2JA7G

Cpd lesion containing rna polymerase ii elongation complex c
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
171
structure length
171
Chain Sequence
b'MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*TP*AP*AP*GP*TP*AP*CP*TP*TP*GP *AP*GP*CP*T)-3'
publication title Cpd Damage Recognition by Transcribing RNA Polymerase II.
pubmed doi rcsb
molecule tags Transferase
total genus 26
structure length 171
sequence length 171
chains with identical sequence S
ec nomenclature
pdb deposition date 2006-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2ja7G02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 2ja7G01
4XIGS 3E0EA 4DR3L 4DV4L 1YEZA 5HGQA 2AHOB 3MXNB 3HOWH 2B29A 2IT1A 2F3IA 2IY5B 2FXQA 2RHQB 4JI0L 4DR3Q 4C3IH 3U50C 3M4QA 4DV4Q 3M7NA 2WFWA 4IPCA 1VCIA 2VQEL 5IP7H 3CC7A 1YITA 4A76A 2LSSA 3GTKH 2K5VA 3KLWA 3PUXA 4NB3A 4DK3C 5IT9c 2E2IH 3STBC 4JI0Q 5IP9G 2MQHA 3D31A 3S1NH 3CCJA 2D0OA 2N49A 1YZ6A 5GAGC 2VQEQ 1BKBA 4DR7L 2QGQA 1NTGA 1NJIC 4JV5Q 2ZJQA 3FP9A 1XPUA 3F2CA 4A3KG 3D0FA 3H15A 4HIKA 4KLKA 4IPHA 3I2ZA 1XMOL 4GOPB 1SR3A 2VW9A 2JQOA 1VQOA 5M3FH 1HZ9A 1SN8A 3H0GH 3NENA 3I4MG 1XMOQ 3TS0A 3W1BA 3L2PA 1E1TA 3PF4A 1TWHH 4A93H 4P74A 5BR8L 1HR0W 3S1QH 4JBWA 4R4IA 3K8AA 4AYBE 1IBKL 3RN5A 4BA2I 3L0OA 4PG3A 4GKJL 1NMGA 1X55A 3PUYA 5BR8Q 3U4VA 2JA5H 4HJ5A 1IBKQ 4JYAL 3DM3A 1UE5A 2A1AA 1M90C 4GKJQ 3CW2C 4HJ7A 1HZBA 3SGIA 3BZCA 4ME3A 3F2DA 1Q8KA 4HJAA 2UUCQ 2CKZB 2UXDL 4YWLA 4JYAQ 1C7YA 2R7DA 2VY3A 4A3EH 4LFBL 1I94Q 1G6PA 3PCOB 1Q81C 1YNXA 2UXDQ 4P75A 4QIWE 1NMFA 1IL2A 1J6QA 4LFBQ 3HOWG 3VDYA 4H02A 4LFCL 2VUMG 2Z0SA 3T1HL 1V43A 2MO1A 3KYHC 5LMNQ 4JBMA 2B63G 2NVTH 1SROA 4IFDJ 1X3GA 1VQGA 2HT1A 4R4OA 4JOIA 3U4ZA 4A75A 3U58A 4LFCQ 5C44G 3S15H 3KDFB 3T1HQ 2Q2TA 4POGA 1TXYA 1UE1A 3FKIH 1UE7A 3B6YA 1B7YB 1JJCB 4GN5A 4DV1L 4DV7L 4IJHA 4IPDA 2K52A 4GN3B 3M85A 1A0IA 4X64L 4DV1Q 1X65A 2E5LL 1PV4A 4DV7Q 2JEAI 3PV0A 3I4OA 3HOXG 1AH9A 2JE6I 4BY1H 3H0GG 2F4VL 4GKKL 4YY3L 4JI1L 4X64Q 4JCVE 2E5LQ 2KENA 2A8VA 3HOVH 3ICEA 1KXLA 2V1CC 3PIOA 2VS1A 2F4VQ 4P72A 4GNXB 4LF8Q 4GKKQ 4YY3Q 4JI1Q 3F8TA 2K75A 5J3BA 4P73A 4X6AH 3K80C 2R6GA 2Q2IA 5IYBG 2CFMA 1ASZA 2UU9L 1GO3E 1VQPA 2AWNA 2GVAA 3I56A 1E7ZA 4JI4L 4JI8Q 4BBSG 2EQSA 4AIMA 4A3EG 3HOYH 1X54A 4R4TA 1Q46A 1KRTA 4LWCA 2HHHL 1QVCA 4DV2L 2KCMA 3OTOL 1C9OA 1J5EL 1S72A 1YJNA 1G51A 4JI4Q 2UXBQ 2WAQE 4DPGA 2RHSB 2BH2A 1I6HH 4GLVB 2MO0A 3RLNA 2HHHQ 4DV2Q 1KHIA 1E24A 4R4CA 2AWOA 3OTOQ 3DLLA 1J5EQ 1HNXL 1VQLA 3ULLA 1EUJA 2UUAQ 3CF5A 1GVPA 2Z6KA 1Y1VG 3BJUA 1HZAA 3MEFA 2I5HA 3OYYA 1YHBA 4IJLA 5JEAG 4DNIA 1HNXQ 1IBML 3PO3G 1L2FA 4BBRH 3PIPA 4DR5L 1N36L 3PGZA 1SRUA 4YCVA 4OXPA 2ATWA 1S40A 1SE8A 2ALYB 1EIYB 2R93G 3ZJYC 4QY7A 4LFAL 4DR5Q 3PF5A 2VL6A 1N36Q 1I3QH 2E2HH 3CPFA 3PUZA 2JA6G 5JJKA 4NPSA 1JJGA 1Q1BA 4LFAQ 3HFZB 1G291 1X3FA 2RF4A 1YHQA 1O7IA 3HOVG 1UWVA 5IY0A 3EIVA 3PSIA 5M5WH 4OWTB 1OXXK 3AEVA 4HIMA 4C2MH 1BBWA 2CWPA 1V1QA 3GTQH 4A3CG 2JA8H 4GOPC 4JI2L 5IE8A 1GKHA 1T9HA 1VQIA 2NZOA 4JV5L 1K9MC 4O2DA 3GTJH 4A3JH 1FVIA 4C3JH 2N8NA 1E22A 4JI2Q 1DGSA 1B70B 2GVBA 2NVYH 5EAYA 3E9HA 1FL0A 4JI3L 3CMAA 2XTIA 1VQAA 5M3MH 2AKWB 3G48A 2YV5A 2ZJPA 4IOAA 4JI3Q 1FJGL 1U5KA 1LTLA 2WAQG 2EXDA 4ALPA 4JI5Q 4B3RL 4X62L 4JBJA 2PI2E 4IOCA 1FJGQ 4GLAC 3ULJA 1VQ8A 1Y1WG 3G71A 3M3YH 3TEHB 4B3RQ 4X62Q 1HJPA 2UUCL 1IXRA 1QZHA 5FJ8H 2K4KA 2D62A 2HIVA 2DUDA 5GQOA 1I94L 2ZJRA 1OXVA 1I5FA 3NBHB 2OCEA 1SFOH 2OWOA 2BA1A 4A3FH 1N8RC 3Q8DA 1PH5A 4OONA 4LUZA 3F1ZA 4MTNA 3A5UA 1Q1EA 2PQAB 4UY8C 2R7ZH 5LMNL 1VQJA 2B3GA 3CP0A 1JE5A 1K3RA 3J81j 4PZ6A 4LF6L 1CSQA 3ERSX 1HH2P 4YHHQ 1JB7A 4DAYB 4B3ML 5IP7G 3J7A5 1PH9A 3W5OA 2RCNA 4A3JG 5FLXc 1CKOA 3STBD 4LF6Q 3GTLH 4JC0A 1VQ5A 3AFPA 1OXTA 1WCMH 2YTYA 1TWAH 4GS3A 4IO9A 4B3SL 4B3MQ 3HOZH 4DR6L 4GNXC 2YYZA 1XPOA 4LF9L 5C3EH 2E2JH 4LNQA 5M3MG 4R4QA 4YWKA 4HIOA 3RNUA 1Z47A 4B3SQ 2PNHA 2YU9H 4DR6Q 3PO2H 5M3FG 4A3BH 4DAMA 4GN4B 2NVXH 4LF9Q 3CD6A 1FGUA 1YHAA 3UDIA 1PYSB 3FHWA 1K8AC 4LF8L 3RR5A 4EX5A 1XMQL 3KF8B 1L1OA 1N9WA 5JEAJ 1XJVA 3I4NH 4A93G 1LYLA 1MKHA 1D7QA 2OQ0A 4DV3L 2OTLA 4A4IA 2JA7H 1XMQQ 4LF4L 1MJEA 1IZ6A 5GADC 2I0QA 3RZOH 1PH4A 4DV3Q 2JA5G 4X66L 3H3VH 1LM0A 4JI8L 5FLMH 1YJWA 4LF4Q 2PQAA 1W2BA 4KI0A 2Y0SG 1NBWA 4X66Q 4JG2A 3UDGA 4WJ3M 2UXBL 1L0WA 2KHIA 5HY6A 4A3FG 1K83H 5IWAL 1MJCA 3UDFA 2NVQH 2QA4A 1KC8C 2UUAL 2R92H 1HNWQ 4GLXA 1VQBA 3IRBA 1WFQA 5C4XH 4K0KL 5IWAQ 4LW1A 4O0AA 5LMNW 1KIXA 2JK8A 4HIDA 2A19A 3CCMA 4K0KQ 2GN5A 2YTVA 3CCVA 1VQ4A 2VNUD 3GTPH 2EIFA 3M4PA 4BXXH 3AFQA 3T1YL 2BA0A 2LXJA 4DKAC 1WCMG 3FKIG 5H1SE 1H95A 1HNZL 1E3PA 2NZHA 1XPRA 3GDEA 1QVGA 2PI2A 3TREA 3T1YQ 5JJLA 3RN2A 4YCWA 1HNZQ 3NEMA 4A3KH 1VQ9A 3A5ZB 4A3BG 1PA6A 4PZ8A 4UPAA 3GTGH 4HJ8A 4A3LH 3CXCA 4BY1G 2D0PA 1PH1A 1VQNA 1PFSA 1VQKA 2UUBL 4FDBA 4OWWB 3I4NG 1D8LA 2WB1G 3CCQA 3I4MH 3S24A 3JAMi 1EWIA 1JJ2A 4OO1G 4AQYQ 2JA7G 4LUOA 2UUBQ 1KL9A 4C3HH 1QVFA 1JT8A 5M5YH 4JOIC 3UE0A 3GTMH 3KJPA 1Z9FA 2IX0A 1PH8A 1A63A 1C0AA 1EQRA 3HOUH 1PH6A 1KQSA 3S1MH 1QZGA 3CMEA 2JA9A 2IX1A 4AH6A 4Y7NH 1VQMA 2ES2A 3S17H 1I50H 3HOYG 4MZ9A 1A62A 4QJFA 4OX9L 4WJ4A 1XNRQ 2L15A 3RLOA 4APVA 3KFUA 1UE6A 2VZAA 4OWXB 2K14A 4IFDI 1X3EA 4OX9Q 3CCLA 1YI2A 1N33L 1EOVA 3GO5A 4JI5L 1YIJA 4DV0L 4DR2L 1OTCA 1U0LA 2VUMH 3A74A 1N33Q 5M5XH 1VQ6A 4QQBX 2KCTA 1PH2A 4NXML 3JC66 2B63H 4DV0Q 2ZTEA 4DR2Q 3GTOH 4L5TA 2R7FA 2Y0SE 4BBRG 5C44H 1EYGA 1E1OA 4NXMQ 3NELA 1UEBA 5E7NA 3JAMc 1JMCA 3S1RH 3S14H 1VQDA 1L1OB 1CKNB 4L5RC 4OO1I 4L5SA 3EBEA 1SLJA 4A3LG 1PHJA 1VQEA 3J81c 1ASYA 4BA1I 2F52A 3S16H 4DR7Q 3H3VI 5C0XG 3CAMA 4EQ5A 3GD7A 1AE2A 3HOXH 2Q2UA 3K0XA 1V9PA 4NXNL 2Z6KC 4YHHL 1IBLL 1Y14B 2JEBI 1TWGH 3HKZE 1Q82C 4BY7H 4DR1L 2BH8A 3CCEA 1A8VA 4XTCS 2JA8G 4NXNQ 1WI5A 1IBLQ 3KF6A 1N34L 1WYDA 1KD1C 4LF7L 3HOUG 2I5LX 5JJIA 4A3GH 4DR1Q 1CKMA 3WWVA 5IYBH 3UDXA 3J7ZC 4A3DH 1BVSA 4MNOA 4LF7Q 3CCUA 3I7FA 3UE1A 3OW2A 1N34Q 1W3SA 1K8GA 4PMWA 4BBSH 3AYHB 1RIPA 1TWFH 2QEXA 3HKSA 3PUVA 2C35B 2K50A 2WB1E 3ER0A 2ID0A 4JBKA 1S3OA 3CC4A 1WJJA 2I5MX 5IYCH 4A3MH 4TVAB 4RG1A 3K7UC 4LF5L 2LXKA 4YCUA 1X9NA 2E8GA 4HJ9A 3W1GA 3LGJA 5ELOA 1P8LA 4UP7A 1CKNA 4LF5Q 2Q2HA 4JI7L 1Y1VH 3I55A 4TQUS 5LMUL 5C0XI 3KJOA 3M4OH 2YTXA 2OQKA 4GOPA 3PO3H 4JI7Q 4IPGA 5IYDH 1HZCA 1KRSA 3M9BA 1QUQB 5FJ8G 5LMUQ 4KHPL 4B3TL 3G6EA 3TRZA 4DV6L 2AMCB 2CWAA 3J80i 1R9TH 4JI6L 3TS2A 3RZDH 1VQFA 2KBNA 4BXXG 2N78A 2NN6G 3KOJA 2R93H 4L5QA 4DUZL 3S2HH 4KHPQ 1HNWL 4B3TQ 2JA6H 2JJQA 1NE3A 4DV6Q 1PH7A 2CCZA 4JI6Q 2K5HA 3K7AH 1XNQL 4A3IH 2OTJA 1PH3A 3A0JA 2VQFL 4DUZQ 4POFA 1OXUA 2R7ZG 4BY7G 2XGTA 4DV5L 1K73C 1PVOA 5K36G 4UP8A 1XNQQ 3F2BA 1EIFA 1YJ9A 3S2DH 1WOCA 2VQFQ 4QGUA 1X6OA 3K81C 4KHZA 4DV5Q 4A3GG 4A3CH 5C4JH 1VQ7A 2HQLA 4A3DG 3HKZG 3CC2A 2KHJA 4IFDG 4AYBG 4P71A 4X65L 1CSPA 1P16A 2HIXA 3ULPA 1VS0A 5ELNA 3HOZG 1YBYA 2DGYA 4PZ7A 1BBUA 5IP9H 4DUYL 1M1KC 5C3EG 2UU9Q 4X65Q 1N32L 3CCRA 1RL2A 5IYCG 5GROA 4A3MG 3PO2G 5AJ3L 4DUYQ 3KDFA 2ZM6L 1N32Q 2ZTDA 4AQYL 3J80c 1AE3A 1IYJB 2K5NA 4RMFA 1QUQA 5AJ3Q 1TWCH 3EN2A 2ZM6Q 1HR0L 3CCSA 2NN6I 4R1JA 1OXSC 2PMZE 2H5XA 3BU2A 4Y52H 1SMXA 1EQQA 1MIUA 4LUVA 4DR4L 2N3SA 2WP8J 1HR0Q 3E9IA 5IYDG 1X56A 2MFIA 3L7ZC 4YWMA 3J81i 1XTDA 3CPWA 5FLMG 1Y1WH 1Q86C 1Q12A 1B8AA 3AQQA 1IBMQ 4DR4Q 5GAHC 2UXCL 1Q7YC 1XNRL 3G4SA 2ZTCA 5GAEC 1YVCA 5DLQE 5C0XJ 1CUKA 2MNAA 4GNXA 3BZKA 2UXCQ 2IHEA 2ASBA 2IHFA 4DK6C 1EFWA 3RLFA 1GD7A 1VQCA 1LUZA 2CQOA 1K0RA 1NY4A 3KF6B 3PUWA 4QL5A 4A3IG 1GM5A 3CQZH 4J15A 2R92G 1KAWA 3TQYA 4UP9A 1VQHA 5C4XG 1L1OC 1PYBA
chains in the Genus database with same CATH superfamily
5I6YA 3EYYA 1YEZA 2RVLA 5HGQA 2AHOB 3MXNB 4DUYH 2HHHH 2F3IA 1I3QB 2RHQB 4DNTB 4JI0L 4DV4Q 4BXXG 2WFWA 1KTKA 3KLWA 2E75C 5ELCA 2B2YC 3FPUB 3D31A 4ZK9B 5IP9G 3CCJA 3S1NH 1E2ZA 1EQTA 4TSSA 4JV5Q 2J6TA 2F0OA 3I90A 5E3FA 3KHLA 4HIKA 4KLKA 3T53B 1N36H 2VW9A 2R7MA 1VQOA 2D9UA 1HZ9A 1SN8A 2B2VA 3EJIA 3I4MG 4DAVA 1XMOQ 3L2PA 1HRJA 4C3HG 3K8AA 3RV4A 1CA6A 3L0OA 1NMGA 1JXLA 1SYDA 4HJ5A 1SJED 4JYAL 3DM3A 3FVQA 1GHKA 5K5PA 4ODGA 4ME3A 1I4HA 1Q8KA 2K5QA 2UUCQ 2FFKB 4YWLA 2R7DA 3MXPA 1YNNC 2A68C 4JI0H 1G6PA 1STHA 3H20A 4BWGB 4CDEC 1YNXA 2EYPA 3S14B 4J9MA 4LFBQ 1J6QA 5D14A 4IRCA 2EXZA 2VUMG 2R61A 2MO1A 2B63G 2WYOA 1X3GA 1VQGA 3KLSX 5KFRA 4DL4A 4A75A 3U58A 5ELDA 3TP5A 3KDFB 2YRXA 1LACA 3TQTA 1FKAH 5D3DA 2PMZA 1TVXA 3B6YA 2K28A 2R7ZB 1TWGB 4IJHA 3G6VA 1MHWC 3KK7A 1A0IA 1JOOA 2F0EA 2I87A 2JEAI 2EE1A 3SVMA 1G8ZD 3HOXG 4BY1H 3H0GG 1BNZA 4A3DB 4X64Q 4JYAH 4JCVE 4JVZA 4AYBB 2A8VA 4H0LC 2FPGB 1GSAA 2V1CC 3PIOA 2IX3A 4GNXB 2VUMA 4JI1Q 2K6AA 2B63A 3RF2A 4R8UB 1TR5A 2M2LA 3C2PA 1E4EA 1HQRD 2R6GA 3OSNA 3WO0A 3EFXD 2WDTA 2VB3X 5IGGA 1GO3E 4ZAIA 1E7ZA 5LP6F 3HOYH 3MFHA 2KVMA 1U4PA 1S5ED 1KRTA 5BMVF 4QIWB 3OTOL 1J5EL 3M4OB 4OELB 5DM73 1E4GT 2WAQE 3OHBA 1Z2PX 2KJXA 3RLNA 1STAA 4DV2Q 1HNXL 4LSAA 3GQCA 4DN4M 3CF5A 2Z6KA 1SYGA 1C8CA 1EYZA 1RYRA 4O42A 1EZ6A 4IJLA 3R5XA 2OLSA 2YW2A 4I7AA 4ZCKA 1ZYRC 3PIP3 3MFIA 3PO3G 3J80W 4CJ1B 1CK1A 4LF8H 1SRUA 4EEQA 1IOWA 4TQSA 5C4XB 3VYUA 2EY5A 4LFAL 3GQBA 3S2DB 3X3MA 2C2EA 3WDNA 4ZI7F 4CBVA 1RTNA 1X3FA 1YHQA 4DU9A 5IY0A 5ELEA 5KFNA 5KFCA 3PSIA 1S5CD 5FD6A 3FMAA 3ITPA 4F87A 2ENBA 3NUCA 5KIXA 4HIMA 4RUCA 2W7PA 1KEEA 2V4DA 3OTOH 4F4YA 1KDCA 2K7VA 4JI2L 4V190 1GKHA 3PN1A 3BYYB 2R8GA 2TMPA 3LWUA 4JV5L 5KFYA 1EY6A 1HNXH 1FVIA 2V59A 2N8NA 1E22A 3I4MB 4J9QA 1DGSA 1EYDA 2GVBA 3GIQA 3E9HA 3HS0C 4C3HB 2JEGA 2XTIA 1VQAA 4CGYB 1PZKD 5CV4A 5DLGA 3GV5B 3S1MB 2DWCA 1U5KA 1GUNA 2VA2A 4LFAH 1O78A 1I50B 4DGZA 4ALPA 4JI5Q 3BDLA 4B3RL 1ULZA 4IOCA 4RNNA 4HAEA 1Y1WG 3TEHB 2WTFA 1HJPA 2F0NA 2IPKD 2UUCL 1QZHA 4ED0A 2K4KA 1DONA 2HIVA 2XCLA 1OXVA 1SFOH 2VUMB 2OCEA 2OWOA 1MZBA 2BA1A 3VPDA 2B63B 2HQEA 1H9KA 4K6LA 1PH5A 1CT1D 1E4EB 4LUZA 1F2MA 2X0SA 2E2IB 2PQAB 4UY8C 1C48A 4B08A 4L1KA 1JE5A 3UFXB 2L4NA 3T5JA 1HFGA 1HH2P 1JB7A 1FYCA 1IW7D 5FPOA 1PH9A 2RCFA 4I55F 3CRKC 3STBD 3HOXB 3BQ1A 5EKLA 1VQ5A 3H0GB 2F0IA 4B3SL 1TWAH 2FINB 4ED8A 1PRTC 3S1QB 1XPOA 4NXMH 5C3EH 4B3RH 2E2JH 4YWKA 2PNHA 4KK7A 4NW2A 2MGSA 2B2WA 1YHAA 3UDIA 1SYEA 1PYSB 3FHWA 3RR5A 2RGVA 2UVRA 1L1OA 3I4NH 1HHVA 2WV6D 4J0MA 2OQ0A 5KFMA 4FXGC 2OTLA 4A4IA 5I2XA 2W9BA 1IZ6A 4DV3Q 5LOVF 4X66L 3H3VH 1UEAB 1ESRA 3PW7A 1NAPA 4NXNH 1G6ZA 2B2YA 2A6HD 3E6ZX 2V58A 2RDFA 1W93A 5DM63 3V96A 5FD5A 1L0WA 1AZQA 4LF7H 1K83H 2L11A 2K03A 2PCFB 3S15B 1MJCA 3UDFA 1WTHA 3PO3B 1PTOC 2FPPB 4LH6A 1LO5D 1PTOH 1WFQA 4K0KL 3GIPA 2V5AA 5KFOA 4B3SH 1K1SA 2EJFC 3FDSA 3RZDB 2KHSA 4HIDA 3CCVA 3GTPH 2B2TC 1U4LA 2EIFA 5E1FA 2F3VA 3TBIB 1HNZL 1E3PA 2NZHA 1XPRA 4FXDA 3GDEA 3OW7A 1HFNA 2PI2A 4YCWA 4YIJA 3D4DA 4A3KH 3LMLA 2TSSA 1VQ9A 3A5ZB 3TP7A 5C4JB 2YZNA 4BY1G 2D0PA 2ZDGA 1VQNA 3SK5A 2FK3A 3J7AK 2L1BA 5KT3A 3DUZA 4OGQC 1KL9A 4RAUC 1XYIA 3OPOA 5I4DA 3GTMH 3SI8A 1XNQH 3E5NA 5CORA 1HUMA 1C0AA 2G5DA 1PH6A 4YQWA 1QZGA 4ZUJA 3HOYG 1HPCA 5CV5A 4E6IA 2NZ1D 4RFBA 4OX9Q 2YZMA 4U673 1YI2A 1Y1WB 2K1BA 1JOKA 2F0QA 1HNZH 4JI5L 5KG7A 1B04A 1F9PA 5KG5A 4ECWA 1U0LA 1HTLD 1VQ6A 5M5XH 4CKCA 3JC66 1TT2A 2ZTEA 3GTOH 4J9OA 2ZDQA 4IZOA 2NYZD 3GIJA 4AQYH 5K2MA 3K5IA 5M5WB 1UEBA 3S14H 3S1RH 1VQDA 1L1OB 1CKNB 4L5RC 2W9CA 1BCPF 4A3LG 1KLGD 1JWMD 