2JA7G

Cpd lesion containing rna polymerase ii elongation complex c
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*TP*AP*AP*GP*TP*AP*CP*TP*TP*GP *AP*GP*CP*T)-3'
publication title Cpd Damage Recognition by Transcribing RNA Polymerase II.
pubmed doi rcsb
molecule tags Transferase
total genus 26
structure length 171
sequence length 171
chains with identical sequence S
ec nomenclature
pdb deposition date 2006-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2ja7G02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 2ja7G01
4DR4L 3PO2H 3ULLA 2NVTH 1A63A 2IY5B 2E2IH 2YYZA 2C35B 2N3SA 5IYBG 4GNXB 3E9HA 4GLXA 4GOPB 4KI0A 4LW1A 1W3SA 3GTGH 4OO1G 1TWCH 2D62A 1PA6A 1PH7A 3UDIA 1ASZA 1JJGA 4XIGS 1WCMG 4DPGA 5AJ3L 3T1YL 4A3CH 2QA4A 3UE1A 3J80i 1KHIA 1XPUA 4LF4L 1PH5A 2Z0SA 1N33L 4OWWB 3ICEA 2UXBQ 1S40A 1HNZL 1DGSA 5M5XH 1SMXA 3ULPA 1Q1BA 2N8NA 2KHIA 4DV4L 1PYSB 2E2HH 2I5MX 2ZJQA 1WJJA 1YJWA 1LM0A 1J5EL 1HZ9A 4HJ7A 3CPFA 2ALYB 1N34Q 1ASYA 4C3HH 4B3SL 4DUZL 4BBSH 2B63G 3KF8B 2VW9A 2JEBI 2ZM6Q 4LFCQ 4UP8A 4IFDI 5IYDH 3KFUA 2CWPA 4MZ9A 4K0KQ 4DR3L 1BVSA 3GTOH 1X3EA 1AE3A 1VQKA 1N36Q 2R93G 1Y1WG 1I50H 1GO3E 2NVQH 3L7ZC 2R7ZH 3S1MH 1XJVA 1VQFA 2HQLA 2WAQG 1VQ9A 2V1CC 4LF9Q 2CWAA 5C3EG 1WI5A 4A3LG 1RIPA 4APVA 2A8VA 3I56A 1YVCA 4JV5L 3M7NA 3PF4A 2KHJA 2YTXA 5GAEC 4A3GG 3A5UA 1L2FA 2AKWB 1K8GA 3M4PA 2VUMH 2FXQA 1PH4A 2Z6KC 2A1AA 2HIXA 2LSSA 4IOAA 4A93H 4X66L 2JQOA 3PO2G 4A3EH 1VQ8A 1PH6A 4QY7A 3PO3G 2UUAL 2HT1A 4GKJL 3S1QH 2GVAA 1YHQA 3PF5A 4JYAL 1TXYA 1OXSC 3NBHB 4P75A 2H5XA 3KJOA 1KC8C 3CD6A 1B7YB 4A3GH 2RCNA 4IPDA 4LF7Q 1QVGA 2UXDL 2KCMA 4DR7L 2QGQA 1EUJA 4C3JH 1IBLL 1X3FA 4JI1Q 4A75A 1X56A 2BA1A 5M5YH 4UY8C 4A76A 5IP9G 3CC7A 4DR1L 3MEFA 2ZTEA 5IYCG 4HJAA 4NB3A 2MO1A 3S2HH 1C7YA 3CPWA 3K0XA 2UXBL 1NMFA 1SLJA 3D0FA 3PGZA 3I4MH 3UDXA 1Q7YC 4L5RC 2I5LX 4HIMA 2XGTA 3ER0A 3F8TA 1A62A 3TQYA 4C2MH 4BBSG 2VS1A 4IJHA 1UE5A 1Y1VH 1U0LA 2NN6I 4R4QA 3G6EA 4AH6A 2N78A 1B8AA 3FKIH 1XMQQ 4JI6L 4XTCS 4LFCL 2ZM6L 4DV2Q 2YU9H 2R7ZG 4BY7H 4K0KL 1K0RA 1NE3A 4JI2Q 3HOXH 3U50C 4X64Q 4DV5Q 4R4TA 1D8LA 3CCMA 4A3DH 1E1TA 4DV3Q 3KF6B 2ZTDA 4JI3L 3M4OH 3W1GA 1X6OA 2Q2HA 4YCUA 5GROA 4POGA 2Y0SE 4GN4B 3CCSA 2VY3A 2VUMG 1KXLA 2UU9Q 3BZCA 2OTJA 3TS0A 4HIOA 5H1SE 4OWTB 4A93G 3DM3A 4GKKQ 2AMCB 4DV6Q 1YI2A 3B6YA 4A3EG 2Q2UA 1VQIA 4DK3C 1YHAA 3H15A 3RN2A 3RZOH 1VQJA 3T1HQ 1E7ZA 4IPCA 1PV4A 2A19A 4IFDG 3S17H 4P72A 1AE2A 1OXTA 3GD7A 5GQOA 1XNRL 1CKOA 1VQHA 4GN3B 3AFQA 5FJ8G 4DV1Q 2YTYA 2PI2A 4DUYQ 3RLOA 4QGUA 3HOVH 2B3GA 3CP0A 1IBKL 1MIUA 1E24A 2ATWA 1JT8A 4LWCA 4BY1H 4AQYL 3S15H 2K5NA 3PCOB 4MNOA 4A3BH 5LMNW 1V43A 1BBWA 2GVBA 4OX9Q 2AWOA 1D7QA 1TWFH 4TVAB 1EOVA 1PFSA 4JBJA 4DV0Q 3I4MG 4YCWA 1WYDA 3FP9A 2IX1A 3GTLH 4OXPA 1OXVA 2NVYH 2ES2A 4HIKA 1QUQA 4HJ8A 2IX0A 1VQ4A 4BA2I 1SE8A 3D31A 4A3FH 1Y1VG 3TS2A 3TREA 1SRUA 1WOCA 2DUDA 3CQZH 3UDGA 1EIYB 1HR0L 2ID0A 4JC0A 4L5TA 4BXXH 3G71A 1T9HA 2IHEA 1I94Q 4JOIC 3GTJH 2WP8J 2MFIA 1Q12A 1UE7A 1PHJA 3CCLA 2JK8A 1HZCA 3NELA 3PUVA 1XMQL 4KHPL 1NMGA 4DV2L 4X62Q 1K3RA 5LMUL 2Y0SG 3E9IA 4DV5L 4H02A 3RR5A 1EIFA 3AYHB 4GS3A 3M4QA 4JI4Q 5K36G 4DV3L 2K52A 1UWVA 1JJCB 4PZ7A 4UPAA 3AEVA 2HHHQ 1K73C 3KLWA 5HY6A 5IT9c 4A3MG 2VQFQ 4X6AH 1NTGA 1PH2A 4DR6L 1V1QA 3GTQH 1MKHA 2UU9L 2XTIA 4P73A 1SROA 2JA8G 1G51A 4YCVA 2I0QA 2K5VA 1L1OA 4GKKL 4DV6L 1HNXQ 2NN6G 3K7AH 4IPHA 2R7FA 3G48A 4IPGA 4JG2A 1HJPA 4JI5L 3F2DA 2BH2A 2F4VL 1VQGA 1Y14B 3I4OA 1HNWL 4MTNA 3I4NG 1N32Q 3HKZE 5ELOA 3J7ZC 3HOWH 4DV1L 1YHBA 1RL2A 1VQMA 1Q82C 4YWLA 4DUYL 4AYBE 1HZBA 2JA6H 5JJKA 1VS0A 4HJ5A 4OWXB 1YITA 3AFPA 1VQBA 2NZOA 4PZ6A 4LFAQ 3S24A 4BBRG 1IBMQ 5IP7H 1E3PA 1XMOQ 5C4XH 4B3TL 1VCIA 1P8LA 4DV7Q 1K83H 4OX9L 1X65A 4NXMQ 1YIJA 2ZTCA 3U4VA 1TWHH 4BA1I 5GAHC 4GNXC 3AQQA 2QEXA 4GOPC 4DR5Q 2CCZA 1XNQQ 4A3CG 3GDEA 3J81c 1FJGQ 1VQCA 5C0XI 3J80c 5C44H 4B3MQ 1K8AC 4JCVE 1IYJB 1MJEA 1I94L 4P71A 3GTKH 2K14A 2PNHA 1H95A 1B70B 3HFZB 2E8GA 5BR8Q 5JEAG 4KHZA 3F2CA 1FGUA 1R9TH 4X62L 3KJPA 2BH8A 1CKMA 5IYDG 4JBKA 5FLXc 4LF5Q 2K75A 2MQHA 1N34L 4R1JA 2B29A 3EBEA 2OCEA 3SGIA 2HHHL 4JI7Q 1KL9A 2OQKA 1VQ6A 4R4CA 1EQQA 4DR4Q 1FL0A 3WWVA 4KLKA 4IFDJ 3HKZG 1PYBA 1N36L 4AIMA 1Z9FA 2YTVA 1E1OA 2PMZE 1HNXL 4AYBG 3HOWG 5IY0A 3A0JA 2JA6G 1NY4A 5HGQA 2ZJPA 1VQPA 2ZJRA 3L2PA 4JI0Q 3S14H 4LF9L 1Q81C 1S3OA 1NJIC 1PH9A 4LF8Q 4X65Q 1I3QH 1N32L 3HKSA 3S16H 4QIWE 5C4XG 2F3IA 4YWMA 3U4ZA 1M1KC 1UE1A 3PV0A 4LFAL 2KBNA 1KRTA 1LYLA 4POFA 4JI8Q 3JAMc 4PMWA 3KDFA 1WCMH 2N49A 4DV4Q 1IBML 2PI2E 4L5QA 1EFWA 1XMOL 4RG1A 1JJ2A 1Q8KA 3M85A 5LMNQ 2KCTA 3PUZA 4DV7L 1YJNA 1X9NA 2UUCQ 4DK6C 4NXML 4LNQA 3KDFB 1VQNA 3S1RH 4B3SQ 4DUZQ 3VDYA 3CCVA 3CMAA 1OXUA 4HJ9A 3A5ZB 4NPSA 3BJUA 1EYGA 4NXNQ 4Y52H 3K8AA 4A3IH 3LGJA 1YBYA 4LF7L 2JEAI 3CCRA 4DR5L 2E5LQ 1UE6A 3OTOQ 5ELNA 4JBWA 1JE5A 5J3BA 4JI1L 1X55A 4J15A 1SN8A 3RLNA 2OQ0A 1N8RC 3PIOA 1QVCA 4LF6Q 2JA9A 3MXNB 1CKNA 3KYHC 4YHHQ 3I7FA 5FLMH 2MNAA 1K9MC 3PUYA 1QVFA 4DR2Q 1LUZA 1HH2P 4JV5Q 2KENA 4UP9A 5BR8L 2R7DA 2VQEQ 1C0AA 2Z6KA 1TWGH 2PQAA 1VQDA 1SFOH 3E0EA 1X3GA 3FKIG 1C9OA 1EWIA 3BU2A 2K50A 1QUQB 4A3LH 3M9BA 4PZ8A 4BY7G 4A3KH 4LF5L 1V9PA 2K4KA 2LXJA 3Q8DA 4P74A 4X66Q 3HOXG 1X54A 2R92H 4Y7NH 1Q46A 3I55A 2CQOA 1KQSA 3A74A 1JMCA 2UUAQ 3CC2A 4A3DG 4JI7L 4GKJQ 5C0XG 1PH8A 4JYAQ 5E7NA 1JB7A 4QL5A 4JI2L 4X64L 1YZ6A 3JC66 3S2DH 2NVXH 3RNUA 1VQLA 2UUBQ 3GTMH 3PO3H 2DGYA 4O0AA 5M3FH 1I6HH 2NZHA 3CMEA 3S1NH 3I2ZA 3HOZH 2UXDQ 4A3JH 3F1ZA 4DR7Q 3HOYH 4L5SA 1IBLQ 4FDBA 2EXDA 1OTCA 2D0OA 3TRZA 4JI0L 2JJQA 2WFWA 5M5WH 4IOCA 2RHSB 4DR1Q 2JA5H 1VQ7A 4LF8L 3J81i 4X65L 1L0WA 3KOJA 3RN5A 2HIVA 3PUXA 3HOUH 5JJIA 4QJFA 5IP9H 2R6GA 1YJ9A 4JI8L 4ME3A 1I5FA 5IYCH 3T1HL 3PUWA 1L1OB 5C4JH 3HOVG 2WB1E 1M90C 5JJLA 2VNUD 2IHFA 1A8VA 4A3IG 4WJ3M 5LMNL 4BY1G 3GTPH 2UUCL 1EQRA 3OW2A 4A3BG 4JI6Q 2YV5A 3H3VI 3ERSX 4B3RQ 4NXNL 1U5KA 3H0GH 1W2BA 2E5LL 2EQSA 5FLMG 3OTOL 2LXKA 2BA0A 5M3MH 3FHWA 4DAYB 3RLFA 1MJCA 5JEAJ 4A3FG 4JI3Q 4DV0L 3L0OA 4WJ4A 3EN2A 3CXCA 4LF6L 4GLVB 3CCJA 3GO5A 4YHHL 2OWOA 4YY3Q 3UE0A 4LUOA 1HZAA 2F52A 4DR2L 3U58A 4BXXG 4A3KG 1BKBA 1VQEA 3ULJA 2VQEL 1Q86C 2R92G 1PH1A 4EX5A 2EIFA 3PSIA 4LUZA 1S72A 2D0PA 4EQ5A 3F2BA 3NEMA 1N9WA 1XNRQ 1IL2A 2UXCQ 3JAMi 2K5HA 5M3FG 3H3VH 3HOZG 4OO1I 4GLAC 4A3JG 2IT1A 3NENA 3HOYG 1A0IA 1IBKQ 4JBMA 1YNXA 2AWNA 3CAMA 5FJ8H 1XPRA 