2FXQA 4X66Q 1KC8C 1PA6A 3CCVA 3GD7A 3CPWA 1VQNA 3F2DA 4AYBE 2UXCQ 2N78A 1Q82C 1PH8A 4BBSG 1YHQA 5FLXc 3KDFB 1CKNB 2E5LL 4JI0L 1VCIA 4HIKA 4ALPA 3J80i 2KENA 1WYDA 4R1JA 4DV1Q 4RMFA 1PH2A 1NJIC 4B3MQ 3J81j 4AQYQ 4POFA 3GTGH 4A3MH 3TEHB 5AJ3Q 1VQOA 2UUAL 3M9BA 4QL5A 3G4SA 1J5EL 2ATWA 3CC4A 3S1RH 3PSIA 4DR2L 3GTJH 4DV3L 4B3SL 1N33L 4LF4L 1E3PA 3GDEA 4GLAC 4IFDI 1JJGA 4R4IA 1NMGA 4DUYQ 4GNXB 4GNXC 3H3VI 3J7A5 3UDGA 2I5HA 2F4VL 2GN5A 4JI3L 4DPGA 1HNZQ 4K0KL 3ULJA 4GKKL 4DV4L 3F2CA 5C44H 2A19A 2Q2TA
chains in the Genus database with same CATH superfamily
3G71A 2YZNA 3MWYW 4ZQIA 1Y8OB 1CKOA 3LP8A 1QVCA 2A69C 3WO0A 1KJQA 5KFGA 2HIVA 3DWQA 1KDAA 1QOHA 4ZHQF 2XTIA 1QJOA 2RGRA 3BQ2A 1U4MA 4A3FH 2B2YA 1CQJB 4Q0YA 2EQSA 2L4NA 5DQHA 4MAMA 4HNVA 3K7AB 1S72A 1IYJB 1Q7YC 3PR5B 1CI3M 1A9XA 3Q8DA 3PW0A 1SE8A 4HCSA 2YV5A 2R7MA 3L4JA 2NBFA 5ELBA 3A7LA 3DXJC 1B70B 1PX2A 1Q86C 4R4CA 2F0GA 1DV2A 1B04A 1W6JA 4APVA 1KDBA 3BU2A 2OQKA 3BZDB 3BYYB 5C4XH 4RFBA 4KY7A 2MO0A 3T4AC 4JK1C 5FO9B 1XPRA 1EZ1A 3H3VC 1K0RA 1O78A 4I7ZC 2VZAA 1LYLA 4CDFC 2VL6A 1EL0A 1AP0A 1JT8A 4WJ4A 3IG0A 3KLWA 5KG3A 4JI6H 4FF1A 5IP9G 2CH4A 3J7AF 2B2UA 2SNSA 4GZYC 3Q8PB 4TVAB 4TQRA 3TP7A 5HGQA 1TS3A 4XT3B 2A68D 3ETJA 3J7YW 4FS2A 1FR3A 1GO3E 2JP1A 1Z2NX 4C5CA 5FJ8G 1TA8A 1Q8KA 2F0EA 4IALA 4DV0Q 3MEFA 2L55A 1PMRA 1H95A 4OONA 3DHQA 4DR6L 2QYZA 2B63G 3V4SA 2ALZA 4RCOA 1NE3A 1KRSA 1UEBA 2KHIA 2Z6KC 3OSPA 2R7DA 3N43B 2XCPA 4DR1Q 4K5VA 1EYZA 3K5IA 1K8GA 2F52A 3HOZH 1NCVA 1S5DD 4TRDA 2BQRA 4UP7A 1VQGA 2PQEA 4CC6A 3C1FA 4X64Q 4YBZB 4O4LF 2V58A 5KFDA 1EIFA 1GYFA 4YY3L 2R93A 2MCTA 2NVTB 4H7BA 2UXDH 4O2BF 2R92H 5IYCH 5KX5F 3KDFA 4IUVA 3ICEA 3PIP3 4DAVA 1E7ZA 1Q3LA 1SFOA 1HR0W 4IURA 2W57A 3Q8RB 1UEAB 2Y0SG 2PMZB 4IJLA 1UC9A 2SEBD 3J81L 2X6LA 3RAQA 2DPIA 2EDGA 1RL2A 3MAQA 5JPMC 1ESFA 2WDTA 1L0WA 3HZXA 1X3QA 3M9MB 2CW0D 4EVOA 2DPJA 1EY8A 1LT4D 5JVG3 5GONF 3FPUB 3KF8B 2LXJA 4XYOA 1PH9A 1EQQA 2ZDQA 2SDFA 4NLGA 3K8AA 2GVBA 4GC7A 3SXHA 1IZ6A 1MJEA 3RUPA 2K50A 4DR4Q 3S1MB 3T5LA 1HZAA 2FKLA 3RIZA 3MA2B 4EQNA 2W9BB 1G2TA 3DMUA 2NVTH 1EFWA 2JA7B 1X55A 3OYYA 3RFCA 2E2IA 4QIWE 4Y7NB 2EY6A 4ECTA 1BDOA 1ILPA 4DV6L 1L0YB 3CCEA 4LF9H 2NVXA 4WRDA 3CCQA 2PYKA 4R4OA 4RA8A 4B08A 2YZMA 5C4JB 2PVPA 1DZ1A 2F0NA 4G3IA 2PZWA 4LK1C 4WBNF 1L1OA 3V6JA 5EWGA 2AQ1B 3CHBD 1PV4A 1LV9A 1VQCA 2D0OA 2OXPA 3NTKA 4F4XA 2UUBQ 1KTKA 3JRWA 1Q1BA 3MWDA 1MJCA 4NW2A 1XNQL 4QWEA 2X6GA 4ECQA 4DL3A 1XMOL 4JYAH 2UVUA 3RUZA 3SK6A 1TR5A 4IRCA 1CA6A 1KLGD 5FO7B 2FINB 1STAA 4A3DG 3RTXA 4ED6A 3FKIB 4YAKB 5IGEA 1SR3A 5KNBA 4Q45A 2PCFB 2VB2X 4XZ3B 2DJGC 2JA7H 2VOBA 4BXXG 4UCTA 2NN6G 4CKBA 4GOPB 2K33A 3PO2H 3MWEA 5KFOA 4LF6Q 3R23A 1MIUA 1Y1VG 5DNFA 1PH1A 1TWGA 4HNTA 4RHRA 4IPDA 4JI8Q 3HOXB 3NBIA 3ND9A 3RD4A 1GSHA 5A35A 2QA4A 3BDLA 4OWXB 4RGNA 4WFN3 5C4JH 1A3VA 1Y69U 5FKAC 2WV6D 2XRQD 4DV5Q 1AE3A 2RVLA 3R2TA 3WOEA 3BABA 4I7HA 3PZPA 3S16B 4F4YA 2P0AA 2W9AA 2HUGA 4HEDA 1RJRA 1GHJA 1X3PA 1SYFA 1EFID 5HURA 3GTMB 2X0SA 2F0WA 2VNUD 3CQZB 4A93G 2B2VC 4KJOA 2ZXOA 4DUZH 4JI6L 1EOVA 2EJMA 4DXGA 1ET9A 3I91A 2L12A 4IN3A 2JA5G 5FO8B 3M4PA 4Y8VB 3T56B 2V4DA 2NWGA 2B8FA 4FXGC 2FPPB 4X62L 2RHQB 2WB1B 5BN3A 3HOXH 1RIPA 4A76A 1MHWC 1ENAA 2Z8LA 4C1NI 4QCLA 3GIQA 4M7EA 1EWCA 5KKNB 3VYRA 5IGDA 3S16H 5EOYA 4JVZA 4CHTB 2R3ZA 4DR4H 4A3LG 3GTQA 1I50B 3HKZG 1YIJA 4O3QA 5M5WH 3CQZH 4RG1A 3HOWB 1G2SA 3STBD 1SEBD 4HIOA 5KG6A 4DK3C 5HGTA 1XMQH 4B3TH 4UFZA 1N48A 5C6AA 1S5BD 4MTNA 1VQ7A 4MV6A 3PVXA 3MEHA 1N36Q 1UNNC 2UXDL 3I4OA 1PRTC 4UP9A 5CV5A 3RZDB 4CDEC 3S1NB 1C30A 4F88A 2C22A 1S97A 5JEAG 4X3SA 1WCMA 1AUXA 1J5EH 3I4NG 1E2VA 1FGUA 5KFFA 5GROA 5J22A 3ULPA 1W2BA 4JBKA 3BZKA 1GJXA 1YHBA 1G8ZD 4ME3A 1TWCA 1I3QA 3ORRA 5LXTF 3MXGA 2UUBH 2FK1A 4OX9H 1ZEQX 1WOCA 1N34H 1U4RA 5EJWA 1I4QA 3H0GG 5DG9A 1I50H 4DNTB 4J9NA 1VQPA 4DR7Q 3RZOB 1V1OA 1M6VA 1QVGA 3HOWH 2FP4B 5LA6F 4IZOA 1EU4A 2B2WA 1QUQB 5BPFA 4LFBQ 5KYLA 2M9VA 2YS7A 1PYWD 4RGTA 2EY1A 4DGZA 3U9OA 2J9GA 3CCMA 4YWLA 4B3SH 5KT3A 1D2BA 1D1IA 1TT2A 3K5MA 1KAWA 2QEXA 1WD1A 1Y8NB 4LF9L 1JR0D 4DV2Q 5JPNC 4K14A 4QY7A 4GKKH 4DV4H 4EBDA 3G6JB 1T9HA 2JE6I 2HJWA 4R8UB 1WVLA 3BZCA 2HDLA 3X3NA 4XT1B 4Y52H 1FKAH 4XTCS 3N6RA 4QJFA 3R2IA 1QB5D 4ABNA 1Y1WB 2BA0A 2E5LQ 4JI0Q 3HOUB 5EWEA 3T1YH 4J9KA 3T5HA 5IWAH 4KHPH 1HNXH 2UUAQ 4GOPC 4JYAL 3D6CA 2A68C 2K52A 5JJZA 3RR5A 3VR5A 1PTOB 3SK4A 2KCMA 3MXPA 4LAAA 5IOCA 1EIYB 4A3MG 2CW8A 5FD5A 1UE5A 5KRUA 3F8TA 2F4VQ 1WTXA 4JI3Q 3GP7A 1YEZA 1PYBA 2E76C 2QKIC 1GUWA 2IMWP 3RB3A 1PRTF 1HQMC 5IGBA 4DNIA 2W6PA 2N88A 4K8JA 5G3LD 5H80A 5IT9L 2CH4W 4FF2A 1EUDB 2A6ED 2R7ZA 4JV5H 4FVMA 1PVOA 1SE2A 1VQ6A 2KBNA 3TN2A 2KHSA 4LMYA 1VQEA 3LX0A 1B6RA 4HSVA 2BH2A 4A3JG 2RQXA 3V6HA 4JV0A 1STYA 1MD2D 1Y1WH 4H0LC 3SK8A 1K3BC 3ERSX 3J7AK 3PCOB 3K5NA 2R93G 4GKJH 1S4ZA 5IP7H 3ORQA 5ELNA 3K6OA 2YTVA 1E22A 2NUCA 3KF6A 1E4EB 1KJ8A 1LTRD 3T1HL 4DUZL 1LTAD 3HRZC 3QB3A 3H4BA 5CV9A 2G5DA 1DYQA 1P8LA 4C56C 2HIXA 2CW0C 3V96A 3S14B 4C5BA 2ASJA 5CV6A 1UUPA 1FNWA 2RF4A 1E24A 3FVQA 3L3OC 1TS4A 1VAJA 4A3CH 1DOMA 1WTPA 2ZTDA 3E6ZX 2B3GA 3E3XA 1V8QA 1B9MA 2ID0A 4A4IA 3SGIA 4X65H 4O1NA 1HH2P 1IBMH 3CC7A 3TIIA 3U4VA 4DNRB 3S2DB 5CA1F 3EIVA 2JA6G 2OQ0A 3T51B 2F0LA 4DR7H 1TWFB 1R9TA 4DR4L 5L1LA 1TWHH 4ECWA 1KLUD 1AH9A 3U4ZA 1I5FA 2FMCA 3K7UC 1S10A 4DR6Q 1HA5A 3MFHA 4ZYSA 5CAEB 2VUMH 2XCLA 1XMQL 4B3TL 2JEGA 3EN2A 3CU7A 3J7AV 2EYMA 2FPIB 2WKCA 2PNHA 3S14H 5KFRA 1EY5A 2ZJTA 5KFLA 2EYFA 3URYA 5C4HA 1A3UA 2JEIA 2PZUA 4CJ2C 4OL7A 3RV3A 2BDOA 2N3SA 3KOJA 2OH2A 3PUYA 1B33N 1YNXA 4YY3Q 5JJKA 3K3PA 2XNAC 1RCVD 5C44B 3CF5A 3OW2A 1SNOA 1XJVA 1TVXA 2W9CB 3G8CA 1VBGA 4K6LA 2UUBL 1UNSA 1I4HA 4LFAQ 1X56A 3L2PA 1VQMA 4OX9L 3HOYB 3MR2A 3MR6A 1N34L 2D5DA 1NAPA 3MXNA 1JCKB 3GIDA 2DY8A 4AYBE 1S0OA 1PH8A 4BBSG 3MWMA 1K8MA 4ALPA 2KENA 4DV1Q 4R1JA 4TSSA 5ELFA 2VPSA 4C3HG 2R82A 4POFA 3GTGH 4LFCH 4HN7A 3TEHB 2EZVA 5KFQA 3A55A 1A2TA 3M9BA 4QL5A 2KCNA 3G4SA 4J9QA 3PSIA 4B3SL 4CDDC 3GTJH 2OLSA 2NUAB 1IYUA 4GLAC 4R4IA 1NMGA 4R8NA 4GNXB 1B53A 1LT6D 4N9TA 2I8CA 2I5HA 2IW3A 3ULJA 4GKKL 4DV4L 3F2CA 2JSOA 1LLRD 5C44H 3MXUA 1EY7A 2ZXPA 5EQ0A 1D5XC 2EJGC 5CR3A 1CSQA 3NTHA 4UDUC 4DV6Q 3HOYH 4B3RH 5LMNL 2WE6A 2OCEA 4BY1G 1HZCA 2M00A 1BNCA 4O3RA 4JOIC 3T1YL 5F2DA 1SYEA 2EOTA 2L9HA 2VY3A 5GQOA 5IWAL 4KHPL 2NVYB 3AQQA 3TSSA 1C48A 4YB8B 4O0AA 1HNXL 1VQIA 5L37A 3CRLC 5KT7A 1VQKA 5IP9H 2AWNA 1F2YA 2FB9A 1FYCA 2KEDA 2VUGA 4EEYA 1VS0A 1XNQQ 2JEJA 1O7LA 3UDIA 2FLNA 4IWXA 1MKHA 1OXVA 1XMOQ 1ZQ7A 2ICEC 3A0JA 5JH7F 5FJ8H 1TWAA 2Q8RE 1OWTA 3MC0B 5C3XA 2IT1A 3TS0A 4EGQA 2XD4A 1LT3D 4A3KG 4JV5L 3L0OA 5T1IA 4KTAA 2B63H 3JAMi 3SE0A 1Z7TA 5JOBA 1FD7D 5LMNW 1JB7A 1I6HH 1GSAA 2DJFC 3TINA 4ILWA 1HR0H 5HV6A 4BY7B 3I12A 4GKJL 3Q24A 2XN9C 1G291 3KUPA 2V4RA 4HQ6A 3G6EA 1KAAA 2I5MX 1JQYD 1D7QA 2R87A 1T36A 3KK7A 3GTKA 2F0HA 5FK9C 2IP4A 5BR8Q 4JI6Q 4L5SA 1II3A 1O7YA 2HCIA 3A8JE 4YCWA 5IODA 4X65L 1IBML 2IX3A 1KBLA 1F9SA 4LFAH 4NDXA 3F2BA 3HOVG 2VXWA 3A8IE 5C0XG 1S0NA 3KBXA 3T16A 1B1ZA 1F9PA 4A3EG 1RF2D 2WAQA 4X62Q 1TS2A 1U9RA 3I73A 3SR1A 2ZJPA 1CKNA 4DKAC 4DV1H 4MTDA 1K83B 3NUCA 5IYDG 5KT5A 3UDFA 2K5NA 1I4GA 3M4QA 4ED0A 1V43A 4JV1A 3DM3A 4IZ8A 4TV9F 1B44D 2Y0SE 3OHXC 2FLPA 1K28A 5K36G 3CMEA 2YZGA 1AN8A 2AGOA 4OEMB 1LTSD 4XIGS 4NKLA 4HJ9A 2LFNA 3BVMA 2DUDA 3N6XA 1F2LA 4L5RC 2W7OA 1SBBB 2UXDQ 2I0QA 4C3JG 1LTBD 5DG7A 2I46A 5GAEC 1EOTA 1YBYA 2Z9HA 4I7AA 5KT2A 2V1CC 5KYIA 2QILA 4EFBA 2VR1A 1QG7A 1IL8A 1EUCB 5DQIA 2R7LA 4PDBA 4GN3B 1K83H 1RJPA 4JBJA 4A3DH 1YJ9A 1C0AA 5M3FG 2CWAA 1R4QB 2A6EC 1X3FA 3E9IA 3NP8A 2FPGB 5C4XB 1RTNA 4CKCA 4LFCL 3A74A 3GTOH 4BXXH 2IX1A 1CHQD 3OTOH 1XWEA 1D8LA 3TP6A 3BG5A 5CBEE 1QVFA 4HTHA 5M3MG 1Y1VH 3AMUA 1GOZA 3B6YA 2RCFA 3H6MA 3KBGA 4KMUC 1ESRA 1HUMA 5KNDA 4RU9A 2AHOB 1RYSA 3G48A 1JDBB 2Q8TA 3JAME 1IOVA 4RB2C 3HFZB 2E2HB 1OXTA 4ZUJA 2QDBA 2K03A 1O80A 2XRSD 4B3RL 2UXBH 1EZ6A 1XPUA 4JI1H 2EXDA 2Z4IA 4LF9Q 1F77A 3VMMA 1GUTA 1HFNA 3CVZA 3T5JA 3RN2A 4K2LA 2F1MA 1HQRD 4A93H 5M9OA 4KD4A 4LF4Q 1PZJD 3CXCA 2UUCH 1PFMA 3V2TA 2A73B 5CB4F 5KFWA 5C3EG 3HOZB 2NU8B 3P75A 4R4TA 3RAXA 3SE7A 2HDMA 1TU2B 4HR7B 1A63A 1WSCA 5KFPA 3TQYA 4UCUA 3RV4A 1EY6A 1BQQT 5BR8H 4JYAQ 3TZUA 1H9MA 4UCRA 1EY4A 2A5HA 2YRWA 4I4TF 2JA9A 5KFCA 5F9LA 4IOCA 2R92B 2M05A 3R5HA 2HHHH 1PFSA 1WD0A 1B3AA 4JBWA 2RSNA 2E2HH 1RK5A 2R86A 4QIWB 3F1ZA 3PMFA 3CMAA 4X62H 5D14A 1SLJA 2O03A 3MR5A 1ASZA 1HR0L 1YHAA 4Q8FA 2PQAB 4LF8H 4XXEA 3EYYA 3NWTA 2A8VA 1BXTA 2PMZA 2R8HA 1ULZA 3SVMA 2K5QA 4UCSA 4DLKA 1OXUA 2ZTEA 5T14A 2MQHA 2WIIB 1P16A 3P1HA 5G3LF 1SNCA 3NBHB 1RD9D 3KJPA 1I4PA 3KF8A 1DV1A 4I65A 1OTCA 2L5TA 5H1SE 4F8MA 3I56A 2HGSA 2EYHA 3M4OH 3U58A 3BQ1A 1KQSA 2B2TC 2R7NA 4YHHL 1IBKH 1CT1D 4MTKA 4YCVA 3I4NH 3T1HQ 1EQRA 2ZJRA 3GQCA 1J8IA 4DUZQ 2JN4A 4J9RA 1RDPD 2R8GA 5C4ZA 2K5DA 3Q22A 2VQFH 3C46A 2W9BA 4LFAL 1JB3A 3P20A 2UU9H 1HPCA 1E2ZA 3HKZE 1VQLA 2W6MA 5KFNA 2JA7A 1ZHQA 3H0GH 1JDEA 2FE3A 5L1KA 1A62A 5IGCA 4UPAA 1PRTB 3FDTA 3GV7B 2MJ8A 2R8IA 4DV1L 1S9FA 4RWSC 2E74C 4IAJA 1Z47A 1ICWA 1I94Q 1GUOA 3LWBA 4RGOS 3NSWA 1HCZA 3C2PA 2JA8G 1HUNA 3M9OB 1VQFA 4J6HA 5KFEA 1FGBD 3W5OA 4DFAA 4RUAA 1Z9FA 3BJYA 3SI8A 4A3IG 3RLOA 5KFVA 2AU0A 1GUSA 2F0FA 3HXLA 1J9OA 3HKSA 1XMQQ 4B3TQ 4MIUA 4EFEA 1E0BA 2HQEA 4ED2A 2YW2A 4LSAA 2YTYA 3FKIA 3FHWA 2K4KA 3CCSA 1X54A 3PO2B 1DIKA 1LUZA 1S0MA 1BBWA 2IX0A 5I2XA 1CFMA 2MO1A 2FHTA 3TREA 4GOPA 2C35B 2R84A 1SYBA 2RDIA 4DV3H 2HVSA 1MBYA 3OSOA 4LF4H 5A2QE 2BA1A 2C2DA 1M0WA 1LM0A 3VR4A 3OUZA 5C1OA 3JAMc 4JBMA 1ENFA 3RN5A 2M2LA 3ITPA 1RK6A 2FK3A 3UQ8A 2C5CA 3EA6A 5KFMA 4OX9Q 2F0SA 2R85A 4ECZA 5FLXE 4K6DA 1N34Q 2NZHA 2IY5B 1JIHA 2VQEH 3I4MG 4PG3A 3OTOL 2CW7A 3WOFA 4KY5A 3GTMA 1WTOA 3IL8A 4C3IG 1NTGA 3CQZA 2KUMA 4Q43A 4DR5H 1CS0A 2BCOA 1X32A 1I6UA 3A8KE 4O4IF 3JAMW 1D5MC 4DAYB 4B3SQ 1GSOA 1EWHA 2W8LA 4TQSA 4FXKC 1H9JA 1HNWH 2UXBL 5J1ZA 4JI1L 3GIPA 2R93H 2ZM6H 5ELEA 3LMLA 4IWYA 5F9NA 2ICIA 1B6SA 4GKKQ 5IGGA 4CGYB 4DV4Q 3K81C 2C2RA 5ELCA 5EAYA 4PMWA 4RNMA 1SFOH 2WB1A 3MJFA 1Q12A 1I6VC 2UUCL 3EVQA 1B2TA 2ASDA 5DLQE 2D9UA 4P71A 5LMNQ 2HVQA 4ZQ3A 4DL4A 2JYOA 5M5WB 3T1YQ 5IWAQ 1AZPA 4KHPQ 3T1HH 2ZDGA 5I9OA 1I50A 1HNXQ 2GLTA 5BR8L 4ECXA 3D4RA 5IGFA 3GQBA 1IKMA 4XDXA 2WAQG 4A3FG 1LTID 2K75A 2MGSA 3PV0A 4MHEA 2HHHL 5L1JA 1SSOA 3S17B 3MFGA 2B2YC 4QGUA 1EIGA 