1STGA 3HP3A 4C1NI 2M00A 4BA1I 4DR7Q 4DF7A 3CAMA 3GD7A 2V9WA 1AE2A 2UVWA 2EYHA 3Q6SA 4HQ6A 4K2KA 1Y8NB 4N8FA 4RWSC 4DAPA 4CDCC 1BO0A 4Q0FA 1IBLL 4ZOLF 1F2LA 1TWGH 2ZXOA 3HKZE 4B9XA 5C8YF 4PMBA 1WD0A 5CAEB 3TIGA 1N34L 4J9RA 5JJIA 2BR0A 4DR1Q 5IYBH 4A3DH 1H9JA 3NTKA 3I7FA 3MA2B 4UCTA 2CZGA 3MFGA 4RHRA 4IHJF 4BBSH 3AYHB 1RIPA 2KUMA 2DY7A 3TIIA 2QEXA 1RJTA 3HKSA 4I7ZC 2R7KA 2WB1E 3ER0A 3M9OB 4L8JA 3CC4A 1TS4A 1J9OA 4RG1A 3K7UC 4O3OA 4LF5L 1EWHA 2LXKA 1PYWD 2J9GA 5BN4A 1X9NA 2E8GA 3S9WA 3KALA 3KHRA 4UP7A 2HUGA 2PBZA 2Q2HA 4JI7L 2FLLA 4TQUS 3NPPA 3OSPA 2F0KA 5LMUL 3KJOA 3M4OH 2OQKA 3SHLA 4XYLB 3U9OA 5LA6F 4KHPL 2H4OA 1IBLH 1R9TH 1QOHA 2R93H 1SYXB 2KBNA 2B8GA 1DIKA 2N78A 1Y8OB 4B3TQ 2JA6H 2CCZA 1N34H 4I65A 3R23A 3VPBA 4IURA 1PH3A 3A0JA 2VQFL 4DUZQ 4POFA 4BY7G 1QE6A 4IWXA 4A2AA 2XGTA 4DV5L 2RGRA 1PVOA 3IFDA 2EJGC 4JV1A 2HD3A 2OT2A 2UXDH 3U9SA 1YJ9A 3S2DH 4MV4A 5T1IA 4RB2C 1BOSA 2K05A 4CJ0B 2YU9B 4YJ2F 5IGCA 2O5JC 1WTWA 2HQLA 1A3UA 3IG0A 4BY1B 1CSPA 1Z2OX 1I7LA 4V0BA 2DGYA 5IP9H 1QG7A 2SOBA 1DXMA 1RK6A 5C3EG 3Q2OA 2Y0SA 1SFOA 1N32L 4U68A 4XX0B 1RL2A 5IYCG 1B53A 1JCKB 5GROA 1EUDB 1AW7A 4DUYQ 2A69C 3K5OA 4KJOA 4KV6A 4X3UA 4XQJA 5KT2A 3J80c 1AE3A 1IYJB 4RMFA 3OUZA 1QUQA 2P5ZX 5AJ3Q 3EN2A 3J81L 2ZM6Q 2W9CB 1OXSC 2J6UA 3HOYB 2RSOA 2XC9A 1RKNA 2NVQB 5IYDG 3DEOA 4YWMA 3J81i 1KABA 4I7HA 1CQFA 1Q86C 1Q12A 2VQFH 4DR4Q 4F8MA 5GAHC 4DV5H 2JEIA 1JDBB 3G4SA 1TWAA 3GIMA 1YVCA 5C0XJ 2SDFA 3N44B 3BZKA 2IHEA 2ASBA 4NKLA 4XXEA 5EWGA 3LX0A 1JQYD 4MTKA 1CHQD 2F0SA 2Z4IA 1L1OC 1PYBA 5A2QL 4PWQA 4XIGS 4DR3L 2B29A 5KFJA 1N32H 5GONF 4UHVA 3U50C 4IPCA 4JW0A 1VCIA 3AU7A 5D65A 1KNEA 1C30A 4S3SA 2E2IH 2DNEA 4JI0Q 2MQHA 2FPIB 2W6QA 3N6XA 2N49A 4NMZA 1YZ6A 4RUAA 2L12A 4DR7L 1NTGA 1XPUA 1WTPA 5CMDA 4A3KG 2W70A 3H94A 1W96A 1IBMH 3H15A 1K83A 3K5HA 3C46A 1SR3A 3JAMW 2DNCA 2DN8A 4X3KA 3H0GH 5EKIA 5KFVA 4A93H 4P74A 3J81W 5ISRA 2F0DA 5BN3A 3S1QH 1H9SA 2CW0D 2XVSA 1NSNS 2F3WA 3BG3A 1PFMA 4KN7C 5C6AA 1AUVA 4Y8VB 5CBAE 1RJQA 2K01A 3PUYA 3DXJC 4QB4A 2B2TA 3GTPA 5IGFA 3U4VA 4KN4C 3RV3A 4EVOA 1M90C 4RCOA 4HJ7A 4DR3H 4K5VA 3F2DA 5KG2A 4FF1A 5EQ0A 2CKZB 3MXNA 4JYAQ 2R8HA 4APMA 4BWSC 2VY3A 2YRWA 1PZID 1N48A 4RB0A 1Q81C 1B3AA 5TSSA 5J22A 1BXRA 1IL2A 3HOWG 1JR0D 2FLPA 4LFCL 3T1HL 4F4ZA 1V43A 3EA6A 5G3LF 3MVVA 4DXGA 2WKCA 4R4OA 2RBMA 3IFTA 3U4ZA 3S15H 5KFWA 3OUUA 1RF2D 4RHSA 2LKVA 1F2ZA 4RGTA 4IRDA 1TXYA 1UE7A 4JPBW 4DV1L 1B7YB 5FPRA 4BY7B 1KJIA 4IPDA 1TS2A 1V8QA 4GN3B 3W2DA 4X62H 3M85A 1E2WA 1MI2A 1E0BA 2E5LL 2GA4B 3PV0A 3I4OA 2DPJA 2N88A 1QJOA 1AH9A 5CA0F 3KBGA 1JIHA 4DNRB 2CW7A 4GKKL 4YY3L 3RB6A 3PIO3 3IL8A 3OMCA 4KKTA 1TWAB 2VS1A 2LFNA 2R8IA 3HGBA 1PRTB 4LF8Q 2EVBA 1TWFB 2ICIA 5C3EB 1SYFA 2E2JB 1CHPD 3GTOA 4P73A 4X6AH 3K80C 5I9PA 2Q2IA 5IYBG 3GILA 3PR4A 2W8LA 1FD7D 3J80E 4XYOA 5J39A 2B39A 1RODA 2AWNA 2GVAA 1FGBD 2W6ZA 2XCAA 4BBSG 1EEFD 1J8IA 4R4TA 2DZDA 1Q46A 4K8IA 5KFZA 4LWCA 2HHHL 1C9OA 3N43B 5IT9L 5FO8B 1G51A 4HN7A 4GLVB 3R93A 5DQIA 1E24A 2EOTA 3OTOQ 3NBIA 4HR7B 1J5EQ 2R84A 1EUJA 2R7ZA 4HTHA 5KG6A 1TWGA 1CA5A 4H7BA 3CHBD 3BQ0A 2RKSA 2I5HA 4ID6A 3N42B 3OYYA 1YHBA 1HNXQ 2E5LH 2Z4HA 3QWNA 4BBRH 4DR5L 2VQDA 2C22A 1N36L 2M9VA 4KKUA 4YCVA 2ATWA 4YY3H 4GKKH 2ALYB 2AUJD 5D1OB 4AYBA 3OMGA 2R93G 3ZJYC 2VL6A 1IHZA 2WKDA 3CPFA 3PUZA 5JVG3 2JA6G 3WOEA 4NPSA 5JJKA 1JJGA 3QOJA 4LFAQ 3HFZB 4WJWA 3GTPB 4R8UA 4JI8H 2PZTA 4EGVA 4EFEA 2KCNA 5M5WH 3URYA 5I6WA 2LY7A 5DGAA 2UXBH 2B8FA 5KG1A 1SMYD 2CWPA 1V1QA 4PMCA 1CI3M 1A3VA 4A3KB 1RCVD 2JA8H 4QIWA 4E4TA 2AQ3B 4GOPC 1VMCA 4ECRA 5L1JA 5IE8A 4NDXA 2CVRA 5L1LA 2NZOA 1K9MC 4O2DA 4LK1C 3GTJH 4FF2A 5KT7A 4EBEA 4JI2Q 1R9TA 2NVYH 2WAQB 5EAYA 4FF3A 4O3RA 3NQIA 5FLXL 1FL0A 3VMMA 5KT5A 2JA6A 5DLFA 3GTMB 5IT9W 3G48A 4DR5H 1EY9A 2ZJPA 4IOAA 3I73A 1D6EC 1DV1A 3MAQA 4K14A 1WTXA 5CYUA 3MR6A 5LXTF 1U9RA 3ETHA 2EYJA 4JBJA 4GLAC 1ET6A 4LMQD 3K3PA 3M3YH 1EIGA 4RU9A 4J9PA 2EY1A 4B3RQ 1MBYA 4OEMB 1IXRA 1ZEQX 2G9HD 3FEWX 2XD4A 3HOWB 1BCPC 4JK1C 3L9AX 3SK6A 5M5XB 4C56C 4FS1A 3Q8DA 3GTOB 3ERQA 4HCSA 1I6UA 1X3QA 3F1ZA 4MTNA 1Q1EA 3S1RB 5L9XA 3CP0A 1V1OA 4ILWA 3J81j 4LF6L 5FKAC 2HCCA 4B3ML 5KFLA 3MC0B 3ONAB 4TV8F 1LTRD 3GV8B 3W5OA 1D5ZC 4C5BA 4EEYA 1OXTA 2YTYA 4GS3A 2E76C 3HEJA 4DR6L 4EGQA 4EYIB 3D4RA 1I50A 2ZXRA 4R4QA 4HIOA 4B3SQ 5FLXW 1Z47A 2OEOA 2YU9H 1E4FT 4ECZA 3OWFA 3FDTA 4GN4B 4MA0A 1B9NA 4LF8L 2F1MA 1XMQL 3KF8B 1N9WA 4A93G 1D7QA 1AP0A 1GGOA 3R5FA 1DZ1A 4BBSB 1ENAA 1Z6HA 4LF4L 1UNNC 2MJ8A 1RJPA 1CE8A 5DG7A 1LM0A 5FLMH 4CDDC 2E2IA 2EPBA 2PQAA 4KD4A 4KI0A 2MCTA 1DYQA 2R87A 4X66Q 3ND8A 2NVTB 4FS2A 4LF6H 1YNND 2A68D 1KDAA 4A3FG 2MUYA 4B3MH 4J8QA 2NVQH 3PW2A 1KC8C 2R92H 1VQBA 3IRBA 4J9LA 3H0GA 3H4DA 4LW1A 4O0AA 3BA9A 4DR6H 1R9TB 4YAKB 2R93B 1IOVA 4K0KQ 1O80A 2EZVA 1JOQA 2JA6B 3UQ8A 4RNOA 3LNNA 3M4PA 3IKJA 3AFQA 4FP5D 3HRZC 3X3NA 3PW5A 4I4TF 1XMQH 2BE5C 5JJLA 4K5XA 4BS9A 1UUPA 4ECVA 1HNZQ 4CC5A 2BQ3A 3J7AV 3MWEA 3HB9A 1W6KA 1AUXA 4A3LH 4F4XA 4LF4H 4ECXA 1SEBD 3CXCA 4FDBA 4ZKBB 4OWWB 3PR5B 2WB1G 4QUCA 3CCQA 3Q1KA 2EYOA 3S24A 2AQ1B 4AQYQ 2JA7G 4FVMA 5JPMC 1JT8A 4JOIC 5IODA 1EL0A 1IKMA 4RH6A 1A63A 4MIUA 2ASDA 2K04A 2NUAB 1TU2B 3GV6A 2F0FA 1JORA 3QFFA 3E3XA 4Y7NH 4ABNA 1STEA 2AQ4A 4LH7A 4MTDA 3RIZA 4APVA 2F0JA 2EYLA 2VZAA 4OWXB 3AMUA 5M9OA 4IFDI 2W6PA 4O2AF 1KDBA 1X3EA 5JQWA 3QR8A 1NUCA 1EOVA 2AGQA 2WB1A 4C5AA 5KYIA 4QQBX 2KCTA 2F0UA 4NXML 1ZYRD 3LP8A 3VR3A 2R7FA 4BBRG 2NUCA 2J4XA 4ULLA 2NU7B 2K5DA 3L4JA 2R3ZA 4EQNA 2E74C 3JAMc 2KQ3A 4TQRA 2CH4W 1BF4A 2KA7A 4EBDA 5KFPA 1T36A 1PHJA 4RKBA 3J81c 3Q8PB 2F52A 5EKKA 1KNAA 5C0XG 3G6YA 2R85A 4ECYA 1NR2A 2NB0A 3QO2A 3K0XA 1O7ZA 1U4MA 4NXNL 4BY7H 2D5DA 4XQNA 2JA8G 1WI5A 1IBLQ 1B4OA 2DY8A 1KD1C 4LF7L 3TINA 3KLSA 1TS3A 3I72A 1CKMA 4FF4A 1Y1WA 4MNOA 5T1GA 1GOZA 1PZJD 2LS01 1A15A 1W3SA 3UE1A 1N34Q 4DV4H 4A93B 1K8GA 4PMWA 4MV9A 5EWEA 1DOKA 1TWFH 1O7LA 1WJJA 5IYCH 4ECQA 5C4HA 4TVAB 2Z1CA 1F9QA 1RTOA 4RKLA 1HTPA 1SBBB 3R2IA 4HSVA 1WTOA 3LGJA 1P8LA 1CKNA 5ELFA 5C4ZA 3ORRA 2WE6A 4LF5Q 1O75A 5C0XI 4A3FB 1UC8A 3BABA 4GOPA 1KAAA 5IYDH 4JI7Q 3EPIA 3TP8A 5LMUQ 4PDBA 4YAJB 3G6EA 1JC7A 4O3PA 2CWAA 2ZT9C 3OOCA 2JEJA 3RFCA 2NVYA 4L5QA 4PV1C 1BXTA 2F0PA 4KHPQ 1VMPA 4MHEA 4O4IF 1B50A 2P0AA 3NQTA 4RB3C 1XNQL 3C3LA 2LMCB 3M9MB 1K73C 5K36G 1XWEA 4RGOS 4UP8A 4FNFA 1SNPA 1WOCA 2VQFQ 1K3BC 1X6OA 3K81C 4DV5Q 4LFBH 1ML0D 3Q23A 2F0VA 4A3GG 2IBKA 4QW9A 1AN7A 3V4ZA 4FO2A 1HUNA 2DIKA 4YP3A 1MD2D 4X65L 3O13A 4HCEA 3ULPA 3H6MA 1VS0A 3J7YW 4O4LF 5ELNA 1WTRA 2WB1B 1PRTD 2ZJTA 1D1IA 1ZQ7A 3FPPA 2JA7B 2IMWP 4IUNA 4A3MG 3RZOB 2C2DA 1N32Q 4AQYL 2KOLA 5KFBA 1JLLB 4ZRZA 1HR0L 4DL6A 1EY0A 2PMZE 4Y52H 1K1QA 4LUVA 3A7AB 2N3SA 2WP8J 4KD3A 1EZ8A 3DM1A 1B1ZA 4KMUC 1X56A 5FO9B 4JI1H 5FLMG 2W6MA 1RD9D 2AGPA 1PX2A 3AQQA 1IBMQ 3RB0A 4EGJA 1Q7YC 1WD1A 1STBA 4TRDA 5KNBA 2MNAA 2X69A 4FXKC 1S97A 2Q8IB 2IHFA 3RLFA 1S72A 4M7EA 1D1KA 1LUZA 2CQOA 4QL5A 2R92G 5KFDA 2YU9A 1GM5A 4O3SA 4J15A 3NXWA 4ZQIA 1PTOD 2F4IA 3TQYA 4UP9A 4BBRB 4X65H 3RB3A 2UU9H 1SE3A 3JAME 3RGXA 2EY6A 3BJYA 3DHQA 5KFXA 1ILQA 1XXGA 3HOWH 2W9AA 2B2UC 2IT1A 3NTHA 2IY5B 3J81E 2FXQA 1EFID 4DR3Q 2MP1A 4G57A 3GTGB 1FNVA 2VQEL 5IP7H 3GTKH 4A76A 1EY7A 5IT9c 4IUPA 3H09A 1HR0H 5GAGC 3F2UA 1BKBA 1GSHA 2QGQA 1NJIC 5EPKA 3F2CA 3D0FA 5M5YB 3K5NA 2C9OA 2FK2A 2A6EC 2XIGA 1I7NA 2JA8B 4QWAA 4GOPB 2R92A 2JQOA 5M3FH 4YR0A 4C1NK 4RA8A 5JAVA 1GUWA 3R3OA 3D6CA 3GTJB 4Q5VA 3W1BA 3S17B 3HXLA 1TWHH 3R5HA 5BR8L 1HR0W 4JBWA 1HCZA 2NVYB 4IUQA 4R4IA 1IBKL 5T14A 4PG3A 3TP6A 4GKJL 1CQIB 3BDCA 3J7AF 1WTQA 2JA5H 4L6TB 3CW2C 3ORQA 3I8ZA 4CJ2C 4HJAA 5KT6A 2UXDL 5CGKA 5F2DA 2FK1A 1I4PA 3PCOB 3TDQA 4HYKA 1D2BA 2VQEH 3M3YB 4P75A 5JH7F 1TAEA 1NMFA 3A54A 3N8DA 4H02A 3G8CA 3L3OC 1BCPB 2NVTH 4IFDJ 1SROA 4Q0YA 1EYAA 2K33A 4JOIA 4LFCQ 4Q44A 3T1HQ 4EYHB 1STNA 2Q2TA 4POGA 3L4KA 1LTAD 2ASLA 4GN5A 1SNCA 4MV3A 2Z6BA 4DV7L 2K52A 5BR8H 1EZ1A 2F0HA 1IBKH 4DV1Q 1G2TA 2HGSA 1PV4A 4RNMA 4GKJH 4IR9A 2OXPA 4A3GB 2BCOA 2JE6I 2F4VL 4MTEA 2G9DA 2E5LQ 5KFUA 2KENA 3P1HA 1I94H 2CH4A 4A2BA 2FMCA 4YY3Q 1TKWB 4GKKQ 1WVLA 4UCRA 3F8TA 5J3BA 4A3MB 2GPWA 2QILA 2JEFA 3N40P 5LMNH 1JWUD 1SNMA 1VQPA 3I56A 1FNWA 3QOLA 4JI4L 4IAJA 1S0MA 4JI8Q 2EQSA 4AIMA 4A3EG 4ED3A 2L5TA 4JV2A 1II3A 1YJNA 4ZHQF 2UXBQ 5KFQA 3Q8SB 3LWEA 3I4LA 1EU3A 4ED7A 2BH2A 1I6HH 2MO0A 2HHHQ 1KHIA 1VQLA 3DLLA 3T51B 2RDGA 2EDGA 3ULLA 2K5WA 4DV7H 1GVPA 1LTID 1HZAA 2FMAA 4G3IA 4UCSA 3W3AA 4DNIA 4IR1A 1IBML 5EWFA 2DJFC 1VBHA 2R92B 2F4VH 5KFKA 2QYZA 4OXPA 5HURA 1SE8A 1Y8PB 3E0JA 4GZYC 4IALA 4ECUA 3RAXA 2VPQA 4DR5Q 4ED1A 1N36Q 3T4AC 2E2HH 3NK9A 1Z7TA 5LL6S 4MV8A 1CZWA 1TWFA 4YB8B 2F0WA 3DWPA 5KFHA 1G291 2RF4A 2R6FA 3HOVG 3MR3A 1MGSA 3VR5A 5F9LA 3AEVA 4JI4H 2EY2A 4O3QA 3ZYYX 4C2MH 1BBWA 2CW0C 5E4WC 5LYJF 3GTQH 3H4BA 2PZUA 2UUAH 1T9HA 1JWSD 3SR1A 2WIIB 3A7LA 1EIHA 3NP8A 1B44D 4HR7A 1CS0A 3K57A 1BGWA 1B70B 5CV8A 4CC6A 2QW7A 3BA8A 4JUZA 1IYUA 4XT1B 4JI3L 5EGTA 2A69D 2AKWB 1M4VA 2YV5A 4HNVA 2N55A 2E2DC 2FKLA 5KFGA 1GUSA 4F50A 1FJGL 4O1NA 3ND9A 5C5MA 5D1OA 4XDXA 4Y7NB 2WAQG 4FBTA 4OIKA 2VA3A 5KRUA 4X62L 4KHVA 5C1OA 2PI2E 5HGTA 1VQ8A 4WRDA 3G71A 4CKEA 4QWDA 4ECSA 4FU0A 5FJ8H 1KBLA 1VBGA 1LTSD 3GP7A 3K5MA 4HNTA 4FBUA 5GQOA 3V6JA 2HCIA 2ZJRA 3C1FA 1DOLA 1ONLA 2W71A 4IQZA 1BR9A 2O2LD 1A6XA 4A3FH 1CTMA 2AQ2B 1ENCA 5IYZF 4OONA 2XRQD 2F0TA 4G4KA 1QB5D 3BZDB 3MFYA 4YBZB 2B3GA 4DL5A 5A2QW 4OX9H 5KFAA 1K3RA 2VXWA 1CSQA 2A5HA 4F88A 2CQYA 2WAQA 4JI3H 3VPCA 5IP7G 3GTMA 2YCHA 2RCNA 4A3JG 4LF6Q 2PW7A 4IFDH 4C3JG 2RA4A 4JC0A 2XSCA 3GTLH 1WH2A 4B3MQ 3JSLA 1FJGH 4IO9A 2IA6A 3HOZH 1SYCA 3JZIA 4UCVA 3QZ7A 1T5XD 4LF9L 4LNQA 5M3MG 2FE3A 1PDQA 4DR6Q 2GPSA 3PO2H 1V1PB 4HMJA 5M3FG 3CD6A 2J6SA 1LV9A 1PLFA 1FGUA 1Q90A 3GIIA 1V4YA 4EX5A 5JEAJ 1XJVA 3WO1A 4MA5A 1LYLA 2W8KA 2XRSD 2B2UA 2JA7H 4A3EB 1XMQQ 1JICA 1YNJC 1MJEA 3RZOH 2RSNA 1PH4A 1KJ9A 2JA5G 3GTKA 5E4XA 4M1UB 4GC7A 4JI8L 1YJWA 3GLKA 1LLRD 4LF4Q 1FR3A 4YHHH 5JUMA 1B9MA 3TZUA 2HVSA 1NBWA 4JG2A 4WJ3M 1MSGA 2UXBL 2I46A 4O2BF 2XN9C 5IWAL 2I80A 2QA4A 1M6VA 5KNDA 4GLXA 2NU9B 3KTMA 2QCPX 4DA2A 4YJ3F 4ETSA 3MEHA 1D5XC 4MAMA 2EYMA 1KIXA 1JX4A 3BYTB 1TWHA 2Q8TA 4LF9H 2A19A 3CCMA 5IGDA 3OHXC 2JYOA 3RJ0A 2PPBC 2VNUD 1BUVT 2XGPA 2PW5A 3T1YL 1S5DD 2LXJA 1WCMG 4DKAC 2YS6A 1H95A 3HOVB 5EOYA 5EBCA 5D1PA 1QVGA 4ZQ3A 4XZ3B 3KF8A 5CR3A 3LWBA 3TREA 5CA1F 4RAZA 1C4QA 3IAYA 1F9SA 3T16A 4A3BG 3GTGH 4HJ8A 2FB9A 2FJZA 1SE2A 5DQHA 5C0XH 1WSCA 1BDOA 3K0YA 2UUBL 4YR3A 4B3TH 1XTCD 3UI2A 1JJ2A 4OO1G 4LUOA 1HNWH 3MWYW 5M5YH 5IWAH 2KEDA 1IL8A 1PH8A 2IL8A 1EQRA 1L0YB 1KQSA 3VR4A 1STYA 2JA9A 2IX1A 4R8NA 3D4WA 4AH6A 2ES2A 3S17H 1K28A 3OIPA 4DK0A 2R93A 4MZ9A 1PMRA 1LABA 2J7ZA 4WJ4A 1DV2A 4MV7A 4TV9F 2L15A 3SE0A 4XYQA 1L2ZA 2XIWA 2K14A 4P2CB 4YR2A 3P7JA 5DNFA 3T1YH 5DG9A 3CCLA 3BG5A 1N33L 4EQPA 1YIJA 5I47A 4DV0L 4DR2L 2XWJB 4HSPA 3A74A 3T13A 3A56A 1SNDA 3CU7A 5KFEA 4DL3A 1QNUA 1I4RA 2ZM6H 3MTSA 2QDBA 2Y0SE 2O5IC 5C44H 1EYGA 1E1OA 2UUBH 4ME6A 4NXMQ 2CQAA 3NELA 5E7NA 1JMCA 5C1PA 4KY5A 3BAAA 4OO1I 4L5SA 3EBEA 2JN4A 3NTIA 1SLJA 4UAIA 1EUCB 4R8IA 3F8NA 4DR4H 1VQEA 1ASYA 3S16H 2RDJA 3PW0A 2F0LA 3GTKB 1S68A 2QKIC 2Q2UA 4A3JB 1XNRH 1GJXA 1V9PA 4C3JB 2VPSA 1Y14B 2JEBI 2PVPA 1XX8A 