2UUBL 4JI4L 5IWAQ 2JA5G 1GD7A 4AQYQ 4LFBQ 2VZAA 2JA7H 1KAWA 2CFMA 4RMFA 1PH3A 4ALPA 3IRBA 1G291 3STBC 2VQFL 3HOUG 1GVPA 3G4SA 3J7A5 4IJLA 3J81j 4C3IH 2WB1G 1FVIA 5EAYA 2I5HA 3W1BA 1KRSA 1VQOA 4QQBX 4TQUS 4A4IA 3K7UC 1QZHA 1L1OC 4PG3A 2ASBA 1QZGA 1O7IA 3CCUA 2JE6I 4JOIA 2OTLA 1HR0Q 1CSPA 1GKHA 4OONA 5IYBH 5AJ3Q 5IP7G 2VL6A 3H0GG 3T1YQ 4R4OA 4DAMA 3CW2C 1E22A 1BBUA 1CUKA 4LF4Q 1N33Q 3W5OA 1HNZQ 4KHPQ 5M3MG 3CC4A 1Q1EA 4B3RL 3KF6A 3CF5A 3CCQA 5LMUQ 1HR0W 3BZKA 1J5EQ 1UEBA 2RF4A 1KD1C 1YEZA 2E2JH 1OXXK 3OYYA 4YWKA 1VQAA 2Q2IA 5C44G 4DR6Q 1IZ6A 1VQ5A 4DR3Q 4O2DA 3TEHB 4YY3L 5GADC 1XNQL 4GN5A 4LUVA 1PVOA 1FJGL 1G6PA 4A3MH 2B63H 3STBD 4B3ML 2AHOB 4DNIA 1CSQA 2CKZB 4R4IA 3UDFA 2JA8H 5C0XJ 4JI5Q 1P16A 2F4VQ 5IE8A 4IO9A 1GM5A 1HNWQ 2MO0A 2R93H 4UP7A 1Y1WH 3DLLA 3K81C 2UXCL 1J6QA 2L15A 2JA7G 1CKNB 1NBWA 2WAQE 5C3EH 4DKAC 1AH9A 3I4NH 1LTLA 1Z47A 3PIPA 1TWAH 5DLQE 5IWAL 4HIDA 1KIXA 2GN5A 4LFBL 3EIVA 4B3TQ 2PQAB 5GAGC 2RHQB 3K80C 1XTDA 2Q2TA 3ZJYC 3M3YH 1IXRA 4GNXA 4BBRH 3RZDH 1XPOA 1WFQA 1SR3A 3CCEA 4GOPA
chains in the Genus database with same CATH superfamily
2FMCA 3SK5A 4DAPA 2EJFC 2NVTH 1A63A 2IY5B 1EY5A 1T5EA 4GNXB 3PW7A 2JSOA 5EWFA 4CC6A 3BYTB 3K6OA 4LW1A 3GTGH 1TWCH 3M3YB 1PH7A 4G3IA 5BPHA 2IP4A 2NVQB 4NDXA 3T1YL 3JAME 3UE1A 2QA4A 3KBGA 2NVYB 4LF4L 1ZETA 1N33L 4O2BF 3GV5B 1S40A 1TY0A 1HNZL 4YR3A 5M5XH 3ULPA 2R7LA 2UUAH 4GKJH 1HUMA 4TUYF 3RIZA 2XCPA 3CPFA 1KNAA 4UHVA 4C3HH 1CTMA 1B44D 1OWTA 4BBSH 2HJWA 4UP8A 3K5NA 2PBZA 2RQXA 4DR3L 2W6PA 4DR7H 3R2TA 2E2HB 3I4LA 2FJ2A 1N36Q 3S1MH 1XJVA 1VQFA 2NUCA 1IYUA 2V1CC 2CWAA 4OIJA 4APVA 1PZJD 2A8VA 2ZXOA 2QILA 1YVCA 5E1FA 3QIAA 3M7NA 4CDEC 2RBMA 4QMGA 2O5IC 3HKZA 3A5UA 1L2FA 2AKWB 3M4PA 1I50B 1KNEA 2A1AA 3NBHA 4UCUA 1FNWA 4A93H 2EYHA 1EY7A 2G5DA 4TSSA 1VQ8A 2ZM6H 4QW9A 3H09A 2UUAL 3NK9A 4GKJL 1CQVA 2LFNA 3S1QH 2GVAA 1OXSC 4RAZA 3KJOA 1KC8C 5IT9E 4IPDA 3TN2A 4LF7Q 3OMCA 4DR7L 5CA0F 2XIGA 3KALA 2BA1A 5A2QW 1CQFA 2ZTEA 3BS1A 1HQRD 1LTBD 4NB3A 2MO1A 1JOKA 1I4RA 4IHJF 3S2HH 3EPGA 3NQTA 1TVXA 2K05A 3I4MH 2F0TA 2YW2A 2WTFA 4ID6A 4L5RC 1SAPA 2PO4A 1BUVT 3ER0A 3KBXA 3TQYA 4BBSG 4ZI7F 4OEMB 3C0FB 3KHGA 4O3QA 1QE6A 4S3SA 2NN6I 3I70A 3G6EA 1TR5A 4AH6A 2N78A 3FKIH 1GHKA 4O3PA 4JV0A 5KG5A 3IAYA 4AQYH 2ZM6L 1NE3A 4JI2Q 3ND8A 1A2TA 2FKLA 4R4TA 1LO5D 2DWCA 4ED0A 1E1TA 4YAJB 1F9PA 2OEOA 3N43B 2ZTDA 2EY5A 2MJ8A 4KJOA 3ITPA 1FNVA 4DK0A 2Q2HA 3LMLA 2H1EA 3CCSA 2J9GA 3IKJA 3MXGA 4KTAA 5K36H 3RGZA 2EE1A 2RVLA 1DIKA 5DEHA 5KG2A 4A93G 1JIHA 2AMCB 4DXFA 4U7CA 3B6YA 1TT2A 2Q2UA 3TQTA 3H15A 3I3CA 3RN2A 3E0JA 1PV4A 3M4OB 2NUAB 1ESRA 4B08A 4DA2A 4P72A 3H20A 5L1LA 2ASLA 1XMQH 1CKOA 4GN3B 5FJ8G 4QIWB 1D6EC 1UEAB 3E3XA 3T5KA 5DGAA 3FVQA 3BAAA 1F9QA 2R8HA 3CP0A 1E24A 1MBYA 1TIID 2IPKD 5KFYA 4AQYL 3NTKA 1JDBB 3VR4A 1VMPA 4EYHB 4FF3A 3CHBD 4A3BH 1V43A 1BBWA 2WKDA 5T14A 2UU9H 2AWOA 1KAAA 3EYYA 4TVAB 1EOVA 4JBJA 5ISRA 4DV0Q 3I4MG 3OIPA 1WYDA 2IX1A 2Z4HA 4FXGC 4IRDA 4BA2I 2NVYH 2F03A 3H4BA 4A3IB 3KUPA 1A15A 4LH6A 3OIQA 3TREA 3LX0A 3CQZH 3UDGA 1PK8A 2ID0A 1A3UA 2L1BA 1LT3D 4L5TA 3G71A 2IHEA 4JOIC 2UVUA 3TZUA 5IGGA 4O2AF 2WP8J 2BE5C 1HCZA 1UE7A 1PHJA 1XMQL 2PQEA 1K3RA 3E9IA 4YR0A 4DV5L 4M1UB 1PTOH 2L9HA 4JI4Q 1SYDA 5K36G 1EU4A 2J6SA 1UWVA 1BXTA 5KFDA 3R5FA 3AEVA 1K73C 4X6AH 4N8FA 5A35A 3VPDA 1F77A 4F4WA 3N52A 1PH2A 1NUCA 2UU9L 1SROA 4YCVA 4R9WA 2K5VA 1KEEA 2W9BB 2NVXB 4GKKL 3GTMB 3K7AH 4WFN3 1G8ZD 2D5DA 3HOZB 3S1NB 4F50A 1I94H 3K3VA 2K33A 3HOYB 2BH2A 1Y14B 3I4OA 1ZEQX 4A2AA 1LTID 2JA5B 4EVOA 1HTLD 5ELDA 1VQMA 2R82A 1S0OA 4AYBE 1CA6A 1DV2A 1VS0A 1RD9D 1YITA 1DOLA 1X32A 1PFBA 2V4RA 1AUVA 3S24A 5JAVA 4BBRG 1AFPA 2Z9HA 4DAYA 1N34H 1IBMQ 3P1HA 5C1OA 2F0VA 1E4GT 2HHHH 4I7AA 2PW5A 4TQRA 3VPCA 1EZ6A 1X65A 2HVQA 4ECRA 2I07B 2A68D 3U4VA 5GAHC 1EQTA 2QEXA 4CDCC 4WJWA 4GOPC 1XNQQ 2YZMA 4LMYA 5IYZF 1EY4A 2PYKA 3BYYB 1I7LA 3J80c 3QZ7A 4EQOA 2DY7A 1FGBD 1ENCA 1MJEA 1I94L 3GIPA 5CV9A 4PV1C 2K14A 3RUZA 5JEAG 2E8GA 2R3ZA 2XGQA 1YNND 1ZKOA 3R2IA 1H9KA 4NKLA 4BS9A 4JBKA 5FLXc 4DV7H 3WOEA 3SVMA 2WACA 3RMHA 3VA5A 1N34L 3D4DA 4R1JA 3X3MA 2HHHL 4RFBA 4UCTA 4EYIB 2OQKA 2XWBB 1B9NA 4DR5H 2CQYA 1B1ZA 1BNCA 2KHSA 2L4NA 5KNDA 2F0FA 1PYBA 1A3TA 2YTVA 2HVRA 2PMZE 2BR0A 2B2TA 5IY0A 1GJXA 1VQPA 3N8DA 2EYMA 2X0SA 5J39A 5JPMC 1NJIC 1ET6A 4X65Q 1LTSD 3HKSA 4C3IB 1EZ1A 2CW0C 3HBLA 3J80W 4OO1H 3HP3A 2E76C 1VBHA 1PZKD 4LFAL 1KRTA 1LYLA 3JAMc 2B8FA 4OELB 4R8UA 1WCMH 4ZLTF 5IGEA 4JI7H 5DQGA 3M85A 2VOBA 4DV7L 2UUCQ 1X9NA 4IRCA 1L0XB 5JJZA 5A2QL 1S5ED 5FLXW 4DV3H 4Y52H 2FLLA 3BJUA 1IHZA 4A3IH 1YBYA 3OW7A 4ZCKA 4DR5L 1S0NA 3RD4A 1UE6A 1JE5A 1JOQA 5J3BA 5BN4A 2F0IA 5EKKA 4LF8H 1GSAA 4ZKCB 3S1RB 3MXNB 2EJGC 1CKNA 3KYHC 4YHHQ 4R7RA 1V4YA 4G57A 4JI8H 2HCCA 3KXYT 4UP9A 1QNUA 4MA0A 2IX3A 1SFOH 4A3MB 2B63B 1EY6A 3M9BA 4PZ8A 4BY7G 4KK7A 2JA8B 2X6LA 1J9OA 3Q8DA 1X54A 3OWFA 4Y7NH 3I55A 3CC2A 5BMVF 3A74A 3ORRA 2UUAQ 4GKJQ 4JI7L 2YL2A 1SEIA 5FD5A 2HDLA 2I87A 5LL6b 4FXKC 1YZ6A 4J1MA 1WD0A 2NVXH 3Q22A 3GTMH 2YS6A 5KFZA 3WO1A 3HOZH 1I4HA 3S1NH 3DF7A 3F1ZA 4DR7Q 3HOYH 4KY7A 1STNA 4GZYC 4FDBA 2EXDA 5DQHA 4K2KA 1TU2B 1ENFA 2WFWA 2Z6BA 3VR6A 2JA5H 4MV7A 2VQEH 2HUGA 4LF8L 1CM9A 4KKSA 3RGXA 1L0WA 3S2DB 4KKTA 1ESFA 3OUZA 1N48A 3N44B 4QJFA 3PR4A 4JI8L 4ME3A 3MVVA 5IYCH 4XYQA 1L1OB 3HOVG 2WB1E 1M90C 5KG1A 2ZJTA 4XX0B 2D2CC 1PTOF 2IHFA 4A3IG 4BY1G 1EQRA 2E2HA 5ELCA 3QJYA 3ETJA 3DHQA 3RFCA 1GYFA 1SNPA 3CRLC 5C4ZA 1FKAH 1U5KA 1TS2A 5EPLA 3TQ1A 1I4XA 5CV7A 4CKBA 4K2LA 2VQFH 2MP1A 3FHWA 3SXHA 4K14A 1MJCA 5C5JA 3GTOA 3M7GA 3L0OA 2GA4B 4WJ4A 2CH4W 2IWHA 3VYUA 5L1JA 3CCJA 1I50A 3UE0A 4LUOA 2XC9A 1QJOA 1XWEA 1BF4A 2VQEL 2KUMA 5KFPA 1PH1A 4ZQ3A 3PSIA 4RGOS 5KFSA 1SNCA 2R7ZB 3NEMA 1HHVA 1N9WA 4UCRA 2W7PA 3BQ2A 3EVQA 3JAMi 2HGSA 3HOZG 4GLAC 2EJMA 3NBIA 3HOYG 1IKMA 1S10A 2NU9B 5KFAA 1JCKB 3MEHA 2AWNA 1KJ9A 3BG3A 1XPRA 5IWAQ 2JA5G 1GD7A 4AQYQ 4LFBQ 5G3LD 1HUNA 2B2WA 4EEYA 4YIJA 2F0QA 4WBNF 2C2EA 2NTTA 1G291 3IRBA 2VQFL 3GIIA 2HCIA 2OXPA 2C22A 2QW7A 1FJGH 2VUGA 1C3OA 4C3IH 4B3MH 2I5HA 5KFRA 3W1BA 4QB4A 3OMGA 2Z8LA 4A4IA 1JQYD 3K7UC 5KG0A 4L8JA 1QZGA 2J7ZA 3IN5A 4RAYA 3KLSX 1B9MA 4ED1A 5TSSA 1ZHQA 2EY1A 5AJ3Q 5IP7G 5KFVA 4EGQA 4PNYA 3N6XA 5FO7B 3CW2C 4L1KA 1E22A 2E2DC 1B04A 3K5OA 3W5OA 3BZDB 1RODA 3CC4A 1Q1EA 3MJFA 5D8DA 3CCQA 2ZDQA 3DWAA 4KHVA 5CBEE 1KD1C 1YEZA 4HSPA 4EBCA 