1PFNA 1NUCA 3RGZA 4FBTA 2JA6H 2RDHA 1IBLQ 2F4IA 2PI2A 2PN1A 5KFIA 1QCBD 4LF8L 4A3BG 4JV5Q 4EQPA 1I94H 3IN5A 3TIGA 3L7ZC 3VR2A 5DQGA 2NVXH 4ME6A 5CV4A 4B9WA 4ZAIA 5C0XJ 2RDGA 4RH6A 3C1EA 1CHPD 3KAJA 3EFXD 2AUKA 4GKJQ 1WI5A 1QZHA 2R7KA 4IPCA 2W7PA 5EKIA 3DEOA 3JSNA 3PIPA 1IBKL 3GV6A 1JE5A 1M1KC 2QEJC 2QF7A 3EPIA 2XGPA 3GV5B 3KHHA 1QUQA 1FNVA 1SDFA 3M85A 4K5XA 3S17H 4NP5A 4QUFA 1ILQA 1CA5A 3BA8A 1IW7D 2VQFL 5TSSA 2UU9L 3KHLA 1PZKD 1AZQA 1VMCA 2DNCA 2IA6A 4ETSA 4B3MH 3M9NB 3U9SA 4BBSH 3CCRA 4HIMA 3NE5B 3H4DA 4X65Q 1RTOA 3OOCA 4JG2A 1IBMQ 4AQYH 5DGAA 1Q1EA 4HJ5A 5JVDF 3NGDA 4KN7C 1S68A 4J9SA 1JE4A 1U4LA 1SAPA 4TUYF 4R8UA 3PQIA 2AGQA 3MFIA 3U50C 1Y1WA 2YU9H 5EGTA 4DK1A 3I70A 2GVAA 5LYJF 3M4YA 4FF3A 4X3UA 3FPPA 1IOWA 2FXQA 3N52A 3QWNA 3GD7A 1VQNA 2BQ3A 5IYZF 4QWDA 4WORA 4ZUIA 1YHQA 5FLXc 1BJTA 4F4ZA 1XNRH 5CV8A 2K1BA 5C3WA 3J80i 1WYDA 4RMFA 1K1SA 4FNFA 4QMGA 3J81j 5EPJA 1VQOA 1K1QA 3LWEA 2ATWA 2G9HD 5AFWA 4DV3L 2F03A 3LWUA 4LF4L 4BWSC 5DG8A 1Q90A 1NNXA 2SCUB 5A2QW 4J9OA 5LMNH 4RKBA 4DPGA 4H44C 5KFKA 3VR6A 1C8CA 5L9XA 2A19A 2Q2TA 5FLXW 2RDJA 2ENBA 2VQEL 3FMAA 2B29A 4EQ5A 5E4WC 1TWHA 3H15A 4JI4H 4A3KH 1E4EA 1LTLA 5NUCA 4EX5A 4DR5L 4RZRA 4QB4A 3M4IA 4NXNH 4LFCQ 2N49A 1IBLH 1FNUA 4NXMH 1L2FA 1CQVA 1TS5A 2RA4A 1WTHA 2PW5A 5ELDA 4BA1I 2F3VA 1YITA 3UE1A 3S2HH 1HNWL 4OWWB 1HJPA 2V4QA 4KLKA 2ZM6L 2C00A 2L15A 5DEHA 2HD3A 3U9TA 1QWYA 4L8JA 5EZYF 1BBUA 3G6YA 4IO9A 4DK0A 1SMXA 3BQ0A 4B3RQ 1JC7A 1ZETA 1B3QA 1TWHB 2QCPX 4ME5A 3X3MA 2CWPA 4YR3A 2B8GA 4OHJA 1TWCH 1D1KA 1I3QH 1TWFA 1KC7A 1X3EA 1IYVA 2VUMB 5KFUA 2E2JB 1TY0A 4AYBB 2I07B 1JXLA 4DK6C 1JKJB 2RBMA 1Z2PX 1W93A 4J9PA 4Q8EA 4UY8C 2DZDA 4ULLA 3GTPB 3HOVH 2K32A 1EEID 3RNUA 2IHFA 5D3IB 5C0XH 4ID6A 2IBKA 1KHIA 3EQLC 1ZKOA 4A3EH 1O7ZA 2JK8A 4P73A 1SMYD 2Q8IB 5I2YA 1ICFB 3GV8B 1I94L 2BR0A 5E1FA 3CD6A 1E4GT 1QILA 4FO2A 4CBVA 1JLLB 4FU0A 4LUZA 3AYHB 1HR0Q 1N32Q 2DIKA 2MFIA 4R4QA 2W9CA 2F0PA 3GIJA 1IL2A 5K36H 5KFTA 3A7AB 1H9KA 2NZOA 3FKIG 2E2JH 3F8NA 5C1PA 1N9WA 4P2CB 2N55A 2FJ2A 1PH7A 3GTGB 2NU7B 4IUNA 2WYOA 3QOLA 4YWKA 1GXDC 5KFBA 3CKIB 5FPOA 3GTPH 1WFQA 3GTJB 1BNZA 4U673 4C3JH 4RNOA 1VQ9A 1O75A 3J80E 4I55F 4ODGA 1FJGH 5M5YH 4RB1A 4LF7H 4JI5H 1B4OA 4YHHQ 1JMCA 2TMPA 5CBAE 2MPMA 3S15H 3A56A 5LMUH 4B3ML 4GNXA 1FL0A 1WTQA 4LUVA 1WTVA 3SEBA 4XYQA 4AQYL 2OTJA 4ED3A 4BBRG 5AJ3L 5M3FH 4MV1A 1WR2A 2YS6A 4XYLB 4YAJB 1KD1C 1E1OA 4LF5Q 5KG5A 2NU9B 4GN5A 5C0XI 2A74C 2PW7A 2KECA 4PWQA 4ECUA 1KNAA 5M3MH 2K5VA 3S9WA 4FDBA 4XQNA 3ER0A 4JI7H 1KJ9A 4I50F 4LMQD 2AWOA 4WJ3M 2NVYA 4JCVE 5KNCA 4DXFA 3BA9A 1Q81C 3BG3A 1BKBA 3UDXA 2O5JC 2NB0A 1X9NA 3H09A 4P74A 3LNNA 1V4YA 4YJ2F 1NR2A 2OT2A 1YI2A 3VPBA 2IL8A 1XNRL 1SRUA 2KHJA 1HZBA 4L6TB 4ZCKA 2WB1G 1EU3A 5J2UF 2N8NA 3PR4A 1K0SA 4EG0A 2RGVA 4J8QA 3VPDA 1HTLD 1ENCA 3A5ZB 1BOSA 4H13C 3SDZA 2B63B 1KJIA 2J7ZA 2J6SA 1ZXTA 1K9MC 3KHGA 2O5IC 1I6HB 4OIKA 2H1EA 3K80C 1M8AA 1QNUA 2WKDA 4KHZA 3OUUA 1A3TA 1SYGA 3FRPB 5C3EH 1AFPA 4A3GG 1SNMA 5J2TF 2F0VA 1SE3A 2L0CA 3L9AX 3NHHA 1B50A 1KJJA 2KA7A 3H20A 1CM9A 3HOWG 3QJYA 2J0TD 3A54A 3MVVA 1EUJA 1AN7A 3OSNA 3OHAA 1SEIA 3CCJA 1TKWB 3HP3A 2IWHA 3I7FA 2CVRA 5FLMG 3NENA 3KLRA 3J81i 4BWGB 1Q8IA 1R9TH 2R61A 1M90C 4JI4L 4ECRA 3PW5A 4JUZA 4UAIA 1AUVA 1PXUA 2FJZA 5JJIA 5GAHC 5JQWA 3OMCA 2H5XA 4NXNL 2HT1A 4J15A 3PW4A 2CFMA 2Y0SB 3TZDA 2JEBI 3D3RA 1IBLL 3QG1A 1YNJD 4NXML 2LY7A 3OTOQ 4O2AF 5DAUA 1VDZA 1JX4A 2Z6KA 2LS01 3STBC 2HQLA 4CC5A 3TS2A 4KV6A 4YIJA 5LL6S 2DY7A 1N32H 4MNOA 4DV7H 4LH7A 1L2ZA 2UXBQ 4JI1Q 1JOKA 2B2TA 1ONLA 4BA2I 1V1PB 3DWAA 4HCEA 4ZRZA 1NBWA 5LOVF 1IW7C 2J6TA 1WCMG 2KCTA 3O13A 5BMVF 2UUCQ 4YQWA 1K83A 2KVMA 1XYIA 2I87A 4B9XA 5LP6F 3GO5A 2K6AA 4YHHH 4EGVA 5D1OB 1V1QA 3T13A 2ZT9C 3K0XA 3FP9A 4BS9A 1H9RA 1YNND 4NMZA 2AMCB 1CSPA 5KFSA 3J80L 3Q8QB 1Y1VA 5C8YF 2VB3X 1C3OA 3SK5A 1SJED 3RF2A 2XCAA 4IQZA 1Y1WG 2HHHQ 3HOUG 4LF5H 1J6QA 4C2MB 4N8FA 2K01A 5JEAJ 3J80c 3I3CA 2F0KA 4K2KA 4LWCA 2EIFA 2CKZB 2NTTA 5CMDA 4QWBA 1Q46A 4FM9A 1ASYA 4LF8Q 4O3SA 3AFPA 5KFJA 2EYOA 4A3DB 3GILA 1XTCD 3D4DA 4A3IH 4G7HC 3Q23A 3GTLB 2D0PA 3Q6SA 3E5SA 3S1QB 3V4ZA 3OIQA 1LABA 3N41B 3HG9A 4Z9CB 1KNEA 1M7JA 1KXLA 5M5XB 3GTOB 2FLLA 1Y8PB 3TQTA 1DOKA 3R5FA 3PF5A 4A3CG 1Y1VB 1HRJA 1F2MA 2F3WA 4LJZC 1IHZA 5CC4A 1FJGL 3J80W 2F0IA 1OO9B 2I80A 4LF7L 4JI5L 5HY6A 1IBKQ 2J4XA 4HJ7A 2Q2IA 4U68A 4OO1G 5LMUL 4HJ8A 1JJCB 4XYMB 2XGTA 4IRDA 4ECSA 1PLFA 1UE7A 2O4XA 4TQUS 4DN4M 3G6VA 3PW7A 4C2MH 2VQFQ 4PV1C 2UU9Q 5BN5A 2E2HA 5CGKA 4GLVB 1SNDA 3RB6A 1JOOA 4P72A 2NU6B 4A93B 3I4MH 1T3NA 3MHBA 2RDFA 4X6AH 1DD2A 4YR0A 1PH6A 4P75A 3GTLH 2F0TA 4JI7L 1U5KA 4C3IH 3J81E 2R7ZG 3S1QH 4QQBX 4RAZA 5JUMA 2JA5B 4KD3A 3RB0A 3QFFA 4DR2H 1N33H 5M5XH 1LT5D 3Q1KA 2NN6H 4KKUA 5IYBG 1Y14B 4LNQA 3JSLA 3M7NA 2Q2UA 4K0KH 4HR7A 1V9PA 4YCUA 4UCVA 2RCNA 4A3BB 4Q44A 1EYCA 3ZYYX 3GIKA 1BVSA 2Z6BA 2ZXRA 1PH3A 1CE8A 3GTKH 2R92A 4PQXA 2KEEA 1CUKA 4OWTB 2K5HA 2B2VA 3HKZB 2WINB 1DGSA 4QIWA 3BYTB 3RB4A 4DV3Q 3H0GA 2PQAA 1WJJA 5K5PA 4EYIB 4J9LA 1WTWA 5BPHA 3R8BA 3OHBA 2JA5H 1SMYC 4CJ1B 3E0JA 1AE2A 3M4OB 2WTFA 2PPBC 3NBHA 1EZ8A 5ISRA 2VQEQ 2SOBA 4YWMA 4C1NK 3I4NB 2W6NA 3H40A 4JI2H 1GHKA 4HAEA 1FVIA 5C44G 3AEVA 4A3BH 1SNQA 4DR3H 3Q8SB 4DR5Q 3KLSX 1AEXA 3HOYG 3DM1A 2FK2A 3I90A 4DL7A 4N9PA 1JWUD 4E4TA 5CV7A 4DAPA 3OPOA 1JJ2A 3JZIA 3KTMA 4U7CA 4R9WA 2NN6I 4A3LH 3H0GB 3PIOA 1N32L 4DV7L 2A6HD 2F0UA 1D6EC 2XVSA 1UE6A 1HNWQ 5GAGC 3QO2A 2A1AA 4ECYA 2ZM6Q 2MUYA 2WAQE 2WFWA 2DNEA 1EYDA 3N8DA 3NK9A 1Z2OX 5DM63 4RAYA 2IHEA 5I4DA 3MZ5A 2OF1A 1K8AC 1T5EA 1YVCA 4G57A 2UVWA 1A2UA 4OXPA 3VYSA 3K7AH 5KG4A 1EEFD 5KT4A 2ZTCA 3CCLA 3HGBA 5JEAH 1DCZA 2AGPA 3T53B 1LO5D 3RGXA 2QGQA 3W2DA 2V9WA 1PHJA 3AFQA 5KT6A 3NTIA 2IJ0A 1CKMA 1A8VA 3IRBA 3PUZA 5FD6A 1VQ8A 1KABA 1OXXK 4ZKCB 2KJXA 3PW2A 3PO3G 4LF5L 3BJUA 4MA0A 3D8GA 4GLXA 4RAUC 4RHSA 1YZ6A 4X66H 1GLVA 3OW7A 3OIPA 2BQUA 2JQOA 4LW1A 4G4KA 1X3GA 2BDNA 3PF4A 2BE5D 4RZQA 2UXCH 1S5ED 1N56A 3QOJA 4A3MB 1BCPD 2K05A 4LUOA 4X3TA 1HZ9A 3JC66 1K8OA 1G6PA 3ULLA 2EJFC 5COYA 3KYHC 2ASLA 3E0EA 4IFDG 3I4LA 1G91A 2AQ4A 3L4KA 2CZGA 4RGMA 4DUYH 3K57A 2KQ3A 1STHA 3F2UA 3J81c 5C5JA 5KFHA 4GS3A 4F50A 5KFAA 5DLFA 2R6GA 5JVH3 4A3JB 4K8IA 1HTPA 1ZYRD 4BY7G 4G7ZC 1AW7A 2L11A 3JAML 2R93B 1I4RA 3F2DA 3R3OA 2N78A 4DAYA 1Q82C 1M0TA 4EEQA 3KDFB 4J9MA 2JA6A 4XQQA 5FOBB 5EBCA 4HIKA 1PH2A 1SFOB 4B3MQ 2EY5A 1RHPA 1YNJC 4AQYQ 4A3MH 5AJ3Q 4FYDA 1WTRA 3BAAA 3VYUA 2GPWA 1J5EL 1SE4A 3J81W 5EPKA 3QR8A 1N33L 4DR2L 3GLKA 5C5LA 4O4HF 2HVRA 1DONA 4ZKBB 1VKZA 3J7A5 3JRXA 4JPBW 2JXMB 3UDGA 5EBDA 2GN5A 1GUGA 1HNZQ 4K0KL 1SXTA 2RSOA 3IAYA 3P7JA 2E2DC 3DUZA 1TQOA 1E4FT 3H94A 1DJRD 4A3JH 2E8GA 3VDYA 2YL2A 3TDQA 2JA6B 1I4XA 4JW0A 4IUTA 1XNRQ 4MV9A 3CCUA 2YRXA 1XXGA 3K3VA 3MTSA 2KCCA 3KLSA 2YCHA 3OWEB 3VPCA 4PMCA 2F0OA 3S1MH 2E2IB 4G7OC 3HBLA 3FDSA 1IKLA 2NVXB 1D5ZC 2XWJB 1PK8A 4IPGA 2RHSB 2PMZE 1YNNC 3MFYA 4Y7NH 3KAKA 4N8X1 2XIWA 4DV0H 3NXWA 5EWFA 5JVLA 4IUUA 3IFDA 2NTSA 1L1OB 4AIMA 4A2AA 5I6YA 4Q5VA 4UP8A 1EY9A 2VS1A 3S24A 2ZJQA 4QW8A 2UVVA 4JI2L 4RCNA 2YU9A 1F9RA 1LACA 2W71A 2EYLA 2XC9A 4JI4Q 4DR1H 5JAVA 5K2MA 4KHVA 4DR3L 5HBRB 1U4PA 4WD3A 1CTMA 4FP5D 2VQDA 4RNNA 4HMJA 4BBRB 4NXNQ 2ALYB 2RKSA 3HS0C 4O3PA 4PZ6A 4X64H 1STGA 4NXMQ 5KG2A 4KI0A 1EQVA 2E2IH 1M4VA 2EVBA 4BBSB 1OXSC 3DWPA 1PTOD 2LKVA 1T5XD 3FKIH 2CQYA 3NELA 4DA2A 4CKEA 1KIXA 4A2BA 1TWGB 4RKLA 4C3HB 5C4XG 1B8AA 5IT9E 1BCPB 1JICA 4O42A 3KHRA 1HHVA 3N42B 2D2CC 3Q2OA 2R8KA 5D65A 1KL9A 3HEJA 2YU9B 2W6OA 2W6QA 3R5XA 4MV3A 5E4XA 2F0QA 4XX0B 2BH8A 4ZLTF 1EQTA 3AB9A 3VYTA 2NZ1D 4HJAA 2QW7A 2X69A 1RODA 1VF5C 4F87A 2B2UC 3CW2C 1B7YB 4NPSA 5J3BA 4BBRH 3TQ1A 5DLGA 2C2EA 4BY1B 1PDQA 4A3GB 3GTMH 1LTGD 4EGJA 4TV8F 2EE1A 3PUWA 5T1GA 4MV8A 5JJLA 2GPSA 4X66L 3QZ8A 3NEMA 1TWGH 3HOZG 4C3HH 3I72A 4MA5A 2TSSA 2UXCL 4DL5A 1NY4A 5A2QL 2XIGA 1VQBA 4HMIA 3H91A 3BDOA 2OEOA 1JORA 4E6IA 4Q0FA 2K5WA 1F2ZA 1SN8A 1EWIA 1BXRA 1HNZH 1VF7A 5FLXL 1PH4A 4M1UB 2EYJA 4A3KB 2R92G 2LXKA 3QZ7A 5IYCG 3OMGA 1HFGA 3GTQB 5KFZA 2DWCA 1SYDA 4DUYL 2Q2HA 3RBEA 2CCZA 1A0IA 2PO4A 4ED8A 4JOIA 3RLNA 1S3OA 1BUVT 3ONAB 4BY1H 4IUQA 4A3GH 1FJGQ 3S2HB 4LF7Q 4JI5Q 1C7YA 1KRTA 1STNA 4POGA 3Q0AA 5LMUQ 1SNPA 1SJHD 2EXZA 1WCMB 5FLMH 3KFUA 4APMA 4QWCA 2XWBB 4LF6H 4GN4B 1ZHSA 1JWSD 1VQJA 1S03G 2KOLA 5D1PA 2WB1E 3RZDH 3S1NH 2F0JA 4JI8H 1TWCB 1I3QB 4MZ9A 1CZWA 2W6ZA 4OELB 1MZBA 4DV5H 3D4WA 4QF4A 1BF4A 4FF4A 2ATLA 4JI7Q 2A6HC 3GTQH 4IOAA 4CDCC 4ZI7F 3PN1A 2VUMA 1VQ4A 4AYBA 2MNAA 3HOVB 4XQJA 3NWSA 1EIHA 4HYKA 3BVZA 4A3EB 2F0DA 4V0BA 2G9DA 1GM5A 3GTPA 3RZOH 1G6ZA 2JJQA 3PGZA 4IJHA 1VMPA 3CRKC 4C5AA 4KY6A 1GVPA 1CQIB 1L1OC 1YJWA 2PI2E 5CA0F 1WCMH 3WDNA 1EY0A 2UVRA 4PZ7A 5LL6X 4IR9A 4DV0L 4EQOA 4EBEA 4WJWA 3TRZA 1K73C 1X65A 1CK1A 1VQDA 3EBEA 2JA7G 3EPGA 2D62A 2ES2A 1BBXC 4YJ3F 2CQAA 2Z1CA 3PO2G 5IT9c 3AU7A 4DR1L 1MSGA 2A69D 5KG7A 2EY2A 4C3JB 1KEEA 5M5YB 4IPHA 2C9OA 3HOUH 4R8IA 3GTGA 3ETHA 1QNKA 2BE5C 2AUJD 4PZ8A 4FXDA 1BCPC 5KEEA 4X64L 3S15B 5EDWA 3GTJA 4JC0A 3VA7A 2QK4A 2DGYA 1HXYD 1X6OA 3T5KA 5IYDH 1XDNA 4NB3A 1PTOH 1ET6A 1N36H 4M9UA 2LMCB 3V05A 5M3FB 2PZTA 2FMAA 3GIIA 2DN8A 5EKKA 2QDLA 2R7ZB 3GV3A 5IT9W 4A75A 4DV7Q 2XSCA 3ERQA 1VQAA 1W96A 2E75C 5M3MB 2VA2A 2B39A 1ZYRC 2JEFA 3GIMA 4KJNA 1DOLA 5ELOA 5KIXA 2NVQB 5I47A 3OWFA 2ASBA 2NYZD 3EROA 1E1TA 2K14A 4FBUA 4OO1H 2FMMA 3E5NA 4KKTA 3K5OA 3KF6B 5DM73 4R7RA 4CJ0B 2IPKD 3VA5A 3HOXG 3UI2A 3A5UA 4YR2A 4LFBH 4IFDJ 3KXYT 1C4QA 2H4OA 4IHJF 3D6WA 3HB9A 5L1IA 3RJ0A 4QUCA 1S5FD 1K3RA 3CPFA 1GUNA 4AH6A 4ZK9B 1BO0A 5C3EB 2B63A 2AKWB 5E7NA 2R7ZH 5CORA 1F9QA 1HA6A 3PUXA 3QIAA 4HSPA 4MV4A 5IYBH 4DV2H 4O2DA 3E9HA 5C5MA 1I7LA 3C3LA 4RB0A 5IIFA 1HNZL 5KFXA 5KG0A 1UE1A 3D0FA 5CYUA 2NVQH 5KGUA 2LSSA 1LTTD 3ZJYC 1R9TB 3WNZA 1H9SA 1NR4A 3J7ZC 2V5AA 2E5LH 4JI0H 4ECVA 1STBA 3MR3A 2GA4B 3S2DH 2Z4HA 3NPPA 3C0FB 4MTEA 4QWAA 1TWFH 2UUAH 3W3AA 4UCOA 2EPBA 4DAMA 4K5WA 4ED7A 3NQIA 1BCPF 2BOSA 2Y0SA 1V51A 1RJTA 2HCCA 2F0MA 3K5LA 2F4VH 2YYAA 1U0LA 4JI3H 4OO1I 2R7FA 3DEPA 3TBIB 3IKJA 4LF6L 1GGOA 2L1BA 1UC8A 1W6KA 2K04A 1H9SB 4JI8L 1EYAA 3KJOA 4MV7A 1C9OA 5I6WA 2B2WC 1JOQA 3CC2A 3VR3A 3TMEA 1WH2A 1V1PA 4DV5L 3M3YB 2MHVA 4DU9A 1QE6A 3MXNB 1VQHA 2JEAI 1SYCA 1W3SA 1J5EQ 1N33Q 4KK7A 4DR2Q 2J6UA 1E2WA 1PTOC 1PZID 5E3FA 1VBHA 3PO3B 1A6XA 1O7IA 4RUCA 