1CFMA 5K36H 2UVUA 4Q8EA 3CCEA 1A8VA 4XTCS 4WD3A 4NXNQ 3KF6A 2C2RA 5M3MB 3HOUG 5I9OA 4A3GH 5J2TF 1Q3LA 3WWVA 5M3FB 3FMCA 1N33H 4LF7Q 3CCUA 4DV0H 4DR2H 3GV7B 5D3IB 2ICEC 3WNZA 4RB1A 1TWHB 1LT5D 2E2HA 3PUVA 2K50A 1CM9A 1BQQT 1SEIA 1GXDC 4A3MH 1QWYA 3SXHA 2JA5B 1A9XA 4HJ9A 4FM9A 5ELOA 1RJRA 2ATLA 3VR6A 4C2MA 1Y1VH 4DFAA 3I55A 1S9FA 3GTQA 5EJWA 3P20A 5JEAH 3J80L 5EBDA 2YTXA 4ZLTF 2IJ0A 4CKBA 4IPGA 1HZCA 1KRSA 5L1KA 3DEPA 5FJ8G 4DV6L 2AMCB 3J80i 4JI6L 3TS2A 1BCPD 4LJZC 2HJWA 1EHIA 2NN6G 3S2HH 3DF7A 1PH7A 3N41B 4XQQA 2V4RA 2PYKA 1PK8A 5KFTA 3K7AH 3M7GA 3QB3A 1SJHD 1S10A 2OTJA 1OXUA 4IUVA 1WCMB 1VDZA 1AEXA 1RHPA 1XNQQ 5JPNC 4M8AA 3F2BA 3KLRA 3SDZA 3TZDA 3T56B 1SSOA 4A3CH 4RAYA 1O7YA 2W6NA 4A3BB 2JP1A 1KJJA 3HKZG 3CC2A 2NVXB 2KHJA 4IFDG 1MSHA 2HIXA 5NUCA 5HV6A 1PFNA 1GUGA 5CB4F 3RD4A 3HOZG 5JVDF 1YBYA 4PZ7A 3OWEB 3NWTA 1F2YA 4EQOA 1M1KC 4X65Q 5JVH3 4X3SA 2UU9Q 4ZYSA 1SNOA 5F9NA 4Q43A 3CCRA 1RYSA 2SCUB 3PO2G 1LT3D 1ZXTA 2HDLA 1GHJA 2ZTDA 1I4GA 4IUTA 5JVLA 3RBDA 2K5NA 2MPMA 3K6OA 4KJNA 5LHY1 3H40A 4DV6H 1TWCH 4RCNA 4JI6H 1EOTA 2NN6I 2WACA 3BU2A 2H5XA 1SMXA 1EQQA 1MIUA 4WFN3 1HR0Q 3E9IA 3RMHA 2MFIA 3R8BA 1NR4A 5DQGA 3CPWA 2QDLA 4XYMB 3HKZA 1SE4A 2NU6B 1I6HB 2UXCL 3GTLA 3EROA 2KEEA 1EY4A 2L0CA 3DMUA 3KBXA 3V4SA 2ZTCA 5KGUA 3GIDA 3VA7A 2NTSA 4FYDA 1EFWA 5GADC 4A3IG 1NY4A 3KF6B 3CQZH 3K3VA 1KAWA 1SNQA 3M4YA 1UNSA 1VQHA 2L9HA 4QW8A 2JSOA 4I50F 3E0EA 5KG3A 4DV4L 2VUGA 3BDOA 5DEHA 2E2HB 1J5EH 2JA7A 3U9TA 3T5KA 4C3IH 3M4QA 3M7NA 1IW7C 1YITA 3G6JB 3CC7A 2LSSA 4QWEA 2K5VA 4NB3A 3PUXA 4DK3C 3STBC 2ALZA 1EQVA 2D0OA 5KFFA 2FMMA 4N9PA 2BE5D 5C3XA 2VQEQ 2X6LA 2YZGA 2ZJQA 1F9RA 3FP9A 3M4IA 4C2MB 3GTQB 5LL6X 4IPHA 1HA5A 3I2ZA 1XMOL 3HOUB 1B2TA 4H44C 1ZKOA 2PMZB 3MZ5A 2UXCH 3NENA 3TS0A 4QF4A 1E1TA 3PF4A 4WORA 3RB4A 5KG0A 3JSNA 4AYBE 4IUUA 3RN5A 4BA2I 1B6SA 1NCVA 1A3TA 1X55A 4RGMA 5BR8Q 1UC9A 3Q8RB 2BQRA 1RK5A 1IBKQ 1UE5A 3Q22A 2A1AA 1I4QA 4GKJQ 2I8CA 1HZBA 2A6HC 3BZCA 3SGIA 1DOMA 2R7LA 2BOSA 1C7YA 1T94A 3MJFA 4A3EH 4LFBL 1I94Q 4JI2H 3GTGA 2NWGA 2UXDQ 2A73B 3WOFA 1XDNA 1BBXC 4JV5H 4IZ8A 4QIWE 1ZHSA 2R8KA 3MR5A 4CDFC 3VDYA 2C00A 2Z0SA 1K0SA 3KYHC 3D6WA 5LMNQ 4JBMA 1B33N 2HT1A 3VYTA 1XMOH 5C44G 1ZETA 3N6RA 1GUTA 4EBCA 1UE1A 3FKIH 1DM0B 1JJCB 3VR2A 3GTJA 1ENFA 2R82A 5KG4A 2XWBB 1JDEA 4QWCA 4X64L 3ETJA 1X65A 5CBEE 4DV7Q 2YL2A 5COYA 2UUCH 3HKZB 4JI1L 1VF7A 3HOVH 3GTLB 3ICEA 3QZ8A 1KXLA 3Q8QB 1LT4D 4K8JA 1SAPA 2F4VQ 3HOZB 1EEID 3NBHA 4P72A 5C3WA 2CW8A 2SNMA 3OIQA 4UFZA 3OHAA 4PNYA 1S4ZA 1U4RA 2K75A 3K58A 3H3VC 3PO2B 4F7XA 4ZUIA 1ILPA 2CFMA 1ASZA 2UU9L 3SEBA 1NNXA 3A8IE 4F4WA 3TSSA 3MXGA 3PVXA 3FRPB 4IRKA 1X54A 1OO9B 1QVCA 2PO4A 2KCMA 4DAYA 1QCBD 3Q0AA 4DV2L 3MWMA 4O4HF 4JI4Q 2KCCA 3C1EA 4UCOA 4DPGA 2RHSB 1Y69U 3NSWA 4OHJA 2YYAA 4TKOB 4R4CA 2AWOA 2UUAQ 4NP5A 3KXYT 3EVQA 1Y1VG 3BJUA 3MEFA 2XNAC 5G3LD 4DK1A 4X64H 5JEAG 5FO7B 4JV0A 3V2TA 5I2YA 3TN2A 4A3IB 1L2FA 3PIPA 2NTTA 4QUFA 3PGZA 1S40A 2IP4A 3QG1A 1EIYB 4ZKCB 1G91A 4QY7A 3PF5A 1CQVA 2PNRC 1I3QH 4O3NA 1JE4A 1GLVA 1JKJB 4ECTA 2W7OA 1Q1BA 5AFWA 2IWHA 4N8X1 5H80A 2R86A 4X66H 2W6OA 1O7IA 3KHHA 1UWVA 3IN5A 3EIVA 4OWTB 1OXXK 3AB9A 4EG0A 2H1EA 1WTVA 1GYFA 5HBRB 1S03G 1Y1VA 4A3CG 1I6VC 4DV2H 3JRXA 5CC4A 1EYCA 2WINB 2RDIA 1ZHQA 1VQIA 4K0KH 2QEJC 4QWBA 4A3JH 3KAKA 4C3JH 3SK8A 2Q8RE 1T3NA 1ET9A 2AU0A 1Z2NX 2V4QA 3CMAA 4K6DA 2K32A 5M3MH 4J1MA 1L0XB 4B9WA 1W6JA 4JI3Q 1R4QB 4XT3B 1LTLA 1SXTA 2EXDA 3NE5B 4QMGA 5A2QE 3EPGA 1FJGQ 3ULJA 1X3PA 4IN3A 3VYRA 4EFBA 3PZPA 1X32A 1UAPA 4X62Q 3JRWA 3BVMA 1AFPA 2NU8B 2D62A 2DUDA 5A35A 1PFBA 2AUKA 1I94L 5BPFA 5C5JA 3NBHB 1I5FA 4OL7A 2W9BB 1H9MA 5CV9A 5J2UF 1QILA 3RUPA 1HQMC 5KX5F 1N8RC 3VA5A 5FOBB 5C44B 4J6HA 3A5UA 2EJMA 3K59A 3RTXA 3S1NB 1TIID 2R7ZH 5LMNL 1VQJA 1TWCA 4NLGA 2FJ2A 4DXFA 3N52A 2SNSA 4DL2A 4OIJA 5JOBA 4PZ6A 3ERSX 4KY7A 4J9NA 4YHHQ 2DPIA 4C3IG 1T5EA 4DAYB 1RDPD 3S16B 2F0MA 3DWQA 1TA8A 3RUZA 3J7A5 5DAUA 1TQOA 3R2TA 1A2TA 4KTAA 1N56A 5FLXc 1CKOA 4JI5H 2IW3A 3AFPA 1WCMH 1LTTD 4GNXC 2YYZA 3C0FB 4J9KA 4G7OC 5D8DA 1LT6D 2W57A 1K8OA 2A6ED 3RNUA 1S5FD 3V6HA 4A3BH 4DAMA 2L55A 2NVXH 2F0GA 4LF9Q 3CQZA 3NHHA 3M9NB 1K8AC 4HMIA 1CQJB 3PW4A 4X3TA 1Q8IA 1MKHA 4GC6A 4DV3L 5L1IA 4OO1H 1LTBD 1VF5C 1EWCA 5KFSA 3MR2A 1BNCA 2I0QA 1A2UA 3CKIB 1JB3A 1B6RA 3NWSA 1K8MA 3E5SA 1W2BA 2KECA 2Y0SG 2PQEA 4RGNA 2PN1A 3UDGA 1EU4A 2X6GA 2KHIA 1Y1VB 5HY6A 5LL6b 4DL7A 5EZYF 2UUAL 3PQIA 1HNWQ 4IWYA 3D3RA 4QCLA 2B2VC 3GIKA 2Z8LA 5C4XH 2O03A 2Z9HA 5IWAQ 2AGOA 3V05A 1TY2A 5LMNW 2J0TD 2JXMB 4R9WA 3KUPA 2RQXA 3SK4A 1KC7A 3Q24A 2JK8A 1HA6A 2GN5A 2YTVA 1VQ4A 3S2HB 3NGDA 3KAJA 2HVQA 4BXXH 3K7AB 4LF5H 1M0TA 1V1PA 2BA0A 5JJZA 1S0NA 2PZWA 3FKIG 5H1SE 2UVVA 5IGEA 3T1YQ 4JI7H 2OF1A 3RN2A 4DV3H 2QK4A 3NEMA 1IYVA 5LMUH 3QIAA 3JAML 1PA6A 4PZ8A 4UPAA 3T5HA 1M8AA 4UDUC 1SDFA 3VYSA 1PH1A 4MV6A 1PFSA 2CHBD 1VQKA 3I4NG 3RAQA 2R8JA 1D8LA 5IT9E 4KHPH 1GSOA 4KY6A 3I4MH 3TMEA 3T5LA 3JAMi 1EWIA 5KNCA 2BDNA 2UUBQ 4C3HH 1QVFA 3UE0A 3KJPA 1Z9FA 2IX0A 3CVZA 1SCUB 3HOUH 1SYBA 1S5BD 2HVRA 3FKIA 2MHVA 5J1ZA 3S1MH 3CMEA 4CHTB 1VQMA 3HG9A 4LSXA 1TWCB 1I50H 3BVZA 4UCUA 4QJFA 1A62A 3MHBA 2ZXPA 4OX9L 1DJRD 1XNRQ 4U7CA 3RLOA 4M9UA 3KFUA 1UE6A 3I12A 5CV6A 4R7RA 1KLUD 4L63B 4WBNF 5DG8A 3GO5A 2BDOA 2VB2X 1OTCA 4MV1A 1AZPA 2VUMH 1N33Q 2B63H 1PH2A 4DV0Q 4DR2Q 4L5TA 3CQZB 1GUOA 5EDWA 1E2VA 2OH2A 1V51A 1ICFB 3A55A 1B3QA 4Z9CB 1F77A 3BQ2A 1C3OA 2XGQA 2NN6H 3H3VI 4C3IB 4EQ5A 1EY5A 1TY0A 5CV7A 5FLXE 3HOXH 2DJGC 2Z6KC 4YHHL 1Q82C 4ME5A 4DR1L 1PXUA 2BH8A 4RZRA 2ZDHA 1WYDA 2A74C 2I5LX 5BPHA 4J9SA 1G2SA 3UDXA 3J7ZC 1EY8A 1VKZA 1BVSA 4G7ZC 3OW2A 1IKLA 1PRTF 3I91A 3RGZA 5IOCA 1CZGA 1I3QA 4Q45A 5IIFA 2C5CA 2C35B 3DWAA 2ID0A 4JBKA 1S3OA 3BS1A 2I5MX 1KJQA 4G7HC 4PQXA 3A8KE 5EPLA 1I4XA 4YCUA 4DLKA 5EPJA 3W1GA 4ED2A 4U6PA 4DR7H 5BN5A 3H91A 2Y0SB 1SFOB 4RZQA 3D8GA 3V6KA 5C5LA 5L37A 3KHGA 3P75A 3PO3H 4HNUA 2O4XA 1R4PB 3M9BA 1QUQB 3RBEA 4B3TL 3TRZA 1HXYD 2BQUA 3OSOA 2D2CC 3RZDH 1VQFA 4LMYA 4DR1H 3A8JE 1TS5A 3KOJA 1S0OA 4DUZL 1HNWL 1FNUA 3G7LA 3PMFA 2JJQA 1NE3A 4DV6Q 1AN8A 4JI6Q 2K5HA 4A3IH 1PTOF 2SEBD 1QNKA 3BVGA 2KSWA 5KFIA 3K5LA 2F03A 2R7ZG 2FP4B 3FKIB 2HDMA 1LTGD 5KYLA 1EIFA 4QGUA 1SMYC 4KHZA 4C5CA 5C4JH 1VQ7A 2FLNA 4A3DG 3MXUA 3QJYA 2EYFA 4P71A 4AYBG 1P16A 1DD2A 4ED6A 2JA5A 4KKSA 3I4NB 4LFCH 3MWDA 4MN3A 1BBUA 3T1HH 4DUYL 3SE7A 4LAAA 3GV3A 2NBFA 2C28A 2VR1A 5AJ3L 1ICWA 2ASJA 3KDFA 2ZM6L 1DCZA 2R7NA 2DLNA 3HZXA 2VOBA 4DV1H 2I07B 3HBLA 3EQLC 5KEEA 1KJ8A 5DGBA 1H9RA 3CCSA 4R1JA 4N9TA 3G6XA 4Q8FA 1YNJD 4DUZH 1K83B 2M05A 4DR4L 3TQ1A 2QF7A 5KT4A 1M7JA 3L7ZC 1XTDA 1Y1WH 1ESFA 1PTOB 2FHTA 1B8AA 1BJTA 1WCMA 5FK9C 1XNRL 4TUYF 3I70A 5GAEC 4K2LA 3I3CA 4K5WA 1CUKA 5DLQE 1H9SB 5ELBA 4HEDA 4GNXA 2YS7A 2UXCQ 4DK6C 2XCPA 4H13C 3CRLC 1GD7A 1VQCA 2GLTA 5KKNB 1K0RA 3PUWA 5IGBA 1VAJA 2B2WC 1M0WA 1WR2A 2NVXA 5C4XG 1D5MC 1OWTA 2RDHA
chains in the Genus database with same CATH topology
4XIGS 3E0EA 4DR3L 4DV4L 1YEZA 5HGQA 2AHOB 3MXNB 3HOWH 2B29A 2IT1A 2F3IA 2IY5B 2FXQA 2RHQB 4JI0L 4DR3Q 4C3IH 3U50C 3M4QA 4DV4Q 3M7NA 2WFWA 4IPCA 1VCIA 2VQEL 5IP7H 3CC7A 1YITA 4A76A 2LSSA 3GTKH 2K5VA 3KLWA 3PUXA 4NB3A 4DK3C 5IT9c 2E2IH 3STBC 4JI0Q 5IP9G 2MQHA 3D31A 3S1NH 3CCJA 2D0OA 2N49A 1YZ6A 5GAGC 2VQEQ 1BKBA 4DR7L 2QGQA 1NTGA 1NJIC 4JV5Q 2ZJQA 3FP9A 1XPUA 3F2CA 4A3KG 3D0FA 3H15A 4HIKA 4KLKA 4IPHA 3I2ZA 1XMOL 4GOPB 1SR3A 2VW9A 2JQOA 1VQOA 5M3FH 1HZ9A 1SN8A 3H0GH 3NENA 3I4MG 1XMOQ 3TS0A 3W1BA 3L2PA 1E1TA 3PF4A 1TWHH 4A93H 4P74A 5BR8L 1HR0W 3S1QH 4JBWA 4R4IA 3K8AA 4AYBE 1IBKL 3RN5A 4BA2I 3L0OA 4PG3A 4GKJL 1NMGA 1X55A 3PUYA 5BR8Q 3U4VA 2JA5H 4HJ5A 1IBKQ 4JYAL 3DM3A 1UE5A 2A1AA 1M90C 4GKJQ 3CW2C 4HJ7A 1HZBA 3SGIA 3BZCA 4ME3A 3F2DA 1Q8KA 4HJAA 2UUCQ 2CKZB 2UXDL 4YWLA 4JYAQ 1C7YA 2R7DA 2VY3A 4A3EH 4LFBL 1I94Q 1G6PA 3PCOB 1Q81C 1YNXA 2UXDQ 4P75A 4QIWE 1NMFA 1IL2A 1J6QA 4LFBQ 3HOWG 3VDYA 4H02A 4LFCL 2VUMG 2Z0SA 3T1HL 1V43A 2MO1A 3KYHC 5LMNQ 4JBMA 2B63G 2NVTH 1SROA 4IFDJ 1X3GA 1VQGA 2HT1A 4R4OA 4JOIA 3U4ZA 4A75A 3U58A 4LFCQ 5C44G 3S15H 3KDFB 3T1HQ 2Q2TA 4POGA 1TXYA 1UE1A 3FKIH 1UE7A 3B6YA 1B7YB 1JJCB 4GN5A 4DV1L 4DV7L 4IJHA 4IPDA 2K52A 4GN3B 3M85A 1A0IA 4X64L 4DV1Q 1X65A 2E5LL 1PV4A 4DV7Q 2JEAI 3PV0A 3I4OA 3HOXG 1AH9A 2JE6I 4BY1H 3H0GG 2F4VL 4GKKL 4YY3L 4JI1L 4X64Q 4JCVE 2E5LQ 2KENA 2A8VA 3HOVH 3ICEA 1KXLA 2V1CC 3PIOA 2VS1A 2F4VQ 4P72A 4GNXB 4LF8Q 4GKKQ 4YY3Q 4JI1Q 3F8TA 2K75A 5J3BA 4P73A 4X6AH 3K80C 2R6GA 2Q2IA 5IYBG 2CFMA 1ASZA 2UU9L 1GO3E 1VQPA 2AWNA 2GVAA 3I56A 1E7ZA 4JI4L 4JI8Q 4BBSG 2EQSA 4AIMA 4A3EG 3HOYH 1X54A 4R4TA 1Q46A 1KRTA 4LWCA 2HHHL 1QVCA 4DV2L 2KCMA 3OTOL 1C9OA 1J5EL 1S72A 1YJNA 1G51A 4JI4Q 2UXBQ 2WAQE 4DPGA 2RHSB 2BH2A 1I6HH 4GLVB 2MO0A 3RLNA 2HHHQ 4DV2Q 1KHIA 1E24A 4R4CA 2AWOA 3OTOQ 3DLLA 1J5EQ 1HNXL 1VQLA 3ULLA 1EUJA 2UUAQ 3CF5A 1GVPA 2Z6KA 1Y1VG 3BJUA 1HZAA 3MEFA 2I5HA 3OYYA 1YHBA 4IJLA 5JEAG 4DNIA 1HNXQ 1IBML 3PO3G 1L2FA 4BBRH 3PIPA 4DR5L 1N36L 3PGZA 1SRUA 4YCVA 4OXPA 2ATWA 1S40A 1SE8A 2ALYB 1EIYB 2R93G 3ZJYC 4QY7A 4LFAL 4DR5Q 3PF5A 2VL6A 1N36Q 1I3QH 2E2HH 3CPFA 3PUZA 2JA6G 5JJKA 4NPSA 1JJGA 1Q1BA 4LFAQ 3HFZB 1G291 1X3FA 2RF4A 1YHQA 1O7IA 3HOVG 1UWVA 5IY0A 3EIVA 3PSIA 5M5WH 4OWTB 1OXXK 3AEVA 4HIMA 4C2MH 1BBWA 2CWPA 1V1QA 3GTQH 4A3CG 2JA8H 4GOPC 4JI2L 5IE8A 1GKHA 1T9HA 1VQIA 2NZOA 4JV5L 1K9MC 4O2DA 3GTJH 4A3JH 1FVIA 4C3JH 2N8NA 1E22A 4JI2Q 1DGSA 1B70B 2GVBA 2NVYH 5EAYA 3E9HA 1FL0A 4JI3L 3CMAA 2XTIA 1VQAA 5M3MH 2AKWB 3G48A 2YV5A 2ZJPA 4IOAA 4JI3Q 1FJGL 1U5KA 1LTLA 2WAQG 2EXDA 4ALPA 4JI5Q 4B3RL 4X62L 4JBJA 2PI2E 4IOCA 1FJGQ 4GLAC 3ULJA 1VQ8A 1Y1WG 3G71A 3M3YH 3TEHB 4B3RQ 4X62Q 1HJPA 2UUCL 1IXRA 1QZHA 5FJ8H 2K4KA 2D62A 2HIVA 2DUDA 5GQOA 1I94L 2ZJRA 1OXVA 1I5FA 3NBHB 2OCEA 1SFOH 2OWOA 2BA1A 4A3FH 1N8RC 3Q8DA 1PH5A 4OONA 4LUZA 3F1ZA 4MTNA 3A5UA 1Q1EA 2PQAB 4UY8C 2R7ZH 5LMNL 1VQJA 2B3GA 3CP0A 1JE5A 1K3RA 3J81j 4PZ6A 4LF6L 1CSQA 3ERSX 1HH2P 4YHHQ 1JB7A 4DAYB 4B3ML 5IP7G 3J7A5 1PH9A 3W5OA 2RCNA 4A3JG 5FLXc 1CKOA 3STBD 4LF6Q 3GTLH 4JC0A 1VQ5A 3AFPA 1OXTA 1WCMH 2YTYA 1TWAH 4GS3A 4IO9A 4B3SL 4B3MQ 3HOZH 4DR6L 4GNXC 2YYZA 1XPOA 4LF9L 5C3EH 2E2JH 4LNQA 5M3MG 4R4QA 4YWKA 4HIOA 3RNUA 1Z47A 4B3SQ 2PNHA 2YU9H 4DR6Q 3PO2H 5M3FG 4A3BH 4DAMA 4GN4B 2NVXH 4LF9Q 3CD6A 1FGUA 1YHAA 3UDIA 1PYSB 3FHWA 1K8AC 4LF8L 3RR5A 4EX5A 1XMQL 3KF8B 1L1OA 1N9WA 5JEAJ 1XJVA 3I4NH 4A93G 1LYLA 1MKHA 1D7QA 2OQ0A 4DV3L 2OTLA 4A4IA 2JA7H 1XMQQ 4LF4L 1MJEA 1IZ6A 5GADC 2I0QA 3RZOH 1PH4A 4DV3Q 2JA5G 4X66L 3H3VH 1LM0A 4JI8L 5FLMH 1YJWA 4LF4Q 2PQAA 1W2BA 4KI0A 2Y0SG 1NBWA 4X66Q 4JG2A 3UDGA 4WJ3M 2UXBL 1L0WA 2KHIA 5HY6A 4A3FG 1K83H 5IWAL 1MJCA 3UDFA 2NVQH 2QA4A 1KC8C 2UUAL 2R92H 1HNWQ 4GLXA 1VQBA 3IRBA 1WFQA 5C4XH 4K0KL 5IWAQ 4LW1A 4O0AA 5LMNW 1KIXA 2JK8A 4HIDA 2A19A 3CCMA 4K0KQ 2GN5A 2YTVA 3CCVA 1VQ4A 2VNUD 3GTPH 2EIFA 3M4PA 4BXXH 3AFQA 3T1YL 2BA0A 2LXJA 4DKAC 1WCMG 3FKIG 5H1SE 1H95A 1HNZL 1E3PA 2NZHA 1XPRA 3GDEA 1QVGA 2PI2A 3TREA 3T1YQ 5JJLA 3RN2A 4YCWA 1HNZQ 3NEMA 4A3KH 1VQ9A 3A5ZB 4A3BG 1PA6A 4PZ8A 4UPAA 3GTGH 4HJ8A 4A3LH 3CXCA 4BY1G 2D0PA 1PH1A 1VQNA 1PFSA 1VQKA 2UUBL 4FDBA 4OWWB 3I4NG 1D8LA 2WB1G 3CCQA 3I4MH 3S24A 3JAMi 1EWIA 1JJ2A 4OO1G 4AQYQ 2JA7G 4LUOA 