2YU9A 3OYYA 1Y1VB 4QUCA 4YWKA 3RB6A 4I50F 1SYXB 3URYA 2XNAC 5I9PA 3HOXB 3PW2A 1PVOA 2YRWA 4JI0H 1FJGL 2FK3A 3RTXA 4A3MH 2B63H 3STBD 5KNCA 4B3ML 1NCVA 2PVPA 5KFLA 4QIWA 2BCOA 1JC7A 5C0XJ 2JA8H 2OF1A 5IE8A 5KFIA 3FPPA 5DG9A 1RTNA 1K1SA 5ELEA 4HTHA 2L15A 5C5LA 1E0BA 4F4YA 1J5EH 1NBWA 4DKAC 1AH9A 1Z47A 3D8GA 3PIPA 2F0JA 4HIDA 4FO2A 4B3SH 2B39A 4C3IG 3S17B 3KHHA 5KYIA 5L9XA 3ZJYC 4N8X1 5FK9C 2K01A 2E5LH 2B2WC 1SR3A 1EWCA 4P73A 1QILA 3CCEA 3QFFA 5LYJF 4IRKA 3PZPA 1ICWA 3NTIA 1TWAB 2YYZA 1TWFA 5JVLA 3I73A 4HNTA 3U9TA 1IYVA 3E9HA 4GOPB 4M7EA 1W3SA 2PZUA 5CR3A 3RF2A 3PN1A 2FLNA 5L1KA 4DPGA 4A3CH 1KHIA 5IODA 4H7BA 3GTLB 3P7JA 2Z0SA 2UXBQ 4OWWB 2BDOA 4M8AA 3D6WA 1DGSA 1L0YB 4A3FB 1SCUB 4X66H 5FLXL 2N8NA 3GTGB 2A68C 2AGOA 4O42A 2ZJQA 1YJWA 1J5EL 1LM0A 1GUSA 2NU8B 2IJ0A 2RDGA 2NZ1D 5CORA 1N34Q 3QWNA 3GTJB 4FBUA 2UUBH 4B3SL 2B63G 3KF8B 2VW9A 5IYDH 1UNNC 2FPGB 3W2DA 3KFUA 4MZ9A 4ZK9B 5M5XB 4K0KQ 1BVSA 4U68A 1E2WA 1X3EA 2RSOA 3C46A 1O7YA 2XCAA 1O75A 5J1ZA 3SK8A 2L0CA 1GO3E 3Q6SA 2R7ZH 3C1FA 4C3HB 1GOZA 1VQ9A 4JK1C 1D5XC 2NB0A 1WI5A 2HD3A 3GTQB 1E4EA 2G9HD 3I56A 2R7NA 3FDSA 3PF4A 2YTXA 2O2LD 2SCUB 1BR9A 2WINB 1F2YA 1EOTA 1K8GA 2Z4IA 3VR3A 2ENBA 1EL0A 3MWEA 2Z6KC 2SNSA 1LACA 2MUYA 2H4OA 3KAKA 1SYBA 2LSSA 4X66L 2R61A 2A5HA 1PH6A 3PO3G 4LFCH 3HOWB 1GXDC 3RAXA 2W6ZA 1BCPC 5CV8A 2H5XA 1XYIA 3R5XA 1K83A 1ZQ7A 2F0EA 1QVGA 4LSAA 4C3JH 1X3FA 4A75A 4P2CB 3S1QB 4EBDA 1K8MA 5CV4A 1V51A 3CC7A 3U9SA 1TWHB 1STEA 5KG6A 3SI8A 3HRZC 4YB8B 4ZHQF 1NMFA 1SLJA 1Q7YC 3IFTA 4H44C 2B2UA 1XNRH 5KFFA 2N55A 4HIMA 3F8TA 3I8ZA 4IJHA 1UE5A 1EYAA 1Y1VH 3MAQA 1IBKH 3NE5B 3GTKB 1ONLA 4R4QA 5LXTF 5KFUA 1B8AA 1VAJA 4DLKA 5D65A 4EFBA 1LTAD 4I7HA 4XTCS 4LFCL 4C56C 4N9PA 1B53A 5KEEA 4DV2Q 2R7ZG 2DZDA 5KG7A 3HOXH 1S5FD 5FPOA 3K59A 1D8LA 3CCMA 4LJZC 4A3DH 3DM1A 1XXGA 4DV3Q 3RBEA 3MFHA 2AQ2B 3BZCA 2OTJA 3GV7B 4HIOA 3J81W 4L63B 5H1SE 5KFOA 5DLFA 3RB0A 2C28A 3DM3A 1DXMA 4DV6Q 1YI2A 3V6JA 3RBDA 2QCPX 1KDBA 1YNJD 1VQJA 4IFDG 4IPCA 2AQ4A 3S17H 1AE2A 1OXTA 4CKEA 4KHPH 5GQOA 1XNRL 1R4QB 1D5ZC 4DUYQ 2RGVA 5LMUH 2LS01 3NPPA 3F2UA 4OL7A 1IBKL 4MTEA 4KV6A 1MIUA 1JORA 2RSNA 4LWCA 5DM73 1CE8A 2VR1A 1GUGA 1EWHA 2QDBA 4OX9Q 4DR3H 3G6VA 1PFSA 3FP9A 5CGKA 2B63A 3GTLH 2FHTA 2EYJA 3BA9A 3BDLA 1VQ4A 4ECYA 1Q90A 2IX0A 2F1MA 3D31A 4A3FH 1KJ8A 1Y1VG 3TS2A 4A3BB 1HNWH 1SRUA 2DUDA 2FE3A 1SDFA 3MR3A 4BXXH 3GTJH 3CCLA 3H94A 4KHPL 3PUVA 1GLVA 4DL5A 3OPOA 2R92A 4B3TH 1TWGB 2WAQB 3CQZB 4N9TA 4X62Q 5LMUL 4FYDA 4H02A 4XQQA 3GV6A 1EIFA 3AYHB 3M4QA 4YR2A 2C5CA 4FP5D 5D1OA 3R5HA 4UPAA 2EXZA 5IGCA 3L4KA 4J9LA 2VQFQ 2W6QA 3K5HA 2KJXA 1V1QA 3GTQH 2C00A 1DV1A 4R8IA 1JR0D 1L1OA 1PTOB 3KTMA 1ILQA 4I7ZC 4ZUIA 1FR3A 3NWSA 1STYA 4JG2A 4ZYSA 1STHA 4B9WA 1HNWL 2MGSA 3I4NG 3A8KE 3HKZE 4HCSA 3J7ZC 3HOWH 4DV1L 1Q82C 5JJKA 2WE6A 3FMCA 1PX2A 1A9XA 2NZOA 3K7AB 1WTXA 2EYFA 4V190 2F0LA 2A69D 2L5TA 2WB1B 2W9AA 5C4JB 4UAIA 4B3TL 3Q8RB 1FNUA 1VCIA 5HBRB 2B2VC 4NXMQ 3GTPB 1TWHH 1HNXH 4H0LC 1RKNA 2O5JC 1Y69U 3H0GB 1E2ZA 3G6JB 1FJGQ 2QEJC 4MV1A 1RYRA 4LF9H 3K0YA 2HDMA 4B3MQ 1PFNA 1N32H 4RA8A 4FF4A 2DPIA 1WTHA 1IYJB 4P71A 3GTKH 3LWUA 4RWSC 2VA3A 2PNHA 1H95A 5BR8Q 3HFZB 4C5AA 4G7HC 2R87A 2R8JA 1E2VA 1FGUA 4Q0FA 4C3HG 1R9TH 1XMOH 3AMUA 1DM0B 2BH8A 3A8IE 4EQPA 2E74C 2K75A 4HCEA 2IL8A 3UFXB 3S9WA 2OCEA 3NSWA 1KDAA 4MAMA 4DXGA 4R4CA 1H9SA 1FL0A 3WWVA 4KLKA 2DY8A 1Z9FA 1HNXL 4AYBG 3HOWG 2FMAA 4CKCA 2RCFA 2JA7B 4Z9CB 1NY4A 1CK1A 2ZJPA 2ZJRA 3L2PA 3RV4A 5EGTA 4JI0Q 5FO8B 4IUUA 4KKUA 1Q81C 4LF9L 4HMIA 1PH9A 1N32L 1I3QH 2ICEC 1B6RA 1SYFA 4K6DA 2BQUA 3H91A 5FPRA 1M1KC 2DNEA 3PV0A 1TAEA 4LF5H 2KBNA 1Y1VA 2W8LA 4PMWA 4L5QA 3DXJC 4RHRA 1KC7A 3PW0A 1XMOL 2MCTA 1Q8KA 5LMNQ 1WTPA 2PCFB 4DV5H 4X64H 3KDFB 3CVZA 4X3UA 4B3SQ 2SNMA 3CMAA 4HJ9A 4NXNQ 5EWGA 2IA6A 4IR1A 2RA4A 3K8AA 4DK1A 5K2MA 3LGJA 1WCMB 2JEAI 1BJTA 3CCRA 2WKCA 2E5LQ 3OTOQ 2O03A 1W6KA 3ERQA 3QB3A 3J7AF 1EYCA 2QF7A 5D3IB 2OQ0A 3Q0AA 1QVCA 4LF6Q 4GKKH 1PTOD 5C1PA 3VYSA 2EY2A 1QVFA 4DR2Q 3AU7A 1STBA 1DYQA 4RU9A 3T1HH 4ECQA 1TWGH 2FK1A 3T16A 3MZ5A 1SE3A 3E0EA 1X3GA 1C9OA 3BU2A 3FKIG 4QF4A 4A3LH 1KJIA 3K3PA 3LP8A 3VR2A 1NR4A 4IUTA 4LF5L 1SMYD 1HFGA 2K4KA 4X66Q 3PQIA 4A3GH 1C0AA 1Y1WB 1TWAA 3EA6A 4XYLB 2M05A 5KFMA 1SFOB 4X64L 4L6TB 3RNUA 2UUBQ 1BCPB 3J81L 4O0AA 4DL3A 4X3KA 4Y7NB 4L5SA 2BDNA 3VR5A 1OTCA 3EJIA 3BDCA 1VQ7A 1SNQA 3OWEB 5FD6A 3GTGA 1TWCA 2E2IB 3G8CA 2W7OA 1VDZA 5IP9H 1MZBA 4ECTA 1T5XD 3T1HL 5C4JH 2F0WA 4O4HF 2W6OA 5JJLA 1UC8A 5DM63 1A8VA 3GTPH 1EIHA 4A3BG 2K1BA 1AN8A 3TIIA 3DEOA 1JB3A 1SE4A 2K5WA 3H0GH 4ED3A 1U4RA 3A7LA 2AUJD 3VMMA 2K32A 4HSVA 1W2BA 4Q45A 2EQSA 2LXKA 2BA0A 4IUPA 1NR2A 2I8CA 3GTQA 4C5BA 3CXCA 2RDFA 2OWOA 2F52A 1JWMD 2A6EC 3DMUA 1HQMC 5LA6F 1DCZA 4DL4A 3MWYW 1G6ZA 4AYBA 1S72A 1SNMA 4ED6A 2D0PA 4EQ5A 3GIMA 3TZDA 4LFAH 1TS5A 1XNRQ 4B3RH 1LABA 1ZYRC 4HAEA 3GIQA 5DGBA 2B8GA 3HEJA 4XT3B 1DZ1A 5KT7A 1IBKQ 2VUMB 1YNXA 5C6AA 4DAVA 5LOVF 5IGBA 2JA7H 1TWHA 4TV8F 2CFMA 5E3FA 4YY3H 1RK6A 3G4SA 1D1IA 4CJ1B 2LY7A 1HPCA 3N42B 1PRTC 2C9OA 1WTWA 2WB1G 5EAYA 4HR7A 3MWDA 4MV9A 4TQUS 4PG3A 5C4HA 4XYOA 1O7IA 3CCUA 4ECWA 5KFQA 5M5YB 2UXCH 3M4IA 1CSPA 2XIWA 1GKHA 1V1PA 4OONA 1ULZA 4QWCA 3T1YQ 3H0GG 1SYCA 4K8JA 3FEWX 4LF4Q 1N33Q 1HNZQ 4KHPQ 4B3RL 1CS0A 1EEID 5EPKA 3M9NB 2KEDA 5LMUQ 5EKLA 1HR0W 5KYLA 3FKIA 2RF4A 3M4YA 3H4DA 4J9PA 1OXXK 1WSCA 5JH7F 4DR4H 1S4ZA 4TRDA 2DJFC 4KN4C 3J81E 2PMZA 4DR3Q 4O2DA 5KG4A 4YY3L 2WIIB 4WORA 5GADC 4GN5A 3RUPA 1TKWB 1Q3LA 1GGOA 1G6PA 2TSSA 2AHOB 4DNIA 1CSQA 2SOBA 1W93A 4MHEA 1M0WA 3MR5A 2EYPA 1S9FA 3RB4A 4ECSA 1HNWQ 4MV4A 4UP7A 1Y1WH 1JDEA 2NN6H 2UXCL 1J6QA 3H6MA 1Q8IA 1J8IA 1C4QA 2JA7G 2C2DA 2WAQE 4ODGA 2QDLA 2JEIA 1LTLA 3RZOB 4FS1A 1WVLA 5DLQE 1G2TA 2XGPA 4DUZH 3LWEA 4TQSA 3EIVA 4X3TA 4CDDC 5GAGC 4B3TQ 3K80C 3H3VC 2W6MA 5EJWA 1IXRA 4GNXA 1XPOA 1JLLB 4MTNA 4DL2A 1UUPA 4DR4L 3ULLA 2A6HD 2M2LA 3P20A 2CQAA 2E2IH 2C35B 2N3SA 4E6IA 1RJRA 1ILPA 5JQWA 4QCLA 4GLXA 2F3VA 4KI0A 4OO1G 2NU6B 2NVYA 4ED2A 4YP3A 4JV5H 2B2TC 3UDIA 1ASZA 4XIGS 1WCMG 1GUTA 2A69C 1HA5A 3CQZA 3J80i 1XPUA 5DG7A 5J22A 1A6XA 1FD7D 3GIKA 3BDOA 1WJJA 1HZ9A 1D2BA 4HJ7A 2ALYB 1QG7A 4HQ6A 4DUZL 1IL8A 1H9RA 2F0PA 2ZM6Q 4IFDI 4EBEA 2CWPA 2IMWP 2UXDH 4MN3A 5I6YA 2W57A 1IW7D 1AE3A 5T1GA 3HG9A 1Y1WG 5CV5A 5C5MA 1TA8A 3T5JA 1Y8NB 2GLTA 1WR2A 1B33N 1KABA 4LF9Q 3HB9A 1PFMA 5KG3A 