2CHBD 1DXMA 1QZGA 4J0MA 5LL6b 3FMCA 2VA3A 4QW9A 1JWMD 5EPLA 4K0KQ 1MI2A 2OWOA 1RJQA 1TAEA 5D1OA 1Z6HA 1DM0B 3BVGA 3NQTA 4OGQC 4IR1A 1N8RC 4L1KA 4V190 3BS1A 2K7VA 4J1MA 4U6PA 4O3NA 1BR9A 2OTLA 5I9PA 2JA8B 5KFYA 4KN4C 3I55A 3N40P 1RYRA 1YJNA 1I7NA 1SYXB 4C2MA 4M8AA 5DGBA 1TY2A 4LH6A 2CQOA 3CP0A 4A3IB 1EYGA 2R8JA 2P5ZX 3WO1A 1PYSB 2YTXA 1GD7A 3M3YH 2SNMA 3TP5A 1TXYA 2V59A 3M7GA 5KG1A 4H02A 3GTLA 1NMFA 1KDCA 3PO3H 4L5TA 3GTOA 3IFTA 4DR6H 4TKOB 1IXRA 1CQFA 2NVYH 4L5QA 1VQ5A 1SCUB 4UHVA 2Z0SA 4EYHB 2PNRC 2W70A 3PIO3 3UFXB 2WACA 4JI2Q 2W8KA 4GC6A 4L63B 4S3SA 4DR3Q 1UWVA 1G51A 2O2LD 4MN3A 3RLFA 5D3DA 3K59A 2MP1A 1N36L 5IY0A 1TWAB 5IP7G 3K58A 4X3KA 2JA8H 3W1BA 5LHY1 4IRKA 3CAMA 3W1GA 2F3IA 3K5HA 1NSNS 1XTDA 1XPOA 3I4MB 4YY3H 2AQ2B 3FEWX 1EHIA 2ZDHA 1TIID 3DLLA 3PUVA 2R6FA 1ML0D 4IFDH 4C3IB 3K0YA 4KKSA 3H3VH 4YP3A 1MSHA 1S40A 3DF7A 4RB3C 4FS1A 1GKHA 4ED1A 1UAPA 1PTOF 5GADC 4BY7H 2JA5A 4DR7L 2PBZA 4PNYA 1B9NA 5IE8A 3WWVA 3S1RB 3TP8A 4LFBL 3N44B 3G7LA 4DL6A 3I2ZA 5D8DA 4DL2A 3I8ZA 2YYZA 3BDCA 4HIDA 2I5LX 4DF7A 1PH5A 3UE0A 3EJIA 3GTKB 1BGWA 2VPQA 3ND8A 3V6KA 1TWAH 4JV2A 1SROA 3R93A 1R4PB 3LGJA 4LSXA 4HNUA 4PMBA 2VW9A 3D31A 4DV2L 1RKNA 2VUMG 5BN4A 4AYBG 1CZGA 3RBDA 2WP8J 4F7XA 2AQ3B 2DLNA 3HKZA 4X66Q 1KC8C 1PA6A 1T94A 3CCVA 2WAQB 4A3FB 3CPWA 2UXCQ 4DV6H 1S5CD 4O3OA 1CKNB 2E5LL 4JI0L 1VCIA 2C28A 1NJIC 1STEA 2EYPA 2XGQA 2K28A 5EKLA 2UUAL 4ZOLF 1A15A 1PRTD 3CC4A 3S1RH 4EBCA 1E3PA 3GDEA 3RMHA 4IFDI 1JJGA 2FFKB 4DUYQ 4GNXC 1PFBA 3H3VI 4OIJA 1XNQH 1XX8A 4IUPA 2F4VL 3SHLA 2KSWA 5FPRA 4JI3L 1MGSA 3KALA 1XMOH 3G6XA 4F4WA 1L0XB 5J39A
chains in the Genus database with same CATH topology
3G71A 4A3JH 2VQEL 1CKOA 2E8GA 1CSQA 1QVCA 4DV6Q 3HOYH 3VDYA 2HIVA 2B29A 4EQ5A 5LMNL 2OCEA 4BY1G 3H15A 1HZCA 1XNRQ 2XTIA 4A3KH 4JOIC 3CCUA 3T1YL 1LTLA 4A3FH 2VY3A 5GQOA 4EX5A 5IWAL 4DR5L 4KHPL 3S1MH 3AQQA 2EQSA 4LFCQ 4O0AA 1HNXL 1VQIA 2N49A 1S72A 1IYJB 1Q7YC 1VQKA 1L2FA 5IP9H 2AWNA 3Q8DA 1YITA 4BA1I 1SE8A 3UE1A 3S2HH 2YV5A 1HNWL 4IPGA 1HJPA 2PMZE 2RHSB 4Y7NH 1VS0A 4KLKA 4OWWB 2ZM6L 1XNQQ 2L15A 3UDIA 1B70B 1MKHA 1OXVA 1XMOQ 1Q86C 4R4CA 4APVA 3A0JA 1BBUA 3BU2A 1L1OB 5FJ8H 4AIMA 2OQKA 4IO9A 1SMXA 2IT1A 4UP8A 3TS0A 5C4XH 4A3KG 2VS1A 3S24A 2ZJQA 4B3RQ 2MO0A 4JV5L 1XPRA 3L0OA 4JI2L 1K0RA 2CWPA 2B63H 3JAMi 4JI4Q 1JB7A 2VZAA 5LMNW 1LYLA 1I6HH 1TWCH 2VL6A 4DR3L 1I3QH 1JT8A 4WJ4A 3KLWA 1X3EA 5IP9G 4NXNQ 2ALYB 4PZ6A 4DK6C 4NXMQ 4TVAB 5HGQA 4KI0A 4GKJL 2E2IH 4UY8C 1G291 1OXSC 3HOVH 3RNUA 3FKIH 2IHFA 1GO3E 3NELA 5FJ8G 1Q8KA 4DV0Q 1KHIA 3G6EA 3MEFA 4A3EH 1KIXA 2I5MX 2JK8A 1B8AA 5C4XG 1H95A 4OONA 4P73A 4DR6L 2B63G 1D7QA 1NE3A 1KRSA 1UEBA 2KHIA 2Z6KC 1KL9A 2R7DA 1I94L 3CD6A 4DR1Q 2BH8A 1K8GA 2F52A 3HOZH 5BR8Q 4JI6Q 4L5SA 4LUZA 3AYHB 1VQGA 4UP7A 4YCWA 4HJAA 1HR0Q 2MFIA 1N32Q 4X65L 4R4QA 1IBML 1IL2A 4X64Q 3CW2C 1B7YB 3F2BA 2NZOA 4NPSA 3HOVG 3FKIG 5C0XG 1EIFA 5J3BA 2E2JH 4YY3L 4BBRH 4A3EG 1N9WA 4X62Q 1PH7A 3GTMH 2R92H 5IYCH 3KDFA 2ZJPA 1CKNA 4DKAC 3ICEA 1E7ZA 4YWKA 1HR0W 3GTPH 1WFQA 3PUWA 5IYDG 4C3JH 1VQ9A 2Y0SG 3UDFA 4IJLA 5M5YH 2K5NA 4X66L 5JJLA 3M4QA 3NEMA 1TWGH 1V43A 4C3HH 3HOZG 1RL2A 4YHHQ 1JMCA 2UXCL 3DM3A 1L0WA 1NY4A 2Y0SE 3S15H 1VQBA 3KF8B 5K36G 4B3ML 4GNXA 1FL0A 2LXJA 4LUVA 1PH9A 1SN8A 1EQQA 1EWIA 2OTJA 4AQYL 3CMEA 4BBRG 5AJ3L 5M3FH 3K8AA 1PH4A 2GVBA 4XIGS 1IZ6A 4HJ9A 1KD1C 2LXKA 1MJEA 1E1OA 5IYCG 4LF5Q 2K50A 2R92G 4DR4Q 2DUDA 4GN5A 4L5RC 5C0XI 1HZAA 4DUYL 1N32L 2UXDQ 2Q2HA 2I0QA 2CCZA 1A0IA 5M3MH 2K5VA 4FDBA 4JOIA 5GAEC 3ER0A 1YBYA 3RLNA 1S3OA 4WJ3M 2AWOA 2V1CC 4BY1H 1EFWA 2NVTH 1X55A 3OYYA 4JCVE 1FJGQ 4A3GH 4QIWE 1Q81C 3UDXA 1BKBA 4LF7Q 4JI5Q 1X9NA 4P74A 1C7YA 4DV6L 4GN3B 3CCEA 1K83H 1KRTA 4POGA 1YI2A 4JBJA 5LMUQ 1XNRL 4A3DH 3CCQA 1SRUA 2KHJA 5M3FG 1HZBA 1YJ9A 2CWAA 2WB1G 4R4OA 1C0AA 3E9IA 1X3FA 2N8NA 5FLMH 3KFUA 4GN4B 4LFCL 3A74A 3GTOH 1VQJA 3A5ZB 4BXXH 2IX1A 2WB1E 3RZDH 1K9MC 3S1NH 1L1OA 1D8LA 1QVFA 5M3MG 4MZ9A 1Y1VH 1PV4A 3K80C 3B6YA 2D0OA 1VQCA 4KHZA 2HT1A 2UUBQ 5C3EH 1Q1BA 2AHOB 1MJCA 1XNQL 4A3GG 3G48A 4JI7Q 1XMOL 3GTQH 3HOWG 4IOAA 3HFZB 1EUJA 1OXTA 1VQ4A 2MNAA 4A3DG 3CCJA 4B3RL 3I7FA 1SR3A 1XPUA 2EXDA 5FLMG 4LF9Q 3NENA 2JA7H 3J81i 1M90C 4JI4L 1R9TH 1GM5A 4BXXG 3RZOH 2NN6G 2JJQA 3PGZA 4GOPB 4IJHA 3RN2A 3PO2H 5JJIA 4A93H 5GAHC 4LF6Q 2H5XA 1MIUA 1Y1VG 4J15A 4NXNL 2CFMA 1GVPA 1PH1A 3CXCA 2JEBI 1IBLL 4LF4Q 1L1OC 1YJWA 4IPDA 2PI2E 4JI8Q 4NXML 5C3EG 3OTOQ 1WCMH 4R4TA 2QA4A 4OWXB 2Z6KA 5C4JH 4PZ7A 1A63A 4DV5Q 3TQYA 1AE3A 3STBC 2HQLA 4DV0L 3TS2A 3TRZA 4JYAQ 1K73C 1X65A 4MNOA 1VQDA 3EBEA 2JA7G 2JA9A 2D62A 4IOCA 2ES2A 2UXBQ 2VNUD 4JI1Q 3PO2G 5IT9c 1PFSA 4A93G 4JBWA 4DR1L 4BA2I 2E2HH 1NBWA 3F1ZA 4JI6L 3CMAA 4IPHA 1SLJA 1EOVA 3HOUH 1ASZA 1HR0L 1WCMG 2KCTA 1YHAA 2PQAB 4PZ8A 2JA5G 2UUCQ 4X64L 3M4PA 4JC0A 2A8VA 2DGYA 1X6OA 3GO5A 5IYDH 4NB3A 1OXUA 2ZTEA 1V1QA 4X62L 3FP9A 2MQHA 3K0XA 1P16A 2RHQB 3HOXH 3NBHB 3KJPA 1RIPA 4A76A 2AMCB 1OTCA 1CSPA 5H1SE 3I56A 4A75A 4DV7Q 3M4OH 3U58A 1KQSA 1VQAA 2HHHQ 1Y1WG 3S16H 4YHHL 3HOUG 1J6QA 4YCVA 3I4NH 4A3LG 3T1HQ 1EQRA 5JEAJ 3J80c 2ZJRA 5ELOA 4DUZQ 2ASBA 3HKZG 1YIJA 4LWCA 1E1TA 2K14A 2EIFA 5M5WH 2CKZB 3CQZH 4RG1A 3STBD 4HIOA 1Q46A 4DK3C 1ASYA 4LF8Q 4LFAL 3AFPA 3KF6B 1VQLA 3HKZE 4A3IH 3HOXG 2D0PA 3H0GH 4MTNA 1VQ7A 3A5UA 1N36Q 2UXDL 1A62A 4IFDJ 4UPAA 3I4OA 1KXLA 4UP9A 4DV1L 2R7ZH 5JEAG 3PF5A 4A3CG 1Z47A 1K3RA 3CPFA 1I94Q 4AH6A 3I4NG 1FJGL 1FGUA 5GROA 4LF7L 4JI5L 2AKWB 5E7NA 5HY6A 3BZKA 3ULPA 1W2BA 1YHBA 4ME3A 1IBKQ 4JBKA 4HJ7A 2Q2IA 3PUXA 2JA8G 4OO1G 1VQFA 5LMUL 5IYBH 1JJCB 4HJ8A 3W5OA 2XGTA 4O2DA 3E9HA 1Z9FA 1UE7A 4TQUS 4A3IG 3RLOA 1WOCA 1HNZL 4C2MH 2VQFQ 3H0GG 3HKSA 1UE1A 3D0FA 1XMQQ 1I50H 4B3TQ 2LSSA 2UU9Q 2NVQH 1VQPA 3ZJYC 4DR7Q 4GLVB 3J7ZC 2YTYA 1QVGA 3FHWA 2K4KA 4P72A 1X54A 3CCSA 3HOWH 1LUZA 3I4MH 1QUQB 1BBWA 2IX0A 4LFBQ 4X6AH 3S2DH 1TWFH 2MO1A 4P75A 1PH6A 3GTLH 4JI7L 1U5KA 3TREA 2C35B 4C3IH 4DAMA 3CCMA 4GOPA 4YWLA 2R7ZG 3S1QH 4QQBX 5M5XH 5IYBG 1KAWA 2BA1A 1LM0A 1Y14B 4LNQA 2QEXA 3JAMc 4JBMA 4LF9L 3RN5A 4DV2Q 1U0LA 3M7NA 2Q2UA 4OO1I 4QY7A 4OX9Q 2R7FA 1V9PA 1T9HA 2NZHA 4YCUA 2JE6I 1N34Q 2RCNA 4LF6L 2IY5B 3BZCA 3I4MG 4PG3A 4JI8L 3KJOA 3OTOL 4Y52H 1BVSA 1C9OA 4XTCS 4QJFA 1PH3A 2E5LQ 3GTKH 4JI0Q 2BA0A 3CC2A 1CUKA 4OWTB 1NTGA 2K5HA 4DV5L 3MXNB 1DGSA 1VQHA 4GOPC 2UUAQ 2JEAI 4JYAL 1W3SA 1J5EQ 4DAYB 2K52A 1N33Q 4B3SQ 4DR2Q 3RR5A 4DV3Q 2KCMA 2PQAA 1EIYB 1WJJA 4A3MG 2UXBL 1O7IA 4JI1L 1UE5A 1QZGA 2R93H 3F8TA 2F4VQ 2JA5H 4JI3Q 1YEZA 1PYBA 4K0KQ 2OWOA 4GKKQ 4DV4Q 3K81C 1AE2A 5EAYA 4PMWA 4DNIA 1SFOH 1Q12A 1N8RC 2VQEQ 2UUCL 4YWMA 1PVOA 5DLQE 4P71A 1VQ6A 5LMNQ 5C44G 1FVIA 2OTLA 2KBNA 3AEVA 3T1YQ 4A3BH 1VQEA 3I55A 2BH2A 5IWAQ 4DR5Q 4A3JG 4KHPQ 1YJNA 3HOYG 1Y1WH 1HNXQ 2CQOA 5BR8L 3CP0A 1JJ2A 3ERSX 1EYGA 2NN6I 1PYSB 3PCOB 2YTXA 2WAQG 3PIOA 4DV7L 4A3FG 5IP7H 4A3LH 1GD7A 2K75A 2R93G 5ELNA 3M3YH 3PV0A 1UE6A 2YTVA 1E22A 1TXYA 3KF6A 5GAGC 2HHHL 1HNWQ 2A1AA 4H02A 2ZM6Q 4QGUA 2WAQE 2WFWA 3T1HL 2JA6H 4DUZL 1NMFA 2IHEA 1IBLQ 3PO3H 4L5TA 1K8AC 1IXRA 1YVCA 2PI2A 1P8LA 2HIXA 2NVYH 4L5QA 1VQ5A 4LF8L 4A3BG 4JV5Q 4OXPA 2Z0SA 3K7AH 2RF4A 4JI2Q 1E24A 3L7ZC 2ZTCA 3CCLA 4A3CH 4DR3Q 1UWVA 1G51A 2ZTDA 2NVXH 2B3GA 3RLFA 1N36L 5C0XJ 2ID0A 4A4IA 5IY0A 5IP7G 2QGQA 3SGIA 1HH2P 3AFQA 1PHJA 2JA8H 3CC7A 3W1BA 3CAMA 3W1GA 2F3IA 1CKMA 1A8VA 3IRBA 1WI5A 1XTDA 3PUZA 4IPCA 3U4VA 1XPOA 1QZHA 4GKJQ 1VQ8A 3EIVA 2JA6G 2OQ0A 3PIPA 1OXXK 3DLLA 3PUVA 1IBKL 3PO3G 1JE5A 1M1KC 4LF5L 4DR4L 3BJUA 1TWHH 3H3VH 1AH9A 3U4ZA 1I5FA 1QUQA 3K7UC 4GLXA 3M85A 4DR6Q 3S17H 1S40A 1YZ6A 2VQFL 2VUMH 1XMQL 4B3TL 1GKHA 3EN2A 2UU9L 2JQOA 4LW1A 1X3GA 5GADC 3PF4A 4BY7H 4DR7L 2PNHA 4LUOA 3S14H 1HZ9A 3JC66 5IE8A 3WWVA 4BBSH 4LFBL 1G6PA 3ULLA 3CCRA 4HIMA 3I2ZA 4X65Q 4JG2A 1IBMQ 1Q1EA 4HJ5A 3KYHC 2N3SA 2YYZA 3KOJA 2I5LX 4HIDA 1PH5A 3UE0A 3E0EA 3PUYA 4IFDG 1YNXA 1TWAH 4YY3Q 5JJKA 1SROA 3LGJA 3CF5A 3OW2A 3J81c 4GS3A 3U50C 1XJVA 2R6GA 2YU9H 2VW9A 3D31A 4DV2L 2VUMG 2UUBL 4AYBG 2GVAA 4LFAQ 1X56A 3L2PA 1VQMA 2WP8J 4OX9L 4BY7G 1N34L 2FXQA 4X66Q 1KC8C 1PA6A 3CCVA 3GD7A 3CPWA 1VQNA 3F2DA 4AYBE 2UXCQ 2N78A 1Q82C 1PH8A 4BBSG 1YHQA 5FLXc 3KDFB 1CKNB 2E5LL 4JI0L 1VCIA 4HIKA 4ALPA 3J80i 2KENA 1WYDA 4R1JA 4DV1Q 4RMFA 1PH2A 1NJIC 4B3MQ 3J81j 4AQYQ 4POFA 3GTGH 4A3MH 3TEHB 5AJ3Q 1VQOA 2UUAL 3M9BA 4QL5A 3G4SA 1J5EL 2ATWA 3CC4A 3S1RH 3PSIA 4DR2L 3GTJH 4DV3L 4B3SL 1N33L 4LF4L 1E3PA 3GDEA 4GLAC 4IFDI 1JJGA 4R4IA 1NMGA 4DUYQ 4GNXB 4GNXC 3H3VI 3J7A5 3UDGA 2I5HA 2F4VL 2GN5A 4JI3L 4DPGA 1HNZQ 4K0KL 3ULJA 4GKKL 4DV4L 3F2CA 5C44H 2A19A 2Q2TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G71 A;  4A3J H;  2VQE L;  1CKO A;  2E8G A;  1CSQ A;  1QVC A;  4DV6 Q;  3HOY H;  3VDY A;  2HIV A;  2B29 A;  4EQ5 A;  5LMN L;  2OCE A;  4BY1 G;  3H15 A;  1HZC A;  1XNR Q;  2XTI A;  4A3K H;  4JOI C;  3CCU A;  3T1Y L;  1LTL A;  4A3F H;  2VY3 A;  5GQO A;  4EX5 A;  5IWA L;  4DR5 L;  4KHP L;  3S1M H;  3AQQ A;  2EQS A;  4LFC Q;  4O0A A;  1HNX L;  1VQI A;  2N49 A;  1S72 A;  1IYJ B;  1Q7Y C;  1VQK A;  1L2F A;  5IP9 H;  2AWN A;  3Q8D A;  1YIT A;  4BA1 I;  1SE8 A;  3UE1 A;  3S2H H;  2YV5 A;  1HNW L;  4IPG A;  1HJP A;  2PMZ E;  2RHS B;  4Y7N H;  1VS0 A;  4KLK A;  4OWW B;  2ZM6 L;  1XNQ Q;  2L15 A;  3UDI A;  1B70 B;  1MKH A;  1OXV A;  1XMO Q;  1Q86 C;  4R4C A;  4APV A;  3A0J A;  1BBU A;  3BU2 A;  1L1O B;  5FJ8 H;  4AIM A;  2OQK A;  4IO9 A;  1SMX A;  2IT1 A;  4UP8 A;  3TS0 A;  5C4X H;  4A3K G;  2VS1 A;  3S24 A;  2ZJQ A;  4B3R Q;  2MO0 A;  4JV5 L;  1XPR A;  3L0O A;  4JI2 L;  1K0R A;  2CWP A;  2B63 H;  3JAM i;  4JI4 Q;  1JB7 A;  2VZA A;  5LMN W;  1LYL A;  1I6H H;  1TWC H;  2VL6 A;  4DR3 L;  1I3Q H;  1JT8 A;  4WJ4 A;  3KLW A;  1X3E A;  5IP9 G;  4NXN Q;  2ALY B;  4PZ6 A;  4DK6 C;  4NXM Q;  4TVA B;  5HGQ A;  4KI0 A;  4GKJ L;  2E2I H;  4UY8 C;  1G29 1;  1OXS C;  3HOV H;  3RNU A;  3FKI H;  2IHF A;  1GO3 E;  3NEL A;  5FJ8 G;  1Q8K A;  4DV0 Q;  1KHI A;  3G6E A;  3MEF A;  4A3E H;  1KIX A;  2I5M X;  2JK8 A;  1B8A A;  5C4X G;  1H95 A;  4OON A;  4P73 A;  4DR6 L;  2B63 G;  1D7Q A;  1NE3 A;  1KRS A;  1UEB A;  2KHI A;  2Z6K C;  1KL9 A;  2R7D A;  1I94 L;  3CD6 A;  4DR1 Q;  2BH8 A;  1K8G A;  2F52 A;  3HOZ H;  5BR8 Q;  4JI6 Q;  4L5S A;  4LUZ A;  3AYH B;  1VQG A;  4UP7 A;  4YCW A;  4HJA A;  1HR0 Q;  2MFI A;  1N32 