2UUBQ 1KL9A 4C3HH 1QVFA 1JT8A 5M5YH 4JOIC 3UE0A 3GTMH 3KJPA 1Z9FA 2IX0A 1PH8A 1A63A 1C0AA 1EQRA 3HOUH 1PH6A 1KQSA 3S1MH 1QZGA 3CMEA 2JA9A 2IX1A 4AH6A 4Y7NH 1VQMA 2ES2A 3S17H 1I50H 3HOYG 4MZ9A 1A62A 4QJFA 4OX9L 4WJ4A 1XNRQ 2L15A 3RLOA 4APVA 3KFUA 1UE6A 2VZAA 4OWXB 2K14A 4IFDI 1X3EA 4OX9Q 3CCLA 1YI2A 1N33L 1EOVA 3GO5A 4JI5L 1YIJA 4DV0L 4DR2L 1OTCA 1U0LA 2VUMH 3A74A 1N33Q 5M5XH 1VQ6A 4QQBX 2KCTA 1PH2A 4NXML 3JC66 2B63H 4DV0Q 2ZTEA 4DR2Q 3GTOH 4L5TA 2R7FA 2Y0SE 4BBRG 5C44H 1EYGA 1E1OA 4NXMQ 3NELA 1UEBA 5E7NA 3JAMc 1JMCA 3S1RH 3S14H 1VQDA 1L1OB 1CKNB 4L5RC 4OO1I 4L5SA 3EBEA 1SLJA 4A3LG 1PHJA 1VQEA 3J81c 1ASYA 4BA1I 2F52A 3S16H 4DR7Q 3H3VI 5C0XG 3CAMA 4EQ5A 3GD7A 1AE2A 3HOXH 2Q2UA 3K0XA 1V9PA 4NXNL 2Z6KC 4YHHL 1IBLL 1Y14B 2JEBI 1TWGH 3HKZE 1Q82C 4BY7H 4DR1L 2BH8A 3CCEA 1A8VA 4XTCS 2JA8G 4NXNQ 1WI5A 1IBLQ 3KF6A 1N34L 1WYDA 1KD1C 4LF7L 3HOUG 2I5LX 5JJIA 4A3GH 4DR1Q 1CKMA 3WWVA 5IYBH 3UDXA 3J7ZC 4A3DH 1BVSA 4MNOA 4LF7Q 3CCUA 3I7FA 3UE1A 3OW2A 1N34Q 1W3SA 1K8GA 4PMWA 4BBSH 3AYHB 1RIPA 1TWFH 2QEXA 3HKSA 3PUVA 2C35B 2K50A 2WB1E 3ER0A 2ID0A 4JBKA 1S3OA 3CC4A 1WJJA 2I5MX 5IYCH 4A3MH 4TVAB 4RG1A 3K7UC 4LF5L 2LXKA 4YCUA 1X9NA 2E8GA 4HJ9A 3W1GA 3LGJA 5ELOA 1P8LA 4UP7A 1CKNA 4LF5Q 2Q2HA 4JI7L 1Y1VH 3I55A 4TQUS 5LMUL 5C0XI 3KJOA 3M4OH 2YTXA 2OQKA 4GOPA 3PO3H 4JI7Q 4IPGA 5IYDH 1HZCA 1KRSA 3M9BA 1QUQB 5FJ8G 5LMUQ 4KHPL 4B3TL 3G6EA 3TRZA 4DV6L 2AMCB 2CWAA 3J80i 1R9TH 4JI6L 3TS2A 3RZDH 1VQFA 2KBNA 4BXXG 2N78A 2NN6G 3KOJA 2R93H 4L5QA 4DUZL 3S2HH 4KHPQ 1HNWL 4B3TQ 2JA6H 2JJQA 1NE3A 4DV6Q 1PH7A 2CCZA 4JI6Q 2K5HA 3K7AH 1XNQL 4A3IH 2OTJA 1PH3A 3A0JA 2VQFL 4DUZQ 4POFA 1OXUA 2R7ZG 4BY7G 2XGTA 4DV5L 1K73C 1PVOA 5K36G 4UP8A 1XNQQ 3F2BA 1EIFA 1YJ9A 3S2DH 1WOCA 2VQFQ 4QGUA 1X6OA 3K81C 4KHZA 4DV5Q 4A3GG 4A3CH 5C4JH 1VQ7A 2HQLA 4A3DG 3HKZG 3CC2A 2KHJA 4IFDG 4AYBG 4P71A 4X65L 1CSPA 1P16A 2HIXA 3ULPA 1VS0A 5ELNA 3HOZG 1YBYA 2DGYA 4PZ7A 1BBUA 5IP9H 4DUYL 1M1KC 5C3EG 2UU9Q 4X65Q 1N32L 3CCRA 1RL2A 5IYCG 5GROA 4A3MG 3PO2G 5AJ3L 4DUYQ 3KDFA 2ZM6L 1N32Q 2ZTDA 4AQYL 3J80c 1AE3A 1IYJB 2K5NA 4RMFA 1QUQA 5AJ3Q 1TWCH 3EN2A 2ZM6Q 1HR0L 3CCSA 2NN6I 4R1JA 1OXSC 2PMZE 2H5XA 3BU2A 4Y52H 1SMXA 1EQQA 1MIUA 4LUVA 4DR4L 2N3SA 2WP8J 1HR0Q 3E9IA 5IYDG 1X56A 2MFIA 3L7ZC 4YWMA 3J81i 1XTDA 3CPWA 5FLMG 1Y1WH 1Q86C 1Q12A 1B8AA 3AQQA 1IBMQ 4DR4Q 5GAHC 2UXCL 1Q7YC 1XNRL 3G4SA 2ZTCA 5GAEC 1YVCA 5DLQE 5C0XJ 1CUKA 2MNAA 4GNXA 3BZKA 2UXCQ 2IHEA 2ASBA 2IHFA 4DK6C 1EFWA 3RLFA 1GD7A 1VQCA 1LUZA 2CQOA 1K0RA 1NY4A 3KF6B 3PUWA 4QL5A 4A3IG 1GM5A 3CQZH 4J15A 2R92G 1KAWA 3TQYA 4UP9A 1VQHA 5C4XG 1L1OC 1PYBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XIG S;  3E0E A;  4DR3 L;  4DV4 L;  1YEZ A;  5HGQ A;  2AHO B;  3MXN B;  3HOW H;  2B29 A;  2IT1 A;  2F3I A;  2IY5 B;  2FXQ A;  2RHQ B;  4JI0 L;  4DR3 Q;  4C3I H;  3U50 C;  3M4Q A;  4DV4 Q;  3M7N A;  2WFW A;  4IPC A;  1VCI A;  2VQE L;  5IP7 H;  3CC7 A;  1YIT A;  4A76 A;  2LSS A;  3GTK H;  2K5V A;  3KLW A;  3PUX A;  4NB3 A;  4DK3 C;  5IT9 c;  2E2I H;  3STB C;  4JI0 Q;  5IP9 G;  2MQH A;  3D31 A;  3S1N H;  3CCJ A;  2D0O A;  2N49 A;  1YZ6 A;  5GAG C;  2VQE Q;  1BKB A;  4DR7 L;  2QGQ A;  1NTG A;  1NJI C;  4JV5 Q;  2ZJQ A;  3FP9 A;  1XPU A;  3F2C A;  4A3K G;  3D0F A;  3H15 A;  4HIK A;  4KLK A;  4IPH A;  3I2Z A;  1XMO L;  4GOP B;  1SR3 A;  2VW9 A;  2JQO A;  1VQO A;  5M3F H;  1HZ9 A;  1SN8 A;  3H0G H;  3NEN A;  3I4M G;  1XMO Q;  3TS0 A;  3W1B A;  3L2P A;  1E1T A;  3PF4 A;  1TWH H;  4A93 H;  4P74 A;  5BR8 L;  1HR0 W;  3S1Q H;  4JBW A;  4R4I A;  3K8A A;  4AYB E;  1IBK L;  3RN5 A;  4BA2 I;  3L0O A;  4PG3 A;  4GKJ L;  1NMG A;  1X55 A;  3PUY A;  5BR8 Q;  3U4V A;  2JA5 H;  4HJ5 A;  1IBK Q;  4JYA L;  3DM3 A;  1UE5 A;  2A1A A;  1M90 C;  4GKJ Q;  3CW2 C;  4HJ7 A;  1HZB A;  3SGI A;  3BZC A;  4ME3 A;  3F2D A;  1Q8K A;  4HJA A;  2UUC Q;  2CKZ B;  2UXD L;  4YWL A;  4JYA Q;  1C7Y A;  2R7D A;  2VY3 A;  4A3E H;  4LFB L;  1I94 Q;  1G6P A;  3PCO B;  1Q81 C;  1YNX A;  2UXD Q;  4P75 A;  4QIW E;  1NMF A;  1IL2 A;  1J6Q A;  4LFB Q;  3HOW G;  3VDY A;  4H02 A;  4LFC L;  2VUM G;  2Z0S A;  3T1H L;  1V43 A;  2MO1 A;  3KYH C;  5LMN Q;  4JBM A;  2B63 G;  2NVT H;  1SRO A;  4IFD J;  1X3G A;  1VQG A;  2HT1 A;  4R4O A;  4JOI A;  3U4Z A;  4A75 A;  3U58 A;  4LFC Q;  5C44 G;  3S15 H;  3KDF B;  3T1H Q;  2Q2T A;  4POG A;  1TXY A;  1UE1 A;  3FKI H;  1UE7 A;  3B6Y A;  1B7Y B;  1JJC B;  4GN5 A;  4DV1 L;  4DV7 L;  4IJH A;  4IPD A;  2K52 A;  4GN3 B;  3M85 A;  1A0I A;  4X64 L;  4DV1 Q;  1X65 A;  2E5L L;  1PV4 A;  4DV7 Q;  2JEA I;  3PV0 A;  3I4O A;  3HOX G;  1AH9 A;  2JE6 I;  4BY1 H;  3H0G G;  2F4V L;  4GKK L;  4YY3 L;  4JI1 L;  4X64 Q;  4JCV E;  2E5L Q;  2KEN A;  2A8V A;  3HOV H;  3ICE A;  1KXL A;  2V1C C;  3PIO A;  2VS1 A;  2F4V Q;  4P72 A;  4GNX B;  4LF8 Q;  4GKK Q;  4YY3 Q;  4JI1 Q;  3F8T A;  2K75 A;  5J3B A;  4P73 A;  4X6A H;  3K80 C;  2R6G A;  2Q2I A;  5IYB G;  2CFM A;  1ASZ A;  2UU9 L;  1GO3 E;  1VQP A;  2AWN A;  2GVA A;  3I56 A;  1E7Z A;  4JI4 L;  4JI8 Q;  4BBS G;  2EQS A;  4AIM A;  4A3E G;  3HOY H;  1X54 A;  4R4T A;  1Q46 A;  1KRT A;  4LWC A;  2HHH L;  1QVC A;  4DV2 L;  2KCM A;  3OTO L;  1C9O A;  1J5E L;  1S72 A;  1YJN A;  1G51 A;  4JI4 Q;  2UXB Q;  2WAQ E;  4DPG A;  2RHS B;  2BH2 A;  1I6H H;  4GLV B;  2MO0 A;  3RLN A;  2HHH Q;  4DV2 Q;  1KHI A;  1E24 A;  4R4C A;  2AWO A;  3OTO Q;  3DLL A;  1J5E Q;  1HNX L;  1VQL A;  3ULL A;  1EUJ A;  2UUA Q;  3CF5 A;  1GVP A;  2Z6K A;  1Y1V G;  3BJU A;  1HZA A;  3MEF A;  2I5H A;  3OYY A;  1YHB A;  4IJL A;  5JEA G;  4DNI A;  1HNX Q;  1IBM L;  3PO3 G;  1L2F A;  4BBR H;  3PIP A;  4DR5 L;  1N36 L;  3PGZ A;  1SRU A;  4YCV A;  4OXP A;  2ATW A;  1S40 A;  1SE8 A;  2ALY B;  1EIY B;  2R93 G;  3ZJY C;  4QY7 A;  4LFA L;  4DR5 Q;  3PF5 A;  2VL6 A;  1N36 Q;  1I3Q H;  2E2H H;  3CPF A;  3PUZ A;  2JA6 G;  5JJK A;  4NPS A;  1JJG A;  1Q1B A;  4LFA Q;  3HFZ B;  1G29 1;  1X3F A;  2RF4 A;  1YHQ A;  1O7I A;  3HOV G;  1UWV A;  5IY0 A;  3EIV A;  3PSI A;  5M5W H;  4OWT B;  1OXX K;  3AEV A;  4HIM A;  4C2M H;  1BBW A;  2CWP A;  1V1Q A;  3GTQ H;  4A3C G;  2JA8 H;  4GOP C;  4JI2 L;  5IE8 A;  1GKH A;  1T9H A;  1VQI A;  2NZO A;  4JV5 L;  1K9M C;  4O2D A;  3GTJ H;  4A3J H;  1FVI A;  4C3J H;  2N8N A;  1E22 A;  4JI2 Q;  1DGS A;  1B70 B;  2GVB A;  2NVY H;  5EAY A;  3E9H A;  1FL0 A;  4JI3 L;  3CMA A;  2XTI A;  1VQA A;  5M3M H;  2AKW B;  3G48 A;  2YV5 A;  2ZJP A;  4IOA A;  4JI3 Q;  1FJG L;  1U5K A;  1LTL A;  2WAQ G;  2EXD A;  4ALP A;  4JI5 Q;  4B3R L;  4X62 L;  4JBJ A;  2PI2 E;  4IOC A;  1FJG Q;  4GLA C;  3ULJ A;  1VQ8 A;  1Y1W G;  3G71 A;  3M3Y H;  3TEH B;  4B3R Q;  4X62 Q;  1HJP A;  2UUC L;  1IXR A;  1QZH A;  5FJ8 H;  2K4K A;  2D62 A;  2HIV A;  2DUD A;  5GQO A;  1I94 L;  2ZJR A;  1OXV A;  1I5F A;  3NBH B;  2OCE A;  1SFO H;  2OWO A;  2BA1 A;  4A3F H;  1N8R C;  3Q8D A;  1PH5 A;  4OON A;  4LUZ A;  3F1Z A;  4MTN A;  3A5U A;  1Q1E A;  2PQA B;  4UY8 C;  2R7Z H;  5LMN L;  1VQJ A;  2B3G A;  3CP0 A;  1JE5 A;  1K3R A;  3J81 j;  4PZ6 A;  4LF6 L;  1CSQ A;  3ERS X;  1HH2 P;  4YHH Q;  1JB7 A;  4DAY B;  4B3M L;  5IP7 G;  3J7A 5;  1PH9 A;  3W5O A;  2RCN A;  4A3J G;  5FLX c;  1CKO A;  3STB D;  4LF6 Q;  3GTL H;  4JC0 A;  1VQ5 A;  3AFP A;  1OXT A;  1WCM H;  2YTY A;  1TWA H;  4GS3 A;  4IO9 A;  4B3S L;  4B3M Q;  3HOZ H;  4DR6 L;  4GNX C;  2YYZ A;  1XPO A;  4LF9 L;  5C3E H;  2E2J H;  4LNQ A;  5M3M G;  4R4Q A;  4YWK A;  4HIO A;  3RNU A;  1Z47 A;  4B3S Q;  2PNH A;  2YU9 H;  4DR6 Q;  3PO2 H;  5M3F G;  4A3B H;  4DAM A;  4GN4 B;  2NVX H;  4LF9 Q;  3CD6 A;  1FGU A;  1YHA A;  3UDI A;  1PYS B;  3FHW A;  1K8A C;  4LF8 L;  3RR5 A;  4EX5 A;  1XMQ L;  3KF8 B;  1L1O A;  1N9W A;  5JEA J;  1XJV A;  3I4N H;  4A93 G;  1LYL A;  1MKH A;  1D7Q A;  2OQ0 A;  4DV3 L;  2OTL A;  4A4I A;  2JA7 H;  1XMQ Q;  4LF4 L;  1MJE A;  1IZ6 A;  5GAD C;  2I0Q A;  3RZO H;  1PH4 A;  4DV3 Q;  2JA5 G;  4X66 L;  3H3V H;  1LM0 A;  4JI8 L;  5FLM H;  1YJW A;  4LF4 Q;  2PQA A;  1W2B A;  4KI0 A;  2Y0S G;  1NBW A;  4X66 Q;  4JG2 A;  3UDG A;  4WJ3 M;  2UXB L;  1L0W A;  2KHI A;  5HY6 A;  4A3F G;  1K83 H;  5IWA L;  1MJC A;  3UDF A;  2NVQ H;  2QA4 A;  1KC8 C;  2UUA L;  2R92 H;  1HNW Q;  4GLX A;  1VQB A;  3IRB A;  1WFQ A;  5C4X H;  4K0K L;  5IWA Q;  4LW1 A;  4O0A A;  5LMN W;  1KIX A;  2JK8 A;  4HID A;  2A19 A;  3CCM A;  4K0K Q;  2GN5 A;  2YTV A;  3CCV A;  1VQ4 A;  2VNU D;  3GTP H;  2EIF A;  3M4P A;  4BXX H;  3AFQ A;  3T1Y L;  2BA0 A;  2LXJ A;  4DKA C;  1WCM G;  3FKI G;  5H1S E;  1H95 A;  1HNZ L;  1E3P A;  2NZH A;  1XPR A;  3GDE A;  1QVG A;  2PI2 A;  3TRE A;  3T1Y Q;  5JJL A;  3RN2 A;  4YCW A;  1HNZ Q;  3NEM A;  4A3K H;  1VQ9 A;  3A5Z B;  4A3B G;  1PA6 A;  4PZ8 A;  4UPA A;  3GTG H;  4HJ8 A;  4A3L H;  3CXC A;  4BY1 G;  2D0P A;  1PH1 A;  1VQN A;  1PFS A;  1VQK A;  2UUB L;  4FDB A;  4OWW B;  3I4N G;  1D8L A;  2WB1 G;  3CCQ A;  3I4M H;  3S24 A;  3JAM i;  1EWI A;  1JJ2 A;  4OO1 G;  4AQY Q;  2JA7 G;  4LUO A;  2UUB Q;  1KL9 A;  4C3H H;  1QVF A;  1JT8 A;  5M5Y H;  4JOI C;  3UE0 A;  3GTM H;  3KJP A;  1Z9F A;  2IX0 A;  1PH8 A;  1A63 A;  1C0A A;  1EQR A;  3HOU H;  1PH6 A;  1KQS A;  3S1M H;  1QZG A;  3CME A;  2JA9 A;  2IX1 A;  4AH6 A;  4Y7N H;  1VQM A;  2ES2 A;  3S17 H;  1I50 H;  3HOY G;  4MZ9 A;  1A62 A;  4QJF A;  4OX9 L;  4WJ4 A;  1XNR Q;  2L15 A;  3RLO A;  4APV A;  3KFU A;  1UE6 A;  2VZA A;  4OWX B;  2K14 A;  4IFD I;  1X3E A;  4OX9 Q;  3CCL A;  1YI2 A;  1N33 L;  1EOV A;  3GO5 A;  4JI5 L;  1YIJ A;  4DV0 L;  4DR2 L;  1OTC A;  1U0L A;  2VUM H;  3A74 A;  1N33 Q;  5M5X H;  1VQ6 A;  4QQB X;  2KCT A;  1PH2 A;  4NXM L;  3JC6 6;  2B63 H;  4DV0 Q;  2ZTE A;  4DR2 Q;  3GTO H;  4L5T A;  2R7F A;  2Y0S E;  4BBR G;  5C44 H;  1EYG A;  1E1O A;  4NXM Q;  3NEL A;  1UEB A;  5E7N A;  3JAM c;  1JMC A;  3S1R H;  3S14 H;  1VQD A;  1L1O B;  1CKN B;  4L5R C;  4OO1 I;  4L5S A;  3EBE A;  1SLJ A;  4A3L G;  1PHJ A;  1VQE A;  3J81 c;  1ASY A;  4BA1 I;  2F52 A;  3S16 H;  4DR7 Q;  3H3V I;  5C0X G;  3CAM A;  4EQ5 A;  3GD7 A;  1AE2 A;  3HOX H;  2Q2U A;  3K0X A;  1V9P A;  4NXN L;  2Z6K C;  4YHH L;  1IBL L;  1Y14 B;  2JEB I;  1TWG H;  3HKZ E;  1Q82 C;  4BY7 H;  4DR1 L;  2BH8 A;  3CCE A;  1A8V A;  4XTC S;  2JA8 G;  4NXN Q;  1WI5 A;  1IBL Q;  3KF6 A;  1N34 L;  1WYD A;  1KD1 C;  4LF7 L;  3HOU G;  2I5L X;  5JJI A;  4A3G H;  4DR1 Q;  1CKM A;  3WWV A;  5IYB H;  3UDX A;  3J7Z C;  4A3D H;  1BVS A;  4MNO A;  4LF7 Q;  3CCU A;  3I7F A;  3UE1 A;  3OW2 A;  1N34 Q;  1W3S A;  1K8G A;  4PMW A;  4BBS H;  3AYH B;  1RIP A;  1TWF H;  2QEX A;  3HKS A;  3PUV A;  2C35 B;  2K50 A;  2WB1 E;  3ER0 A;  2ID0 A;  4JBK A;  1S3O A;  3CC4 A;  1WJJ A;  2I5M X;  5IYC H;  4A3M H;  4TVA B;  4RG1 A;  3K7U C;  4LF5 L;  2LXK A;  4YCU A;  1X9N A;  2E8G A;  4HJ9 A;  3W1G A;  3LGJ A;  5ELO A;  1P8L A;  4UP7 A;  1CKN A;  4LF5 Q;  2Q2H A;  4JI7 L;  1Y1V H;  3I55 A;  4TQU S;  5LMU L;  5C0X I;  3KJO A;  3M4O H;  2YTX A;  2OQK A;  4GOP A;  3PO3 H;  4JI7 Q;  4IPG A;  5IYD H;  1HZC A;  1KRS A;  3M9B A;  1QUQ B;  5FJ8 G;  5LMU Q;  4KHP L;  4B3T L;  3G6E A;  3TRZ A;  4DV6 L;  2AMC B;  