5IGFA 1JWSD 4JV5L 3N40P 4JV2A 2AQ3B 2WB1A 5I9OA 3K5LA 3WOFA 5KX5F 2VUMH 3PW4A 1PH4A 2DNCA 3GTPA 2HIXA 4IOAA 4QWBA 3I91A 1TS4A 3HKZB 4KD3A 1CT1D 4QY7A 3O13A 2HT1A 1EYZA 5HURA 1YHQA 3PF5A 1BNZA 1TXYA 3NBHB 4P75A 4RGMA 2BOSA 2RKSA 1B7YB 4PMBA 4HEDA 4ME5A 2UXDL 5C4XB 2KCMA 4IWXA 4NW2A 1EIGA 5M5YH 4A76A 3MEFA 3A8JE 5IYCG 4LSXA 4ULLA 3OSPA 2PW7A 3CPWA 3K0XA 1FYCA 4MTDA 3NP8A 2PN1A 3EFXD 3GLKA 4C3JB 1LLRD 3U9OA 5C44B 3Q8PB 1A62A 4C2MH 2VS1A 1U0LA 1EU3A 1QB5D 2J0TD 3HXLA 5DLGA 5FOBB 1XMQQ 5BPFA 2JA7A 1CHPD 4R8NA 2ZXRA 4X64Q 4DV5Q 2L55A 1ML0D 2R6FA 2MPMA 2WDTA 1XX8A 3KF6B 1SBBB 1Y8PB 5L37A 3W1GA 1X6OA 5GROA 4RHSA 4F88A 2Y0SE 4GN4B 2VY3A 2VUMG 1KXLA 2UU9Q 3V4ZA 2W9CB 3GIJA 2MHVA 1SMYC 4CGYB 4OWTB 4A3DB 4GKKQ 1HR0H 4QWEA 4DK3C 1YHAA 3RZOH 3G6YA 3H40A 1MGSA 4RGNA 3T1HQ 2Q8TA 2CW8A 3GD7A 1VQHA 3AFQA 2YTYA 2PI2A 1HTPA 1RTOA 1WCMA 3S16B 1S5CD 4U673 2EZVA 4DNTB 3SHLA 2P0AA 2J6UA 2ATWA 4RNOA 4XZ3B 3GIDA 4O3SA 1JT8A 3S15H 3PCOB 4Q0YA 4RB1A 4DR6H 1D7QA 2UVRA 3A54A 4FM9A 4FVMA 2ATLA 2V5AA 2JEFA 1LV9A 1ICFB 4OXPA 1OXVA 2ES2A 4O3OA 4HIKA 2FINB 1S97A 1G2SA 4RCNA 4RGTA 2F4VH 3R93A 1WOCA 1EIYB 1Y1WA 1HR0L 1O7LA 1BCPF 3ETHA 1T9HA 3K58A 1I94Q 3CU7A 1S5BD 1SFOA 4ILWA 1PYWD 1M7JA 2MFIA 3NELA 5EOYA 2PZTA 4MV3A 1WTQA 3OOCA 4CHTB 5CV6A 3RR5A 1VMCA 4F4ZA 4GC6A 4QW8A 2K52A 1JJCB 4PZ7A 2W9BA 3VYTA 2HHHQ 3KLWA 2NVXA 3NTHA 4A3MG 3GTMA 2AUKA 5IGDA 1NTGA 3J7YW 4DR6L 3SE0A 3OHXC 2XTIA 2JA8G 1G51A 2XVSA 1MD2D 2R84A 4KMUC 1EUDB 5EBCA 2JA5A 4O3RA 1YNNC 2R7FA 3G48A 1AZPA 2ZDGA 4A3JB 3T51B 2OT2A 1HJPA 5KFGA 2F4VL 1Z2OX 2FJZA 3MR6A 5ELOA 3TDQA 1RL2A 1UC9A 2DPJA 4YWLA 1SEBD 1CA5A 5EDWA 1WTOA 2RDIA 1UNSA 1VQBA 4PZ6A 4LFAQ 4CJ2C 1AUXA 3OHBA 3KHRA 2R8IA 1U4MA 1E3PA 1MSGA 5C4XH 1SXTA 3MFIA 3BJYA 2FB9A 4JV1A 2BE5D 1DOMA 2B2YA 4DV7Q 2QKIC 2V9WA 4TV9F 1PXUA 2K7VA 1MHWC 2TMPA 2ZTCA 4BA1I 3AQQA 5H80A 4RNMA 5NUCA 4DR5Q 2CCZA 2O4XA 3GDEA 1CFMA 2N88A 3J81c 3SDZA 4A3CG 4YJ3F 1TS3A 5C44H 4IN3A 3GP7A 2A74C 3TP6A 1KDCA 1BDOA 3Q8QB 4J8QA 4ECVA 1S03G 2VUMA 3F2CA 2G9DA 4K8IA 2ASJA 3BVGA 4IWYA 4RKLA 3Q24A 3KJPA 5IYDG 1CKMA 3QOLA 4LH7A 5LL6S 2MQHA 4MV6A 5L1IA 3EBEA 4JVZA 4JI7Q 1EHIA 1KL9A 5KFJA 2X69A 1VQ6A 5CBAE 1R9TB 3N6RA 1A2UA 2LKVA 2X6GA 4DR4Q 4UCSA 4JI1H 3HKZG 2FFKB 5FKAC 4AIMA 5C0XH 3JRXA 1LTRD 3V6KA 5LHY1 5EKIA 1M4VA 5I47A 3CKIB 5HV6A 1N56A 1CQIB 3FPUB 4LF8Q 1CQJB 3S16H 5I2YA 3TINA 5C4XG 2F3IA 4YWMA 3VPBA 1I7NA 3D6CA 5E4WC 1I4PA 1Z6HA 4POFA 1S68A 4JI8Q 5CA1F 2WV6D 4G4KA 2N49A 2F3WA 1IBML 1EFWA 4EQNA 3A56A 2XN9C 4J9OA 1LTTD 2A6HC 3EROA 1QWYA 4RG1A 1JJ2A 1I3QB 1YJNA 4EEQA 3PVXA 4DK6C 1VF5C 1A3VA 4LNQA 3FRPB 5C8YF 1W6JA 3MTSA 4C3JG 4DUZQ 3VDYA 1RJQA 3CCVA 1EYGA 1OXUA 4IZOA 2JEJA 4ECUA 1CZGA 1L2ZA 3MXNA 2VB3X 2HVSA 5ELNA 2E2JB 4JI1L 3C2PA 1X55A 4J15A 5G3LF 4X65H 1N8RC 1DJRD 2C2RA 2R86A 2V58A 3Q8SB 3I7FA 1KTKA 5FLMH 3MHBA 4JV5Q 2R7DA 2VQEQ 2AU0A 1VQDA 1G91A 5KFNA 3FDTA 4DV1H 1EWIA 4RB3C 1QUQB 3E5NA 1GUOA 2UUCH 3MA2B 2B2UC 1V9PA 2YYAA 3K5IA 4P74A 3HOXG 4RB2C 1B4OA 2CW0D 4YAKB 3X3NA 2CQOA 3L3OC 4A3DG 2R93B 3NQIA 2Z1CA 5C0XG 3VA7A 1F9RA 5EBDA 1PH8A 4PQXA 3LNNA 1S5DD 5E7NA 3V6HA 4XXEA 5JVDF 3JC66 4V0BA 5C3EB 4Q44A 4UCVA 5KFKA 2DGYA 2NZHA 3I2ZA 2UXDQ 4A3JH 4ZUJA 4A3GB 4YHHH 3TRZA 2D0OA 2M9VA 5I6WA 5ELFA 4WD3A 3RZDB 3BQ0A 4BBRB 5M5WH 4CDFC 3J81i 5K5PA 4X65L 2L11A 3PO2B 3KOJA 3RN5A 1AN7A 5KFWA 5CB4F 3PUXA 2PPBC 2R6GA 1I5FA 3PUWA 3SK6A 1NNXA 3ZYYX 2VNUD 3JRWA 1U9RA 1PDQA 4WJ3M 4EGJA 1II3A 2UUCL 4F4XA 3HZXA 2RDJA 3OW2A 1ENAA 4IQZA 3I90A 2YV5A 4J9MA 3ERSX 3MR2A 1K8OA 1TY2A 1NAPA 4YQWA 1K3BC 4Q8EA 4EG0A 3V4SA 1EQVA 5FLMG 1E4FT 5KT3A 1EUCB 3RLFA 4CBVA 4A3FG 5JEAJ 4XDXA 5T1IA 2FLPA 1VKZA 1PMRA 3BQ1A 4YHHL 2XRQD 4BXXG 1F2LA 2R7ZA 3U58A 5EWEA 1VQEA 3GTOB 3CRKC 3I12A 4YBZB 2BQ3A 1BXRA 4EX5A 4X3SA 4LUZA 1XTCD 2NYZD 2R8GA 1AEXA 1IL2A 5D14A 3H3VH 1EEFD 2F0OA 4OO1I 4A3JG 1DONA 2IT1A 2CH4A 1A0IA 4YJ2F 3CAMA 5FJ8H 4J9KA 3MFGA 4IZ8A 3NHHA 2VZAA 1KAWA 5JPNC 4RMFA 4A3EB 3STBC 2K03A 4IUNA 1GVPA 5KT2A 2V59A 4IJLA 3J81j 1FVIA 3QR8A 2DJGC 5KFBA 4EGVA 1KRSA 4QQBX 1T94A 1QZHA 1L1OC 2ASBA 4DNRB 3D4RA 4KY5A 2JE6I 4JOIA 2OTLA 1HR0Q 2IBKA 4IUVA 5IYBH 2VL6A 4MV8A 1UAPA 4DAMA 1X3QA 3JZIA 1BBUA 2AGPA 3WNZA 4XQNA 3TMEA 5IWAH 3F8NA 2EYOA 3KF6A 4LFBH 3CF5A 1J5EQ 3OSOA 2E2JH 3RAQA 2W9CA 1VQAA 3MWMA 1EY8A 2F0UA 2HQEA 4DR6Q 1IZ6A 3HS0C 3ND9A 3T13A 1B6SA 3TEHB 4LK1C 4BY7B 2YU9B 4F87A 2DN8A 1IOWA 1C8CA 3MXUA 4FF2A 4R4IA 4F7XA 1GHJA 1PZID 3Q1KA 4OHJA 1P16A 2Y0SB 2F4VQ 2F4IA 2RGRA 3PMFA 2R93H 2AGQA 4CC5A 3KAJA 3DLLA 4DV4H 4DL6A 4I65A 5C3EH 4OIKA 3Q23A 2JYOA 4IR9A 5IWAL 1KIXA 4DN4M 3C3LA 4LFBL 2PQAB 3RJ0A 2RHQB 3RV3A 1XTDA 2F0GA 2ZXPA 3M3YH 2KECA 3RZDH 4BBRH 1Z2NX 2KEEA 4GOPA 2NVQH 4B9XA 3HOVB 3PO2H 2RDHA 5BN3A 5CAEB 1JOOA 5IYBG 4BY1B 4FU0A 2K28A 4IAJA 3GTLA 2K5QA 1QOHA 2D62A 1PA6A 4K5VA 4HN7A 1TWFB 1JJGA 5AJ3L 1ZXTA 1K1QA 1PH5A 3ICEA 2J4XA 2GPSA 1F2ZA 3MC0B 1SMXA 1Q1BA 2KHIA 3T56B 4DV4L 3GTJA 1PYSB 2E2HH 2I5MX 3R8BA 3KF8A 5JEAH 1PRTF 4JYAH 5JVH3 1ASYA 5KFEA 1VBGA 3G6XA 3KK7A 2JEBI 4LFCQ 5IIFA 5ELBA 3GTOH 1IBLH 1KBLA 1M0TA 1X3PA 4JUZA 2KCCA 1VQKA 1QNKA 2R93G 4DR1H 1I50H 1RJTA 3L7ZC 4ECXA 4IALA 5HGTA 2HQLA 2WAQG 2BQRA 3M9OB 4DL7A 4A3LG 5C3EG 1C48A 2UXBH 1RIPA 5EQ0A 3SR1A 4PDBA 1EYDA 2KHJA 2R7KA 3QZ8A 5GAEC 4A3GG 1RYSA 1Z2PX 1R4PB 2FXQA 1E4EB 1MI2A 3M9MB 1O7ZA 3P75A 4JI6H 2JQOA 3PO2G 1RF2D 4A3EH 2SDFA 4K0KH 4Q5VA 4RUAA 5KFTA 2ZDHA 1WTRA 2JA6B 4JYAL 1B3AA 2R7MA 1I4GA 3CD6A 4C5CA 4O4IF 4A2BA 2RCNA 4JI3H 1SE2A 5KRUA 2QGQA 1EUJA 5CMDA 1IBLL 4JI1Q 3TBIB 1X56A 2K04A 1K83B 3SEBA 4UY8C 5IP9G 4DR1L 1YNJC 2DLNA 4HJAA 2CZGA 5F2DA 3EQLC 3PW5A 1C7YA 1XDNA 2UXBL 3D0FA 3PGZA 1K28A 3UDXA 2NWGA 3GTKA 2ASDA 4KN7C 2I5LX 4G7OC 3WO0A 1KLUD 2XGTA 1SYGA 4IUQA 4DF7A 4ZAIA 2IW3A 3DWQA 2OLSA 1SNOA 2PZWA 5KFHA 1R9TA 2R8KA 5KFCA 2R85A 1STAA 5DG8A 4JI6L 3KHLA 2Q8IB 3T5LA 5DNFA 4BY7H 2CVRA 2YU9H 4K0KL 1K0RA 1O78A 1CHQD 3U50C 2FPIB 4C2MB 4JI3L 1JICA 3M4OH 4ED7A 1BCPD 4YCUA 4POGA 4I4TF 2VXWA 3E5SA 3W3AA 5D3DA 3PIO3 2A73B 3TS0A 1CZWA 3R3OA 2W70A 4A3EG 3N41B 1I3QA 1VQIA 3J7AV 4ETSA 1E7ZA 2QYZA 1BQQT 2A19A 1IKLA 4KD4A 4J9RA 5I4DA 3DEPA 3S14B 1S0MA 4DV1Q 4DV2H 3PIP3 4O4LF 3SE7A 3RLOA 3QO2A 4ZQIA 4QGUA 3HOVH 2B3GA 1B3QA 1BO0A 3JSLA 4O1NA 3QG1A 4GC7A 1BOSA 3V05A 4BY1H 2K5NA 1WTVA 2W71A 3D4WA 2VA2A 4MNOA 4ZKBB 5LMNW 2GVBA 3DUZA 4ED8A 4FF1A 