Q;  4X65 L;  4R4Q A;  1IBM L;  1IL2 A;  4X64 Q;  3CW2 C;  1B7Y B;  3F2B A;  2NZO A;  4NPS A;  3HOV G;  3FKI G;  5C0X G;  1EIF A;  5J3B A;  2E2J H;  4YY3 L;  4BBR H;  4A3E G;  1N9W A;  4X62 Q;  1PH7 A;  3GTM H;  2R92 H;  5IYC H;  3KDF A;  2ZJP A;  1CKN A;  4DKA C;  3ICE A;  1E7Z A;  4YWK A;  1HR0 W;  3GTP H;  1WFQ A;  3PUW A;  5IYD G;  4C3J H;  1VQ9 A;  2Y0S G;  3UDF A;  4IJL A;  5M5Y H;  2K5N A;  4X66 L;  5JJL A;  3M4Q A;  3NEM A;  1TWG H;  1V43 A;  4C3H H;  3HOZ G;  1RL2 A;  4YHH Q;  1JMC A;  2UXC L;  3DM3 A;  1L0W A;  1NY4 A;  2Y0S E;  3S15 H;  1VQB A;  3KF8 B;  5K36 G;  4B3M L;  4GNX A;  1FL0 A;  2LXJ A;  4LUV A;  1PH9 A;  1SN8 A;  1EQQ A;  1EWI A;  2OTJ A;  4AQY L;  3CME A;  4BBR G;  5AJ3 L;  5M3F H;  3K8A A;  1PH4 A;  2GVB A;  4XIG S;  1IZ6 A;  4HJ9 A;  1KD1 C;  2LXK A;  1MJE A;  1E1O A;  5IYC G;  4LF5 Q;  2K50 A;  2R92 G;  4DR4 Q;  2DUD A;  4GN5 A;  4L5R C;  5C0X I;  1HZA A;  4DUY L;  1N32 L;  2UXD Q;  2Q2H A;  2I0Q A;  2CCZ A;  1A0I A;  5M3M H;  2K5V A;  4FDB A;  4JOI A;  5GAE C;  3ER0 A;  1YBY A;  3RLN A;  1S3O A;  4WJ3 M;  2AWO A;  2V1C C;  4BY1 H;  1EFW A;  2NVT H;  1X55 A;  3OYY A;  4JCV E;  1FJG Q;  4A3G H;  4QIW E;  1Q81 C;  3UDX A;  1BKB A;  4LF7 Q;  4JI5 Q;  1X9N A;  4P74 A;  1C7Y A;  4DV6 L;  4GN3 B;  3CCE A;  1K83 H;  1KRT A;  4POG A;  1YI2 A;  4JBJ A;  5LMU Q;  1XNR L;  4A3D H;  3CCQ A;  1SRU A;  2KHJ A;  5M3F G;  1HZB A;  1YJ9 A;  2CWA A;  2WB1 G;  4R4O A;  1C0A A;  3E9I A;  1X3F A;  2N8N A;  5FLM H;  3KFU A;  4GN4 B;  4LFC L;  3A74 A;  3GTO H;  1VQJ A;  3A5Z B;  4BXX H;  2IX1 A;  2WB1 E;  3RZD H;  1K9M C;  3S1N H;  1L1O A;  1D8L A;  1QVF A;  5M3M G;  4MZ9 A;  1Y1V H;  1PV4 A;  3K80 C;  3B6Y A;  2D0O A;  1VQC A;  4KHZ A;  2HT1 A;  2UUB Q;  5C3E H;  1Q1B A;  2AHO B;  1MJC A;  1XNQ L;  4A3G G;  3G48 A;  4JI7 Q;  1XMO L;  3GTQ H;  3HOW G;  4IOA A;  3HFZ B;  1EUJ A;  1OXT A;  1VQ4 A;  2MNA A;  4A3D G;  3CCJ A;  4B3R L;  3I7F A;  1SR3 A;  1XPU A;  2EXD A;  5FLM G;  4LF9 Q;  3NEN A;  2JA7 H;  3J81 i;  1M90 C;  4JI4 L;  1R9T H;  1GM5 A;  4BXX G;  3RZO H;  2NN6 G;  2JJQ A;  3PGZ A;  4GOP B;  4IJH A;  3RN2 A;  3PO2 H;  5JJI A;  4A93 H;  5GAH C;  4LF6 Q;  2H5X A;  1MIU A;  1Y1V G;  4J15 A;  4NXN L;  2CFM A;  1GVP A;  1PH1 A;  3CXC A;  2JEB I;  1IBL L;  4LF4 Q;  1L1O C;  1YJW A;  4IPD A;  2PI2 E;  4JI8 Q;  4NXM L;  5C3E G;  3OTO Q;  1WCM H;  4R4T A;  2QA4 A;  4OWX B;  2Z6K A;  5C4J H;  4PZ7 A;  1A63 A;  4DV5 Q;  3TQY A;  1AE3 A;  3STB C;  2HQL A;  4DV0 L;  3TS2 A;  3TRZ A;  4JYA Q;  1K73 C;  1X65 A;  4MNO A;  1VQD A;  3EBE A;  2JA7 G;  2JA9 A;  2D62 A;  4IOC A;  2ES2 A;  2UXB Q;  2VNU D;  4JI1 Q;  3PO2 G;  5IT9 c;  1PFS A;  4A93 G;  4JBW A;  4DR1 L;  4BA2 I;  2E2H H;  1NBW A;  3F1Z A;  4JI6 L;  3CMA A;  4IPH A;  1SLJ A;  1EOV A;  3HOU H;  1ASZ A;  1HR0 L;  1WCM G;  2KCT A;  1YHA A;  2PQA B;  4PZ8 A;  2JA5 G;  2UUC Q;  4X64 L;  3M4P A;  4JC0 A;  2A8V A;  2DGY A;  1X6O A;  3GO5 A;  5IYD H;  4NB3 A;  1OXU A;  2ZTE A;  1V1Q A;  4X62 L;  3FP9 A;  2MQH A;  3K0X A;  1P16 A;  2RHQ B;  3HOX H;  3NBH B;  3KJP A;  1RIP A;  4A76 A;  2AMC B;  1OTC A;  1CSP A;  5H1S E;  3I56 A;  4A75 A;  4DV7 Q;  3M4O H;  3U58 A;  1KQS A;  1VQA A;  2HHH Q;  1Y1W G;  3S16 H;  4YHH L;  3HOU G;  1J6Q A;  4YCV A;  3I4N H;  4A3L G;  3T1H Q;  1EQR A;  5JEA J;  3J80 c;  2ZJR A;  5ELO A;  4DUZ Q;  2ASB A;  3HKZ G;  1YIJ A;  4LWC A;  1E1T A;  2K14 A;  2EIF A;  5M5W H;  2CKZ B;  3CQZ H;  4RG1 A;  3STB D;  4HIO A;  1Q46 A;  4DK3 C;  1ASY A;  4LF8 Q;  4LFA L;  3AFP A;  3KF6 B;  1VQL A;  3HKZ E;  4A3I H;  3HOX G;  2D0P A;  3H0G H;  4MTN A;  1VQ7 A;  3A5U A;  1N36 Q;  2UXD L;  1A62 A;  4IFD J;  4UPA A;  3I4O A;  1KXL A;  4UP9 A;  4DV1 L;  2R7Z H;  5JEA G;  3PF5 A;  4A3C G;  1Z47 A;  1K3R A;  3CPF A;  1I94 Q;  4AH6 A;  3I4N G;  1FJG L;  1FGU A;  5GRO A;  4LF7 L;  4JI5 L;  2AKW B;  5E7N A;  5HY6 A;  3BZK A;  3ULP A;  1W2B A;  1YHB A;  4ME3 A;  1IBK Q;  4JBK A;  4HJ7 A;  2Q2I A;  3PUX A;  2JA8 G;  4OO1 G;  1VQF A;  5LMU L;  5IYB H;  1JJC B;  4HJ8 A;  3W5O A;  2XGT A;  4O2D A;  3E9H A;  1Z9F A;  1UE7 A;  4TQU S;  4A3I G;  3RLO A;  1WOC A;  1HNZ L;  4C2M H;  2VQF Q;  3H0G G;  3HKS A;  1UE1 A;  3D0F A;  1XMQ Q;  1I50 H;  4B3T Q;  2LSS A;  2UU9 Q;  2NVQ H;  1VQP A;  3ZJY C;  4DR7 Q;  4GLV B;  3J7Z C;  2YTY A;  1QVG A;  3FHW A;  2K4K A;  4P72 A;  1X54 A;  3CCS A;  3HOW H;  1LUZ A;  3I4M H;  1QUQ B;  1BBW A;  2IX0 A;  4LFB Q;  4X6A H;  3S2D H;  1TWF H;  2MO1 A;  4P75 A;  1PH6 A;  3GTL H;  4JI7 L;  1U5K A;  3TRE A;  2C35 B;  4C3I H;  4DAM A;  3CCM A;  4GOP A;  4YWL A;  2R7Z G;  3S1Q H;  4QQB X;  5M5X H;  5IYB G;  1KAW A;  2BA1 A;  1LM0 A;  1Y14 B;  4LNQ A;  2QEX A;  3JAM c;  4JBM A;  4LF9 L;  3RN5 A;  4DV2 Q;  1U0L A;  3M7N A;  2Q2U A;  4OO1 I;  4QY7 A;  4OX9 Q;  2R7F A;  1V9P A;  1T9H A;  2NZH A;  4YCU A;  2JE6 I;  1N34 Q;  2RCN A;  4LF6 L;  2IY5 B;  3BZC A;  3I4M G;  4PG3 A;  4JI8 L;  3KJO A;  3OTO L;  4Y52 H;  1BVS A;  1C9O A;  4XTC S;  4QJF A;  1PH3 A;  2E5L Q;  3GTK H;  4JI0 Q;  2BA0 A;  3CC2 A;  1CUK A;  4OWT B;  1NTG A;  2K5H A;  4DV5 L;  3MXN B;  1DGS A;  1VQH A;  4GOP C;  2UUA Q;  2JEA I;  4JYA L;  1W3S A;  1J5E Q;  4DAY B;  2K52 A;  1N33 Q;  4B3S Q;  4DR2 Q;  3RR5 A;  4DV3 Q;  2KCM A;  2PQA A;  1EIY B;  1WJJ A;  4A3M G;  2UXB L;  1O7I A;  4JI1 L;  1UE5 A;  1QZG A;  2R93 H;  3F8T A;  2F4V Q;  2JA5 H;  4JI3 Q;  1YEZ A;  1PYB A;  4K0K Q;  2OWO A;  4GKK Q;  4DV4 Q;  3K81 C;  1AE2 A;  5EAY A;  4PMW A;  4DNI A;  1SFO H;  1Q12 A;  1N8R C;  2VQE Q;  2UUC L;  4YWM A;  1PVO A;  5DLQ E;  4P71 A;  1VQ6 A;  5LMN Q;  5C44 G;  1FVI A;  2OTL A;  2KBN A;  3AEV A;  3T1Y Q;  4A3B H;  1VQE A;  3I55 A;  2BH2 A;  5IWA Q;  4DR5 Q;  4A3J G;  4KHP Q;  1YJN A;  3HOY G;  1Y1W H;  1HNX Q;  2CQO A;  5BR8 L;  3CP0 A;  1JJ2 A;  3ERS X;  1EYG A;  2NN6 I;  1PYS B;  3PCO B;  2YTX A;  2WAQ G;  3PIO A;  4DV7 L;  4A3F G;  5IP7 H;  4A3L H;  1GD7 A;  2K75 A;  2R93 G;  5ELN A;  3M3Y H;  3PV0 A;  1UE6 A;  2YTV A;  1E22 A;  1TXY A;  3KF6 A;  5GAG C;  2HHH L;  1HNW Q;  2A1A A;  4H02 A;  2ZM6 Q;  4QGU A;  2WAQ E;  2WFW A;  3T1H L;  2JA6 H;  4DUZ L;  1NMF A;  2IHE A;  1IBL Q;  3PO3 H;  4L5T A;  1K8A C;  1IXR A;  1YVC A;  2PI2 A;  1P8L A;  2HIX A;  2NVY H;  4L5Q A;  1VQ5 A;  4LF8 L;  4A3B G;  4JV5 Q;  4OXP A;  2Z0S A;  3K7A H;  2RF4 A;  4JI2 Q;  1E24 A;  3L7Z C;  2ZTC A;  3CCL A;  4A3C H;  4DR3 Q;  1UWV A;  1G51 A;  2ZTD A;  2NVX H;  2B3G A;  3RLF A;  1N36 L;  5C0X J;  2ID0 A;  4A4I A;  5IY0 A;  5IP7 G;  2QGQ A;  3SGI A;  1HH2 P;  3AFQ A;  1PHJ A;  2JA8 H;  3CC7 A;  3W1B A;  3CAM A;  3W1G A;  2F3I A;  1CKM A;  1A8V A;  3IRB A;  1WI5 A;  1XTD A;  3PUZ A;  4IPC A;  3U4V A;  1XPO A;  1QZH A;  4GKJ Q;  1VQ8 A;  3EIV A;  2JA6 G;  2OQ0 A;  3PIP A;  1OXX K;  3DLL A;  3PUV A;  1IBK L;  3PO3 G;  1JE5 A;  1M1K C;  4LF5 L;  4DR4 L;  3BJU A;  1TWH H;  3H3V H;  1AH9 A;  3U4Z A;  1I5F A;  1QUQ A;  3K7U C;  4GLX A;  3M85 A;  4DR6 Q;  3S17 H;  1S40 A;  1YZ6 A;  2VQF L;  2VUM H;  1XMQ L;  4B3T L;  1GKH A;  3EN2 A;  2UU9 L;  2JQO A;  4LW1 A;  1X3G A;  5GAD C;  3PF4 A;  4BY7 H;  4DR7 L;  2PNH A;  4LUO A;  3S14 H;  1HZ9 A;  3JC6 6;  5IE8 A;  3WWV A;  4BBS H;  4LFB L;  1G6P A;  3ULL A;  3CCR A;  4HIM A;  3I2Z A;  4X65 Q;  4JG2 A;  1IBM Q;  1Q1E A;  4HJ5 A;  3KYH C;  2N3S A;  2YYZ A;  3KOJ A;  2I5L X;  4HID A;  1PH5 A;  3UE0 A;  3E0E A;  3PUY A;  4IFD G;  1YNX A;  1TWA H;  4YY3 Q;  5JJK A;  1SRO A;  3LGJ A;  3CF5 A;  3OW2 A;  3J81 c;  4GS3 A;  3U50 C;  1XJV A;  2R6G A;  2YU9 H;  2VW9 A;  3D31 A;  4DV2 L;  2VUM G;  2UUB L;  4AYB G;  2GVA A;  4LFA Q;  1X56 A;  3L2P A;  1VQM A;  2WP8 J;  4OX9 L;  4BY7 G;  1N34 L;  2FXQ A;  4X66 Q;  1KC8 C;  1PA6 A;  3CCV A;  3GD7 A;  3CPW A;  1VQN A;  3F2D A;  4AYB E;  2UXC Q;  2N78 A;  1Q82 C;  1PH8 A;  4BBS G;  1YHQ A;  5FLX c;  3KDF B;  1CKN B;  2E5L L;  4JI0 L;  1VCI A;  4HIK A;  4ALP A;  3J80 i;  2KEN A;  1WYD A;  4R1J A;  4DV1 Q;  4RMF A;  1PH2 A;  1NJI C;  4B3M Q;  3J81 j;  4AQY Q;  4POF A;  3GTG H;  4A3M H;  3TEH B;  5AJ3 Q;  1VQO A;  2UUA L;  3M9B A;  4QL5 A;  3G4S A;  1J5E L;  2ATW A;  3CC4 A;  3S1R H;  3PSI A;  4DR2 L;  3GTJ H;  4DV3 L;  4B3S L;  1N33 L;  4LF4 L;  1E3P A;  3GDE A;  4GLA C;  4IFD I;  1JJG A;  4R4I A;  1NMG A;  4DUY Q;  4GNX B;  4GNX C;  3H3V I;  3J7A 5;  3UDG A;  2I5H A;  2F4V L;  2GN5 A;  4JI3 L;  4DPG A;  1HNZ Q;  4K0K L;  3ULJ A;  4GKK L;  4DV4 L;  3F2C A;  5C44 H;  2A19 A;  2Q2T A; 
#chains in the Genus database with same CATH topology
 3G71 A;  2YZN A;  3MWY W;  4ZQI A;  1Y8O B;  1CKO A;  3LP8 A;  1QVC A;  2A69 C;  3WO0 A;  1KJQ A;  5KFG A;  2HIV A;  3DWQ A;  1KDA A;  1QOH A;  4ZHQ F;  2XTI A;  1QJO A;  2RGR A;  3BQ2 A;  1U4M A;  4A3F H;  2B2Y A;  1CQJ B;  4Q0Y A;  2EQS A;  2L4N A;  5DQH A;  4MAM A;  4HNV A;  3K7A B;  1S72 A;  1IYJ B;  1Q7Y C;  3PR5 B;  1CI3 M;  1A9X A;  3Q8D A;  3PW0 A;  1SE8 A;  4HCS A;  2YV5 A;  2R7M A;  3L4J A;  2NBF A;  5ELB A;  3A7L A;  3DXJ C;  1B70 B;  1PX2 A;  1Q86 C;  4R4C A;  2F0G A;  1DV2 A;  1B04 A;  1W6J A;  4APV A;  1KDB A;  3BU2 A;  2OQK A;  3BZD B;  3BYY B;  5C4X H;  4RFB A;  4KY7 A;  2MO0 A;  3T4A C;  4JK1 C;  5FO9 B;  1XPR A;  1EZ1 A;  3H3V C;  1K0R A;  1O78 A;  4I7Z C;  2VZA A;  1LYL A;  4CDF C;  2VL6 A;  1EL0 A;  1AP0 A;  1JT8 A;  4WJ4 A;  3IG0 A;  3KLW A;  5KG3 A;  4JI6 H;  4FF1 A;  5IP9 G;  2CH4 A;  3J7A F;  2B2U A;  2SNS A;  4GZY C;  3Q8P B;  4TVA B;  4TQR A;  3TP7 A;  5HGQ A;  1TS3 A;  4XT3 B;  2A68 D;  3ETJ A;  3J7Y W;  4FS2 A;  1FR3 A;  1GO3 E;  2JP1 A;  1Z2N X;  4C5C A;  5FJ8 G;  1TA8 A;  1Q8K A;  2F0E A;  4IAL A;  4DV0 Q;  3MEF A;  2L55 A;  1PMR A;  1H95 A;  4OON A;  3DHQ A;  4DR6 L;  2QYZ A;  2B63 G;  3V4S A;  2ALZ A;  4RCO A;  1NE3 A;  1KRS A;  1UEB A;  2KHI A;  2Z6K C;  3OSP A;  2R7D A;  3N43 B;  2XCP A;  4DR1 Q;  4K5V A;  1EYZ A;  3K5I A;  1K8G A;  2F52 A;  3HOZ H;  1NCV A;  1S5D D;  4TRD A;  2BQR A;  4UP7 A;  1VQG A;  2PQE A;  4CC6 A;  3C1F A;  4X64 Q;  4YBZ B;  4O4L F;  2V58 A;  5KFD A;  1EIF A;  1GYF A;  4YY3 L;  2R93 A;  2MCT A;  2NVT B;  4H7B A;  2UXD H;  4O2B F;  2R92 H;  5IYC H;  5KX5 F;  3KDF A;  4IUV A;  3ICE A;  