2CWA A;  3J80 i;  1R9T H;  4JI6 L;  3TS2 A;  3RZD H;  1VQF A;  2KBN A;  4BXX G;  2N78 A;  2NN6 G;  3KOJ A;  2R93 H;  4L5Q A;  4DUZ L;  3S2H H;  4KHP Q;  1HNW L;  4B3T Q;  2JA6 H;  2JJQ A;  1NE3 A;  4DV6 Q;  1PH7 A;  2CCZ A;  4JI6 Q;  2K5H A;  3K7A H;  1XNQ L;  4A3I H;  2OTJ A;  1PH3 A;  3A0J A;  2VQF L;  4DUZ Q;  4POF A;  1OXU A;  2R7Z G;  4BY7 G;  2XGT A;  4DV5 L;  1K73 C;  1PVO A;  5K36 G;  4UP8 A;  1XNQ Q;  3F2B A;  1EIF A;  1YJ9 A;  3S2D H;  1WOC A;  2VQF Q;  4QGU A;  1X6O A;  3K81 C;  4KHZ A;  4DV5 Q;  4A3G G;  4A3C H;  5C4J H;  1VQ7 A;  2HQL A;  4A3D G;  3HKZ G;  3CC2 A;  2KHJ A;  4IFD G;  4AYB G;  4P71 A;  4X65 L;  1CSP A;  1P16 A;  2HIX A;  3ULP A;  1VS0 A;  5ELN A;  3HOZ G;  1YBY A;  2DGY A;  4PZ7 A;  1BBU A;  5IP9 H;  4DUY L;  1M1K C;  5C3E G;  2UU9 Q;  4X65 Q;  1N32 L;  3CCR A;  1RL2 A;  5IYC G;  5GRO A;  4A3M G;  3PO2 G;  5AJ3 L;  4DUY Q;  3KDF A;  2ZM6 L;  1N32 Q;  2ZTD A;  4AQY L;  3J80 c;  1AE3 A;  1IYJ B;  2K5N A;  4RMF A;  1QUQ A;  5AJ3 Q;  1TWC H;  3EN2 A;  2ZM6 Q;  1HR0 L;  3CCS A;  2NN6 I;  4R1J A;  1OXS C;  2PMZ E;  2H5X A;  3BU2 A;  4Y52 H;  1SMX A;  1EQQ A;  1MIU A;  4LUV A;  4DR4 L;  2N3S A;  2WP8 J;  1HR0 Q;  3E9I A;  5IYD G;  1X56 A;  2MFI A;  3L7Z C;  4YWM A;  3J81 i;  1XTD A;  3CPW A;  5FLM G;  1Y1W H;  1Q86 C;  1Q12 A;  1B8A A;  3AQQ A;  1IBM Q;  4DR4 Q;  5GAH C;  2UXC L;  1Q7Y C;  1XNR L;  3G4S A;  2ZTC A;  5GAE C;  1YVC A;  5DLQ E;  5C0X J;  1CUK A;  2MNA A;  4GNX A;  3BZK A;  2UXC Q;  2IHE A;  2ASB A;  2IHF A;  4DK6 C;  1EFW A;  3RLF A;  1GD7 A;  1VQC A;  1LUZ A;  2CQO A;  1K0R A;  1NY4 A;  3KF6 B;  3PUW A;  4QL5 A;  4A3I G;  1GM5 A;  3CQZ H;  4J15 A;  2R92 G;  1KAW A;  3TQY A;  4UP9 A;  1VQH A;  5C4X G;  1L1O C;  1PYB A; 
#chains in the Genus database with same CATH topology
 5I6Y A;  3EYY A;  1YEZ A;  2RVL A;  5HGQ A;  2AHO B;  3MXN B;  4DUY H;  2HHH H;  2F3I A;  1I3Q B;  2RHQ B;  4DNT B;  4JI0 L;  4DV4 Q;  4BXX G;  2WFW A;  1KTK A;  3KLW A;  2E75 C;  5ELC A;  2B2Y C;  3FPU B;  3D31 A;  4ZK9 B;  5IP9 G;  3CCJ A;  3S1N H;  1E2Z A;  1EQT A;  4TSS A;  4JV5 Q;  2J6T A;  2F0O A;  3I90 A;  5E3F A;  3KHL A;  4HIK A;  4KLK A;  3T53 B;  1N36 H;  2VW9 A;  2R7M A;  1VQO A;  2D9U A;  1HZ9 A;  1SN8 A;  2B2V A;  3EJI A;  3I4M G;  4DAV A;  1XMO Q;  3L2P A;  1HRJ A;  4C3H G;  3K8A A;  3RV4 A;  1CA6 A;  3L0O A;  1NMG A;  1JXL A;  1SYD A;  4HJ5 A;  1SJE D;  4JYA L;  3DM3 A;  3FVQ A;  1GHK A;  5K5P A;  4ODG A;  4ME3 A;  1I4H A;  1Q8K A;  2K5Q A;  2UUC Q;  2FFK B;  4YWL A;  2R7D A;  3MXP A;  1YNN C;  2A68 C;  4JI0 H;  1G6P A;  1STH A;  3H20 A;  4BWG B;  4CDE C;  1YNX A;  2EYP A;  3S14 B;  4J9M A;  4LFB Q;  1J6Q A;  5D14 A;  4IRC A;  2EXZ A;  2VUM G;  2R61 A;  2MO1 A;  2B63 G;  2WYO A;  1X3G A;  1VQG A;  3KLS X;  5KFR A;  4DL4 A;  4A75 A;  3U58 A;  5ELD A;  3TP5 A;  3KDF B;  2YRX A;  1LAC A;  3TQT A;  1FKA H;  5D3D A;  2PMZ A;  1TVX A;  3B6Y A;  2K28 A;  2R7Z B;  1TWG B;  4IJH A;  3G6V A;  1MHW C;  3KK7 A;  1A0I A;  1JOO A;  2F0E A;  2I87 A;  2JEA I;  2EE1 A;  3SVM A;  1G8Z D;  3HOX G;  4BY1 H;  3H0G G;  1BNZ A;  4A3D B;  4X64 Q;  4JYA H;  4JCV E;  4JVZ A;  4AYB B;  2A8V A;  4H0L C;  2FPG B;  1GSA A;  2V1C C;  3PIO A;  2IX3 A;  4GNX B;  2VUM A;  4JI1 Q;  2K6A A;  2B63 A;  3RF2 A;  4R8U B;  1TR5 A;  2M2L A;  3C2P A;  1E4E A;  1HQR D;  2R6G A;  3OSN A;  3WO0 A;  3EFX D;  2WDT A;  2VB3 X;  5IGG A;  1GO3 E;  4ZAI A;  1E7Z A;  5LP6 F;  3HOY H;  3MFH A;  2KVM A;  1U4P A;  1S5E D;  1KRT A;  5BMV F;  4QIW B;  3OTO L;  1J5E L;  3M4O B;  4OEL B;  5DM7 3;  1E4G T;  2WAQ E;  3OHB A;  1Z2P X;  2KJX A;  3RLN A;  1STA A;  4DV2 Q;  1HNX L;  4LSA A;  3GQC A;  4DN4 M;  3CF5 A;  2Z6K A;  1SYG A;  1C8C A;  1EYZ A;  1RYR A;  4O42 A;  1EZ6 A;  4IJL A;  3R5X A;  2OLS A;  2YW2 A;  4I7A A;  4ZCK A;  1ZYR C;  3PIP 3;  3MFI A;  3PO3 G;  3J80 W;  4CJ1 B;  1CK1 A;  4LF8 H;  1SRU A;  4EEQ A;  1IOW A;  4TQS A;  5C4X B;  3VYU A;  2EY5 A;  4LFA L;  3GQB A;  3S2D B;  3X3M A;  2C2E A;  3WDN A;  4ZI7 F;  4CBV A;  1RTN A;  1X3F A;  1YHQ A;  4DU9 A;  5IY0 A;  5ELE A;  5KFN A;  5KFC A;  3PSI A;  1S5C D;  5FD6 A;  3FMA A;  3ITP A;  4F87 A;  2ENB A;  3NUC A;  5KIX A;  4HIM A;  4RUC A;  2W7P A;  1KEE A;  2V4D A;  3OTO H;  4F4Y A;  1KDC A;  2K7V A;  4JI2 L;  4V19 0;  1GKH A;  3PN1 A;  3BYY B;  2R8G A;  2TMP A;  3LWU A;  4JV5 L;  5KFY A;  1EY6 A;  1HNX H;  1FVI A;  2V59 A;  2N8N A;  1E22 A;  3I4M B;  4J9Q A;  1DGS A;  1EYD A;  2GVB A;  3GIQ A;  3E9H A;  3HS0 C;  4C3H B;  2JEG A;  2XTI A;  1VQA A;  4CGY B;  1PZK D;  5CV4 A;  5DLG A;  3GV5 B;  3S1M B;  2DWC A;  1U5K A;  1GUN A;  2VA2 A;  4LFA H;  1O78 A;  1I50 B;  4DGZ A;  4ALP A;  4JI5 Q;  3BDL A;  4B3R L;  1ULZ A;  4IOC A;  4RNN A;  4HAE A;  1Y1W G;  3TEH B;  2WTF A;  1HJP A;  2F0N A;  2IPK D;  2UUC L;  1QZH A;  4ED0 A;  2K4K A;  1DON A;  2HIV A;  2XCL A;  1OXV A;  1SFO H;  2VUM B;  2OCE A;  2OWO A;  1MZB A;  2BA1 A;  3VPD A;  2B63 B;  2HQE A;  1H9K A;  4K6L A;  1PH5 A;  1CT1 D;  1E4E B;  4LUZ A;  1F2M A;  2X0S A;  2E2I B;  2PQA B;  4UY8 C;  1C48 A;  4B08 A;  4L1K A;  1JE5 A;  3UFX B;  2L4N A;  3T5J A;  1HFG A;  1HH2 P;  1JB7 A;  1FYC A;  1IW7 D;  5FPO A;  1PH9 A;  2RCF A;  4I55 F;  3CRK C;  3STB D;  3HOX B;  3BQ1 A;  5EKL A;  1VQ5 A;  3H0G B;  2F0I A;  4B3S L;  1TWA H;  2FIN B;  4ED8 A;  1PRT C;  3S1Q B;  1XPO A;  4NXM H;  5C3E H;  4B3R H;  2E2J H;  4YWK A;  2PNH A;  4KK7 A;  4NW2 A;  2MGS A;  2B2W A;  1YHA A;  3UDI A;  1SYE A;  1PYS B;  3FHW A;  3RR5 A;  2RGV A;  2UVR A;  1L1O A;  3I4N H;  1HHV A;  2WV6 D;  4J0M A;  2OQ0 A;  5KFM A;  4FXG C;  2OTL A;  4A4I A;  5I2X A;  2W9B A;  1IZ6 A;  4DV3 Q;  5LOV F;  4X66 L;  3H3V H;  1UEA B;  1ESR A;  3PW7 A;  1NAP A;  4NXN H;  1G6Z A;  2B2Y A;  2A6H D;  3E6Z X;  2V58 A;  2RDF A;  1W93 A;  5DM6 3;  3V96 A;  5FD5 A;  1L0W A;  1AZQ A;  4LF7 H;  1K83 H;  2L11 A;  2K03 A;  2PCF B;  3S15 B;  1MJC A;  3UDF A;  1WTH A;  3PO3 B;  1PTO C;  2FPP B;  4LH6 A;  1LO5 D;  1PTO H;  1WFQ A;  4K0K L;  3GIP A;  2V5A A;  5KFO A;  4B3S H;  1K1S A;  2EJF C;  3FDS A;  3RZD B;  2KHS A;  4HID A;  3CCV A;  3GTP H;  2B2T C;  1U4L A;  2EIF A;  5E1F A;  2F3V A;  3TBI B;  1HNZ L;  1E3P A;  2NZH A;  1XPR A;  4FXD A;  3GDE A;  3OW7 A;  1HFN A;  2PI2 A;  4YCW A;  4YIJ A;  3D4D A;  4A3K H;  3LML A;  2TSS A;  1VQ9 A;  3A5Z B;  3TP7 A;  5C4J B;  2YZN A;  4BY1 G;  2D0P A;  2ZDG A;  1VQN A;  3SK5 A;  2FK3 A;  3J7A K;  2L1B A;  5KT3 A;  3DUZ A;  4OGQ C;  1KL9 A;  4RAU C;  1XYI A;  3OPO A;  5I4D A;  3GTM H;  3SI8 A;  1XNQ H;  3E5N A;  5COR A;  1HUM A;  1C0A A;  2G5D A;  1PH6 A;  4YQW A;  1QZG A;  4ZUJ A;  3HOY G;  1HPC A;  5CV5 A;  4E6I A;  2NZ1 D;  4RFB A;  4OX9 Q;  2YZM A;  4U67 3;  1YI2 A;  1Y1W B;  2K1B A;  1JOK A;  2F0Q A;  1HNZ H;  4JI5 L;  5KG7 A;  1B04 A;  1F9P A;  5KG5 A;  4ECW A;  1U0L A;  1HTL D;  1VQ6 A;  5M5X H;  4CKC A;  3JC6 6;  1TT2 A;  2ZTE A;  3GTO H;  4J9O A;  2ZDQ A;  4IZO A;  2NYZ D;  3GIJ A;  4AQY H;  5K2M A;  3K5I A;  5M5W B;  1UEB A;  3S14 H;  3S1R H;  1VQD A;  1L1O B;  1CKN B;  4L5R C;  2W9C A;  1BCP F;  4A3L G;  1KLG D;  1JWM D;  1STG A;  3HP3 A;  4C1N I;  2M00 A;  4BA1 I;  4DR7 Q;  4DF7 A;  3CAM A;  3GD7 A;  2V9W A;  1AE2 A;  2UVW A;  2EYH A;  3Q6S A;  4HQ6 A;  4K2K A;  1Y8N B;  4N8F A;  4RWS C;  4DAP A;  4CDC C;  1BO0 A;  4Q0F A;  1IBL L;  4ZOL F;  1F2L A;  1TWG H;  2ZXO A;  3HKZ E;  4B9X A;  5C8Y F;  4PMB A;  1WD0 A;  5CAE B;  3TIG A;  1N34 L;  4J9R A;  5JJI A;  2BR0 A;  4DR1 Q;  5IYB H;  4A3D H;  1H9J A;  3NTK A;  3I7F A;  3MA2 B;  4UCT A;  2CZG A;  3MFG A;  4RHR A;  4IHJ F;  4BBS H;  3AYH B;  1RIP A;  2KUM A;  2DY7 A;  3TII A;  2QEX A;  1RJT A;  3HKS A;  4I7Z C;  2R7K A;  2WB1 E;  3ER0 A;  3M9O B;  4L8J A;  3CC4 A;  1TS4 A;  1J9O A;  4RG1 A;  3K7U C;  4O3O A;  4LF5 L;  1EWH A;  2LXK A;  1PYW D;  2J9G A;  5BN4 A;  1X9N A;  2E8G A;  3S9W A;  3KAL A;  3KHR A;  4UP7 A;  2HUG A;  2PBZ A;  2Q2H A;  4JI7 L;  2FLL A;  4TQU S;  3NPP A;  3OSP A;  2F0K A;  5LMU L;  3KJO A;  3M4O H;  2OQK A;  3SHL A;  4XYL B;  3U9O A;  5LA6 F;  4KHP L;  2H4O A;  1IBL H;  1R9T H;  1QOH A;  2R93 H;  1SYX B;  2KBN A;  2B8G A;  1DIK A;  2N78 A;  1Y8O B;  4B3T Q;  2JA6 H;  2CCZ A;  1N34 H;  4I65 A;  3R23 A;  3VPB A;  4IUR A;  1PH3 A;  3A0J A;  2VQF L;  4DUZ Q;  4POF A;  4BY7 G;  1QE6 A;  4IWX A;  4A2A A;  2XGT A;  4DV5 L;  2RGR A;  1PVO A;  3IFD A;  2EJG C;  4JV1 A;  2HD3 A;  2OT2 A;  2UXD H;  3U9S A;  1YJ9 A;  3S2D H;  4MV4 A;  5T1I A;  4RB2 C;  1BOS A;  2K05 A;  4CJ0 B;  2YU9 B;  4YJ2 F;  5IGC A;  2O5J C;  1WTW A;  2HQL A;  1A3U A;  3IG0 A;  4BY1 B;  1CSP A;  1Z2O X;  1I7L A;  4V0B A;  2DGY A;  5IP9 H;  1QG7 A;  2SOB A;  1DXM A;  1RK6 A;  5C3E G;  3Q2O A;  2Y0S A;  1SFO A;  1N32 L;  4U68 A;  4XX0 B;  1RL2 A;  5IYC G;  1B53 A;  1JCK B;  5GRO A;  1EUD B;  1AW7 A;  4DUY Q;  2A69 C;  3K5O A;  4KJO A;  4KV6 A;  4X3U A;  4XQJ A;  5KT2 A;  3J80 c;  1AE3 A;  1IYJ B;  4RMF A;  3OUZ A;  1QUQ A;  2P5Z X;  5AJ3 Q;  3EN2 A;  3J81 L;  2ZM6 Q;  2W9C B;  1OXS C;  2J6U A;  3HOY B;  2RSO A;  2XC9 A;  1RKN A;  2NVQ B;  5IYD G;  3DEO A;  4YWM A;  3J81 i;  1KAB A;  4I7H A;  1CQF A;  1Q86 C;  1Q12 A;  2VQF H;  4DR4 Q;  4F8M A;  5GAH C;  4DV5 H;  2JEI A;  1JDB B;  3G4S A;  1TWA A;  3GIM A;  1YVC A;  5C0X J;  2SDF A;  3N44 B;  3BZK A;  2IHE A;  2ASB A;  4NKL A;  4XXE A;  5EWG A;  3LX0 A;  1JQY D;  4MTK A;  1CHQ D;  2F0S A;  2Z4I A;  1L1O C;  1PYB A;  5A2Q L;  4PWQ A;  4XIG S;  4DR3 L;  2B29 A;  5KFJ A;  1N32 H;  5GON F;  4UHV A;  3U50 C;  4IPC A;  4JW0 A;  1VCI A;  3AU7 A;  5D65 A;  1KNE A;  1C30 A;  4S3S A;  2E2I H;  2DNE A;  4JI0 Q;  2MQH A;  2FPI B;  2W6Q A;  3N6X A;  2N49 A;  4NMZ A;  1YZ6 A;  4RUA A;  2L12 A;  4DR7 L;  1NTG A;  1XPU A;  1WTP A;  5CMD A;  4A3K G;  2W70 A;  3H94 A;  1W96 A;  1IBM H;  3H15 A;  1K83 A;  3K5H A;  3C46 A;  1SR3 A;  3JAM W;  2DNC A;  2DN8 A;  4X3K A;  3H0G H;  5EKI A;  5KFV A;  4A93 H;  4P74 A;  3J81 W;  5ISR A;  2F0D A;  5BN3 A;  3S1Q H;  1H9S A;  2CW0 D;  2XVS A;  1NSN S;  2F3W A;  3BG3 A;  1PFM A;  4KN7 C;  5C6A A;  1AUV A;  4Y8V B;  5CBA E;  1RJQ A;  2K01 A;  3PUY A;  3DXJ C;  4QB4 A;  2B2T A;  3GTP A;  5IGF A;  3U4V A;  4KN4 C;  3RV3 A;  4EVO A;  1M90 C;  4RCO A;  4HJ7 A;  4DR3 H;  4K5V A;  3F2D A;  5KG2 A;  4FF1 A;  5EQ0 A;  2CKZ B;  3MXN A;  4JYA Q;  2R8H A;  4APM A;  4BWS C;  2VY3 A;  2YRW A;  1PZI D;  1N48 A;  4RB0 A;  1Q81 C;  1B3A A;  5TSS A;  5J22 A;  1BXR A;  1IL2 A;  3HOW G;  1JR0 D;  2FLP A;  4LFC L;  3T1H L;  4F4Z A;  1V43 A;  3EA6 A;  5G3L F;  3MVV A;  4DXG A;  2WKC A;  4R4O A;  2RBM A;  3IFT A;  3U4Z A;  3S15 H;  5KFW A;  3OUU A;  1RF2 D;  4RHS A;  2LKV A;  1F2Z A;  4RGT A;  4IRD A;  1TXY A;  1UE7 A;  4JPB W;  4DV1 L;  1B7Y B;  5FPR A;  4BY7 B;  1KJI A;  4IPD A;  1TS2 A;  1V8Q A;  4GN3 B;  3W2D A;  4X62 H;  3M85 A;  1E2W A;  1MI2 A;  1E0B A;  2E5L L;  2GA4 B;  3PV0 A;  3I4O A;  2DPJ A;  2N88 A;  1QJO A;  1AH9 A;  5CA0 F;  3KBG A;  1JIH A;  4DNR B;  2CW7 A;  4GKK L;  4YY3 L;  3RB6 A;  3PIO 3;  