4H13C 1TWFH 2UVVA 2F0SA 4YCWA 3JSNA 4DV6H 1JWUD 3GQBA 2YZNA 1H9JA 1QUQA 4HJ8A 4J9SA 2W6NA 3S15B 1SE8A 2YS7A 3GV8B 4JI5H 4Q43A 4ECZA 3K57A 5EPJA 4JPBW 2R93A 1BBXC 5C3XA 4JC0A 4DUYH 4KJNA 1RK5A 5KT6A 1TWGA 2WAQA 1ET9A 4EFEA 1Q12A 3T5HA 2JK8A 1HZCA 1HRJA 3JAMW 2AQ1B 1NMGA 4DV2L 3GQCA 2Y0SG 2F0NA 1JXLA 4OX9H 5EZYF 4GS3A 4FXDA 4A3KB 4DV3L 3SK4A 2R92B 3K5MA 5HY6A 5IT9c 1B50A 1I4QA 1MKHA 5J2TF 3A7AB 5D1OB 2I0QA 3C1EA 3PO3B 4DV6L 1HNXQ 2NN6G 5M3FB 4IPHA 1I6HB 3NGDA 2KVMA 4RB0A 4IPGA 3OUUA 4JI5L 3F2DA 1VQGA 2KQ3A 4FNFA 4RKBA 1N32Q 3BABA 1YHBA 4LAAA 4DUYL 4X62H 2JA6H 1HZBA 1LT5D 4HJ5A 4OWXB 3AFPA 3HOUB 5JVG3 4QUFA 2KA7A 1OO9B 5IP7H 1XMOQ 3T4AC 3I72A 3G7LA 3NXWA 1P8LA 3H0GA 1K83H 4OX9L 1WH2A 1YIJA 2YCHA 4XQJA 2JEGA 4BWSC 2FK2A 1N36H 4RAUC 4GNXC 2Q8RE 3D3RA 3UQ8A 4F8MA 2VQDA 2F0KA 5IT9W 1VQCA 2KSWA 5C0XI 5M3MB 4RZQA 2FPPB 1K8AC 1IOVA 4ZRZA 1QCBD 2PNRC 4JCVE 2FP4B 3OHAA 2VPSA 1JE4A 1B70B 4WRDA 4KHZA 5BN5A 4ZOLF 1GUNA 2XSCA 2XWJB 2DIKA 3T53B 4X62L 4DGZA 4LF5Q 1HA6A 4NXMH 1O80A 5A2QE 4APMA 1HXYD 2B29A 3SGIA 4RUCA 3EPIA 1EZ8A 2EDGA 2XCLA 1JX4A 4LF7H 2ALZA 4K6LA 1EQQA 4JW0A 1PTOC 4IFDJ 2ZT9C 1CI3M 1Z7TA 1N36L 1H9MA 1E1OA 1SNDA 5CYUA 1H9SB 4RNNA 3A0JA 1AZQA 5HGQA 2JA6G 4M9UA 4MTKA 4OGQC 3S14H 5BR8H 5M9OA 1S3OA 1KLGD 2I46A 1C30A 4QIWE 4K5XA 5J2UF 5F9NA 3U4ZA 3RB3A 1UE1A 4ABNA 5LL6X 4HNUA 2J6TA 3KDFA 4FS2A 4DV4Q 2PI2E 2EY6A 3IFDA 1RJPA 4DFAA 1NSNS 2KCTA 3PUZA 4JI2H 2GPWA 4MA5A 4NXML 1VQNA 4NLGA 3S1RH 1MSHA 1JKJB 2F0HA 3A5ZB 4NPSA 4XYMB 2NBFA 4NP5A 2K5DA 4LF7L 5DQIA 2D9UA 3J7AK 2Y0SA 2CHBD 2WYOA 4JBWA 4BWGB 1U4PA 1F2MA 4QWDA 1SN8A 4TKOB 3RLNA 1LT6D 1RCVD 2SEBD 1U4LA 3PIOA 2JA9A 2MNAA 1K9MC 4Q8FA 3PUYA 1LUZA 1HH2P 3AB9A 1TQOA 2KENA 5KGUA 5BR8L 5COYA 2Z6KA 3HGBA 2PQAA 2UVWA 1PLFA 2K50A 5LMNH 4A3KH 1GSOA 1SJHD 4FBTA 2LXJA 3NWTA 2R92H 2JXMB 3NUCA 1Q46A 1KQSA 1JMCA 4NXNH 3L9AX 4IURA 2P5ZX 4U6PA 2EPBA 3BVMA 4JYAQ 1W96A 1RHPA 1JB7A 4QL5A 2E75C 4JI2L 1Y8OB 3OTOH 1SYEA 3S2DH 2LMCB 4E4TA 3GILA 1VQLA 3I4NB 3PO3H 5M3FH 1I6HH 4DV0H 3CMEA 5D1PA 2L12A 3E6ZX 3J80L 1KJJA 3OSNA 4LF6H 4RH6A 1F9SA 1IBLQ 5F9LA 2V4DA 5I2XA 4LMQD 4DR2H 2E2IA 1D1KA 4JI0L 1M6VA 2JJQA 3A55A 2EYLA 4IOCA 2RHSB 4DR1Q 4QWAA 3GV3A 2VB2X 2XRSD 1KJQA 1EFID 2NVTB 3BG5A 1PRTB 2HIVA 3TP5A 3HOUH 5JJIA 1YJ9A 4RCOA 1T36A 2YZGA 1TWCB 1B2TA 3QOJA 5M5WB 1GSHA 4G7ZC 3V2TA 5FO9B 5LMNL 4UCOA 5KFXA 2CW7A 5GONF 1SJED 4XT1B 5JOBA 4JI6Q 4JI4H 3H3VI 4B3RQ 4NXNL 2NU7B 5KT5A 4MIUA 2JN4A 3TIGA 5E4XA 1I6VC 2E5LL 3OTOL 4Y8VB 5M3MH 1WD1A 4J6HA 4DAYB 3R23A 1BGWA 5KT4A 4JI3Q 1M8AA 2EOTA 4DV0L 2KOLA 3EN2A 4PWQA 4ME6A 1EY0A 4LF6L 4GLVB 4BBSB 3GO5A 4YY3Q 4DR2L 1HZAA 1AW7A 1BKBA 3ULJA 4A3KG 1HFNA 1Q86C 2R92G 1RDPD 3JAML 1D5MC 2KCNA 2EIFA 1V1OA 1VF7A 3S1MB 1GUWA 2JA6A 2XD4A 5IOCA 3F2BA 4RZRA 1ZHSA 1LT4D 4UFZA 2UXCQ 2K6AA 1IBMH 2K5HA 5KIXA 5M3FG 4AYBB 1DOKA 3KLRA 4IFDH 4NMZA 5JUMA 3NENA 1T3NA 4JBMA 2FMMA 5DAUA 4K5WA 3ONAB 2NTSA 2UUBL 4JI4L 4A93B 4J9NA 3IG0A 4J0MA 1PH3A 4ALPA 4J9QA 1DD2A 1XNQH 3HOUG 4HYKA 3J7A5 3MXPA 3FMAA 3ORQA 4PMCA 2F0MA 1LTGD 1VQOA 1I6UA 4HR7B 2OH2A 3IL8A 3L4JA 1SSOA 3PR5B 4R4OA 2A6ED 4C1NI 1CUKA 4C2MA 1V8QA 3S2HB 2VPQA 5M3MG 1K0SA 1V1PB 3TP7A 4CJ0B 3I4MB 4HNVA 3BZKA 1UEBA 3VYRA 1ZYRD 5IT9L 3WDNA 4DU9A 2Q2IA 4R8UB 3BVZA 3TP8A 3BA8A 2B2YC 2YRXA 5KKNB 1EY9A 3FKIB 2F0DA 3TSSA 3DWPA 5C44G 1VQ5A 1AP0A 2W8KA 4O3NA 3J80E 1XNQL 2M00A 3Q2OA 4LUVA 5LP6F 3UI2A 1STGA 2QK4A 2PMZB 5CC4A 3UDFA 2CKZB 3T1YH 4UDUC 4JI5Q 1PRTD 4LF4H 1N33H 3V96A 4IO9A 1GM5A 4KY6A 2MO0A 3LWBA 1HNZH 3K81C 4I55F 5FLXE 1CKNB 3MFYA 2ICIA 3I4NH 1TWAH 4HMJA 2EVBA 1IW7C 2JP1A 2B2VA 2GN5A 5C3WA 2V4QA 5KNBA 2Q2TA 2I80A 5AFWA 1WFQA 4C1NK 3KLSA
chains in the Genus database with same CATH topology
4DR4L 3PO2H 3ULLA 2NVTH 1A63A 2IY5B 2E2IH 2YYZA 2C35B 2N3SA 5IYBG 4GNXB 3E9HA 4GLXA 4GOPB 4KI0A 4LW1A 1W3SA 3GTGH 4OO1G 1TWCH 2D62A 1PA6A 1PH7A 3UDIA 1ASZA 1JJGA 4XIGS 1WCMG 4DPGA 5AJ3L 3T1YL 4A3CH 2QA4A 3UE1A 3J80i 1KHIA 1XPUA 4LF4L 1PH5A 2Z0SA 1N33L 4OWWB 3ICEA 2UXBQ 1S40A 1HNZL 1DGSA 5M5XH 1SMXA 3ULPA 1Q1BA 2N8NA 2KHIA 4DV4L 1PYSB 2E2HH 2I5MX 2ZJQA 1WJJA 1YJWA 1LM0A 1J5EL 1HZ9A 4HJ7A 3CPFA 2ALYB 1N34Q 1ASYA 4C3HH 4B3SL 4DUZL 4BBSH 2B63G 3KF8B 2VW9A 2JEBI 2ZM6Q 4LFCQ 4UP8A 4IFDI 5IYDH 3KFUA 2CWPA 4MZ9A 4K0KQ 4DR3L 1BVSA 3GTOH 1X3EA 1AE3A 1VQKA 1N36Q 2R93G 1Y1WG 1I50H 1GO3E 2NVQH 3L7ZC 2R7ZH 3S1MH 1XJVA 1VQFA 2HQLA 2WAQG 1VQ9A 2V1CC 4LF9Q 2CWAA 5C3EG 1WI5A 4A3LG 1RIPA 4APVA 2A8VA 3I56A 1YVCA 4JV5L 3M7NA 3PF4A 2KHJA 2YTXA 5GAEC 4A3GG 3A5UA 1L2FA 2AKWB 1K8GA 3M4PA 2VUMH 2FXQA 1PH4A 2Z6KC 2A1AA 2HIXA 2LSSA 4IOAA 4A93H 4X66L 2JQOA 3PO2G 4A3EH 1VQ8A 1PH6A 4QY7A 3PO3G 2UUAL 2HT1A 4GKJL 3S1QH 2GVAA 1YHQA 3PF5A 4JYAL 1TXYA 1OXSC 3NBHB 4P75A 2H5XA 3KJOA 1KC8C 3CD6A 1B7YB 4A3GH 2RCNA 4IPDA 4LF7Q 1QVGA 2UXDL 2KCMA 4DR7L 2QGQA 1EUJA 4C3JH 1IBLL 1X3FA 4JI1Q 4A75A 1X56A 2BA1A 5M5YH 4UY8C 4A76A 5IP9G 3CC7A 4DR1L 3MEFA 2ZTEA 5IYCG 4HJAA 4NB3A 2MO1A 3S2HH 1C7YA 3CPWA 3K0XA 2UXBL 1NMFA 1SLJA 3D0FA 3PGZA 3I4MH 3UDXA 1Q7YC 4L5RC 2I5LX 4HIMA 2XGTA 3ER0A 3F8TA 1A62A 3TQYA 4C2MH 4BBSG 2VS1A 4IJHA 1UE5A 1Y1VH 1U0LA 2NN6I 4R4QA 3G6EA 4AH6A 2N78A 1B8AA 3FKIH 1XMQQ 4JI6L 4XTCS 4LFCL 2ZM6L 4DV2Q 2YU9H 2R7ZG 4BY7H 4K0KL 1K0RA 1NE3A 4JI2Q 3HOXH 3U50C 4X64Q 4DV5Q 4R4TA 1D8LA 3CCMA 4A3DH 1E1TA 4DV3Q 3KF6B 2ZTDA 4JI3L 3M4OH 3W1GA 1X6OA 2Q2HA 4YCUA 5GROA 4POGA 2Y0SE 4GN4B 3CCSA 2VY3A 2VUMG 1KXLA 2UU9Q 3BZCA 2OTJA 3TS0A 4HIOA 5H1SE 4OWTB 4A93G 3DM3A 4GKKQ 2AMCB 4DV6Q 1YI2A 3B6YA 4A3EG 2Q2UA 1VQIA 4DK3C 1YHAA 3H15A 3RN2A 3RZOH 1VQJA 3T1HQ 1E7ZA 4IPCA 1PV4A 2A19A 4IFDG 3S17H 4P72A 1AE2A 1OXTA 3GD7A 5GQOA 1XNRL 1CKOA 1VQHA 4GN3B 3AFQA 5FJ8G 4DV1Q 2YTYA 2PI2A 4DUYQ 3RLOA 4QGUA 3HOVH 2B3GA 3CP0A 1IBKL 1MIUA 1E24A 2ATWA 1JT8A 4LWCA 4BY1H 4AQYL 3S15H 2K5NA 3PCOB 4MNOA 4A3BH 5LMNW 1V43A 1BBWA 2GVBA 4OX9Q 2AWOA 1D7QA 1TWFH 4TVAB 1EOVA 1PFSA 4JBJA 4DV0Q 3I4MG 4YCWA 1WYDA 3FP9A 2IX1A 3GTLH 4OXPA 1OXVA 2NVYH 2ES2A 4HIKA 1QUQA 4HJ8A 2IX0A 1VQ4A 4BA2I 1SE8A 3D31A 4A3FH 1Y1VG 3TS2A 3TREA 1SRUA 1WOCA 2DUDA 3CQZH 3UDGA 1EIYB 1HR0L 2ID0A 4JC0A 4L5TA 4BXXH 3G71A 1T9HA 2IHEA 1I94Q 4JOIC 3GTJH 2WP8J 2MFIA 1Q12A 1UE7A 1PHJA 3CCLA 2JK8A 1HZCA 3NELA 3PUVA 1XMQL 4KHPL 1NMGA 4DV2L 4X62Q 1K3RA 5LMUL 2Y0SG 3E9IA 4DV5L 4H02A 3RR5A 1EIFA 3AYHB 4GS3A 3M4QA 4JI4Q 5K36G 4DV3L 2K52A 1UWVA 