3PIP 3;  4DAV A;  1E7Z A;  1Q3L A;  1SFO A;  1HR0 W;  4IUR A;  2W57 A;  3Q8R B;  1UEA B;  2Y0S G;  2PMZ B;  4IJL A;  1UC9 A;  2SEB D;  3J81 L;  2X6L A;  3RAQ A;  2DPI A;  2EDG A;  1RL2 A;  3MAQ A;  5JPM C;  1ESF A;  2WDT A;  1L0W A;  3HZX A;  1X3Q A;  3M9M B;  2CW0 D;  4EVO A;  2DPJ A;  1EY8 A;  1LT4 D;  5JVG 3;  5GON F;  3FPU B;  3KF8 B;  2LXJ A;  4XYO A;  1PH9 A;  1EQQ A;  2ZDQ A;  2SDF A;  4NLG A;  3K8A A;  2GVB A;  4GC7 A;  3SXH A;  1IZ6 A;  1MJE A;  3RUP A;  2K50 A;  4DR4 Q;  3S1M B;  3T5L A;  1HZA A;  2FKL A;  3RIZ A;  3MA2 B;  4EQN A;  2W9B B;  1G2T A;  3DMU A;  2NVT H;  1EFW A;  2JA7 B;  1X55 A;  3OYY A;  3RFC A;  2E2I A;  4QIW E;  4Y7N B;  2EY6 A;  4ECT A;  1BDO A;  1ILP A;  4DV6 L;  1L0Y B;  3CCE A;  4LF9 H;  2NVX A;  4WRD A;  3CCQ A;  2PYK A;  4R4O A;  4RA8 A;  4B08 A;  2YZM A;  5C4J B;  2PVP A;  1DZ1 A;  2F0N A;  4G3I A;  2PZW A;  4LK1 C;  4WBN F;  1L1O A;  3V6J A;  5EWG A;  2AQ1 B;  3CHB D;  1PV4 A;  1LV9 A;  1VQC A;  2D0O A;  2OXP A;  3NTK A;  4F4X A;  2UUB Q;  1KTK A;  3JRW A;  1Q1B A;  3MWD A;  1MJC A;  4NW2 A;  1XNQ L;  4QWE A;  2X6G A;  4ECQ A;  4DL3 A;  1XMO L;  4JYA H;  2UVU A;  3RUZ A;  3SK6 A;  1TR5 A;  4IRC A;  1CA6 A;  1KLG D;  5FO7 B;  2FIN B;  1STA A;  4A3D G;  3RTX A;  4ED6 A;  3FKI B;  4YAK B;  5IGE A;  1SR3 A;  5KNB A;  4Q45 A;  2PCF B;  2VB2 X;  4XZ3 B;  2DJG C;  2JA7 H;  2VOB A;  4BXX G;  4UCT A;  2NN6 G;  4CKB A;  4GOP B;  2K33 A;  3PO2 H;  3MWE A;  5KFO A;  4LF6 Q;  3R23 A;  1MIU A;  1Y1V G;  5DNF A;  1PH1 A;  1TWG A;  4HNT A;  4RHR A;  4IPD A;  4JI8 Q;  3HOX B;  3NBI A;  3ND9 A;  3RD4 A;  1GSH A;  5A35 A;  2QA4 A;  3BDL A;  4OWX B;  4RGN A;  4WFN 3;  5C4J H;  1A3V A;  1Y69 U;  5FKA C;  2WV6 D;  2XRQ D;  4DV5 Q;  1AE3 A;  2RVL A;  3R2T A;  3WOE A;  3BAB A;  4I7H A;  3PZP A;  3S16 B;  4F4Y A;  2P0A A;  2W9A A;  2HUG A;  4HED A;  1RJR A;  1GHJ A;  1X3P A;  1SYF A;  1EFI D;  5HUR A;  3GTM B;  2X0S A;  2F0W A;  2VNU D;  3CQZ B;  4A93 G;  2B2V C;  4KJO A;  2ZXO A;  4DUZ H;  4JI6 L;  1EOV A;  2EJM A;  4DXG A;  1ET9 A;  3I91 A;  2L12 A;  4IN3 A;  2JA5 G;  5FO8 B;  3M4P A;  4Y8V B;  3T56 B;  2V4D A;  2NWG A;  2B8F A;  4FXG C;  2FPP B;  4X62 L;  2RHQ B;  2WB1 B;  5BN3 A;  3HOX H;  1RIP A;  4A76 A;  1MHW C;  1ENA A;  2Z8L A;  4C1N I;  4QCL A;  3GIQ A;  4M7E A;  1EWC A;  5KKN B;  3VYR A;  5IGD A;  3S16 H;  5EOY A;  4JVZ A;  4CHT B;  2R3Z A;  4DR4 H;  4A3L G;  3GTQ A;  1I50 B;  3HKZ G;  1YIJ A;  4O3Q A;  5M5W H;  3CQZ H;  4RG1 A;  3HOW B;  1G2S A;  3STB D;  1SEB D;  4HIO A;  5KG6 A;  4DK3 C;  5HGT A;  1XMQ H;  4B3T H;  4UFZ A;  1N48 A;  5C6A A;  1S5B D;  4MTN A;  1VQ7 A;  4MV6 A;  3PVX A;  3MEH A;  1N36 Q;  1UNN C;  2UXD L;  3I4O A;  1PRT C;  4UP9 A;  5CV5 A;  3RZD B;  4CDE C;  3S1N B;  1C30 A;  4F88 A;  2C22 A;  1S97 A;  5JEA G;  4X3S A;  1WCM A;  1AUX A;  1J5E H;  3I4N G;  1E2V A;  1FGU A;  5KFF A;  5GRO A;  5J22 A;  3ULP A;  1W2B A;  4JBK A;  3BZK A;  1GJX A;  1YHB A;  1G8Z D;  4ME3 A;  1TWC A;  1I3Q A;  3ORR A;  5LXT F;  3MXG A;  2UUB H;  2FK1 A;  4OX9 H;  1ZEQ X;  1WOC A;  1N34 H;  1U4R A;  5EJW A;  1I4Q A;  3H0G G;  5DG9 A;  1I50 H;  4DNT B;  4J9N A;  1VQP A;  4DR7 Q;  3RZO B;  1V1O A;  1M6V A;  1QVG A;  3HOW H;  2FP4 B;  5LA6 F;  4IZO A;  1EU4 A;  2B2W A;  1QUQ B;  5BPF A;  4LFB Q;  5KYL A;  2M9V A;  2YS7 A;  1PYW D;  4RGT A;  2EY1 A;  4DGZ A;  3U9O A;  2J9G A;  3CCM A;  4YWL A;  4B3S H;  5KT3 A;  1D2B A;  1D1I A;  1TT2 A;  3K5M A;  1KAW A;  2QEX A;  1WD1 A;  1Y8N B;  4LF9 L;  1JR0 D;  4DV2 Q;  5JPN C;  4K14 A;  4QY7 A;  4GKK H;  4DV4 H;  4EBD A;  3G6J B;  1T9H A;  2JE6 I;  2HJW A;  4R8U B;  1WVL A;  3BZC A;  2HDL A;  3X3N A;  4XT1 B;  4Y52 H;  1FKA H;  4XTC S;  3N6R A;  4QJF A;  3R2I A;  1QB5 D;  4ABN A;  1Y1W B;  2BA0 A;  2E5L Q;  4JI0 Q;  3HOU B;  5EWE A;  3T1Y H;  4J9K A;  3T5H A;  5IWA H;  4KHP H;  1HNX H;  2UUA Q;  4GOP C;  4JYA L;  3D6C A;  2A68 C;  2K52 A;  5JJZ A;  3RR5 A;  3VR5 A;  1PTO B;  3SK4 A;  2KCM A;  3MXP A;  4LAA A;  5IOC A;  1EIY B;  4A3M G;  2CW8 A;  5FD5 A;  1UE5 A;  5KRU A;  3F8T A;  2F4V Q;  1WTX A;  4JI3 Q;  3GP7 A;  1YEZ A;  1PYB A;  2E76 C;  2QKI C;  1GUW A;  2IMW P;  3RB3 A;  1PRT F;  1HQM C;  5IGB A;  4DNI A;  2W6P A;  2N88 A;  4K8J A;  5G3L D;  5H80 A;  5IT9 L;  2CH4 W;  4FF2 A;  1EUD B;  2A6E D;  2R7Z A;  4JV5 H;  4FVM A;  1PVO A;  1SE2 A;  1VQ6 A;  2KBN A;  3TN2 A;  2KHS A;  4LMY A;  1VQE A;  3LX0 A;  1B6R A;  4HSV A;  2BH2 A;  4A3J G;  2RQX A;  3V6H A;  4JV0 A;  1STY A;  1MD2 D;  1Y1W H;  4H0L C;  3SK8 A;  1K3B C;  3ERS X;  3J7A K;  3PCO B;  3K5N A;  2R93 G;  4GKJ H;  1S4Z A;  5IP7 H;  3ORQ A;  5ELN A;  3K6O A;  2YTV A;  1E22 A;  2NUC A;  3KF6 A;  1E4E B;  1KJ8 A;  1LTR D;  3T1H L;  4DUZ L;  1LTA D;  3HRZ C;  3QB3 A;  3H4B A;  5CV9 A;  2G5D A;  1DYQ A;  1P8L A;  4C56 C;  2HIX A;  2CW0 C;  3V96 A;  3S14 B;  4C5B A;  2ASJ A;  5CV6 A;  1UUP A;  1FNW A;  2RF4 A;  1E24 A;  3FVQ A;  3L3O C;  1TS4 A;  1VAJ A;  4A3C H;  1DOM A;  1WTP A;  2ZTD A;  3E6Z X;  2B3G A;  3E3X A;  1V8Q A;  1B9M A;  2ID0 A;  4A4I A;  3SGI A;  4X65 H;  4O1N A;  1HH2 P;  1IBM H;  3CC7 A;  3TII A;  3U4V A;  4DNR B;  3S2D B;  5CA1 F;  3EIV A;  2JA6 G;  2OQ0 A;  3T51 B;  2F0L A;  4DR7 H;  1TWF B;  1R9T A;  4DR4 L;  5L1L A;  1TWH H;  4ECW A;  1KLU D;  1AH9 A;  3U4Z A;  1I5F A;  2FMC A;  3K7U C;  1S10 A;  4DR6 Q;  1HA5 A;  3MFH A;  4ZYS A;  5CAE B;  2VUM H;  2XCL A;  1XMQ L;  4B3T L;  2JEG A;  3EN2 A;  3CU7 A;  3J7A V;  2EYM A;  2FPI B;  2WKC A;  2PNH A;  3S14 H;  5KFR A;  1EY5 A;  2ZJT A;  5KFL A;  2EYF A;  3URY A;  5C4H A;  1A3U A;  2JEI A;  2PZU A;  4CJ2 C;  4OL7 A;  3RV3 A;  2BDO A;  2N3S A;  3KOJ A;  2OH2 A;  3PUY A;  1B33 N;  1YNX A;  4YY3 Q;  5JJK A;  3K3P A;  2XNA C;  1RCV D;  5C44 B;  3CF5 A;  3OW2 A;  1SNO A;  1XJV A;  1TVX A;  2W9C B;  3G8C A;  1VBG A;  4K6L A;  2UUB L;  1UNS A;  1I4H A;  4LFA Q;  1X56 A;  3L2P A;  1VQM A;  4OX9 L;  3HOY B;  3MR2 A;  3MR6 A;  1N34 L;  2D5D A;  1NAP A;  3MXN A;  1JCK B;  3GID A;  2DY8 A;  4AYB E;  1S0O A;  1PH8 A;  4BBS G;  3MWM A;  1K8M A;  4ALP A;  2KEN A;  4DV1 Q;  4R1J A;  4TSS A;  5ELF A;  2VPS A;  4C3H G;  2R82 A;  4POF A;  3GTG H;  4LFC H;  4HN7 A;  3TEH B;  2EZV A;  5KFQ A;  3A55 A;  1A2T A;  3M9B A;  4QL5 A;  2KCN A;  3G4S A;  4J9Q A;  3PSI A;  4B3S L;  4CDD C;  3GTJ H;  2OLS A;  2NUA B;  1IYU A;  4GLA C;  4R4I A;  1NMG A;  4R8N A;  4GNX B;  1B53 A;  1LT6 D;  4N9T A;  2I8C A;  2I5H A;  2IW3 A;  3ULJ A;  4GKK L;  4DV4 L;  3F2C A;  2JSO A;  1LLR D;  5C44 H;  3MXU A;  1EY7 A;  2ZXP A;  5EQ0 A;  1D5X C;  2EJG C;  5CR3 A;  1CSQ A;  3NTH A;  4UDU C;  4DV6 Q;  3HOY H;  4B3R H;  5LMN L;  2WE6 A;  2OCE A;  4BY1 G;  1HZC A;  2M00 A;  1BNC A;  4O3R A;  4JOI C;  3T1Y L;  5F2D A;  1SYE A;  2EOT A;  2L9H A;  2VY3 A;  5GQO A;  5IWA L;  4KHP L;  2NVY B;  3AQQ A;  3TSS A;  1C48 A;  4YB8 B;  4O0A A;  1HNX L;  1VQI A;  5L37 A;  3CRL C;  5KT7 A;  1VQK A;  5IP9 H;  2AWN A;  1F2Y A;  2FB9 A;  1FYC A;  2KED A;  2VUG A;  4EEY A;  1VS0 A;  1XNQ Q;  2JEJ A;  1O7L A;  3UDI A;  2FLN A;  4IWX A;  1MKH A;  1OXV A;  1XMO Q;  1ZQ7 A;  2ICE C;  3A0J A;  5JH7 F;  5FJ8 H;  1TWA A;  2Q8R E;  1OWT A;  3MC0 B;  5C3X A;  2IT1 A;  3TS0 A;  4EGQ A;  2XD4 A;  1LT3 D;  4A3K G;  4JV5 L;  3L0O A;  5T1I A;  4KTA A;  2B63 H;  3JAM i;  3SE0 A;  1Z7T A;  5JOB A;  1FD7 D;  5LMN W;  1JB7 A;  1I6H H;  1GSA A;  2DJF C;  3TIN A;  4ILW A;  1HR0 H;  5HV6 A;  4BY7 B;  3I12 A;  4GKJ L;  3Q24 A;  2XN9 C;  1G29 1;  3KUP A;  2V4R A;  4HQ6 A;  3G6E A;  1KAA A;  2I5M X;  1JQY D;  1D7Q A;  2R87 A;  1T36 A;  3KK7 A;  3GTK A;  2F0H A;  5FK9 C;  2IP4 A;  5BR8 Q;  4JI6 Q;  4L5S A;  1II3 A;  1O7Y A;  2HCI A;  3A8J E;  4YCW A;  5IOD A;  4X65 L;  1IBM L;  2IX3 A;  1KBL A;  1F9S A;  4LFA H;  4NDX A;  3F2B A;  3HOV G;  2VXW A;  3A8I E;  5C0X G;  1S0N A;  3KBX A;  3T16 A;  1B1Z A;  1F9P A;  4A3E G;  1RF2 D;  2WAQ A;  4X62 Q;  1TS2 A;  1U9R A;  3I73 A;  3SR1 A;  2ZJP A;  1CKN A;  4DKA C;  4DV1 H;  4MTD A;  1K83 B;  3NUC A;  5IYD G;  5KT5 A;  3UDF A;  2K5N A;  1I4G A;  3M4Q A;  4ED0 A;  1V43 A;  4JV1 A;  3DM3 A;  4IZ8 A;  4TV9 F;  1B44 D;  2Y0S E;  3OHX C;  2FLP A;  1K28 A;  5K36 G;  3CME A;  2YZG A;  1AN8 A;  2AGO A;  4OEM B;  1LTS D;  4XIG S;  4NKL A;  4HJ9 A;  2LFN A;  3BVM A;  2DUD A;  3N6X A;  1F2L A;  4L5R C;  2W7O A;  1SBB B;  2UXD Q;  2I0Q A;  4C3J G;  1LTB D;  5DG7 A;  2I46 A;  5GAE C;  1EOT A;  1YBY A;  2Z9H A;  4I7A A;  5KT2 A;  2V1C C;  5KYI A;  2QIL A;  4EFB A;  2VR1 A;  1QG7 A;  1IL8 A;  1EUC B;  5DQI A;  2R7L A;  4PDB A;  4GN3 B;  1K83 H;  1RJP A;  4JBJ A;  4A3D H;  1YJ9 A;  1C0A A;  5M3F G;  2CWA A;  1R4Q B;  2A6E C;  1X3F A;  3E9I A;  3NP8 A;  2FPG B;  5C4X B;  1RTN A;  4CKC A;  4LFC L;  3A74 A;  3GTO H;  4BXX H;  2IX1 A;  1CHQ D;  3OTO H;  1XWE A;  1D8L A;  3TP6 A;  3BG5 A;  5CBE E;  1QVF A;  4HTH A;  5M3M G;  1Y1V H;  3AMU A;  1GOZ A;  3B6Y A;  2RCF A;  3H6M A;  3KBG A;  4KMU C;  1ESR A;  1HUM A;  5KND A;  4RU9 A;  2AHO B;  1RYS A;  3G48 A;  1JDB B;  2Q8T A;  3JAM E;  1IOV A;  4RB2 C;  3HFZ B;  2E2H B;  1OXT A;  4ZUJ A;  2QDB A;  2K03 A;  1O80 A;  2XRS D;  4B3R L;  2UXB H;  1EZ6 A;  1XPU A;  4JI1 H;  2EXD A;  2Z4I A;  4LF9 Q;  1F77 A;  3VMM A;  1GUT A;  1HFN A;  3CVZ A;  3T5J A;  3RN2 A;  4K2L A;  2F1M A;  1HQR D;  4A93 H;  5M9O A;  4KD4 A;  4LF4 Q;  1PZJ D;  3CXC A;  2UUC H;  1PFM A;  3V2T A;  2A73 B;  5CB4 F;  5KFW A;  5C3E G;  3HOZ B;  2NU8 B;  3P75 A;  4R4T A;  3RAX A;  3SE7 A;  2HDM A;  1TU2 B;  4HR7 B;  1A63 A;  1WSC A;  5KFP A;  3TQY A;  4UCU A;  3RV4 A;  1EY6 A;  1BQQ T;  5BR8 H;  4JYA Q;  3TZU A;  1H9M A;  4UCR A;  1EY4 A;  2A5H A;  2YRW A;  4I4T F;  2JA9 A;  5KFC A;  5F9L A;  4IOC A;  2R92 B;  2M05 A;  3R5H A;  2HHH H;  1PFS A;  1WD0 A;  1B3A A;  4JBW A;  2RSN A;  2E2H H;  1RK5 A;  2R86 A;  4QIW B;  3F1Z A;  3PMF A;  3CMA A;  4X62 H;  5D14 A;  1SLJ A;  2O03 A;  3MR5 A;  1ASZ A;  1HR0 L;  1YHA A;  4Q8F A;  2PQA B;  4LF8 H;  4XXE A;  3EYY A;  3NWT A;  2A8V A;  1BXT A;  2PMZ A;  2R8H A;  1ULZ A;  3SVM A;  2K5Q A;  4UCS A;  4DLK A;  1OXU A;  2ZTE A;  5T14 A;  2MQH A;  2WII B;  1P16 A;  3P1H A;  5G3L F;  