3IL8 A;  3OMC A;  4KKT A;  1TWA B;  2VS1 A;  2LFN A;  2R8I A;  3HGB A;  1PRT B;  4LF8 Q;  2EVB A;  1TWF B;  2ICI A;  5C3E B;  1SYF A;  2E2J B;  1CHP D;  3GTO A;  4P73 A;  4X6A H;  3K80 C;  5I9P A;  2Q2I A;  5IYB G;  3GIL A;  3PR4 A;  2W8L A;  1FD7 D;  3J80 E;  4XYO A;  5J39 A;  2B39 A;  1ROD A;  2AWN A;  2GVA A;  1FGB D;  2W6Z A;  2XCA A;  4BBS G;  1EEF D;  1J8I A;  4R4T A;  2DZD A;  1Q46 A;  4K8I A;  5KFZ A;  4LWC A;  2HHH L;  1C9O A;  3N43 B;  5IT9 L;  5FO8 B;  1G51 A;  4HN7 A;  4GLV B;  3R93 A;  5DQI A;  1E24 A;  2EOT A;  3OTO Q;  3NBI A;  4HR7 B;  1J5E Q;  2R84 A;  1EUJ A;  2R7Z A;  4HTH A;  5KG6 A;  1TWG A;  1CA5 A;  4H7B A;  3CHB D;  3BQ0 A;  2RKS A;  2I5H A;  4ID6 A;  3N42 B;  3OYY A;  1YHB A;  1HNX Q;  2E5L H;  2Z4H A;  3QWN A;  4BBR H;  4DR5 L;  2VQD A;  2C22 A;  1N36 L;  2M9V A;  4KKU A;  4YCV A;  2ATW A;  4YY3 H;  4GKK H;  2ALY B;  2AUJ D;  5D1O B;  4AYB A;  3OMG A;  2R93 G;  3ZJY C;  2VL6 A;  1IHZ A;  2WKD A;  3CPF A;  3PUZ A;  5JVG 3;  2JA6 G;  3WOE A;  4NPS A;  5JJK A;  1JJG A;  3QOJ A;  4LFA Q;  3HFZ B;  4WJW A;  3GTP B;  4R8U A;  4JI8 H;  2PZT A;  4EGV A;  4EFE A;  2KCN A;  5M5W H;  3URY A;  5I6W A;  2LY7 A;  5DGA A;  2UXB H;  2B8F A;  5KG1 A;  1SMY D;  2CWP A;  1V1Q A;  4PMC A;  1CI3 M;  1A3V A;  4A3K B;  1RCV D;  2JA8 H;  4QIW A;  4E4T A;  2AQ3 B;  4GOP C;  1VMC A;  4ECR A;  5L1J A;  5IE8 A;  4NDX A;  2CVR A;  5L1L A;  2NZO A;  1K9M C;  4O2D A;  4LK1 C;  3GTJ H;  4FF2 A;  5KT7 A;  4EBE A;  4JI2 Q;  1R9T A;  2NVY H;  2WAQ B;  5EAY A;  4FF3 A;  4O3R A;  3NQI A;  5FLX L;  1FL0 A;  3VMM A;  5KT5 A;  2JA6 A;  5DLF A;  3GTM B;  5IT9 W;  3G48 A;  4DR5 H;  1EY9 A;  2ZJP A;  4IOA A;  3I73 A;  1D6E C;  1DV1 A;  3MAQ A;  4K14 A;  1WTX A;  5CYU A;  3MR6 A;  5LXT F;  1U9R A;  3ETH A;  2EYJ A;  4JBJ A;  4GLA C;  1ET6 A;  4LMQ D;  3K3P A;  3M3Y H;  1EIG A;  4RU9 A;  4J9P A;  2EY1 A;  4B3R Q;  1MBY A;  4OEM B;  1IXR A;  1ZEQ X;  2G9H D;  3FEW X;  2XD4 A;  3HOW B;  1BCP C;  4JK1 C;  3L9A X;  3SK6 A;  5M5X B;  4C56 C;  4FS1 A;  3Q8D A;  3GTO B;  3ERQ A;  4HCS A;  1I6U A;  1X3Q A;  3F1Z A;  4MTN A;  1Q1E A;  3S1R B;  5L9X A;  3CP0 A;  1V1O A;  4ILW A;  3J81 j;  4LF6 L;  5FKA C;  2HCC A;  4B3M L;  5KFL A;  3MC0 B;  3ONA B;  4TV8 F;  1LTR D;  3GV8 B;  3W5O A;  1D5Z C;  4C5B A;  4EEY A;  1OXT A;  2YTY A;  4GS3 A;  2E76 C;  3HEJ A;  4DR6 L;  4EGQ A;  4EYI B;  3D4R A;  1I50 A;  2ZXR A;  4R4Q A;  4HIO A;  4B3S Q;  5FLX W;  1Z47 A;  2OEO A;  2YU9 H;  1E4F T;  4ECZ A;  3OWF A;  3FDT A;  4GN4 B;  4MA0 A;  1B9N A;  4LF8 L;  2F1M A;  1XMQ L;  3KF8 B;  1N9W A;  4A93 G;  1D7Q A;  1AP0 A;  1GGO A;  3R5F A;  1DZ1 A;  4BBS B;  1ENA A;  1Z6H A;  4LF4 L;  1UNN C;  2MJ8 A;  1RJP A;  1CE8 A;  5DG7 A;  1LM0 A;  5FLM H;  4CDD C;  2E2I A;  2EPB A;  2PQA A;  4KD4 A;  4KI0 A;  2MCT A;  1DYQ A;  2R87 A;  4X66 Q;  3ND8 A;  2NVT B;  4FS2 A;  4LF6 H;  1YNN D;  2A68 D;  1KDA A;  4A3F G;  2MUY A;  4B3M H;  4J8Q A;  2NVQ H;  3PW2 A;  1KC8 C;  2R92 H;  1VQB A;  3IRB A;  4J9L A;  3H0G A;  3H4D A;  4LW1 A;  4O0A A;  3BA9 A;  4DR6 H;  1R9T B;  4YAK B;  2R93 B;  1IOV A;  4K0K Q;  1O80 A;  2EZV A;  1JOQ A;  2JA6 B;  3UQ8 A;  4RNO A;  3LNN A;  3M4P A;  3IKJ A;  3AFQ A;  4FP5 D;  3HRZ C;  3X3N A;  3PW5 A;  4I4T F;  1XMQ H;  2BE5 C;  5JJL A;  4K5X A;  4BS9 A;  1UUP A;  4ECV A;  1HNZ Q;  4CC5 A;  2BQ3 A;  3J7A V;  3MWE A;  3HB9 A;  1W6K A;  1AUX A;  4A3L H;  4F4X A;  4LF4 H;  4ECX A;  1SEB D;  3CXC A;  4FDB A;  4ZKB B;  4OWW B;  3PR5 B;  2WB1 G;  4QUC A;  3CCQ A;  3Q1K A;  2EYO A;  3S24 A;  2AQ1 B;  4AQY Q;  2JA7 G;  4FVM A;  5JPM C;  1JT8 A;  4JOI C;  5IOD A;  1EL0 A;  1IKM A;  4RH6 A;  1A63 A;  4MIU A;  2ASD A;  2K04 A;  2NUA B;  1TU2 B;  3GV6 A;  2F0F A;  1JOR A;  3QFF A;  3E3X A;  4Y7N H;  4ABN A;  1STE A;  2AQ4 A;  4LH7 A;  4MTD A;  3RIZ A;  4APV A;  2F0J A;  2EYL A;  2VZA A;  4OWX B;  3AMU A;  5M9O A;  4IFD I;  2W6P A;  4O2A F;  1KDB A;  1X3E A;  5JQW A;  3QR8 A;  1NUC A;  1EOV A;  2AGQ A;  2WB1 A;  4C5A A;  5KYI A;  4QQB X;  2KCT A;  2F0U A;  4NXM L;  1ZYR D;  3LP8 A;  3VR3 A;  2R7F A;  4BBR G;  2NUC A;  2J4X A;  4ULL A;  2NU7 B;  2K5D A;  3L4J A;  2R3Z A;  4EQN A;  2E74 C;  3JAM c;  2KQ3 A;  4TQR A;  2CH4 W;  1BF4 A;  2KA7 A;  4EBD A;  5KFP A;  1T36 A;  1PHJ A;  4RKB A;  3J81 c;  3Q8P B;  2F52 A;  5EKK A;  1KNA A;  5C0X G;  3G6Y A;  2R85 A;  4ECY A;  1NR2 A;  2NB0 A;  3QO2 A;  3K0X A;  1O7Z A;  1U4M A;  4NXN L;  4BY7 H;  2D5D A;  4XQN A;  2JA8 G;  1WI5 A;  1IBL Q;  1B4O A;  2DY8 A;  1KD1 C;  4LF7 L;  3TIN A;  3KLS A;  1TS3 A;  3I72 A;  1CKM A;  4FF4 A;  1Y1W A;  4MNO A;  5T1G A;  1GOZ A;  1PZJ D;  2LS0 1;  1A15 A;  1W3S A;  3UE1 A;  1N34 Q;  4DV4 H;  4A93 B;  1K8G A;  4PMW A;  4MV9 A;  5EWE A;  1DOK A;  1TWF H;  1O7L A;  1WJJ A;  5IYC H;  4ECQ A;  5C4H A;  4TVA B;  2Z1C A;  1F9Q A;  1RTO A;  4RKL A;  1HTP A;  1SBB B;  3R2I A;  4HSV A;  1WTO A;  3LGJ A;  1P8L A;  1CKN A;  5ELF A;  5C4Z A;  3ORR A;  2WE6 A;  4LF5 Q;  1O75 A;  5C0X I;  4A3F B;  1UC8 A;  3BAB A;  4GOP A;  1KAA A;  5IYD H;  4JI7 Q;  3EPI A;  3TP8 A;  5LMU Q;  4PDB A;  4YAJ B;  3G6E A;  1JC7 A;  4O3P A;  2CWA A;  2ZT9 C;  3OOC A;  2JEJ A;  3RFC A;  2NVY A;  4L5Q A;  4PV1 C;  1BXT A;  2F0P A;  4KHP Q;  1VMP A;  4MHE A;  4O4I F;  1B50 A;  2P0A A;  3NQT A;  4RB3 C;  1XNQ L;  3C3L A;  2LMC B;  3M9M B;  1K73 C;  5K36 G;  1XWE A;  4RGO S;  4UP8 A;  4FNF A;  1SNP A;  1WOC A;  2VQF Q;  1K3B C;  1X6O A;  3K81 C;  4DV5 Q;  4LFB H;  1ML0 D;  3Q23 A;  2F0V A;  4A3G G;  2IBK A;  4QW9 A;  1AN7 A;  3V4Z A;  4FO2 A;  1HUN A;  2DIK A;  4YP3 A;  1MD2 D;  4X65 L;  3O13 A;  4HCE A;  3ULP A;  3H6M A;  1VS0 A;  3J7Y W;  4O4L F;  5ELN A;  1WTR A;  2WB1 B;  1PRT D;  2ZJT A;  1D1I A;  1ZQ7 A;  3FPP A;  2JA7 B;  2IMW P;  4IUN A;  4A3M G;  3RZO B;  2C2D A;  1N32 Q;  4AQY L;  2KOL A;  5KFB A;  1JLL B;  4ZRZ A;  1HR0 L;  4DL6 A;  1EY0 A;  2PMZ E;  4Y52 H;  1K1Q A;  4LUV A;  3A7A B;  2N3S A;  2WP8 J;  4KD3 A;  1EZ8 A;  3DM1 A;  1B1Z A;  4KMU C;  1X56 A;  5FO9 B;  4JI1 H;  5FLM G;  2W6M A;  1RD9 D;  2AGP A;  1PX2 A;  3AQQ A;  1IBM Q;  3RB0 A;  4EGJ A;  1Q7Y C;  1WD1 A;  1STB A;  4TRD A;  5KNB A;  2MNA A;  2X69 A;  4FXK C;  1S97 A;  2Q8I B;  2IHF A;  3RLF A;  1S72 A;  4M7E A;  1D1K A;  1LUZ A;  2CQO A;  4QL5 A;  2R92 G;  5KFD A;  2YU9 A;  1GM5 A;  4O3S A;  4J15 A;  3NXW A;  4ZQI A;  1PTO D;  2F4I A;  3TQY A;  4UP9 A;  4BBR B;  4X65 H;  3RB3 A;  2UU9 H;  1SE3 A;  3JAM E;  3RGX A;  2EY6 A;  3BJY A;  3DHQ A;  5KFX A;  1ILQ A;  1XXG A;  3HOW H;  2W9A A;  2B2U C;  2IT1 A;  3NTH A;  2IY5 B;  3J81 E;  2FXQ A;  1EFI D;  4DR3 Q;  2MP1 A;  4G57 A;  3GTG B;  1FNV A;  2VQE L;  5IP7 H;  3GTK H;  4A76 A;  1EY7 A;  5IT9 c;  4IUP A;  3H09 A;  1HR0 H;  5GAG C;  3F2U A;  1BKB A;  1GSH A;  2QGQ A;  1NJI C;  5EPK A;  3F2C A;  3D0F A;  5M5Y B;  3K5N A;  2C9O A;  2FK2 A;  2A6E C;  2XIG A;  1I7N A;  2JA8 B;  4QWA A;  4GOP B;  2R92 A;  2JQO A;  5M3F H;  4YR0 A;  4C1N K;  4RA8 A;  5JAV A;  1GUW A;  3R3O A;  3D6C A;  3GTJ B;  4Q5V A;  3W1B A;  3S17 B;  3HXL A;  1TWH H;  3R5H A;  5BR8 L;  1HR0 W;  4JBW A;  1HCZ A;  2NVY B;  4IUQ A;  4R4I A;  1IBK L;  5T14 A;  4PG3 A;  3TP6 A;  4GKJ L;  1CQI B;  3BDC A;  3J7A F;  1WTQ A;  2JA5 H;  4L6T B;  3CW2 C;  3ORQ A;  3I8Z A;  4CJ2 C;  4HJA A;  5KT6 A;  2UXD L;  5CGK A;  5F2D A;  2FK1 A;  1I4P A;  3PCO B;  3TDQ A;  4HYK A;  1D2B A;  2VQE H;  3M3Y B;  4P75 A;  5JH7 F;  1TAE A;  1NMF A;  3A54 A;  3N8D A;  4H02 A;  3G8C A;  3L3O C;  1BCP B;  2NVT H;  4IFD J;  1SRO A;  4Q0Y A;  1EYA A;  2K33 A;  4JOI A;  4LFC Q;  4Q44 A;  3T1H Q;  4EYH B;  1STN A;  2Q2T A;  4POG A;  3L4K A;  1LTA D;  2ASL A;  4GN5 A;  1SNC A;  4MV3 A;  2Z6B A;  4DV7 L;  2K52 A;  5BR8 H;  1EZ1 A;  2F0H A;  1IBK H;  4DV1 Q;  1G2T A;  2HGS A;  1PV4 A;  4RNM A;  4GKJ H;  4IR9 A;  2OXP A;  4A3G B;  2BCO A;  2JE6 I;  2F4V L;  4MTE A;  2G9D A;  2E5L Q;  5KFU A;  2KEN A;  3P1H A;  1I94 H;  2CH4 A;  4A2B A;  2FMC A;  4YY3 Q;  1TKW B;  4GKK Q;  1WVL A;  4UCR A;  3F8T A;  5J3B A;  4A3M B;  2GPW A;  2QIL A;  2JEF A;  3N40 P;  5LMN H;  1JWU D;  1SNM A;  1VQP A;  3I56 A;  1FNW A;  3QOL A;  4JI4 L;  4IAJ A;  1S0M A;  4JI8 Q;  2EQS A;  4AIM A;  4A3E G;  4ED3 A;  2L5T A;  4JV2 A;  1II3 A;  1YJN A;  4ZHQ F;  2UXB Q;  5KFQ A;  3Q8S B;  3LWE A;  3I4L A;  1EU3 A;  4ED7 A;  2BH2 A;  1I6H H;  2MO0 A;  2HHH Q;  1KHI A;  1VQL A;  3DLL A;  3T51 B;  2RDG A;  2EDG A;  3ULL A;  2K5W A;  4DV7 H;  1GVP A;  1LTI D;  1HZA A;  2FMA A;  4G3I A;  4UCS A;  3W3A A;  4DNI A;  4IR1 A;  1IBM L;  5EWF A;  2DJF C;  1VBH A;  2R92 B;  2F4V H;  5KFK A;  2QYZ A;  4OXP A;  5HUR A;  1SE8 A;  1Y8P B;  3E0J A;  4GZY C;  4IAL A;  4ECU A;  3RAX A;  2VPQ A;  4DR5 Q;  4ED1 A;  1N36 Q;  3T4A C;  2E2H H;  3NK9 A;  1Z7T A;  5LL6 S;  4MV8 A;  1CZW A;  1TWF A;  4YB8 B;  2F0W A;  3DWP A;  5KFH A;  1G29 1;  2RF4 A;  2R6F A;  3HOV G;  3MR3 A;  1MGS A;  3VR5 A;  5F9L A;  3AEV A;  4JI4 H;  2EY2 A;  4O3Q A;  3ZYY X;  4C2M H;  1BBW A;  2CW0 C;  5E4W C;  5LYJ F;  3GTQ H;  3H4B A;  2PZU A;  2UUA H;  1T9H A;  1JWS D;  3SR1 A;  2WII B;  3A7L A;  1EIH A;  3NP8 A;  1B44 D;  4HR7 A;  1CS0 A;  3K57 A;  1BGW A;  1B70 B;  5CV8 A;  4CC6 A;  2QW7 A;  3BA8 A;  4JUZ A;  1IYU A;  4XT1 B;  4JI3 L;  5EGT A;  2A69 D;  2AKW B;  1M4V A;  2YV5 A;  4HNV A;  2N55 A;  2E2D C;  2FKL A;  5KFG A;  1GUS A;  4F50 A;  1FJG L;  4O1N A;  3ND9 A;  5C5M A;  5D1O A;  4XDX A;  4Y7N B;  2WAQ G;  4FBT A;  4OIK A;  2VA3 A;  5KRU A;  4X62 L;  4KHV A;  5C1O A;  2PI2 E;  5HGT A;  1VQ8 A;  4WRD A;  3G71 A;  4CKE A;  4QWD A;  4ECS A;  4FU0 A;  5FJ8 H;  1KBL A;  1VBG A;  1LTS D;  3GP7 A;  3K5M A;  4HNT A;  4FBU A;  5GQO A;  3V6J A;  2HCI A;  2ZJR A;  3C1F A;  1DOL A;  1ONL A;  2W71 A;  4IQZ A;  1BR9 A;  2O2L D;  1A6X A;  4A3F H;  1CTM A;  2AQ2 B;  1ENC A;  5IYZ F;  4OON A;  2XRQ D;  2F0T A;  4G4K A;  1QB5 D;  3BZD B;  3MFY A;  4YBZ B;  2B3G A;  4DL5 A;  5A2Q W;  4OX9 H;  5KFA A;  1K3R A;  2VXW A;  1CSQ A;  2A5H A;  4F88 A;  2CQY A;  2WAQ A;  4JI3 H;  3VPC A;  5IP7 G;  3GTM A;  2YCH A;  2RCN A;  4A3J G;  4LF6 Q;  2PW7 A;  4IFD H;  4C3J G;  2RA4 A;  4JC0 A;  2XSC A;  3GTL H;  1WH2 A;  4B3M Q;  3JSL A;  1FJG H;  4IO9 A;  2IA6 A;  3HOZ H;  1SYC A;  3JZI A;  4UCV A;  3QZ7 A;  1T5X D;  4LF9 L;  4LNQ A;  5M3M G;  2FE3 A;  1PDQ A;  4DR6 Q;  2GPS A;  3PO2 H;  1V1P B;  4HMJ A;  5M3F G;  3CD6 A;  2J6S A;  1LV9 A;  1PLF A;  1FGU A;  1Q90 A;  3GII A;  1V4Y A;  4EX5 A;  5JEA J;  1XJV A;  3WO1 A;  4MA5 A;  1LYL A;  2W8K A;  2XRS D;  2B2U A;  2JA7 H;  4A3E B;  1XMQ Q;  1JIC A;  1YNJ C;  1MJE A;  3RZO H;  2RSN A;  1PH4 A;  1KJ9 A;  2JA5 G;  3GTK A;  5E4X A;  4M1U B;  4GC7 A;  4JI8 L;  1YJW A;  3GLK A;  1LLR D;  4LF4 Q;  1FR3 A;  4YHH H;  5JUM A;  1B9M A;  3TZU A;  2HVS A;  1NBW A;  4JG2 A;  4WJ3 M;  1MSG A;  2UXB L;  2I46 A;  4O2B F;  2XN9 C;  5IWA L;  2I80 A;  2QA4 A;  1M6V A;  5KND A;  4GLX A;  2NU9 B;  3KTM A;  2QCP X;  4DA2 A;  4YJ3 F;  4ETS A;  3MEH A;  1D5X C;  4MAM A;  2EYM A;  1KIX A;  