1JJCB 4PZ7A 4UPAA 3AEVA 2HHHQ 1K73C 3KLWA 5HY6A 5IT9c 4A3MG 2VQFQ 4X6AH 1NTGA 1PH2A 4DR6L 1V1QA 3GTQH 1MKHA 2UU9L 2XTIA 4P73A 1SROA 2JA8G 1G51A 4YCVA 2I0QA 2K5VA 1L1OA 4GKKL 4DV6L 1HNXQ 2NN6G 3K7AH 4IPHA 2R7FA 3G48A 4IPGA 4JG2A 1HJPA 4JI5L 3F2DA 2BH2A 2F4VL 1VQGA 1Y14B 3I4OA 1HNWL 4MTNA 3I4NG 1N32Q 3HKZE 5ELOA 3J7ZC 3HOWH 4DV1L 1YHBA 1RL2A 1VQMA 1Q82C 4YWLA 4DUYL 4AYBE 1HZBA 2JA6H 5JJKA 1VS0A 4HJ5A 4OWXB 1YITA 3AFPA 1VQBA 2NZOA 4PZ6A 4LFAQ 3S24A 4BBRG 1IBMQ 5IP7H 1E3PA 1XMOQ 5C4XH 4B3TL 1VCIA 1P8LA 4DV7Q 1K83H 4OX9L 1X65A 4NXMQ 1YIJA 2ZTCA 3U4VA 1TWHH 4BA1I 5GAHC 4GNXC 3AQQA 2QEXA 4GOPC 4DR5Q 2CCZA 1XNQQ 4A3CG 3GDEA 3J81c 1FJGQ 1VQCA 5C0XI 3J80c 5C44H 4B3MQ 1K8AC 4JCVE 1IYJB 1MJEA 1I94L 4P71A 3GTKH 2K14A 2PNHA 1H95A 1B70B 3HFZB 2E8GA 5BR8Q 5JEAG 4KHZA 3F2CA 1FGUA 1R9TH 4X62L 3KJPA 2BH8A 1CKMA 5IYDG 4JBKA 5FLXc 4LF5Q 2K75A 2MQHA 1N34L 4R1JA 2B29A 3EBEA 2OCEA 3SGIA 2HHHL 4JI7Q 1KL9A 2OQKA 1VQ6A 4R4CA 1EQQA 4DR4Q 1FL0A 3WWVA 4KLKA 4IFDJ 3HKZG 1PYBA 1N36L 4AIMA 1Z9FA 2YTVA 1E1OA 2PMZE 1HNXL 4AYBG 3HOWG 5IY0A 3A0JA 2JA6G 1NY4A 5HGQA 2ZJPA 1VQPA 2ZJRA 3L2PA 4JI0Q 3S14H 4LF9L 1Q81C 1S3OA 1NJIC 1PH9A 4LF8Q 4X65Q 1I3QH 1N32L 3HKSA 3S16H 4QIWE 5C4XG 2F3IA 4YWMA 3U4ZA 1M1KC 1UE1A 3PV0A 4LFAL 2KBNA 1KRTA 1LYLA 4POFA 4JI8Q 3JAMc 4PMWA 3KDFA 1WCMH 2N49A 4DV4Q 1IBML 2PI2E 4L5QA 1EFWA 1XMOL 4RG1A 1JJ2A 1Q8KA 3M85A 5LMNQ 2KCTA 3PUZA 4DV7L 1YJNA 1X9NA 2UUCQ 4DK6C 4NXML 4LNQA 3KDFB 1VQNA 3S1RH 4B3SQ 4DUZQ 3VDYA 3CCVA 3CMAA 1OXUA 4HJ9A 3A5ZB 4NPSA 3BJUA 1EYGA 4NXNQ 4Y52H 3K8AA 4A3IH 3LGJA 1YBYA 4LF7L 2JEAI 3CCRA 4DR5L 2E5LQ 1UE6A 3OTOQ 5ELNA 4JBWA 1JE5A 5J3BA 4JI1L 1X55A 4J15A 1SN8A 3RLNA 2OQ0A 1N8RC 3PIOA 1QVCA 4LF6Q 2JA9A 3MXNB 1CKNA 3KYHC 4YHHQ 3I7FA 5FLMH 2MNAA 1K9MC 3PUYA 1QVFA 4DR2Q 1LUZA 1HH2P 4JV5Q 2KENA 4UP9A 5BR8L 2R7DA 2VQEQ 1C0AA 2Z6KA 1TWGH 2PQAA 1VQDA 1SFOH 3E0EA 1X3GA 3FKIG 1C9OA 1EWIA 3BU2A 2K50A 1QUQB 4A3LH 3M9BA 4PZ8A 4BY7G 4A3KH 4LF5L 1V9PA 2K4KA 2LXJA 3Q8DA 4P74A 4X66Q 3HOXG 1X54A 2R92H 4Y7NH 1Q46A 3I55A 2CQOA 1KQSA 3A74A 1JMCA 2UUAQ 3CC2A 4A3DG 4JI7L 4GKJQ 5C0XG 1PH8A 4JYAQ 5E7NA 1JB7A 4QL5A 4JI2L 4X64L 1YZ6A 3JC66 3S2DH 2NVXH 3RNUA 1VQLA 2UUBQ 3GTMH 3PO3H 2DGYA 4O0AA 5M3FH 1I6HH 2NZHA 3CMEA 3S1NH 3I2ZA 3HOZH 2UXDQ 4A3JH 3F1ZA 4DR7Q 3HOYH 4L5SA 1IBLQ 4FDBA 2EXDA 1OTCA 2D0OA 3TRZA 4JI0L 2JJQA 2WFWA 5M5WH 4IOCA 2RHSB 4DR1Q 2JA5H 1VQ7A 4LF8L 3J81i 4X65L 1L0WA 3KOJA 3RN5A 2HIVA 3PUXA 3HOUH 5JJIA 4QJFA 5IP9H 2R6GA 1YJ9A 4JI8L 4ME3A 1I5FA 5IYCH 3T1HL 3PUWA 1L1OB 5C4JH 3HOVG 2WB1E 1M90C 5JJLA 2VNUD 2IHFA 1A8VA 4A3IG 4WJ3M 5LMNL 4BY1G 3GTPH 2UUCL 1EQRA 3OW2A 4A3BG 4JI6Q 2YV5A 3H3VI 3ERSX 4B3RQ 4NXNL 1U5KA 3H0GH 1W2BA 2E5LL 2EQSA 5FLMG 3OTOL 2LXKA 2BA0A 5M3MH 3FHWA 4DAYB 3RLFA 1MJCA 5JEAJ 4A3FG 4JI3Q 4DV0L 3L0OA 4WJ4A 3EN2A 3CXCA 4LF6L 4GLVB 3CCJA 3GO5A 4YHHL 2OWOA 4YY3Q 3UE0A 4LUOA 1HZAA 2F52A 4DR2L 3U58A 4BXXG 4A3KG 1BKBA 1VQEA 3ULJA 2VQEL 1Q86C 2R92G 1PH1A 4EX5A 2EIFA 3PSIA 4LUZA 1S72A 2D0PA 4EQ5A 3F2BA 3NEMA 1N9WA 1XNRQ 1IL2A 2UXCQ 3JAMi 2K5HA 5M3FG 3H3VH 3HOZG 4OO1I 4GLAC 4A3JG 2IT1A 3NENA 3HOYG 1A0IA 1IBKQ 4JBMA 1YNXA 2AWNA 3CAMA 5FJ8H 1XPRA 2UUBL 4JI4L 5IWAQ 2JA5G 1GD7A 4AQYQ 4LFBQ 2VZAA 2JA7H 1KAWA 2CFMA 4RMFA 1PH3A 4ALPA 3IRBA 1G291 3STBC 2VQFL 3HOUG 1GVPA 3G4SA 3J7A5 4IJLA 3J81j 4C3IH 2WB1G 1FVIA 5EAYA 2I5HA 3W1BA 1KRSA 1VQOA 4QQBX 4TQUS 4A4IA 3K7UC 1QZHA 1L1OC 4PG3A 2ASBA 1QZGA 1O7IA 3CCUA 2JE6I 4JOIA 2OTLA 1HR0Q 1CSPA 1GKHA 4OONA 5IYBH 5AJ3Q 5IP7G 2VL6A 3H0GG 3T1YQ 4R4OA 4DAMA 3CW2C 1E22A 1BBUA 1CUKA 4LF4Q 1N33Q 3W5OA 1HNZQ 4KHPQ 5M3MG 3CC4A 1Q1EA 4B3RL 3KF6A 3CF5A 3CCQA 5LMUQ 1HR0W 3BZKA 1J5EQ 1UEBA 2RF4A 1KD1C 1YEZA 2E2JH 1OXXK 3OYYA 4YWKA 1VQAA 2Q2IA 5C44G 4DR6Q 1IZ6A 1VQ5A 4DR3Q 4O2DA 3TEHB 4YY3L 5GADC 1XNQL 4GN5A 4LUVA 1PVOA 1FJGL 1G6PA 4A3MH 2B63H 3STBD 4B3ML 2AHOB 4DNIA 1CSQA 2CKZB 4R4IA 3UDFA 2JA8H 5C0XJ 4JI5Q 1P16A 2F4VQ 5IE8A 4IO9A 1GM5A 1HNWQ 2MO0A 2R93H 4UP7A 1Y1WH 3DLLA 3K81C 2UXCL 1J6QA 2L15A 2JA7G 1CKNB 1NBWA 2WAQE 5C3EH 4DKAC 1AH9A 3I4NH 1LTLA 1Z47A 3PIPA 1TWAH 5DLQE 5IWAL 4HIDA 1KIXA 2GN5A 4LFBL 3EIVA 4B3TQ 2PQAB 5GAGC 2RHQB 3K80C 1XTDA 2Q2TA 3ZJYC 3M3YH 1IXRA 4GNXA 4BBRH 3RZDH 1XPOA 1WFQA 1SR3A 3CCEA 4GOPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR4 L;  3PO2 H;  3ULL A;  2NVT H;  1A63 A;  2IY5 B;  2E2I H;  2YYZ A;  2C35 B;  2N3S A;  5IYB G;  4GNX B;  3E9H A;  4GLX A;  4GOP B;  4KI0 A;  4LW1 A;  1W3S A;  3GTG H;  4OO1 G;  1TWC H;  2D62 A;  1PA6 A;  1PH7 A;  3UDI A;  1ASZ A;  1JJG A;  4XIG S;  1WCM G;  4DPG A;  5AJ3 L;  3T1Y L;  4A3C H;  2QA4 A;  3UE1 A;  3J80 i;  1KHI A;  1XPU A;  4LF4 L;  1PH5 A;  2Z0S A;  1N33 L;  4OWW B;  3ICE A;  2UXB Q;  1S40 A;  1HNZ L;  1DGS A;  5M5X H;  1SMX A;  3ULP A;  1Q1B A;  2N8N A;  2KHI A;  4DV4 L;  1PYS B;  2E2H H;  2I5M X;  2ZJQ A;  1WJJ A;  1YJW A;  1LM0 A;  1J5E L;  1HZ9 A;  4HJ7 A;  3CPF A;  2ALY B;  1N34 Q;  1ASY A;  4C3H H;  4B3S L;  4DUZ L;  4BBS H;  2B63 G;  3KF8 B;  2VW9 A;  2JEB I;  2ZM6 Q;  4LFC Q;  4UP8 A;  4IFD I;  5IYD H;  3KFU A;  2CWP A;  4MZ9 A;  4K0K Q;  4DR3 L;  1BVS A;  3GTO H;  1X3E A;  1AE3 A;  1VQK A;  1N36 Q;  2R93 G;  1Y1W G;  1I50 H;  1GO3 E;  2NVQ H;  3L7Z C;  2R7Z H;  3S1M H;  1XJV A;  1VQF A;  2HQL A;  2WAQ G;  1VQ9 A;  2V1C C;  4LF9 Q;  2CWA A;  5C3E G;  1WI5 A;  4A3L G;  1RIP A;  4APV A;  2A8V A;  3I56 A;  1YVC A;  4JV5 L;  3M7N A;  3PF4 A;  2KHJ A;  2YTX A;  5GAE C;  4A3G G;  3A5U A;  1L2F A;  2AKW B;  1K8G A;  3M4P A;  2VUM H;  2FXQ A;  1PH4 A;  2Z6K C;  2A1A A;  2HIX A;  2LSS A;  4IOA A;  4A93 H;  4X66 L;  2JQO A;  3PO2 G;  4A3E H;  1VQ8 A;  1PH6 A;  4QY7 A;  3PO3 G;  2UUA L;  2HT1 A;  4GKJ L;  3S1Q H;  2GVA A;  1YHQ A;  3PF5 A;  4JYA L;  1TXY A;  1OXS C;  3NBH B;  4P75 A;  2H5X A;  3KJO A;  1KC8 C;  3CD6 A;  1B7Y B;  4A3G H;  2RCN A;  4IPD A;  4LF7 Q;  1QVG A;  2UXD L;  2KCM A;  4DR7 L;  2QGQ A;  1EUJ A;  4C3J H;  1IBL L;  1X3F A;  4JI1 Q;  4A75 A;  1X56 A;  2BA1 A;  5M5Y H;  4UY8 C;  4A76 A;  5IP9 G;  3CC7 A;  4DR1 L;  3MEF A;  2ZTE A;  5IYC G;  4HJA A;  4NB3 A;  2MO1 A;  3S2H H;  1C7Y A;  3CPW A;  3K0X A;  2UXB L;  1NMF A;  1SLJ A;  3D0F A;  3PGZ A;  3I4M H;  3UDX A;  1Q7Y C;  4L5R C;  2I5L X;  4HIM A;  2XGT A;  3ER0 A;  3F8T A;  1A62 A;  3TQY A;  4C2M H;  4BBS G;  2VS1 A;  4IJH A;  