1SNC A;  3NBH B;  1RD9 D;  3KJP A;  1I4P A;  3KF8 A;  1DV1 A;  4I65 A;  1OTC A;  2L5T A;  5H1S E;  4F8M A;  3I56 A;  2HGS A;  2EYH A;  3M4O H;  3U58 A;  3BQ1 A;  1KQS A;  2B2T C;  2R7N A;  4YHH L;  1IBK H;  1CT1 D;  4MTK A;  4YCV A;  3I4N H;  3T1H Q;  1EQR A;  2ZJR A;  3GQC A;  1J8I A;  4DUZ Q;  2JN4 A;  4J9R A;  1RDP D;  2R8G A;  5C4Z A;  2K5D A;  3Q22 A;  2VQF H;  3C46 A;  2W9B A;  4LFA L;  1JB3 A;  3P20 A;  2UU9 H;  1HPC A;  1E2Z A;  3HKZ E;  1VQL A;  2W6M A;  5KFN A;  2JA7 A;  1ZHQ A;  3H0G H;  1JDE A;  2FE3 A;  5L1K A;  1A62 A;  5IGC A;  4UPA A;  1PRT B;  3FDT A;  3GV7 B;  2MJ8 A;  2R8I A;  4DV1 L;  1S9F A;  4RWS C;  2E74 C;  4IAJ A;  1Z47 A;  1ICW A;  1I94 Q;  1GUO A;  3LWB A;  4RGO S;  3NSW A;  1HCZ A;  3C2P A;  2JA8 G;  1HUN A;  3M9O B;  1VQF A;  4J6H A;  5KFE A;  1FGB D;  3W5O A;  4DFA A;  4RUA A;  1Z9F A;  3BJY A;  3SI8 A;  4A3I G;  3RLO A;  5KFV A;  2AU0 A;  1GUS A;  2F0F A;  3HXL A;  1J9O A;  3HKS A;  1XMQ Q;  4B3T Q;  4MIU A;  4EFE A;  1E0B A;  2HQE A;  4ED2 A;  2YW2 A;  4LSA A;  2YTY A;  3FKI A;  3FHW A;  2K4K A;  3CCS A;  1X54 A;  3PO2 B;  1DIK A;  1LUZ A;  1S0M A;  1BBW A;  2IX0 A;  5I2X A;  1CFM A;  2MO1 A;  2FHT A;  3TRE A;  4GOP A;  2C35 B;  2R84 A;  1SYB A;  2RDI A;  4DV3 H;  2HVS A;  1MBY A;  3OSO A;  4LF4 H;  5A2Q E;  2BA1 A;  2C2D A;  1M0W A;  1LM0 A;  3VR4 A;  3OUZ A;  5C1O A;  3JAM c;  4JBM A;  1ENF A;  3RN5 A;  2M2L A;  3ITP A;  1RK6 A;  2FK3 A;  3UQ8 A;  2C5C A;  3EA6 A;  5KFM A;  4OX9 Q;  2F0S A;  2R85 A;  4ECZ A;  5FLX E;  4K6D A;  1N34 Q;  2NZH A;  2IY5 B;  1JIH A;  2VQE H;  3I4M G;  4PG3 A;  3OTO L;  2CW7 A;  3WOF A;  4KY5 A;  3GTM A;  1WTO A;  3IL8 A;  4C3I G;  1NTG A;  3CQZ A;  2KUM A;  4Q43 A;  4DR5 H;  1CS0 A;  2BCO A;  1X32 A;  1I6U A;  3A8K E;  4O4I F;  3JAM W;  1D5M C;  4DAY B;  4B3S Q;  1GSO A;  1EWH A;  2W8L A;  4TQS A;  4FXK C;  1H9J A;  1HNW H;  2UXB L;  5J1Z A;  4JI1 L;  3GIP A;  2R93 H;  2ZM6 H;  5ELE A;  3LML A;  4IWY A;  5F9N A;  2ICI A;  1B6S A;  4GKK Q;  5IGG A;  4CGY B;  4DV4 Q;  3K81 C;  2C2R A;  5ELC A;  5EAY A;  4PMW A;  4RNM A;  1SFO H;  2WB1 A;  3MJF A;  1Q12 A;  1I6V C;  2UUC L;  3EVQ A;  1B2T A;  2ASD A;  5DLQ E;  2D9U A;  4P71 A;  5LMN Q;  2HVQ A;  4ZQ3 A;  4DL4 A;  2JYO A;  5M5W B;  3T1Y Q;  5IWA Q;  1AZP A;  4KHP Q;  3T1H H;  2ZDG A;  5I9O A;  1I50 A;  1HNX Q;  2GLT A;  5BR8 L;  4ECX A;  3D4R A;  5IGF A;  3GQB A;  1IKM A;  4XDX A;  2WAQ G;  4A3F G;  1LTI D;  2K75 A;  2MGS A;  3PV0 A;  4MHE A;  2HHH L;  5L1J A;  1SSO A;  3S17 B;  3MFG A;  2B2Y C;  4QGU A;  1EIG A;  1PFN A;  1NUC A;  3RGZ A;  4FBT A;  2JA6 H;  2RDH A;  1IBL Q;  2F4I A;  2PI2 A;  2PN1 A;  5KFI A;  1QCB D;  4LF8 L;  4A3B G;  4JV5 Q;  4EQP A;  1I94 H;  3IN5 A;  3TIG A;  3L7Z C;  3VR2 A;  5DQG A;  2NVX H;  4ME6 A;  5CV4 A;  4B9W A;  4ZAI A;  5C0X J;  2RDG A;  4RH6 A;  3C1E A;  1CHP D;  3KAJ A;  3EFX D;  2AUK A;  4GKJ Q;  1WI5 A;  1QZH A;  2R7K A;  4IPC A;  2W7P A;  5EKI A;  3DEO A;  3JSN A;  3PIP A;  1IBK L;  3GV6 A;  1JE5 A;  1M1K C;  2QEJ C;  2QF7 A;  3EPI A;  2XGP A;  3GV5 B;  3KHH A;  1QUQ A;  1FNV A;  1SDF A;  3M85 A;  4K5X A;  3S17 H;  4NP5 A;  4QUF A;  1ILQ A;  1CA5 A;  3BA8 A;  1IW7 D;  2VQF L;  5TSS A;  2UU9 L;  3KHL A;  1PZK D;  1AZQ A;  1VMC A;  2DNC A;  2IA6 A;  4ETS A;  4B3M H;  3M9N B;  3U9S A;  4BBS H;  3CCR A;  4HIM A;  3NE5 B;  3H4D A;  4X65 Q;  1RTO A;  3OOC A;  4JG2 A;  1IBM Q;  4AQY H;  5DGA A;  1Q1E A;  4HJ5 A;  5JVD F;  3NGD A;  4KN7 C;  1S68 A;  4J9S A;  1JE4 A;  1U4L A;  1SAP A;  4TUY F;  4R8U A;  3PQI A;  2AGQ A;  3MFI A;  3U50 C;  1Y1W A;  2YU9 H;  5EGT A;  4DK1 A;  3I70 A;  2GVA A;  5LYJ F;  3M4Y A;  4FF3 A;  4X3U A;  3FPP A;  1IOW A;  2FXQ A;  3N52 A;  3QWN A;  3GD7 A;  1VQN A;  2BQ3 A;  5IYZ F;  4QWD A;  4WOR A;  4ZUI A;  1YHQ A;  5FLX c;  1BJT A;  4F4Z A;  1XNR H;  5CV8 A;  2K1B A;  5C3W A;  3J80 i;  1WYD A;  4RMF A;  1K1S A;  4FNF A;  4QMG A;  3J81 j;  5EPJ A;  1VQO A;  1K1Q A;  3LWE A;  2ATW A;  2G9H D;  5AFW A;  4DV3 L;  2F03 A;  3LWU A;  4LF4 L;  4BWS C;  5DG8 A;  1Q90 A;  1NNX A;  2SCU B;  5A2Q W;  4J9O A;  5LMN H;  4RKB A;  4DPG A;  4H44 C;  5KFK A;  3VR6 A;  1C8C A;  5L9X A;  2A19 A;  2Q2T A;  5FLX W;  2RDJ A;  2ENB A;  2VQE L;  3FMA A;  2B29 A;  4EQ5 A;  5E4W C;  1TWH A;  3H15 A;  4JI4 H;  4A3K H;  1E4E A;  1LTL A;  5NUC A;  4EX5 A;  4DR5 L;  4RZR A;  4QB4 A;  3M4I A;  4NXN H;  4LFC Q;  2N49 A;  1IBL H;  1FNU A;  4NXM H;  1L2F A;  1CQV A;  1TS5 A;  2RA4 A;  1WTH A;  2PW5 A;  5ELD A;  4BA1 I;  2F3V A;  1YIT A;  3UE1 A;  3S2H H;  1HNW L;  4OWW B;  1HJP A;  2V4Q A;  4KLK A;  2ZM6 L;  2C00 A;  2L15 A;  5DEH A;  2HD3 A;  3U9T A;  1QWY A;  4L8J A;  5EZY F;  1BBU A;  3G6Y A;  4IO9 A;  4DK0 A;  1SMX A;  3BQ0 A;  4B3R Q;  1JC7 A;  1ZET A;  1B3Q A;  1TWH B;  2QCP X;  4ME5 A;  3X3M A;  2CWP A;  4YR3 A;  2B8G A;  4OHJ A;  1TWC H;  1D1K A;  1I3Q H;  1TWF A;  1KC7 A;  1X3E A;  1IYV A;  2VUM B;  5KFU A;  2E2J B;  1TY0 A;  4AYB B;  2I07 B;  1JXL A;  4DK6 C;  1JKJ B;  2RBM A;  1Z2P X;  1W93 A;  4J9P A;  4Q8E A;  4UY8 C;  2DZD A;  4ULL A;  3GTP B;  3HOV H;  2K32 A;  1EEI D;  3RNU A;  2IHF A;  5D3I B;  5C0X H;  4ID6 A;  2IBK A;  1KHI A;  3EQL C;  1ZKO A;  4A3E H;  1O7Z A;  2JK8 A;  4P73 A;  1SMY D;  2Q8I B;  5I2Y A;  1ICF B;  3GV8 B;  1I94 L;  2BR0 A;  5E1F A;  3CD6 A;  1E4G T;  1QIL A;  4FO2 A;  4CBV A;  1JLL B;  4FU0 A;  4LUZ A;  3AYH B;  1HR0 Q;  1N32 Q;  2DIK A;  2MFI A;  4R4Q A;  2W9C A;  2F0P A;  3GIJ A;  1IL2 A;  5K36 H;  5KFT A;  3A7A B;  1H9K A;  2NZO A;  3FKI G;  2E2J H;  3F8N A;  5C1P A;  1N9W A;  4P2C B;  2N55 A;  2FJ2 A;  1PH7 A;  3GTG B;  2NU7 B;  4IUN A;  2WYO A;  3QOL A;  4YWK A;  1GXD C;  5KFB A;  3CKI B;  5FPO A;  3GTP H;  1WFQ A;  3GTJ B;  1BNZ A;  4U67 3;  4C3J H;  4RNO A;  1VQ9 A;  1O75 A;  3J80 E;  4I55 F;  4ODG A;  1FJG H;  5M5Y H;  4RB1 A;  4LF7 H;  4JI5 H;  1B4O A;  4YHH Q;  1JMC A;  2TMP A;  5CBA E;  2MPM A;  3S15 H;  3A56 A;  5LMU H;  4B3M L;  4GNX A;  1FL0 A;  1WTQ A;  4LUV A;  1WTV A;  3SEB A;  4XYQ A;  4AQY L;  2OTJ A;  4ED3 A;  4BBR G;  5AJ3 L;  5M3F H;  4MV1 A;  1WR2 A;  2YS6 A;  4XYL B;  4YAJ B;  1KD1 C;  1E1O A;  4LF5 Q;  5KG5 A;  2NU9 B;  4GN5 A;  5C0X I;  2A74 C;  2PW7 A;  2KEC A;  4PWQ A;  4ECU A;  1KNA A;  5M3M H;  2K5V A;  3S9W A;  4FDB A;  4XQN A;  3ER0 A;  4JI7 H;  1KJ9 A;  4I50 F;  4LMQ D;  2AWO A;  4WJ3 M;  2NVY A;  4JCV E;  5KNC A;  4DXF A;  3BA9 A;  1Q81 C;  3BG3 A;  1BKB A;  3UDX A;  2O5J C;  2NB0 A;  1X9N A;  3H09 A;  4P74 A;  3LNN A;  1V4Y A;  4YJ2 F;  1NR2 A;  2OT2 A;  1YI2 A;  3VPB A;  2IL8 A;  1XNR L;  1SRU A;  2KHJ A;  1HZB A;  4L6T B;  4ZCK A;  2WB1 G;  1EU3 A;  5J2U F;  2N8N A;  3PR4 A;  1K0S A;  4EG0 A;  2RGV A;  4J8Q A;  3VPD A;  1HTL D;  1ENC A;  3A5Z B;  1BOS A;  4H13 C;  3SDZ A;  2B63 B;  1KJI A;  2J7Z A;  2J6S A;  1ZXT A;  1K9M C;  3KHG A;  2O5I C;  1I6H B;  4OIK A;  2H1E A;  3K80 C;  1M8A A;  1QNU A;  2WKD A;  4KHZ A;  3OUU A;  1A3T A;  1SYG A;  3FRP B;  5C3E H;  1AFP A;  4A3G G;  1SNM A;  5J2T F;  2F0V A;  1SE3 A;  2L0C A;  3L9A X;  3NHH A;  1B50 A;  1KJJ A;  2KA7 A;  3H20 A;  1CM9 A;  3HOW G;  3QJY A;  2J0T D;  3A54 A;  3MVV A;  1EUJ A;  1AN7 A;  3OSN A;  3OHA A;  1SEI A;  3CCJ A;  1TKW B;  3HP3 A;  2IWH A;  3I7F A;  2CVR A;  5FLM G;  3NEN A;  3KLR A;  3J81 i;  4BWG B;  1Q8I A;  1R9T H;  2R61 A;  1M90 C;  4JI4 L;  4ECR A;  3PW5 A;  4JUZ A;  4UAI A;  1AUV A;  1PXU A;  2FJZ A;  5JJI A;  5GAH C;  5JQW A;  3OMC A;  2H5X A;  4NXN L;  2HT1 A;  4J15 A;  3PW4 A;  2CFM A;  2Y0S B;  3TZD A;  2JEB I;  3D3R A;  1IBL L;  3QG1 A;  1YNJ D;  4NXM L;  2LY7 A;  3OTO Q;  4O2A F;  5DAU A;  1VDZ A;  1JX4 A;  2Z6K A;  2LS0 1;  3STB C;  2HQL A;  4CC5 A;  3TS2 A;  4KV6 A;  4YIJ A;  5LL6 S;  2DY7 A;  1N32 H;  4MNO A;  4DV7 H;  4LH7 A;  1L2Z A;  2UXB Q;  4JI1 Q;  1JOK A;  2B2T A;  1ONL A;  4BA2 I;  1V1P B;  3DWA A;  4HCE A;  4ZRZ A;  1NBW A;  5LOV F;  1IW7 C;  2J6T A;  1WCM G;  2KCT A;  3O13 A;  5BMV F;  2UUC Q;  4YQW A;  1K83 A;  2KVM A;  1XYI A;  2I87 A;  4B9X A;  5LP6 F;  3GO5 A;  2K6A A;  4YHH H;  4EGV A;  5D1O B;  1V1Q A;  3T13 A;  2ZT9 C;  3K0X A;  3FP9 A;  4BS9 A;  1H9R A;  1YNN D;  4NMZ A;  2AMC B;  1CSP A;  5KFS A;  3J80 L;  3Q8Q B;  1Y1V A;  5C8Y F;  2VB3 X;  1C3O A;  3SK5 A;  1SJE D;  3RF2 A;  2XCA A;  4IQZ A;  1Y1W G;  2HHH Q;  3HOU G;  4LF5 H;  1J6Q A;  4C2M B;  4N8F A;  2K01 A;  5JEA J;  3J80 c;  3I3C A;  2F0K A;  4K2K A;  4LWC A;  2EIF A;  2CKZ B;  2NTT A;  5CMD A;  4QWB A;  1Q46 A;  4FM9 A;  1ASY A;  4LF8 Q;  4O3S A;  3AFP A;  5KFJ A;  2EYO A;  4A3D B;  3GIL A;  1XTC D;  3D4D A;  4A3I H;  4G7H C;  3Q23 A;  3GTL B;  2D0P A;  3Q6S A;  3E5S A;  3S1Q B;  3V4Z A;  3OIQ A;  1LAB A;  3N41 B;  3HG9 A;  4Z9C B;  1KNE A;  1M7J A;  1KXL A;  5M5X B;  3GTO B;  2FLL A;  1Y8P B;  3TQT A;  1DOK A;  3R5F A;  3PF5 A;  4A3C G;  1Y1V B;  1HRJ A;  1F2M A;  2F3W A;  4LJZ C;  1IHZ A;  5CC4 A;  1FJG L;  3J80 W;  2F0I A;  1OO9 B;  2I80 A;  4LF7 L;  4JI5 L;  5HY6 A;  1IBK Q;  2J4X A;  4HJ7 A;  2Q2I A;  4U68 A;  4OO1 G;  5LMU L;  4HJ8 A;  1JJC B;  4XYM B;  2XGT A;  4IRD A;  4ECS A;  1PLF A;  1UE7 A;  2O4X A;  4TQU S;  4DN4 M;  3G6V A;  3PW7 A;  4C2M H;  2VQF Q;  4PV1 C;  2UU9 Q;  5BN5 A;  2E2H A;  5CGK A;  4GLV B;  1SND A;  3RB6 A;  1JOO A;  4P72 A;  2NU6 B;  4A93 B;  3I4M H;  1T3N A;  3MHB A;  2RDF A;  4X6A H;  1DD2 A;  4YR0 A;  1PH6 A;  4P75 A;  3GTL H;  2F0T A;  4JI7 L;  1U5K A;  4C3I H;  3J81 E;  2R7Z G;  3S1Q H;  4QQB X;  4RAZ A;  5JUM A;  2JA5 B;  4KD3 A;  3RB0 A;  3QFF A;  4DR2 H;  1N33 H;  5M5X H;  1LT5 D;  3Q1K A;  2NN6 H;  4KKU A;  5IYB G;  1Y14 B;  4LNQ A;  3JSL A;  3M7N A;  2Q2U A;  4K0K H;  4HR7 A;  1V9P A;  4YCU A;  4UCV A;  2RCN A;  4A3B B;  4Q44 A;  1EYC A;  3ZYY X;  3GIK A;  1BVS A;  2Z6B A;  2ZXR A;  1PH3 A;  1CE8 A;  3GTK H;  2R92 A;  4PQX A;  2KEE A;  1CUK A;  4OWT B;  2K5H A;  2B2V A;  3HKZ B;  2WIN B;  1DGS A;  4QIW A;  3BYT B;  3RB4 A;  4DV3 Q;  3H0G A;  2PQA A;  1WJJ A;  5K5P A;  4EYI B;  4J9L A;  1WTW A;  5BPH A;  3R8B A;  3OHB A;  2JA5 H;  1SMY C;  4CJ1 B;  3E0J A;  1AE2 A;  3M4O B;  2WTF A;  2PPB C;  3NBH A;  1EZ8 A;  5ISR A;  2VQE Q;  2SOB