1JX4 A;  3BYT B;  1TWH A;  2Q8T A;  4LF9 H;  2A19 A;  3CCM A;  5IGD A;  3OHX C;  2JYO A;  3RJ0 A;  2PPB C;  2VNU D;  1BUV T;  2XGP A;  2PW5 A;  3T1Y L;  1S5D D;  2LXJ A;  1WCM G;  4DKA C;  2YS6 A;  1H95 A;  3HOV B;  5EOY A;  5EBC A;  5D1P A;  1QVG A;  4ZQ3 A;  4XZ3 B;  3KF8 A;  5CR3 A;  3LWB A;  3TRE A;  5CA1 F;  4RAZ A;  1C4Q A;  3IAY A;  1F9S A;  3T16 A;  4A3B G;  3GTG H;  4HJ8 A;  2FB9 A;  2FJZ A;  1SE2 A;  5DQH A;  5C0X H;  1WSC A;  1BDO A;  3K0Y A;  2UUB L;  4YR3 A;  4B3T H;  1XTC D;  3UI2 A;  1JJ2 A;  4OO1 G;  4LUO A;  1HNW H;  3MWY W;  5M5Y H;  5IWA H;  2KED A;  1IL8 A;  1PH8 A;  2IL8 A;  1EQR A;  1L0Y B;  1KQS A;  3VR4 A;  1STY A;  2JA9 A;  2IX1 A;  4R8N A;  3D4W A;  4AH6 A;  2ES2 A;  3S17 H;  1K28 A;  3OIP A;  4DK0 A;  2R93 A;  4MZ9 A;  1PMR A;  1LAB A;  2J7Z A;  4WJ4 A;  1DV2 A;  4MV7 A;  4TV9 F;  2L15 A;  3SE0 A;  4XYQ A;  1L2Z A;  2XIW A;  2K14 A;  4P2C B;  4YR2 A;  3P7J A;  5DNF A;  3T1Y H;  5DG9 A;  3CCL A;  3BG5 A;  1N33 L;  4EQP A;  1YIJ A;  5I47 A;  4DV0 L;  4DR2 L;  2XWJ B;  4HSP A;  3A74 A;  3T13 A;  3A56 A;  1SND A;  3CU7 A;  5KFE A;  4DL3 A;  1QNU A;  1I4R A;  2ZM6 H;  3MTS A;  2QDB A;  2Y0S E;  2O5I C;  5C44 H;  1EYG A;  1E1O A;  2UUB H;  4ME6 A;  4NXM Q;  2CQA A;  3NEL A;  5E7N A;  1JMC A;  5C1P A;  4KY5 A;  3BAA A;  4OO1 I;  4L5S A;  3EBE A;  2JN4 A;  3NTI A;  1SLJ A;  4UAI A;  1EUC B;  4R8I A;  3F8N A;  4DR4 H;  1VQE A;  1ASY A;  3S16 H;  2RDJ A;  3PW0 A;  2F0L A;  3GTK B;  1S68 A;  2QKI C;  2Q2U A;  4A3J B;  1XNR H;  1GJX A;  1V9P A;  4C3J B;  2VPS A;  1Y14 B;  2JEB I;  2PVP A;  1XX8 A;  1CFM A;  5K36 H;  2UVU A;  4Q8E A;  3CCE A;  1A8V A;  4XTC S;  4WD3 A;  4NXN Q;  3KF6 A;  2C2R A;  5M3M B;  3HOU G;  5I9O A;  4A3G H;  5J2T F;  1Q3L A;  3WWV A;  5M3F B;  3FMC A;  1N33 H;  4LF7 Q;  3CCU A;  4DV0 H;  4DR2 H;  3GV7 B;  5D3I B;  2ICE C;  3WNZ A;  4RB1 A;  1TWH B;  1LT5 D;  2E2H A;  3PUV A;  2K50 A;  1CM9 A;  1BQQ T;  1SEI A;  1GXD C;  4A3M H;  1QWY A;  3SXH A;  2JA5 B;  1A9X A;  4HJ9 A;  4FM9 A;  5ELO A;  1RJR A;  2ATL A;  3VR6 A;  4C2M A;  1Y1V H;  4DFA A;  3I55 A;  1S9F A;  3GTQ A;  5EJW A;  3P20 A;  5JEA H;  3J80 L;  5EBD A;  2YTX A;  4ZLT F;  2IJ0 A;  4CKB A;  4IPG A;  1HZC A;  1KRS A;  5L1K A;  3DEP A;  5FJ8 G;  4DV6 L;  2AMC B;  3J80 i;  4JI6 L;  3TS2 A;  1BCP D;  4LJZ C;  2HJW A;  1EHI A;  2NN6 G;  3S2H H;  3DF7 A;  1PH7 A;  3N41 B;  4XQQ A;  2V4R A;  2PYK A;  1PK8 A;  5KFT A;  3K7A H;  3M7G A;  3QB3 A;  1SJH D;  1S10 A;  2OTJ A;  1OXU A;  4IUV A;  1WCM B;  1VDZ A;  1AEX A;  1RHP A;  1XNQ Q;  5JPN C;  4M8A A;  3F2B A;  3KLR A;  3SDZ A;  3TZD A;  3T56 B;  1SSO A;  4A3C H;  4RAY A;  1O7Y A;  2W6N A;  4A3B B;  2JP1 A;  1KJJ A;  3HKZ G;  3CC2 A;  2NVX B;  2KHJ A;  4IFD G;  1MSH A;  2HIX A;  5NUC A;  5HV6 A;  1PFN A;  1GUG A;  5CB4 F;  3RD4 A;  3HOZ G;  5JVD F;  1YBY A;  4PZ7 A;  3OWE B;  3NWT A;  1F2Y A;  4EQO A;  1M1K C;  4X65 Q;  5JVH 3;  4X3S A;  2UU9 Q;  4ZYS A;  1SNO A;  5F9N A;  4Q43 A;  3CCR A;  1RYS A;  2SCU B;  3PO2 G;  1LT3 D;  1ZXT A;  2HDL A;  1GHJ A;  2ZTD A;  1I4G A;  4IUT A;  5JVL A;  3RBD A;  2K5N A;  2MPM A;  3K6O A;  4KJN A;  5LHY 1;  3H40 A;  4DV6 H;  1TWC H;  4RCN A;  4JI6 H;  1EOT A;  2NN6 I;  2WAC A;  3BU2 A;  2H5X A;  1SMX A;  1EQQ A;  1MIU A;  4WFN 3;  1HR0 Q;  3E9I A;  3RMH A;  2MFI A;  3R8B A;  1NR4 A;  5DQG A;  3CPW A;  2QDL A;  4XYM B;  3HKZ A;  1SE4 A;  2NU6 B;  1I6H B;  2UXC L;  3GTL A;  3ERO A;  2KEE A;  1EY4 A;  2L0C A;  3DMU A;  3KBX A;  3V4S A;  2ZTC A;  5KGU A;  3GID A;  3VA7 A;  2NTS A;  4FYD A;  1EFW A;  5GAD C;  4A3I G;  1NY4 A;  3KF6 B;  3CQZ H;  3K3V A;  1KAW A;  1SNQ A;  3M4Y A;  1UNS A;  1VQH A;  2L9H A;  4QW8 A;  2JSO A;  4I50 F;  3E0E A;  5KG3 A;  4DV4 L;  2VUG A;  3BDO A;  5DEH A;  2E2H B;  1J5E H;  2JA7 A;  3U9T A;  3T5K A;  4C3I H;  3M4Q A;  3M7N A;  1IW7 C;  1YIT A;  3G6J B;  3CC7 A;  2LSS A;  4QWE A;  2K5V A;  4NB3 A;  3PUX A;  4DK3 C;  3STB C;  2ALZ A;  1EQV A;  2D0O A;  5KFF A;  2FMM A;  4N9P A;  2BE5 D;  5C3X A;  2VQE Q;  2X6L A;  2YZG A;  2ZJQ A;  1F9R A;  3FP9 A;  3M4I A;  4C2M B;  3GTQ B;  5LL6 X;  4IPH A;  1HA5 A;  3I2Z A;  1XMO L;  3HOU B;  1B2T A;  4H44 C;  1ZKO A;  2PMZ B;  3MZ5 A;  2UXC H;  3NEN A;  3TS0 A;  4QF4 A;  1E1T A;  3PF4 A;  4WOR A;  3RB4 A;  5KG0 A;  3JSN A;  4AYB E;  4IUU A;  3RN5 A;  4BA2 I;  1B6S A;  1NCV A;  1A3T A;  1X55 A;  4RGM A;  5BR8 Q;  1UC9 A;  3Q8R B;  2BQR A;  1RK5 A;  1IBK Q;  1UE5 A;  3Q22 A;  2A1A A;  1I4Q A;  4GKJ Q;  2I8C A;  1HZB A;  2A6H C;  3BZC A;  3SGI A;  1DOM A;  2R7L A;  2BOS A;  1C7Y A;  1T94 A;  3MJF A;  4A3E H;  4LFB L;  1I94 Q;  4JI2 H;  3GTG A;  2NWG A;  2UXD Q;  2A73 B;  3WOF A;  1XDN A;  1BBX C;  4JV5 H;  4IZ8 A;  4QIW E;  1ZHS A;  2R8K A;  3MR5 A;  4CDF C;  3VDY A;  2C00 A;  2Z0S A;  1K0S A;  3KYH C;  3D6W A;  5LMN Q;  4JBM A;  1B33 N;  2HT1 A;  3VYT A;  1XMO H;  5C44 G;  1ZET A;  3N6R A;  1GUT A;  4EBC A;  1UE1 A;  3FKI H;  1DM0 B;  1JJC B;  3VR2 A;  3GTJ A;  1ENF A;  2R82 A;  5KG4 A;  2XWB B;  1JDE A;  4QWC A;  4X64 L;  3ETJ A;  1X65 A;  5CBE E;  4DV7 Q;  2YL2 A;  5COY A;  2UUC H;  3HKZ B;  4JI1 L;  1VF7 A;  3HOV H;  3GTL B;  3ICE A;  3QZ8 A;  1KXL A;  3Q8Q B;  1LT4 D;  4K8J A;  1SAP A;  2F4V Q;  3HOZ B;  1EEI D;  3NBH A;  4P72 A;  5C3W A;  2CW8 A;  2SNM A;  3OIQ A;  4UFZ A;  3OHA A;  4PNY A;  1S4Z A;  1U4R A;  2K75 A;  3K58 A;  3H3V C;  3PO2 B;  4F7X A;  4ZUI A;  1ILP A;  2CFM A;  1ASZ A;  2UU9 L;  3SEB A;  1NNX A;  3A8I E;  4F4W A;  3TSS A;  3MXG A;  3PVX A;  3FRP B;  4IRK A;  1X54 A;  1OO9 B;  1QVC A;  2PO4 A;  2KCM A;  4DAY A;  1QCB D;  3Q0A A;  4DV2 L;  3MWM A;  4O4H F;  4JI4 Q;  2KCC A;  3C1E A;  4UCO A;  4DPG A;  2RHS B;  1Y69 U;  3NSW A;  4OHJ A;  2YYA A;  4TKO B;  4R4C A;  2AWO A;  2UUA Q;  4NP5 A;  3KXY T;  3EVQ A;  1Y1V G;  3BJU A;  3MEF A;  2XNA C;  5G3L D;  4DK1 A;  4X64 H;  5JEA G;  5FO7 B;  4JV0 A;  3V2T A;  5I2Y A;  3TN2 A;  4A3I B;  1L2F A;  3PIP A;  2NTT A;  4QUF A;  3PGZ A;  1S40 A;  2IP4 A;  3QG1 A;  1EIY B;  4ZKC B;  1G91 A;  4QY7 A;  3PF5 A;  1CQV A;  2PNR C;  1I3Q H;  4O3N A;  1JE4 A;  1GLV A;  1JKJ B;  4ECT A;  2W7O A;  1Q1B A;  5AFW A;  2IWH A;  4N8X 1;  5H80 A;  2R86 A;  4X66 H;  2W6O A;  1O7I A;  3KHH A;  1UWV A;  3IN5 A;  3EIV A;  4OWT B;  1OXX K;  3AB9 A;  4EG0 A;  2H1E A;  1WTV A;  1GYF A;  5HBR B;  1S03 G;  1Y1V A;  4A3C G;  1I6V C;  4DV2 H;  3JRX A;  5CC4 A;  1EYC A;  2WIN B;  2RDI A;  1ZHQ A;  1VQI A;  4K0K H;  2QEJ C;  4QWB A;  4A3J H;  3KAK A;  4C3J H;  3SK8 A;  2Q8R E;  1T3N A;  1ET9 A;  2AU0 A;  1Z2N X;  2V4Q A;  3CMA A;  4K6D A;  2K32 A;  5M3M H;  4J1M A;  1L0X B;  4B9W A;  1W6J A;  4JI3 Q;  1R4Q B;  4XT3 B;  1LTL A;  1SXT A;  2EXD A;  3NE5 B;  4QMG A;  5A2Q E;  3EPG A;  1FJG Q;  3ULJ A;  1X3P A;  4IN3 A;  3VYR A;  4EFB A;  3PZP A;  1X32 A;  1UAP A;  4X62 Q;  3JRW A;  3BVM A;  1AFP A;  2NU8 B;  2D62 A;  2DUD A;  5A35 A;  1PFB A;  2AUK A;  1I94 L;  5BPF A;  5C5J A;  3NBH B;  1I5F A;  4OL7 A;  2W9B B;  1H9M A;  5CV9 A;  5J2U F;  1QIL A;  3RUP A;  1HQM C;  5KX5 F;  1N8R C;  3VA5 A;  5FOB B;  5C44 B;  4J6H A;  3A5U A;  2EJM A;  3K59 A;  3RTX A;  3S1N B;  1TII D;  2R7Z H;  5LMN L;  1VQJ A;  1TWC A;  4NLG A;  2FJ2 A;  4DXF A;  3N52 A;  2SNS A;  4DL2 A;  4OIJ A;  5JOB A;  4PZ6 A;  3ERS X;  4KY7 A;  4J9N A;  4YHH Q;  2DPI A;  4C3I G;  1T5E A;  4DAY B;  1RDP D;  3S16 B;  2F0M A;  3DWQ A;  1TA8 A;  3RUZ A;  3J7A 5;  5DAU A;  1TQO A;  3R2T A;  1A2T A;  4KTA A;  1N56 A;  5FLX c;  1CKO A;  4JI5 H;  2IW3 A;  3AFP A;  1WCM H;  1LTT D;  4GNX C;  2YYZ A;  3C0F B;  4J9K A;  4G7O C;  5D8D A;  1LT6 D;  2W57 A;  1K8O A;  2A6E D;  3RNU A;  1S5F D;  3V6H A;  4A3B H;  4DAM A;  2L55 A;  2NVX H;  2F0G A;  4LF9 Q;  3CQZ A;  3NHH A;  3M9N B;  1K8A C;  4HMI A;  1CQJ B;  3PW4 A;  4X3T A;  1Q8I A;  1MKH A;  4GC6 A;  4DV3 L;  5L1I A;  4OO1 H;  1LTB D;  1VF5 C;  1EWC A;  5KFS A;  3MR2 A;  1BNC A;  2I0Q A;  1A2U A;  3CKI B;  1JB3 A;  1B6R A;  3NWS A;  1K8M A;  3E5S A;  1W2B A;  2KEC A;  2Y0S G;  2PQE A;  4RGN A;  2PN1 A;  3UDG A;  1EU4 A;  2X6G A;  2KHI A;  1Y1V B;  5HY6 A;  5LL6 b;  4DL7 A;  5EZY F;  2UUA L;  3PQI A;  1HNW Q;  4IWY A;  3D3R A;  4QCL A;  2B2V C;  3GIK A;  2Z8L A;  5C4X H;  2O03 A;  2Z9H A;  5IWA Q;  2AGO A;  3V05 A;  1TY2 A;  5LMN W;  2J0T D;  2JXM B;  4R9W A;  3KUP A;  2RQX A;  3SK4 A;  1KC7 A;  3Q24 A;  2JK8 A;  1HA6 A;  2GN5 A;  2YTV A;  1VQ4 A;  3S2H B;  3NGD A;  3KAJ A;  2HVQ A;  4BXX H;  3K7A B;  4LF5 H;  1M0T A;  1V1P A;  2BA0 A;  5JJZ A;  1S0N A;  2PZW A;  3FKI G;  5H1S E;  2UVV A;  5IGE A;  3T1Y Q;  4JI7 H;  2OF1 A;  3RN2 A;  4DV3 H;  2QK4 A;  3NEM A;  1IYV A;  5LMU H;  3QIA A;  3JAM L;  1PA6 A;  4PZ8 A;  4UPA A;  3T5H A;  1M8A A;  4UDU C;  1SDF A;  3VYS A;  1PH1 A;  4MV6 A;  1PFS A;  2CHB D;  1VQK A;  3I4N G;  3RAQ A;  2R8J A;  1D8L A;  5IT9 E;  4KHP H;  1GSO A;  4KY6 A;  3I4M H;  3TME A;  3T5L A;  3JAM i;  1EWI A;  5KNC A;  2BDN A;  2UUB Q;  4C3H H;  1QVF A;  3UE0 A;  3KJP A;  1Z9F A;  2IX0 A;  3CVZ A;  1SCU B;  3HOU H;  1SYB A;  1S5B D;  2HVR A;  3FKI A;  2MHV A;  5J1Z A;  3S1M H;  3CME A;  4CHT B;  1VQM A;  3HG9 A;  4LSX A;  1TWC B;  1I50 H;  3BVZ A;  4UCU A;  4QJF A;  1A62 A;  3MHB A;  2ZXP A;  4OX9 L;  1DJR D;  1XNR Q;  4U7C A;  3RLO A;  4M9U A;  3KFU A;  1UE6 A;  3I12 A;  5CV6 A;  4R7R A;  1KLU D;  4L63 B;  4WBN F;  5DG8 A;  3GO5 A;  2BDO A;  2VB2 X;  1OTC A;  4MV1 A;  1AZP A;  2VUM H;  1N33 Q;  2B63 H;  1PH2 A;  4DV0 Q;  4DR2 Q;  4L5T A;  3CQZ B;  1GUO A;  5EDW A;  1E2V A;  2OH2 A;  1V51 A;  1ICF B;  3A55 A;  1B3Q A;  4Z9C B;  1F77 A;  3BQ2 A;  1C3O A;  2XGQ A;  2NN6 H;  3H3V I;  4C3I B;  4EQ5 A;  1EY5 A;  1TY0 A;  5CV7 A;  5FLX E;  3HOX H;  2DJG C;  2Z6K C;  4YHH L;  1Q82 C;  4ME5 A;  4DR1 L;  1PXU A;  2BH8 A;  4RZR A;  2ZDH A;  1WYD A;  2A74 C;  2I5L X;  5BPH A;  4J9S A;  1G2S A;  3UDX A;  3J7Z C;  1EY8 A;  1VKZ A;  1BVS A;  4G7Z C;  3OW2 A;  1IKL A;  1PRT F;  3I91 A;  3RGZ A;  5IOC A;  1CZG A;  1I3Q A;  4Q45 A;  5IIF A;  2C5C A;  2C35 B;  3DWA A;  2ID0 A;  4JBK A;  1S3O A;  3BS1 A;  2I5M X;  1KJQ A;  4G7H C;  4PQX A;  3A8K E;  5EPL A;  1I4X A;  4YCU A;  4DLK A;  5EPJ A;  3W1G A;  4ED2 A;  4U6P A;  4DR7 H;  5BN5 A;  3H91 A;  2Y0S B;  1SFO B;  4RZQ A;  3D8G A;  3V6K A;  5C5L A;  5L37 A;  3KHG A;  3P75 A;  3PO3 H;  4HNU A;  2O4X A;  1R4P B;  3M9B A;  1QUQ B;  3RBE A;  4B3T L;  3TRZ A;  1HXY D;  2BQU A;  3OSO A;  2D2C C;  3RZD H;  1VQF A;  4LMY A;  4DR1 H;  3A8J E;  1TS5 A;  3KOJ A;  1S0O A;  4DUZ L;  1HNW L;  1FNU A;  3G7L A;  3PMF A;  2JJQ A;  1NE3 A;  4DV6 Q;  1AN8 A;  4JI6 Q;  2K5H A;  4A3I H;  1PTO F;  2SEB D;  1QNK A;  3BVG A;  2KSW A;  5KFI A;  3K5L A;  2F03 A;  2R7Z G;  2FP4 B;  3FKI B;  2HDM A;  1LTG D;  5KYL A;  1EIF A;  4QGU A;  1SMY C;  4KHZ A;  4C5C A;  5C4J H;  1VQ7 A;  2FLN A;  4A3D G;  3MXU A;  3QJY A;  2EYF A;  4P71 A;  4AYB G;  1P16 A;  1DD2 A;  4ED6 A;  2JA5 A;  4KKS A;  3I4N B;  4LFC H;  3MWD A;  4MN3 A;  1BBU A;  3T1H H;  4DUY L;  3SE7 A;  4LAA A;  3GV3 A;  2NBF A;  2C28 A;  2VR1 A;  5AJ3 L;  1ICW A;  2ASJ A;  3KDF A;  2ZM6 L;  1DCZ A;  2R7N A;  2DLN A;  3HZX A;  2VOB A;  4DV1 H;  2I07 B;  3HBL A;  3EQL C;  5KEE A;  1KJ8 A;  5DGB A;  1H9R A;  3CCS A;  4R1J A;  4N9T A;  3G6X A;  4Q8F A;  1YNJ D;  4DUZ H;  1K83 B;  2M05 A;  4DR4 L;  3TQ1 A;  2QF7 A;  5KT4 A;  1M7J A;  3L7Z C;  1XTD A;  1Y1W H;  1ESF A;  1PTO B;  2FHT A;  1B8A A;  1BJT A;  1WCM A;  5FK9 C;  1XNR L;  4TUY F;  3I70 A;  5GAE C;  4K2L A;  3I3C A;  4K5W A;  1CUK A;  5DLQ E;  1H9S B;  5ELB A;  4HED A;  4GNX A;  2YS7 A;  2UXC Q;  4DK6 C;  2XCP A;  4H13 C;  3CRL C;  1GD7 A;  1VQC A;  2GLT A;  5KKN B;  1K0R A;  3PUW A;  5IGB A;  1VAJ A;  2B2W C;  1M0W A;  1WR2 A;  2NVX A;  5C4X G;  1D5M C;  1OWT A;  2RDH A; 