1UE5 A;  1Y1V H;  1U0L A;  2NN6 I;  4R4Q A;  3G6E A;  4AH6 A;  2N78 A;  1B8A A;  3FKI H;  1XMQ Q;  4JI6 L;  4XTC S;  4LFC L;  2ZM6 L;  4DV2 Q;  2YU9 H;  2R7Z G;  4BY7 H;  4K0K L;  1K0R A;  1NE3 A;  4JI2 Q;  3HOX H;  3U50 C;  4X64 Q;  4DV5 Q;  4R4T A;  1D8L A;  3CCM A;  4A3D H;  1E1T A;  4DV3 Q;  3KF6 B;  2ZTD A;  4JI3 L;  3M4O H;  3W1G A;  1X6O A;  2Q2H A;  4YCU A;  5GRO A;  4POG A;  2Y0S E;  4GN4 B;  3CCS A;  2VY3 A;  2VUM G;  1KXL A;  2UU9 Q;  3BZC A;  2OTJ A;  3TS0 A;  4HIO A;  5H1S E;  4OWT B;  4A93 G;  3DM3 A;  4GKK Q;  2AMC B;  4DV6 Q;  1YI2 A;  3B6Y A;  4A3E G;  2Q2U A;  1VQI A;  4DK3 C;  1YHA A;  3H15 A;  3RN2 A;  3RZO H;  1VQJ A;  3T1H Q;  1E7Z A;  4IPC A;  1PV4 A;  2A19 A;  4IFD G;  3S17 H;  4P72 A;  1AE2 A;  1OXT A;  3GD7 A;  5GQO A;  1XNR L;  1CKO A;  1VQH A;  4GN3 B;  3AFQ A;  5FJ8 G;  4DV1 Q;  2YTY A;  2PI2 A;  4DUY Q;  3RLO A;  4QGU A;  3HOV H;  2B3G A;  3CP0 A;  1IBK L;  1MIU A;  1E24 A;  2ATW A;  1JT8 A;  4LWC A;  4BY1 H;  4AQY L;  3S15 H;  2K5N A;  3PCO B;  4MNO A;  4A3B H;  5LMN W;  1V43 A;  1BBW A;  2GVB A;  4OX9 Q;  2AWO A;  1D7Q A;  1TWF H;  4TVA B;  1EOV A;  1PFS A;  4JBJ A;  4DV0 Q;  3I4M G;  4YCW A;  1WYD A;  3FP9 A;  2IX1 A;  3GTL H;  4OXP A;  1OXV A;  2NVY H;  2ES2 A;  4HIK A;  1QUQ A;  4HJ8 A;  2IX0 A;  1VQ4 A;  4BA2 I;  1SE8 A;  3D31 A;  4A3F H;  1Y1V G;  3TS2 A;  3TRE A;  1SRU A;  1WOC A;  2DUD A;  3CQZ H;  3UDG A;  1EIY B;  1HR0 L;  2ID0 A;  4JC0 A;  4L5T A;  4BXX H;  3G71 A;  1T9H A;  2IHE A;  1I94 Q;  4JOI C;  3GTJ H;  2WP8 J;  2MFI A;  1Q12 A;  1UE7 A;  1PHJ A;  3CCL A;  2JK8 A;  1HZC A;  3NEL A;  3PUV A;  1XMQ L;  4KHP L;  1NMG A;  4DV2 L;  4X62 Q;  1K3R A;  5LMU L;  2Y0S G;  3E9I A;  4DV5 L;  4H02 A;  3RR5 A;  1EIF A;  3AYH B;  4GS3 A;  3M4Q A;  4JI4 Q;  5K36 G;  4DV3 L;  2K52 A;  1UWV A;  1JJC B;  4PZ7 A;  4UPA A;  3AEV A;  2HHH Q;  1K73 C;  3KLW A;  5HY6 A;  5IT9 c;  4A3M G;  2VQF Q;  4X6A H;  1NTG A;  1PH2 A;  4DR6 L;  1V1Q A;  3GTQ H;  1MKH A;  2UU9 L;  2XTI A;  4P73 A;  1SRO A;  2JA8 G;  1G51 A;  4YCV A;  2I0Q A;  2K5V A;  1L1O A;  4GKK L;  4DV6 L;  1HNX Q;  2NN6 G;  3K7A H;  4IPH A;  2R7F A;  3G48 A;  4IPG A;  4JG2 A;  1HJP A;  4JI5 L;  3F2D A;  2BH2 A;  2F4V L;  1VQG A;  1Y14 B;  3I4O A;  1HNW L;  4MTN A;  3I4N G;  1N32 Q;  3HKZ E;  5ELO A;  3J7Z C;  3HOW H;  4DV1 L;  1YHB A;  1RL2 A;  1VQM A;  1Q82 C;  4YWL A;  4DUY L;  4AYB E;  1HZB A;  2JA6 H;  5JJK A;  1VS0 A;  4HJ5 A;  4OWX B;  1YIT A;  3AFP A;  1VQB A;  2NZO A;  4PZ6 A;  4LFA Q;  3S24 A;  4BBR G;  1IBM Q;  5IP7 H;  1E3P A;  1XMO Q;  5C4X H;  4B3T L;  1VCI A;  1P8L A;  4DV7 Q;  1K83 H;  4OX9 L;  1X65 A;  4NXM Q;  1YIJ A;  2ZTC A;  3U4V A;  1TWH H;  4BA1 I;  5GAH C;  4GNX C;  3AQQ A;  2QEX A;  4GOP C;  4DR5 Q;  2CCZ A;  1XNQ Q;  4A3C G;  3GDE A;  3J81 c;  1FJG Q;  1VQC A;  5C0X I;  3J80 c;  5C44 H;  4B3M Q;  1K8A C;  4JCV E;  1IYJ B;  1MJE A;  1I94 L;  4P71 A;  3GTK H;  2K14 A;  2PNH A;  1H95 A;  1B70 B;  3HFZ B;  2E8G A;  5BR8 Q;  5JEA G;  4KHZ A;  3F2C A;  1FGU A;  1R9T H;  4X62 L;  3KJP A;  2BH8 A;  1CKM A;  5IYD G;  4JBK A;  5FLX c;  4LF5 Q;  2K75 A;  2MQH A;  1N34 L;  4R1J A;  2B29 A;  3EBE A;  2OCE A;  3SGI A;  2HHH L;  4JI7 Q;  1KL9 A;  2OQK A;  1VQ6 A;  4R4C A;  1EQQ A;  4DR4 Q;  1FL0 A;  3WWV A;  4KLK A;  4IFD J;  3HKZ G;  1PYB A;  1N36 L;  4AIM A;  1Z9F A;  2YTV A;  1E1O A;  2PMZ E;  1HNX L;  4AYB G;  3HOW G;  5IY0 A;  3A0J A;  2JA6 G;  1NY4 A;  5HGQ A;  2ZJP A;  1VQP A;  2ZJR A;  3L2P A;  4JI0 Q;  3S14 H;  4LF9 L;  1Q81 C;  1S3O A;  1NJI C;  1PH9 A;  4LF8 Q;  4X65 Q;  1I3Q H;  1N32 L;  3HKS A;  3S16 H;  4QIW E;  5C4X G;  2F3I A;  4YWM A;  3U4Z A;  1M1K C;  1UE1 A;  3PV0 A;  4LFA L;  2KBN A;  1KRT A;  1LYL A;  4POF A;  4JI8 Q;  3JAM c;  4PMW A;  3KDF A;  1WCM H;  2N49 A;  4DV4 Q;  1IBM L;  2PI2 E;  4L5Q A;  1EFW A;  1XMO L;  4RG1 A;  1JJ2 A;  1Q8K A;  3M85 A;  5LMN Q;  2KCT A;  3PUZ A;  4DV7 L;  1YJN A;  1X9N A;  2UUC Q;  4DK6 C;  4NXM L;  4LNQ A;  3KDF B;  1VQN A;  3S1R H;  4B3S Q;  4DUZ Q;  3VDY A;  3CCV A;  3CMA A;  1OXU A;  4HJ9 A;  3A5Z B;  4NPS A;  3BJU A;  1EYG A;  4NXN Q;  4Y52 H;  3K8A A;  4A3I H;  3LGJ A;  1YBY A;  4LF7 L;  2JEA I;  3CCR A;  4DR5 L;  2E5L Q;  1UE6 A;  3OTO Q;  5ELN A;  4JBW A;  1JE5 A;  5J3B A;  4JI1 L;  1X55 A;  4J15 A;  1SN8 A;  3RLN A;  2OQ0 A;  1N8R C;  3PIO A;  1QVC A;  4LF6 Q;  2JA9 A;  3MXN B;  1CKN A;  3KYH C;  4YHH Q;  3I7F A;  5FLM H;  2MNA A;  1K9M C;  3PUY A;  1QVF A;  4DR2 Q;  1LUZ A;  1HH2 P;  4JV5 Q;  2KEN A;  4UP9 A;  5BR8 L;  2R7D A;  2VQE Q;  1C0A A;  2Z6K A;  1TWG H;  2PQA A;  1VQD A;  1SFO H;  3E0E A;  1X3G A;  3FKI G;  1C9O A;  1EWI A;  3BU2 A;  2K50 A;  1QUQ B;  4A3L H;  3M9B A;  4PZ8 A;  4BY7 G;  4A3K H;  4LF5 L;  1V9P A;  2K4K A;  2LXJ A;  3Q8D A;  4P74 A;  4X66 Q;  3HOX G;  1X54 A;  2R92 H;  4Y7N H;  1Q46 A;  3I55 A;  2CQO A;  1KQS A;  3A74 A;  1JMC A;  2UUA Q;  3CC2 A;  4A3D G;  4JI7 L;  4GKJ Q;  5C0X G;  1PH8 A;  4JYA Q;  5E7N A;  1JB7 A;  4QL5 A;  4JI2 L;  4X64 L;  1YZ6 A;  3JC6 6;  3S2D H;  2NVX H;  3RNU A;  1VQL A;  2UUB Q;  3GTM H;  3PO3 H;  2DGY A;  4O0A A;  5M3F H;  1I6H H;  2NZH A;  3CME A;  3S1N H;  3I2Z A;  3HOZ H;  2UXD Q;  4A3J H;  3F1Z A;  4DR7 Q;  3HOY H;  4L5S A;  1IBL Q;  4FDB A;  2EXD A;  1OTC A;  2D0O A;  3TRZ A;  4JI0 L;  2JJQ A;  2WFW A;  5M5W H;  4IOC A;  2RHS B;  4DR1 Q;  2JA5 H;  1VQ7 A;  4LF8 L;  3J81 i;  4X65 L;  1L0W A;  3KOJ A;  3RN5 A;  2HIV A;  3PUX A;  3HOU H;  5JJI A;  4QJF A;  5IP9 H;  2R6G A;  1YJ9 A;  4JI8 L;  4ME3 A;  1I5F A;  5IYC H;  3T1H L;  3PUW A;  1L1O B;  5C4J H;  3HOV G;  2WB1 E;  1M90 C;  5JJL A;  2VNU D;  2IHF A;  1A8V A;  4A3I G;  4WJ3 M;  5LMN L;  4BY1 G;  3GTP H;  2UUC L;  1EQR A;  3OW2 A;  4A3B G;  4JI6 Q;  2YV5 A;  3H3V I;  3ERS X;  4B3R Q;  4NXN L;  1U5K A;  3H0G H;  1W2B A;  2E5L L;  2EQS A;  5FLM G;  3OTO L;  2LXK A;  2BA0 A;  5M3M H;  3FHW A;  4DAY B;  3RLF A;  1MJC A;  5JEA J;  4A3F G;  4JI3 Q;  4DV0 L;  3L0O A;  4WJ4 A;  3EN2 A;  3CXC A;  4LF6 L;  4GLV B;  3CCJ A;  3GO5 A;  4YHH L;  2OWO A;  4YY3 Q;  3UE0 A;  4LUO A;  1HZA A;  2F52 A;  4DR2 L;  3U58 A;  4BXX G;  4A3K G;  1BKB A;  1VQE A;  3ULJ A;  2VQE L;  1Q86 C;  2R92 G;  1PH1 A;  4EX5 A;  2EIF A;  3PSI A;  4LUZ A;  1S72 