A;  4YWM A;  4C1N K;  3I4N B;  2W6N A;  3H40 A;  4JI2 H;  1GHK A;  4HAE A;  1FVI A;  5C44 G;  3AEV A;  4A3B H;  1SNQ A;  4DR3 H;  3Q8S B;  4DR5 Q;  3KLS X;  1AEX A;  3HOY G;  3DM1 A;  2FK2 A;  3I90 A;  4DL7 A;  4N9P A;  1JWU D;  4E4T A;  5CV7 A;  4DAP A;  3OPO A;  1JJ2 A;  3JZI A;  3KTM A;  4U7C A;  4R9W A;  2NN6 I;  4A3L H;  3H0G B;  3PIO A;  1N32 L;  4DV7 L;  2A6H D;  2F0U A;  1D6E C;  2XVS A;  1UE6 A;  1HNW Q;  5GAG C;  3QO2 A;  2A1A A;  4ECY A;  2ZM6 Q;  2MUY A;  2WAQ E;  2WFW A;  2DNE A;  1EYD A;  3N8D A;  3NK9 A;  1Z2O X;  5DM6 3;  4RAY A;  2IHE A;  5I4D A;  3MZ5 A;  2OF1 A;  1K8A C;  1T5E A;  1YVC A;  4G57 A;  2UVW A;  1A2U A;  4OXP A;  3VYS A;  3K7A H;  5KG4 A;  1EEF D;  5KT4 A;  2ZTC A;  3CCL A;  3HGB A;  5JEA H;  1DCZ A;  2AGP A;  3T53 B;  1LO5 D;  3RGX A;  2QGQ A;  3W2D A;  2V9W A;  1PHJ A;  3AFQ A;  5KT6 A;  3NTI A;  2IJ0 A;  1CKM A;  1A8V A;  3IRB A;  3PUZ A;  5FD6 A;  1VQ8 A;  1KAB A;  1OXX K;  4ZKC B;  2KJX A;  3PW2 A;  3PO3 G;  4LF5 L;  3BJU A;  4MA0 A;  3D8G A;  4GLX A;  4RAU C;  4RHS A;  1YZ6 A;  4X66 H;  1GLV A;  3OW7 A;  3OIP A;  2BQU A;  2JQO A;  4LW1 A;  4G4K A;  1X3G A;  2BDN A;  3PF4 A;  2BE5 D;  4RZQ A;  2UXC H;  1S5E D;  1N56 A;  3QOJ A;  4A3M B;  1BCP D;  2K05 A;  4LUO A;  4X3T A;  1HZ9 A;  3JC6 6;  1K8O A;  1G6P A;  3ULL A;  2EJF C;  5COY A;  3KYH C;  2ASL A;  3E0E A;  4IFD G;  3I4L A;  1G91 A;  2AQ4 A;  3L4K A;  2CZG A;  4RGM A;  4DUY H;  3K57 A;  2KQ3 A;  1STH A;  3F2U A;  3J81 c;  5C5J A;  5KFH A;  4GS3 A;  4F50 A;  5KFA A;  5DLF A;  2R6G A;  5JVH 3;  4A3J B;  4K8I A;  1HTP A;  1ZYR D;  4BY7 G;  4G7Z C;  1AW7 A;  2L11 A;  3JAM L;  2R93 B;  1I4R A;  3F2D A;  3R3O A;  2N78 A;  4DAY A;  1Q82 C;  1M0T A;  4EEQ A;  3KDF B;  4J9M A;  2JA6 A;  4XQQ A;  5FOB B;  5EBC A;  4HIK A;  1PH2 A;  1SFO B;  4B3M Q;  2EY5 A;  1RHP A;  1YNJ C;  4AQY Q;  4A3M H;  5AJ3 Q;  4FYD A;  1WTR A;  3BAA A;  3VYU A;  2GPW A;  1J5E L;  1SE4 A;  3J81 W;  5EPK A;  3QR8 A;  1N33 L;  4DR2 L;  3GLK A;  5C5L A;  4O4H F;  2HVR A;  1DON A;  4ZKB B;  1VKZ A;  3J7A 5;  3JRX A;  4JPB W;  2JXM B;  3UDG A;  5EBD A;  2GN5 A;  1GUG A;  1HNZ Q;  4K0K L;  1SXT A;  2RSO A;  3IAY A;  3P7J A;  2E2D C;  3DUZ A;  1TQO A;  1E4F T;  3H94 A;  1DJR D;  4A3J H;  2E8G A;  3VDY A;  2YL2 A;  3TDQ A;  2JA6 B;  1I4X A;  4JW0 A;  4IUT A;  1XNR Q;  4MV9 A;  3CCU A;  2YRX A;  1XXG A;  3K3V A;  3MTS A;  2KCC A;  3KLS A;  2YCH A;  3OWE B;  3VPC A;  4PMC A;  2F0O A;  3S1M H;  2E2I B;  4G7O C;  3HBL A;  3FDS A;  1IKL A;  2NVX B;  1D5Z C;  2XWJ B;  1PK8 A;  4IPG A;  2RHS B;  2PMZ E;  1YNN C;  3MFY A;  4Y7N H;  3KAK A;  4N8X 1;  2XIW A;  4DV0 H;  3NXW A;  5EWF A;  5JVL A;  4IUU A;  3IFD A;  2NTS A;  1L1O B;  4AIM A;  4A2A A;  5I6Y A;  4Q5V A;  4UP8 A;  1EY9 A;  2VS1 A;  3S24 A;  2ZJQ A;  4QW8 A;  2UVV A;  4JI2 L;  4RCN A;  2YU9 A;  1F9R A;  1LAC A;  2W71 A;  2EYL A;  2XC9 A;  4JI4 Q;  4DR1 H;  5JAV A;  5K2M A;  4KHV A;  4DR3 L;  5HBR B;  1U4P A;  4WD3 A;  1CTM A;  4FP5 D;  2VQD A;  4RNN A;  4HMJ A;  4BBR B;  4NXN Q;  2ALY B;  2RKS A;  3HS0 C;  4O3P A;  4PZ6 A;  4X64 H;  1STG A;  4NXM Q;  5KG2 A;  4KI0 A;  1EQV A;  2E2I H;  1M4V A;  2EVB A;  4BBS B;  1OXS C;  3DWP A;  1PTO D;  2LKV A;  1T5X D;  3FKI H;  2CQY A;  3NEL A;  4DA2 A;  4CKE A;  1KIX A;  4A2B A;  1TWG B;  4RKL A;  4C3H B;  5C4X G;  1B8A A;  5IT9 E;  1BCP B;  1JIC A;  4O42 A;  3KHR A;  1HHV A;  3N42 B;  2D2C C;  3Q2O A;  2R8K A;  5D65 A;  1KL9 A;  3HEJ A;  2YU9 B;  2W6O A;  2W6Q A;  3R5X A;  4MV3 A;  5E4X A;  2F0Q A;  4XX0 B;  2BH8 A;  4ZLT F;  1EQT A;  3AB9 A;  3VYT A;  2NZ1 D;  4HJA A;  2QW7 A;  2X69 A;  1ROD A;  1VF5 C;  4F87 A;  2B2U C;  3CW2 C;  1B7Y B;  4NPS A;  5J3B A;  4BBR H;  3TQ1 A;  5DLG A;  2C2E A;  4BY1 B;  1PDQ A;  4A3G B;  3GTM H;  1LTG D;  4EGJ A;  4TV8 F;  2EE1 A;  3PUW A;  5T1G A;  4MV8 A;  5JJL A;  2GPS A;  4X66 L;  3QZ8 A;  3NEM A;  1TWG H;  3HOZ G;  4C3H H;  3I72 A;  4MA5 A;  2TSS A;  2UXC L;  4DL5 A;  1NY4 A;  5A2Q L;  2XIG A;  1VQB A;  4HMI A;  3H91 A;  3BDO A;  2OEO A;  1JOR A;  4E6I A;  4Q0F A;  2K5W A;  1F2Z A;  1SN8 A;  1EWI A;  1BXR A;  1HNZ H;  1VF7 A;  5FLX L;  1PH4 A;  4M1U B;  2EYJ A;  4A3K B;  2R92 G;  2LXK A;  3QZ7 A;  5IYC G;  3OMG A;  1HFG A;  3GTQ B;  5KFZ A;  2DWC A;  1SYD A;  4DUY L;  2Q2H A;  3RBE A;  2CCZ A;  1A0I A;  2PO4 A;  4ED8 A;  4JOI A;  3RLN A;  1S3O A;  1BUV T;  3ONA B;  4BY1 H;  4IUQ A;  4A3G H;  1FJG Q;  3S2H B;  4LF7 Q;  4JI5 Q;  1C7Y A;  1KRT A;  1STN A;  4POG A;  3Q0A A;  5LMU Q;  1SNP A;  1SJH D;  2EXZ A;  1WCM B;  5FLM H;  3KFU A;  4APM A;  4QWC A;  2XWB B;  4LF6 H;  4GN4 B;  1ZHS A;  1JWS D;  1VQJ A;  1S03 G;  2KOL A;  5D1P A;  2WB1 E;  3RZD H;  3S1N H;  2F0J A;  4JI8 H;  1TWC B;  1I3Q B;  4MZ9 A;  1CZW A;  2W6Z A;  4OEL B;  1MZB A;  4DV5 H;  3D4W A;  4QF4 A;  1BF4 A;  4FF4 A;  2ATL A;  4JI7 Q;  2A6H C;  3GTQ H;  4IOA A;  4CDC C;  4ZI7 F;  3PN1 A;  2VUM A;  1VQ4 A;  4AYB A;  2MNA A;  3HOV B;  4XQJ A;  3NWS A;  1EIH A;  4HYK A;  3BVZ A;  4A3E B;  2F0D A;  4V0B A;  2G9D A;  1GM5 A;  3GTP A;  3RZO H;  1G6Z A;  2JJQ A;  3PGZ A;  4IJH A;  1VMP A;  3CRK C;  4C5A A;  4KY6 A;  1GVP A;  1CQI B;  1L1O C;  1YJW A;  2PI2 E;  5CA0 F;  1WCM H;  3WDN A;  1EY0 A;  2UVR A;  4PZ7 A;  5LL6 X;  4IR9 A;  4DV0 L;  4EQO A;  4EBE A;  4WJW A;  3TRZ A;  1K73 C;  1X65 A;  1CK1 A;  1VQD A;  3EBE A;  2JA7 G;  3EPG A;  2D62 A;  2ES2 A;  1BBX C;  4YJ3 F;  2CQA A;  2Z1C A;  3PO2 G;  5IT9 c;  3AU7 A;  4DR1 L;  1MSG A;  2A69 D;  5KG7 A;  2EY2 A;  4C3J B;  1KEE A;  5M5Y B;  4IPH A;  2C9O A;  3HOU H;  4R8I A;  3GTG A;  3ETH A;  1QNK A;  2BE5 C;  2AUJ D;  4PZ8 A;  4FXD A;  1BCP C;  5KEE A;  4X64 L;  3S15 B;  5EDW A;  3GTJ A;  4JC0 A;  3VA7 A;  2QK4 A;  2DGY A;  1HXY D;  1X6O A;  3T5K A;  5IYD H;  1XDN A;  4NB3 A;  1PTO H;  1ET6 A;  1N36 H;  4M9U A;  2LMC B;  3V05 A;  5M3F B;  2PZT A;  2FMA A;  3GII A;  2DN8 A;  5EKK A;  2QDL A;  2R7Z B;  3GV3 A;  5IT9 W;  4A75 A;  4DV7 Q;  2XSC A;  3ERQ A;  1VQA A;  1W96 A;  2E75 C;  5M3M B;  2VA2 A;  2B39 A;  1ZYR C;  2JEF A;  3GIM A;  4KJN A;  1DOL A;  5ELO A;  5KIX A;  2NVQ B;  5I47 A;  3OWF A;  2ASB A;  2NYZ D;  3ERO A;  1E1T A;  2K14 A;  4FBU A;  4OO1 H;  2FMM A;  3E5N A;  4KKT A;  3K5O A;  3KF6 B;  5DM7 3;  4R7R A;  4CJ0 B;  2IPK D;  3VA5 A;  3HOX G;  3UI2 A;  3A5U A;  4YR2 A;  4LFB H;  4IFD J;  3KXY T;  1C4Q A;  2H4O A;  4IHJ F;  3D6W A;  3HB9 A;  5L1I A;  3RJ0 A;  4QUC A;  1S5F D;  1K3R A;  3CPF A;  1GUN A;  4AH6 A;  4ZK9 B;  1BO0 A;  5C3E B;  2B63 A;  2AKW B;  5E7N A;  2R7Z H;  5COR A;  1F9Q A;  1HA6 A;  3PUX A;  3QIA A;  4HSP A;  4MV4 A;  5IYB H;  4DV2 H;  4O2D A;  3E9H A;  5C5M A;  1I7L A;  3C3L A;  4RB0 A;  5IIF A;  1HNZ L;  5KFX A;  5KG0 A;  1UE1 A;  3D0F A;  5CYU A;  2NVQ H;  5KGU A;  2LSS A;  1LTT D;  3ZJY C;  1R9T B;  3WNZ A;  1H9S A;  1NR4 A;  3J7Z C;  2V5A A;  2E5L H;  4JI0 H;  4ECV A;  1STB A;  3MR3 A;  2GA4 B;  3S2D H;  2Z4H A;  3NPP A;  3C0F B;  4MTE A;  4QWA A;  1TWF H;  2UUA H;  3W3A A;  4UCO A;  2EPB A;  4DAM A;  4K5W A;  4ED7 A;  3NQI A;  1BCP F;  2BOS A;  2Y0S A;  1V51 A;  1RJT A;  2HCC A;  2F0M A;  3K5L A;  2F4V H;  2YYA A;  1U0L A;  4JI3 H;  4OO1 I;  2R7F A;  3DEP A;  3TBI B;  3IKJ A;  4LF6 L;  1GGO A;  2L1B A;  1UC8 A;  1W6K A;  2K04 A;  1H9S B;  4JI8 L;  1EYA A;  3KJO A;  4MV7 A;  1C9O A;  5I6W A;  2B2W C;  1JOQ A;  3CC2 A;  3VR3 A;  3TME A;  1WH2 A;  1V1P A;  4DV5 L;  3M3Y B;  2MHV A;  4DU9 A;  1QE6 A;  3MXN B;  1VQH A;  2JEA I;  1SYC A;  1W3S A;  1J5E Q;  1N33 Q;  4KK7 A;  4DR2 Q;  2J6U A;  1E2W A;  1PTO C;  1PZI D;  5E3F A;  1VBH A;  3PO3 B;  1A6X A;  1O7I A;  4RUC A;  2CHB D;  1DXM A;  1QZG A;  4J0M A;  5LL6 b;  3FMC A;  2VA3 A;  4QW9 A;  1JWM D;  5EPL A;  4K0K Q;  1MI2 A;  2OWO A;  1RJQ A;  1TAE A;  5D1O A;  1Z6H A;  1DM0 B;  3BVG A;  3NQT A;  4OGQ C;  4IR1 A;  1N8R C;  4L1K A;  4V19 0;  3BS1 A;  2K7V A;  4J1M A;  4U6P A;  4O3N A;  1BR9 A;  2OTL A;  5I9P A;  2JA8 B;  5KFY A;  4KN4 C;  3I55 A;  3N40 P;  1RYR A;  1YJN A;  1I7N A;  1SYX B;  4C2M A;  4M8A A;  5DGB A;  1TY2 A;  4LH6 A;  2CQO A;  3CP0 A;  4A3I B;  1EYG A;  2R8J A;  2P5Z X;  3WO1 A;  1PYS B;  2YTX A;  1GD7 A;  3M3Y H;  2SNM A;  3TP5 A;  1TXY A;  2V59 A;  3M7G A;  5KG1 A;  4H02 A;  3GTL A;  1NMF A;  1KDC A;  3PO3 H;  4L5T A;  3GTO A;  3IFT A;  4DR6 H;  4TKO B;  1IXR A;  1CQF A;  2NVY H;  4L5Q A;  1VQ5 A;  1SCU B;  4UHV A;  2Z0S A;  4EYH B;  2PNR C;  2W70 A;  3PIO 3;  3UFX B;  2WAC A;  4JI2 Q;  2W8K A;  4GC6 A;  4L63 B;  4S3S A;  4DR3 Q;  1UWV A;  1G51 A;  2O2L D;  4MN3 A;  3RLF A;  5D3D A;  3K59 A;  2MP1 A;  1N36 L;  5IY0 A;  1TWA B;  5IP7 G;  3K58 A;  4X3K A;  2JA8 H;  3W1B A;  5LHY 1;  4IRK A;  3CAM A;  3W1G A;  2F3I A;  3K5H A;  1NSN S;  1XTD A;  1XPO A;  3I4M B;  4YY3 H;  2AQ2 B;  3FEW X;  1EHI A;  2ZDH A;  1TII D;  3DLL A;  3PUV A;  2R6F A;  1ML0 D;  4IFD H;  4C3I B;  3K0Y A;  4KKS A;  3H3V H;  4YP3 A;  1MSH A;  1S40 A;  3DF7 A;  4RB3 C;  4FS1 A;  1GKH A;  4ED1 A;  1UAP A;  1PTO F;  5GAD C;  4BY7 H;  2JA5 A;  4DR7 L;  2PBZ A;  4PNY A;  1B9N A;  5IE8 A;  3WWV A;  3S1R B;  3TP8 A;  4LFB L;  3N44 B;  3G7L A;  4DL6 A;  3I2Z A;  5D8D A;  4DL2 A;  3I8Z A;  2YYZ A;  3BDC A;  4HID A;  2I5L X;  4DF7 A;  1PH5 A;  3UE0 A;  3EJI A;  3GTK B;  1BGW A;  2VPQ A;  3ND8 A;  3V6K A;  1TWA H;  4JV2 A;  1SRO A;  3R93 A;  1R4P B;  3LGJ A;  4LSX A;  4HNU A;  4PMB A;  2VW9 A;  3D31 A;  4DV2 L;  1RKN A;  2VUM G;  5BN4 A;  4AYB G;  1CZG A;  3RBD A;  2WP8 J;  4F7X A;  2AQ3 B;  2DLN A;  3HKZ A;  4X66 Q;  1KC8 C;  1PA6 A;  1T94 A;  3CCV A;  2WAQ B;  4A3F B;  3CPW A;  2UXC Q;  4DV6 H;  1S5C D;  4O3O A;  1CKN B;  2E5L L;  4JI0 L;  1VCI A;  2C28 A;  1NJI C;  1STE A;  2EYP A;  2XGQ A;  2K28 A;  5EKL A;  2UUA L;  4ZOL F;  1A15 A;  1PRT D;  3CC4 A;  3S1R H;  4EBC A;  1E3P A;  3GDE A;  3RMH A;  4IFD I;  1JJG A;  2FFK B;  4DUY Q;  4GNX C;  1PFB A;  3H3V I;  4OIJ A;  1XNQ H;  1XX8 A;  4IUP A;  2F4V L;  3SHL A;  2KSW A;  5FPR A;  4JI3 L;  1MGS A;  3KAL A;  1XMO H;  3G6X A;  4F4W A;  1L0X B;  5J39 A; 
#chains in the Genus database with same CATH homology