#chains in the Genus database with same CATH homology
 4XIG S;  3E0E A;  4DR3 L;  4DV4 L;  1YEZ A;  5HGQ A;  2AHO B;  3MXN B;  3HOW H;  2B29 A;  2IT1 A;  2F3I A;  2IY5 B;  2FXQ A;  2RHQ B;  4JI0 L;  4DR3 Q;  4C3I H;  3U50 C;  3M4Q A;  4DV4 Q;  3M7N A;  2WFW A;  4IPC A;  1VCI A;  2VQE L;  5IP7 H;  3CC7 A;  1YIT A;  4A76 A;  2LSS A;  3GTK H;  2K5V A;  3KLW A;  3PUX A;  4NB3 A;  4DK3 C;  5IT9 c;  2E2I H;  3STB C;  4JI0 Q;  5IP9 G;  2MQH A;  3D31 A;  3S1N H;  3CCJ A;  2D0O A;  2N49 A;  1YZ6 A;  5GAG C;  2VQE Q;  1BKB A;  4DR7 L;  2QGQ A;  1NTG A;  1NJI C;  4JV5 Q;  2ZJQ A;  3FP9 A;  1XPU A;  3F2C A;  4A3K G;  3D0F A;  3H15 A;  4HIK A;  4KLK A;  4IPH A;  3I2Z A;  1XMO L;  4GOP B;  1SR3 A;  2VW9 A;  2JQO A;  1VQO A;  5M3F H;  1HZ9 A;  1SN8 A;  3H0G H;  3NEN A;  3I4M G;  1XMO Q;  3TS0 A;  3W1B A;  3L2P A;  1E1T A;  3PF4 A;  1TWH H;  4A93 H;  4P74 A;  5BR8 L;  1HR0 W;  3S1Q H;  4JBW A;  4R4I A;  3K8A A;  4AYB E;  1IBK L;  3RN5 A;  4BA2 I;  3L0O A;  4PG3 A;  4GKJ L;  1NMG A;  1X55 A;  3PUY A;  5BR8 Q;  3U4V A;  2JA5 H;  4HJ5 A;  1IBK Q;  4JYA L;  3DM3 A;  1UE5 A;  2A1A A;  1M90 C;  4GKJ Q;  3CW2 C;  4HJ7 A;  1HZB A;  3SGI A;  3BZC A;  4ME3 A;  3F2D A;  1Q8K A;  4HJA A;  2UUC Q;  2CKZ B;  2UXD L;  4YWL A;  4JYA Q;  1C7Y A;  2R7D A;  2VY3 A;  4A3E H;  4LFB L;  1I94 Q;  1G6P A;  3PCO B;  1Q81 C;  1YNX A;  2UXD Q;  4P75 A;  4QIW E;  1NMF A;  1IL2 A;  1J6Q A;  4LFB Q;  3HOW G;  3VDY A;  4H02 A;  4LFC L;  2VUM G;  2Z0S A;  3T1H L;  1V43 A;  2MO1 A;  3KYH C;  5LMN Q;  4JBM A;  2B63 G;  2NVT H;  1SRO A;  4IFD J;  1X3G A;  1VQG A;  2HT1 A;  4R4O A;  4JOI A;  3U4Z A;  4A75 A;  3U58 A;  4LFC Q;  5C44 G;  3S15 H;  3KDF B;  3T1H Q;  2Q2T A;  4POG A;  1TXY A;  1UE1 A;  3FKI H;  1UE7 A;  3B6Y A;  1B7Y B;  1JJC B;  4GN5 A;  4DV1 L;  4DV7 L;  4IJH A;  4IPD A;  2K52 A;  4GN3 B;  3M85 A;  1A0I A;  4X64 L;  4DV1 Q;  1X65 A;  2E5L L;  1PV4 A;  4DV7 Q;  2JEA I;  3PV0 A;  3I4O A;  3HOX G;  1AH9 A;  2JE6 I;  4BY1 H;  3H0G G;  2F4V L;  4GKK L;  4YY3 L;  4JI1 L;  4X64 Q;  4JCV E;  2E5L Q;  2KEN A;  2A8V A;  3HOV H;  3ICE A;  1KXL A;  2V1C C;  3PIO A;  2VS1 A;  2F4V Q;  4P72 A;  4GNX B;  4LF8 Q;  4GKK Q;  4YY3 Q;  4JI1 Q;  3F8T A;  2K75 A;  5J3B A;  4P73 A;  4X6A H;  3K80 C;  2R6G A;  2Q2I A;  5IYB G;  2CFM A;  1ASZ A;  2UU9 L;  1GO3 E;  1VQP A;  2AWN A;  2GVA A;  3I56 A;  1E7Z A;  4JI4 L;  4JI8 Q;  4BBS G;  2EQS A;  4AIM A;  4A3E G;  3HOY H;  1X54 A;  4R4T A;  1Q46 A;  1KRT A;  4LWC A;  2HHH L;  1QVC A;  4DV2 L;  2KCM A;  3OTO L;  1C9O A;  1J5E L;  1S72 A;  1YJN A;  1G51 A;  4JI4 Q;  2UXB Q;  2WAQ E;  4DPG A;  2RHS B;  2BH2 A;  1I6H H;  4GLV B;  2MO0 A;  3RLN A;  2HHH Q;  4DV2 Q;  1KHI A;  1E24 A;  4R4C A;  2AWO A;  3OTO Q;  3DLL A;  1J5E Q;  1HNX L;  1VQL A;  3ULL A;  1EUJ A;  2UUA Q;  3CF5 A;  1GVP A;  2Z6K A;  1Y1V G;  3BJU A;  1HZA A;  3MEF A;  2I5H A;  3OYY A;  1YHB A;  4IJL A;  5JEA G;  4DNI A;  1HNX Q;  1IBM L;  3PO3 G;  1L2F A;  4BBR H;  3PIP A;  4DR5 L;  1N36 L;  3PGZ A;  1SRU A;  4YCV A;  4OXP A;  2ATW A;  1S40 A;  1SE8 A;  2ALY B;  1EIY B;  2R93 G;  3ZJY C;  4QY7 A;  4LFA L;  4DR5 Q;  3PF5 A;  2VL6 A;  1N36 Q;  1I3Q H;  2E2H H;  3CPF A;  3PUZ A;  2JA6 G;  5JJK A;  4NPS A;  1JJG A;  1Q1B A;  4LFA Q;  3HFZ B;  1G29 1;  1X3F A;  2RF4 A;  1YHQ A;  1O7I A;  3HOV G;  1UWV A;  5IY0 A;  3EIV A;  3PSI A;  5M5W H;  4OWT B;  1OXX K;  3AEV A;  4HIM A;  4C2M H;  1BBW A;  2CWP A;  1V1Q A;  3GTQ H;  4A3C G;  2JA8 H;  4GOP C;  4JI2 L;  5IE8 A;  1GKH A;  1T9H A;  1VQI A;  2NZO A;  4JV5 L;  1K9M C;  4O2D A;  3GTJ H;  4A3J H;  1FVI A;  4C3J H;  2N8N A;  1E22 A;  4JI2 Q;  1DGS A;  1B70 B;  2GVB A;  2NVY H;  5EAY A;  3E9H A;  1FL0 A;  4JI3 L;  3CMA A;  2XTI A;  1VQA A;  5M3M H;  2AKW B;  3G48 A;  2YV5 A;  2ZJP A;  4IOA A;  4JI3 Q;  1FJG L;  1U5K A;  1LTL A;  2WAQ G;  2EXD A;  4ALP A;  4JI5 Q;  4B3R L;  4X62 L;  4JBJ A;  2PI2 E;  4IOC A;  1FJG Q;  4GLA C;  3ULJ A;  1VQ8 A;  1Y1W G;  3G71 A;  3M3Y H;  3TEH B;  4B3R Q;  4X62 Q;  1HJP A;  2UUC L;  1IXR A;  1QZH A;  5FJ8 H;  2K4K A;  2D62 A;  2HIV A;  2DUD A;  5GQO A;  1I94 L;  2ZJR A;  1OXV A;  1I5F A;  3NBH B;  2OCE A;  1SFO H;  2OWO A;  2BA1 A;  4A3F H;  1N8R C;  3Q8D A;  1PH5 A;  4OON A;  4LUZ A;  3F1Z A;  4MTN A;  3A5U A;  1Q1E A;  2PQA B;  4UY8 C;  2R7Z H;  5LMN L;  1VQJ A;  2B3G A;  3CP0 A;  1JE5 A;  1K3R A;  3J81 j;  4PZ6 A;  4LF6 L;  1CSQ A;  3ERS X;  1HH2 P;  4YHH Q;  1JB7 A;  4DAY B;  4B3M L;  5IP7 G;  3J7A 5;  1PH9 A;  3W5O A;  2RCN A;  4A3J G;  5FLX c;  1CKO A;  3STB D;  4LF6 Q;  3GTL H;  4JC0 A;  1VQ5 A;  3AFP A;  1OXT A;  1WCM H;  2YTY A;  1TWA H;  4GS3 A;  4IO9 A;  4B3S L;  4B3M Q;  3HOZ H;  4DR6 L;  4GNX C;  2YYZ A;  1XPO A;  4LF9 L;  5C3E H;  2E2J H;  4LNQ A;  5M3M G;  4R4Q A;  4YWK A;  4HIO A;  3RNU A;  1Z47 A;  4B3S Q;  2PNH A;  2YU9 H;  4DR6 Q;  3PO2 H;  5M3F G;  4A3B H;  4DAM A;  4GN4 B;  2NVX H;  4LF9 Q;  3CD6 A;  1FGU A;  1YHA A;  3UDI A;  1PYS B;  3FHW A;  1K8A C;  4LF8 L;  3RR5 A;  4EX5 A;  1XMQ L;  3KF8 B;  1L1O A;  1N9W A;  5JEA J;  1XJV A;  3I4N H;  4A93 G;  1LYL A;  1MKH A;  1D7Q A;  2OQ0 A;  4DV3 L;  2OTL A;  4A4I A;  2JA7 H;  1XMQ Q;  4LF4 L;  1MJE A;  1IZ6 A;  5GAD C;  2I0Q A;  3RZO H;  1PH4 A;  4DV3 Q;  2JA5 G;  4X66 L;  3H3V H;  1LM0 A;  4JI8 L;  5FLM H;  1YJW A;  4LF4 Q;  2PQA A;  1W2B A;  4KI0 A;  2Y0S G;  1NBW A;  4X66 Q;  4JG2 A;  3UDG A;  4WJ3 M;  2UXB L;  1L0W A;  2KHI A;  5HY6 A;  4A3F G;  1K83 H;  5IWA L;  1MJC A;  3UDF A;  2NVQ H;  2QA4 A;  1KC8 C;  2UUA L;  2R92 H;  1HNW Q;  4GLX A;  1VQB A;  3IRB A;  1WFQ A;  5C4X H;  4K0K L;  5IWA Q;  4LW1 A;  4O0A A;  5LMN W;  1KIX A;  2JK8 A;  4HID A;  2A19 A;  3CCM A;  4K0K Q;  2GN5 A;  2YTV A;  3CCV A;  1VQ4 A;  2VNU D;  3GTP H;  2EIF A;  3M4P A;  4BXX H;  3AFQ A;  3T1Y L;  2BA0 A;  2LXJ A;  4DKA C;  1WCM G;  3FKI G;  5H1S E;  1H95 A;  1HNZ L;  1E3P A;  2NZH A;  1XPR A;  3GDE A;  1QVG A;  2PI2 A;  3TRE A;  3T1Y Q;  5JJL A;  3RN2 A;  4YCW A;  1HNZ Q;  3NEM A;  4A3K H;  1VQ9 A;  3A5Z B;  4A3B G;  1PA6 A;  4PZ8 A;  4UPA A;  3GTG H;  4HJ8 A;  4A3L H;  3CXC A;  4BY1 G;  2D0P A;  1PH1 A;  1VQN A;  1PFS A;  1VQK A;  2UUB L;  4FDB A;  4OWW B;  3I4N G;  1D8L A;  2WB1 G;  3CCQ A;  3I4M H;  3S24 A;  3JAM i;  1EWI A;  1JJ2 A;  4OO1 G;  4AQY Q;  2JA7 G;  4LUO A;  2UUB Q;  1KL9 A;  4C3H H;  1QVF A;  1JT8 A;  5M5Y H;  4JOI C;  3UE0 A;  3GTM H;  3KJP A;  1Z9F A;  2IX0 A;  1PH8 A;  1A63 A;  1C0A A;  1EQR A;  3HOU H;  1PH6 A;  1KQS A;  3S1M H;  1QZG A;  3CME A;  2JA9 A;  2IX1 A;  4AH6 A;  4Y7N H;  1VQM A;  2ES2 A;  3S17 H;  1I50 H;  3HOY G;  4MZ9 A;  1A62 A;  4QJF A;  4OX9 L;  4WJ4 A;  1XNR Q;  2L15 A;  3RLO A;  4APV A;  3KFU A;  1UE6 A;  2VZA A;  4OWX B;  2K14 A;  4IFD I;  1X3E A;  4OX9 Q;  3CCL A;  1YI2 A;  1N33 L;  1EOV A;  3GO5 A;  4JI5 L;  1YIJ A;  4DV0 L;  4DR2 L;  1OTC A;  1U0L A;  2VUM H;  3A74 A;  1N33 Q;  5M5X H;  1VQ6 A;  4QQB X;  2KCT A;  1PH2 A;  4NXM L;  3JC6 6;  2B63 H;  4DV0 Q;  2ZTE A;  4DR2 Q;  3GTO H;  4L5T A;  2R7F A;  2Y0S E;  4BBR G;  5C44 H;  1EYG A;  1E1O A;  4NXM Q;  3NEL A;  1UEB A;  5E7N A;  3JAM c;  1JMC A;  3S1R H;  3S14 H;  1VQD A;  1L1O B;  1CKN B;  4L5R C;  4OO1 I;  4L5S A;  3EBE A;  1SLJ A;  4A3L G;  1PHJ A;  1VQE A;  3J81 c;  1ASY A;  4BA1 I;  2F52 A;  3S16 H;  4DR7 Q;  3H3V I;  5C0X G;  3CAM A;  4EQ5 A;  3GD7 A;  1AE2 A;  3HOX H;  2Q2U A;  3K0X A;  1V9P A;  4NXN L;  2Z6K C;  4YHH L;  1IBL L;  1Y14 B;  2JEB I;  1TWG H;  3HKZ E;  1Q82 C;  4BY7 H;  4DR1 L;  2BH8 A;  3CCE A;  1A8V A;  4XTC S;  2JA8 G;  4NXN Q;  1WI5 A;  1IBL Q;  3KF6 A;  1N34 L;  1WYD A;  1KD1 C;  4LF7 L;  3HOU G;  2I5L X;  5JJI A;  4A3G H;  4DR1 Q;  1CKM A;  3WWV A;  5IYB H;  3UDX A;  3J7Z C;  4A3D H;  1BVS A;  4MNO A;  4LF7 Q;  3CCU A;  3I7F A;  3UE1 A;  3OW2 A;  1N34 Q;  1W3S A;  1K8G A;  4PMW A;  4BBS H;  3AYH B;  1RIP A;  1TWF H;  2QEX A;  3HKS A;  3PUV A;  2C35 B;  2K50 A;  2WB1 E;  3ER0 A;  2ID0 A;  4JBK A;  1S3O A;  3CC4 A;  1WJJ A;  2I5M X;  5IYC H;  4A3M H;  4TVA B;  4RG1 A;  3K7U C;  4LF5 L;  2LXK A;  4YCU A;  1X9N A;  2E8G A;  4HJ9 A;  3W1G A;  3LGJ A;  5ELO A;  1P8L A;  4UP7 A;  1CKN A;  4LF5 Q;  2Q2H A;  4JI7 L;  1Y1V H;  3I55 A;  4TQU S;  5LMU L;  5C0X I;  3KJO A;  3M4O H;  2YTX A;  2OQK A;  4GOP A;  3PO3 H;  4JI7 Q;  4IPG A;  5IYD H;  1HZC A;  1KRS A;  3M9B A;  1QUQ B;  5FJ8 G;  5LMU Q;  4KHP L;  4B3T L;  3G6E A;  3TRZ A;  4DV6 L;  2AMC B;  2CWA A;  3J80 i;  1R9T H;  4JI6 L;  3TS2 A;  3RZD H;  1VQF A;  2KBN A;  4BXX G;  2N78 A;  2NN6 G;  3KOJ A;  2R93 H;  4L5Q A;  4DUZ L;  3S2H H;  4KHP Q;  1HNW L;  4B3T Q;  2JA6 H;  2JJQ A;  1NE3 A;  4DV6 Q;  1PH7 A;  2CCZ A;  4JI6 Q;  2K5H A;  3K7A H;  1XNQ L;  4A3I H;  2OTJ A;  1PH3 A;  3A0J A;  2VQF L;  4DUZ Q;  4POF A;  1OXU A;  2R7Z G;  4BY7 G;  2XGT A;  4DV5 L;  1K73 C;  1PVO A;  5K36 G;  4UP8 A;  1XNQ Q;  3F2B A;  1EIF A;  1YJ9 A;  3S2D H;  1WOC A;  2VQF Q;  4QGU A;  1X6O A;  3K81 C;  4KHZ A;  4DV5 Q;  4A3G G;  4A3C H;  5C4J H;  1VQ7 A;  2HQL A;  4A3D G;  3HKZ G;  3CC2 A;  2KHJ A;  4IFD G;  4AYB G;  4P71 A;  4X65 L;  1CSP A;  1P16 A;  2HIX A;  3ULP A;  1VS0 A;  5ELN A;  3HOZ G;  1YBY A;  2DGY A;  4PZ7 A;  1BBU A;  5IP9 H;  4DUY L;  1M1K C;  5C3E G;  2UU9 Q;  4X65 Q;  1N32 L;  3CCR A;  1RL2 A;  5IYC G;  5GRO A;  4A3M G;  3PO2 G;  5AJ3 L;  4DUY Q;  3KDF A;  2ZM6 L;  1N32 Q;  2ZTD A;  4AQY L;  3J80 c;  1AE3 A;  1IYJ B;  2K5N A;  4RMF A;  1QUQ A;  5AJ3 Q;  1TWC H;  3EN2 A;  2ZM6 Q;  1HR0 L;  3CCS A;  2NN6 I;  4R1J A;  1OXS C;  2PMZ E;  2H5X A;  3BU2 A;  4Y52 H;  1SMX A;  1EQQ A;  1MIU A;  4LUV A;  4DR4 L;  2N3S A;  2WP8 J;  1HR0 Q;  3E9I A;  5IYD G;  1X56 A;  2MFI A;  3L7Z C;  4YWM A;  3J81 i;  1XTD A;  3CPW A;  5FLM G;  1Y1W H;  1Q86 C;  1Q12 A;  1B8A A;  3AQQ A;  1IBM Q;  4DR4 Q;  5GAH C;  2UXC L;  1Q7Y C;  1XNR L;  3G4S A;  2ZTC A;  5GAE C;  1YVC A;  5DLQ E;  5C0X J;  1CUK A;  2MNA A;  4GNX A;  3BZK A;  2UXC Q;  2IHE A;  2ASB A;  2IHF A;  4DK6 C;  1EFW A;  3RLF A;  1GD7 A;  1VQC A;  1LUZ A;  2CQO A;  1K0R A;  1NY4 A;  3KF6 B;  3PUW A;  4QL5 A;  4A3I G;  1GM5 A;  3CQZ H;  4J15 A;  2R92 G;  1KAW A;  3TQY A;  4UP9 A;  1VQH A;  5C4X G;  1L1O C;  1PYB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...