 3G71 A;  4A3J H;  2VQE L;  1CKO A;  2E8G A;  1CSQ A;  1QVC A;  4DV6 Q;  3HOY H;  3VDY A;  2HIV A;  2B29 A;  4EQ5 A;  5LMN L;  2OCE A;  4BY1 G;  3H15 A;  1HZC A;  1XNR Q;  2XTI A;  4A3K H;  4JOI C;  3CCU A;  3T1Y L;  1LTL A;  4A3F H;  2VY3 A;  5GQO A;  4EX5 A;  5IWA L;  4DR5 L;  4KHP L;  3S1M H;  3AQQ A;  2EQS A;  4LFC Q;  4O0A A;  1HNX L;  1VQI A;  2N49 A;  1S72 A;  1IYJ B;  1Q7Y C;  1VQK A;  1L2F A;  5IP9 H;  2AWN A;  3Q8D A;  1YIT A;  4BA1 I;  1SE8 A;  3UE1 A;  3S2H H;  2YV5 A;  1HNW L;  4IPG A;  1HJP A;  2PMZ E;  2RHS B;  4Y7N H;  1VS0 A;  4KLK A;  4OWW B;  2ZM6 L;  1XNQ Q;  2L15 A;  3UDI A;  1B70 B;  1MKH A;  1OXV A;  1XMO Q;  1Q86 C;  4R4C A;  4APV A;  3A0J A;  1BBU A;  3BU2 A;  1L1O B;  5FJ8 H;  4AIM A;  2OQK A;  4IO9 A;  1SMX A;  2IT1 A;  4UP8 A;  3TS0 A;  5C4X H;  4A3K G;  2VS1 A;  3S24 A;  2ZJQ A;  4B3R Q;  2MO0 A;  4JV5 L;  1XPR A;  3L0O A;  4JI2 L;  1K0R A;  2CWP A;  2B63 H;  3JAM i;  4JI4 Q;  1JB7 A;  2VZA A;  5LMN W;  1LYL A;  1I6H H;  1TWC H;  2VL6 A;  4DR3 L;  1I3Q H;  1JT8 A;  4WJ4 A;  3KLW A;  1X3E A;  5IP9 G;  4NXN Q;  2ALY B;  4PZ6 A;  4DK6 C;  4NXM Q;  4TVA B;  5HGQ A;  4KI0 A;  4GKJ L;  2E2I H;  4UY8 C;  1G29 1;  1OXS C;  3HOV H;  3RNU A;  3FKI H;  2IHF A;  1GO3 E;  3NEL A;  5FJ8 G;  1Q8K A;  4DV0 Q;  1KHI A;  3G6E A;  3MEF A;  4A3E H;  1KIX A;  2I5M X;  2JK8 A;  1B8A A;  5C4X G;  1H95 A;  4OON A;  4P73 A;  4DR6 L;  2B63 G;  1D7Q A;  1NE3 A;  1KRS A;  1UEB A;  2KHI A;  2Z6K C;  1KL9 A;  2R7D A;  1I94 L;  3CD6 A;  4DR1 Q;  2BH8 A;  1K8G A;  2F52 A;  3HOZ H;  5BR8 Q;  4JI6 Q;  4L5S A;  4LUZ A;  3AYH B;  1VQG A;  4UP7 A;  4YCW A;  4HJA A;  1HR0 Q;  2MFI A;  1N32 Q;  4X65 L;  4R4Q A;  1IBM L;  1IL2 A;  4X64 Q;  3CW2 C;  1B7Y B;  3F2B A;  2NZO A;  4NPS A;  3HOV G;  3FKI G;  5C0X G;  1EIF A;  5J3B A;  2E2J H;  4YY3 L;  4BBR H;  4A3E G;  1N9W A;  4X62 Q;  1PH7 A;  3GTM H;  2R92 H;  5IYC H;  3KDF A;  2ZJP A;  1CKN A;  4DKA C;  3ICE A;  1E7Z A;  4YWK A;  1HR0 W;  3GTP H;  1WFQ A;  3PUW A;  5IYD G;  4C3J H;  1VQ9 A;  2Y0S G;  3UDF A;  4IJL A;  5M5Y H;  2K5N A;  4X66 L;  5JJL A;  3M4Q A;  3NEM A;  1TWG H;  1V43 A;  4C3H H;  3HOZ G;  1RL2 A;  4YHH Q;  1JMC A;  2UXC L;  3DM3 A;  1L0W A;  1NY4 A;  2Y0S E;  3S15 H;  1VQB A;  3KF8 B;  5K36 G;  4B3M L;  4GNX A;  1FL0 A;  2LXJ A;  4LUV A;  1PH9 A;  1SN8 A;  1EQQ A;  1EWI A;  2OTJ A;  4AQY L;  3CME A;  4BBR G;  5AJ3 L;  5M3F H;  3K8A A;  1PH4 A;  2GVB A;  4XIG S;  1IZ6 A;  4HJ9 A;  1KD1 C;  2LXK A;  1MJE A;  1E1O A;  5IYC G;  4LF5 Q;  2K50 A;  2R92 G;  4DR4 Q;  2DUD A;  4GN5 A;  4L5R C;  5C0X I;  1HZA A;  4DUY L;  1N32 L;  2UXD Q;  2Q2H A;  2I0Q A;  2CCZ A;  1A0I A;  5M3M H;  2K5V A;  4FDB A;  4JOI A;  5GAE C;  3ER0 A;  1YBY A;  3RLN A;  1S3O A;  4WJ3 M;  2AWO A;  2V1C C;  4BY1 H;  1EFW A;  2NVT H;  1X55 A;  3OYY A;  4JCV E;  1FJG Q;  4A3G H;  4QIW E;  1Q81 C;  3UDX A;  1BKB A;  4LF7 Q;  4JI5 Q;  1X9N A;  4P74 A;  1C7Y A;  4DV6 L;  4GN3 B;  3CCE A;  1K83 H;  1KRT A;  4POG A;  1YI2 A;  4JBJ A;  5LMU Q;  1XNR L;  4A3D H;  3CCQ A;  1SRU A;  2KHJ A;  5M3F G;  1HZB A;  1YJ9 A;  2CWA A;  2WB1 G;  4R4O A;  1C0A A;  3E9I A;  1X3F A;  2N8N A;  5FLM H;  3KFU A;  4GN4 B;  4LFC L;  3A74 A;  3GTO H;  1VQJ A;  3A5Z B;  4BXX H;  2IX1 A;  2WB1 E;  3RZD H;  1K9M C;  3S1N H;  1L1O A;  1D8L A;  1QVF A;  5M3M G;  4MZ9 A;  1Y1V H;  1PV4 A;  3K80 C;  3B6Y A;  2D0O A;  1VQC A;  4KHZ A;  2HT1 A;  2UUB Q;  5C3E H;  1Q1B A;  2AHO B;  1MJC A;  1XNQ L;  4A3G G;  3G48 A;  4JI7 Q;  1XMO L;  3GTQ H;  3HOW G;  4IOA A;  3HFZ B;  1EUJ A;  1OXT A;  1VQ4 A;  2MNA A;  4A3D G;  3CCJ A;  4B3R L;  3I7F A;  1SR3 A;  1XPU A;  2EXD A;  5FLM G;  4LF9 Q;  3NEN A;  2JA7 H;  3J81 i;  1M90 C;  4JI4 L;  1R9T H;  1GM5 A;  4BXX G;  3RZO H;  2NN6 G;  2JJQ A;  3PGZ A;  4GOP B;  4IJH A;  3RN2 A;  3PO2 H;  5JJI A;  4A93 H;  5GAH C;  4LF6 Q;  2H5X A;  1MIU A;  1Y1V G;  4J15 A;  4NXN L;  2CFM A;  1GVP A;  1PH1 A;  3CXC A;  2JEB I;  1IBL L;  4LF4 Q;  1L1O C;  1YJW A;  4IPD A;  2PI2 E;  4JI8 Q;  4NXM L;  5C3E G;  3OTO Q;  1WCM H;  4R4T A;  2QA4 A;  4OWX B;  2Z6K A;  5C4J H;  4PZ7 A;  1A63 A;  4DV5 Q;  3TQY A;  1AE3 A;  3STB C;  2HQL A;  4DV0 L;  3TS2 A;  3TRZ A;  4JYA Q;  1K73 C;  1X65 A;  4MNO A;  1VQD A;  3EBE A;  2JA7 G;  2JA9 A;  2D62 A;  4IOC A;  2ES2 A;  2UXB Q;  2VNU D;  4JI1 Q;  3PO2 G;  5IT9 c;  1PFS A;  4A93 G;  4JBW A;  4DR1 L;  4BA2 I;  2E2H H;  1NBW A;  3F1Z A;  4JI6 L;  3CMA A;  4IPH A;  1SLJ A;  1EOV A;  3HOU H;  1ASZ A;  1HR0 L;  1WCM G;  2KCT A;  1YHA A;  2PQA B;  4PZ8 A;  2JA5 G;  2UUC Q;  4X64 L;  3M4P A;  4JC0 A;  2A8V A;  2DGY A;  1X6O A;  3GO5 A;  5IYD H;  4NB3 A;  1OXU A;  2ZTE A;  1V1Q A;  4X62 L;  3FP9 A;  2MQH A;  3K0X A;  1P16 A;  2RHQ B;  3HOX H;  3NBH B;  3KJP A;  1RIP A;  4A76 A;  2AMC B;  1OTC A;  1CSP A;  5H1S E;  3I56 A;  4A75 A;  4DV7 Q;  3M4O H;  3U58 A;  1KQS A;  1VQA A;  2HHH Q;  1Y1W G;  3S16 H;  4YHH L;  3HOU G;  1J6Q A;  4YCV A;  3I4N H;  4A3L G;  3T1H Q;  1EQR A;  5JEA J;  3J80 c;  2ZJR A;  5ELO A;  4DUZ Q;  2ASB A;  3HKZ G;  1YIJ A;  4LWC A;  1E1T A;  2K14 A;  2EIF A;  5M5W H;  2CKZ B;  3CQZ H;  4RG1 A;  3STB D;  4HIO A;  1Q46 A;  4DK3 C;  1ASY A;  4LF8 Q;  4LFA L;  3AFP A;  3KF6 B;  1VQL A;  3HKZ E;  4A3I H;  3HOX G;  2D0P A;  3H0G H;  4MTN A;  1VQ7 A;  3A5U A;  1N36 Q;  2UXD L;  1A62 A;  4IFD J;  4UPA A;  3I4O A;  1KXL A;  4UP9 A;  4DV1 L;  2R7Z H;  5JEA G;  3PF5 A;  4A3C G;  1Z47 A;  1K3R A;  3CPF A;  1I94 Q;  4AH6 A;  3I4N G;  1FJG L;  1FGU A;  5GRO A;  4LF7 L;  4JI5 L;  2AKW B;  5E7N A;  5HY6 A;  3BZK A;  3ULP A;  1W2B A;  1YHB A;  4ME3 A;  1IBK Q;  4JBK A;  4HJ7 A;  2Q2I A;  3PUX A;  2JA8 G;  4OO1 G;  1VQF A;  5LMU L;  5IYB H;  1JJC B;  4HJ8 A;  3W5O A;  2XGT A;  4O2D A;  3E9H A;  1Z9F A;  1UE7 A;  4TQU S;  4A3I G;  3RLO A;  1WOC A;  1HNZ L;  4C2M H;  2VQF Q;  3H0G G;  3HKS A;  1UE1 A;  3D0F A;  1XMQ Q;  1I50 H;  4B3T Q;  2LSS A;  2UU9 Q;  2NVQ H;  1VQP A;  3ZJY C;  4DR7 Q;  4GLV B;  3J7Z C;  2YTY A;  1QVG A;  3FHW A;  2K4K A;  4P72 A;  1X54 A;  3CCS A;  3HOW H;  1LUZ A;  3I4M H;  1QUQ B;  1BBW A;  2IX0 A;  4LFB Q;  4X6A H;  3S2D H;  1TWF H;  2MO1 A;  4P75 A;  1PH6 A;  3GTL H;  4JI7 L;  1U5K A;  3TRE A;  2C35 B;  4C3I H;  4DAM A;  3CCM A;  4GOP A;  4YWL A;  2R7Z G;  3S1Q H;  4QQB X;  5M5X H;  5IYB G;  1KAW A;  2BA1 A;  1LM0 A;  1Y14 B;  4LNQ A;  2QEX A;  3JAM c;  4JBM A;  4LF9 L;  3RN5 A;  4DV2 Q;  1U0L A;  3M7N A;  2Q2U A;  4OO1 I;  4QY7 A;  4OX9 Q;  2R7F A;  1V9P A;  1T9H A;  2NZH A;  4YCU A;  2JE6 I;  1N34 Q;  2RCN A;  4LF6 L;  2IY5 B;  3BZC A;  3I4M G;  4PG3 A;  4JI8 L;  3KJO A;  3OTO L;  4Y52 H;  1BVS A;  1C9O A;  4XTC S;  4QJF A;  1PH3 A;  2E5L Q;  3GTK H;  4JI0 Q;  2BA0 A;  3CC2 A;  1CUK A;  4OWT B;  1NTG A;  2K5H A;  4DV5 L;  3MXN B;  1DGS A;  1VQH A;  4GOP C;  2UUA Q;  2JEA I;  4JYA L;  1W3S A;  1J5E Q;  4DAY B;  2K52 A;  1N33 Q;  4B3S Q;  4DR2 Q;  3RR5 A;  4DV3 Q;  2KCM A;  2PQA A;  1EIY B;  1WJJ A;  4A3M G;  2UXB L;  1O7I A;  4JI1 L;  1UE5 A;  1QZG A;  2R93 H;  3F8T A;  2F4V Q;  2JA5 H;  4JI3 Q;  1YEZ A;  1PYB A;  4K0K Q;  2OWO A;  4GKK Q;  4DV4 Q;  3K81 C;  1AE2 A;  5EAY A;  4PMW A;  4DNI A;  1SFO H;  1Q12 A;  1N8R C;  2VQE Q;  2UUC L;  4YWM A;  1PVO A;  5DLQ E;  4P71 A;  1VQ6 A;  5LMN Q;  5C44 G;  1FVI A;  2OTL A;  2KBN A;  3AEV A;  3T1Y Q;  4A3B H;  1VQE A;  3I55 A;  2BH2 A;  5IWA Q;  4DR5 Q;  4A3J G;  4KHP Q;  1YJN A;  3HOY G;  1Y1W H;  1HNX Q;  2CQO A;  5BR8 L;  3CP0 A;  1JJ2 A;  3ERS X;  1EYG A;  2NN6 I;  1PYS B;  3PCO B;  2YTX A;  2WAQ G;  3PIO A;  4DV7 L;  4A3F G;  5IP7 H;  4A3L H;  1GD7 A;  2K75 A;  2R93 G;  5ELN A;  3M3Y H;  3PV0 A;  1UE6 A;  2YTV A;  1E22 A;  1TXY A;  3KF6 A;  5GAG C;  2HHH L;  1HNW Q;  2A1A A;  4H02 A;  2ZM6 Q;  4QGU A;  2WAQ E;  2WFW A;  3T1H L;  2JA6 H;  4DUZ L;  1NMF A;  2IHE A;  1IBL Q;  3PO3 H;  4L5T A;  1K8A C;  1IXR A;  1YVC A;  2PI2 A;  1P8L A;  2HIX A;  2NVY H;  4L5Q A;  1VQ5 A;  4LF8 L;  4A3B G;  4JV5 Q;  4OXP A;  2Z0S A;  3K7A H;  2RF4 A;  4JI2 Q;  1E24 A;  3L7Z C;  2ZTC A;  3CCL A;  4A3C H;  4DR3 Q;  1UWV A;  1G51 A;  2ZTD A;  2NVX H;  2B3G A;  3RLF A;  1N36 L;  5C0X J;  2ID0 A;  4A4I A;  5IY0 A;  5IP7 G;  2QGQ A;  3SGI A;  1HH2 P;  3AFQ A;  1PHJ A;  2JA8 H;  3CC7 A;  3W1B A;  3CAM A;  3W1G A;  2F3I A;  1CKM A;  1A8V A;  3IRB A;  1WI5 A;  1XTD A;  3PUZ A;  4IPC A;  3U4V A;  1XPO A;  1QZH A;  4GKJ Q;  1VQ8 A;  3EIV A;  2JA6 G;  2OQ0 A;  3PIP A;  1OXX K;  3DLL A;  3PUV A;  1IBK L;  3PO3 G;  1JE5 A;  1M1K C;  4LF5 L;  4DR4 L;  3BJU A;  1TWH H;  3H3V H;  1AH9 A;  3U4Z A;  1I5F A;  1QUQ A;  3K7U C;  4GLX A;  3M85 A;  4DR6 Q;  3S17 H;  1S40 A;  1YZ6 A;  2VQF L;  2VUM H;  1XMQ L;  4B3T L;  1GKH A;  3EN2 A;  2UU9 L;  2JQO A;  4LW1 A;  1X3G A;  5GAD C;  3PF4 A;  4BY7 H;  4DR7 L;  2PNH A;  4LUO A;  3S14 H;  1HZ9 A;  3JC6 6;  5IE8 A;  3WWV A;  4BBS H;  4LFB L;  1G6P A;  3ULL A;  3CCR A;  4HIM A;  3I2Z A;  4X65 Q;  4JG2 A;  1IBM Q;  1Q1E A;  4HJ5 A;  3KYH C;  2N3S A;  2YYZ A;  3KOJ A;  2I5L X;  4HID A;  1PH5 A;  3UE0 A;  3E0E A;  3PUY A;  4IFD G;  1YNX A;  1TWA H;  4YY3 Q;  5JJK A;  1SRO A;  3LGJ A;  3CF5 A;  3OW2 A;  3J81 c;  4GS3 A;  3U50 C;  1XJV A;  2R6G A;  2YU9 H;  2VW9 A;  3D31 A;  4DV2 L;  2VUM G;  2UUB L;  4AYB G;  2GVA A;  4LFA Q;  1X56 A;  3L2P A;  1VQM A;  2WP8 J;  4OX9 L;  4BY7 G;  1N34 L;  2FXQ A;  4X66 Q;  1KC8 C;  1PA6 A;  3CCV A;  3GD7 A;  3CPW A;  1VQN A;  3F2D A;  4AYB E;  2UXC Q;  2N78 A;  1Q82 C;  1PH8 A;  4BBS G;  1YHQ A;  5FLX c;  3KDF B;  1CKN B;  2E5L L;  4JI0 L;  1VCI A;  4HIK A;  4ALP A;  3J80 i;  2KEN A;  1WYD A;  4R1J A;  4DV1 Q;  4RMF A;  1PH2 A;  1NJI C;  4B3M Q;  3J81 j;  4AQY Q;  4POF A;  3GTG H;  4A3M H;  3TEH B;  5AJ3 Q;  1VQO A;  2UUA L;  3M9B A;  4QL5 A;  3G4S A;  1J5E L;  2ATW A;  3CC4 A;  3S1R H;  3PSI A;  4DR2 L;  3GTJ H;  4DV3 L;  4B3S L;  1N33 L;  4LF4 L;  1E3P A;  3GDE A;  4GLA C;  4IFD I;  1JJG A;  4R4I A;  1NMG A;  4DUY Q;  4GNX B;  4GNX C;  3H3V I;  3J7A 5;  3UDG A;  2I5H A;  2F4V L;  2GN5 A;  4JI3 L;  4DPG A;  1HNZ Q;  4K0K L;  3ULJ A;  4GKK L;  4DV4 L;  3F2C A;  5C44 H;  2A19 A;  2Q2T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...