A;  2D0P A;  4EQ5 A;  3F2B A;  3NEM A;  1N9W A;  1XNR Q;  1IL2 A;  2UXC Q;  3JAM i;  2K5H A;  5M3F G;  3H3V H;  3HOZ G;  4OO1 I;  4GLA C;  4A3J G;  2IT1 A;  3NEN A;  3HOY G;  1A0I A;  1IBK Q;  4JBM A;  1YNX A;  2AWN A;  3CAM A;  5FJ8 H;  1XPR A;  2UUB L;  4JI4 L;  5IWA Q;  2JA5 G;  1GD7 A;  4AQY Q;  4LFB Q;  2VZA A;  2JA7 H;  1KAW A;  2CFM A;  4RMF A;  1PH3 A;  4ALP A;  3IRB A;  1G29 1;  3STB C;  2VQF L;  3HOU G;  1GVP A;  3G4S A;  3J7A 5;  4IJL A;  3J81 j;  4C3I H;  2WB1 G;  1FVI A;  5EAY A;  2I5H A;  3W1B A;  1KRS A;  1VQO A;  4QQB X;  4TQU S;  4A4I A;  3K7U C;  1QZH A;  1L1O C;  4PG3 A;  2ASB A;  1QZG A;  1O7I A;  3CCU A;  2JE6 I;  4JOI A;  2OTL A;  1HR0 Q;  1CSP A;  1GKH A;  4OON A;  5IYB H;  5AJ3 Q;  5IP7 G;  2VL6 A;  3H0G G;  3T1Y Q;  4R4O A;  4DAM A;  3CW2 C;  1E22 A;  1BBU A;  1CUK A;  4LF4 Q;  1N33 Q;  3W5O A;  1HNZ Q;  4KHP Q;  5M3M G;  3CC4 A;  1Q1E A;  4B3R L;  3KF6 A;  3CF5 A;  3CCQ A;  5LMU Q;  1HR0 W;  3BZK A;  1J5E Q;  1UEB A;  2RF4 A;  1KD1 C;  1YEZ A;  2E2J H;  1OXX K;  3OYY A;  4YWK A;  1VQA A;  2Q2I A;  5C44 G;  4DR6 Q;  1IZ6 A;  1VQ5 A;  4DR3 Q;  4O2D A;  3TEH B;  4YY3 L;  5GAD C;  1XNQ L;  4GN5 A;  4LUV A;  1PVO A;  1FJG L;  1G6P A;  4A3M H;  2B63 H;  3STB D;  4B3M L;  2AHO B;  4DNI A;  1CSQ A;  2CKZ B;  4R4I A;  3UDF A;  2JA8 H;  5C0X J;  4JI5 Q;  1P16 A;  2F4V Q;  5IE8 A;  4IO9 A;  1GM5 A;  1HNW Q;  2MO0 A;  2R93 H;  4UP7 A;  1Y1W H;  3DLL A;  3K81 C;  2UXC L;  1J6Q A;  2L15 A;  2JA7 G;  1CKN B;  1NBW A;  2WAQ E;  5C3E H;  4DKA C;  1AH9 A;  3I4N H;  1LTL A;  1Z47 A;  3PIP A;  1TWA H;  5DLQ E;  5IWA L;  4HID A;  1KIX A;  2GN5 A;  4LFB L;  3EIV A;  4B3T Q;  2PQA B;  5GAG C;  2RHQ B;  3K80 C;  1XTD A;  2Q2T A;  3ZJY C;  3M3Y H;  1IXR A;  4GNX A;  4BBR H;  3RZD H;  1XPO A;  1WFQ A;  1SR3 A;  3CCE A;  4GOP A; 
#chains in the Genus database with same CATH topology
 2FMC A;  3SK5 A;  4DAP A;  2EJF C;  2NVT H;  1A63 A;  2IY5 B;  1EY5 A;  1T5E A;  4GNX B;  3PW7 A;  2JSO A;  5EWF A;  4CC6 A;  3BYT B;  3K6O A;  4LW1 A;  3GTG H;  1TWC H;  3M3Y B;  1PH7 A;  4G3I A;  5BPH A;  2IP4 A;  2NVQ B;  4NDX A;  3T1Y L;  3JAM E;  3UE1 A;  2QA4 A;  3KBG A;  2NVY B;  4LF4 L;  1ZET A;  1N33 L;  4O2B F;  3GV5 B;  1S40 A;  1TY0 A;  1HNZ L;  4YR3 A;  5M5X H;  3ULP A;  2R7L A;  2UUA H;  4GKJ H;  1HUM A;  4TUY F;  3RIZ A;  2XCP A;  3CPF A;  1KNA A;  4UHV A;  4C3H H;  1CTM A;  1B44 D;  1OWT A;  4BBS H;  2HJW A;  4UP8 A;  3K5N A;  2PBZ A;  2RQX A;  4DR3 L;  2W6P A;  4DR7 H;  3R2T A;  2E2H B;  3I4L A;  2FJ2 A;  1N36 Q;  3S1M H;  1XJV A;  1VQF A;  2NUC A;  1IYU A;  2V1C C;  2CWA A;  4OIJ A;  4APV A;  1PZJ D;  2A8V A;  2ZXO A;  2QIL A;  1YVC A;  5E1F A;  3QIA A;  3M7N A;  4CDE C;  2RBM A;  4QMG A;  2O5I C;  3HKZ A;  3A5U A;  1L2F A;  2AKW B;  3M4P A;  1I50 B;  1KNE A;  2A1A A;  3NBH A;  4UCU A;  1FNW A;  4A93 H;  2EYH A;  1EY7 A;  2G5D A;  4TSS A;  1VQ8 A;  2ZM6 H;  4QW9 A;  3H09 A;  2UUA L;  3NK9 A;  4GKJ L;  1CQV A;  2LFN A;  3S1Q H;  2GVA A;  1OXS C;  4RAZ A;  3KJO A;  1KC8 C;  5IT9 E;  4IPD A;  3TN2 A;  4LF7 Q;  3OMC A;  4DR7 L;  5CA0 F;  2XIG A;  3KAL A;  2BA1 A;  5A2Q W;  1CQF A;  2ZTE A;  3BS1 A;  1HQR D;  1LTB D;  4NB3 A;  2MO1 A;  1JOK A;  1I4R A;  4IHJ F;  3S2H H;  3EPG A;  3NQT A;  1TVX A;  2K05 A;  3I4M H;  2F0T A;  2YW2 A;  2WTF A;  4ID6 A;  4L5R C;  1SAP A;  2PO4 A;  1BUV T;  3ER0 A;  3KBX A;  3TQY A;  4BBS G;  4ZI7 F;  4OEM B;  3C0F B;  3KHG A;  4O3Q A;  1QE6 A;  4S3S A;  2NN6 I;  3I70 A;  3G6E A;  1TR5 A;  4AH6 A;  2N78 A;  3FKI H;  1GHK A;  4O3P A;  4JV0 A;  5KG5 A;  3IAY A;  4AQY H;  2ZM6 L;  1NE3 A;  4JI2 Q;  3ND8 A;  1A2T A;  2FKL A;  4R4T A;  1LO5 D;  2DWC A;  4ED0 A;  1E1T A;  4YAJ B;  1F9P A;  2OEO A;  3N43 B;  2ZTD A;  2EY5 A;  2MJ8 A;  4KJO A;  3ITP A;  1FNV A;  4DK0 A;  2Q2H A;  3LML A;  2H1E A;  3CCS A;  2J9G A;  3IKJ A;  3MXG A;  4KTA A;  5K36 H;  3RGZ A;  2EE1 A;  2RVL A;  1DIK A;  5DEH A;  5KG2 A;  4A93 G;  1JIH A;  2AMC B;  4DXF A;  4U7C A;  3B6Y A;  1TT2 A;  2Q2U A;  3TQT A;  3H15 A;  3I3C A;  3RN2 A;  3E0J A;  1PV4 A;  3M4O B;  2NUA B;  1ESR A;  4B08 A;  4DA2 A;  4P72 A;  3H20 A;  5L1L A;  2ASL A;  1XMQ H;  1CKO A;  4GN3 B;  5FJ8 G;  4QIW B;  1D6E C;  1UEA B;  3E3X A;  3T5K A;  5DGA A;  3FVQ A;  3BAA A;  1F9Q A;  2R8H A;  3CP0 A;  1E24 A;  1MBY A;  1TII D;  2IPK D;  5KFY A;  4AQY L;  3NTK A;  1JDB B;  3VR4 A;  1VMP A;  4EYH B;  4FF3 A;  3CHB D;  4A3B H;  1V43 A;  1BBW A;  2WKD A;  5T14 A;  2UU9 H;  2AWO A;  1KAA A;  3EYY A;  4TVA B;  1EOV A;  4JBJ A;  5ISR A;  4DV0 Q;  3I4M G;  3OIP A;  1WYD A;  2IX1 A;  2Z4H A;  4FXG C;  4IRD A;  4BA2 I;  2NVY H;  2F03 A;  3H4B A;  4A3I B;  3KUP A;  1A15 A;  4LH6 A;  3OIQ A;  3TRE A;  3LX0 A;  3CQZ H;  3UDG A;  1PK8 A;  2ID0 A;  1A3U A;  2L1B A;  1LT3 D;  4L5T A;  3G71 A;  2IHE A;  4JOI C;  2UVU A;  3TZU A;  5IGG A;  4O2A F;  2WP8 J;  2BE5 C;  1HCZ A;  1UE7 A;  1PHJ A;  1XMQ L;  2PQE A;  1K3R A;  3E9I A;  4YR0 A;  4DV5 L;  4M1U B;  1PTO H;  2L9H A;  4JI4 Q;  1SYD A;  5K36 G;  1EU4 A;  2J6S A;  1UWV A;  1BXT A;  5KFD A;  3R5F A;  3AEV A;  1K73 C;  4X6A H;  4N8F A;  5A35 A;  3VPD A;  1F77 A;  4F4W A;  3N52 A;  1PH2 A;  1NUC A;  2UU9 L;  1SRO A;  4YCV A;  4R9W A;  2K5V A;  1KEE A;  2W9B B;  2NVX B;  4GKK L;  3GTM B;  3K7A H;  4WFN 3;  1G8Z D;  2D5D A;  3HOZ B;  3S1N B;  4F50 A;  1I94 H;  3K3V A;  2K33 A;  3HOY B;  2BH2 A;  1Y14 B;  3I4O A;  1ZEQ X;  4A2A A;  1LTI D;  2JA5 B;  4EVO A;  1HTL D;  5ELD A;  1VQM A;  2R82 A;  1S0O A;  4AYB E;  1CA6 A;  1DV2 A;  1VS0 A;  1RD9 D;  1YIT A;  1DOL A;  1X32 A;  1PFB A;  2V4R A;  1AUV A;  3S24 A;  5JAV A;  4BBR G;  1AFP A;  2Z9H A;  4DAY A;  1N34 H;  1IBM Q;  3P1H A;  5C1O A;  2F0V A;  1E4G T;  2HHH H;  4I7A A;  2PW5 A;  4TQR A;  3VPC A;  1EZ6 A;  1X65 A;  2HVQ A;  4ECR A;  2I07 B;  2A68 D;  3U4V A;  5GAH C;  1EQT A;  2QEX A;  4CDC C;  4WJW A;  4GOP C;  1XNQ Q;  2YZM A;  4LMY A;  5IYZ F;  1EY4 A;  2PYK A;  3BYY B;  1I7L A;  3J80 c;  3QZ7 A;  4EQO A;  2DY7 A;  1FGB D;  1ENC A;  1MJE A;  1I94 L;  3GIP A;  5CV9 A;  4PV1 C;  2K14 A;  3RUZ A;  5JEA G;  2E8G A;  2R3Z A;  2XGQ A;  1YNN D;  1ZKO A;  3R2I A;  1H9K A;  4NKL A;  4BS9 A;  4JBK A;  5FLX c;  4DV7 H;  3WOE A;  3SVM A;  2WAC A;  3RMH A;  3VA5 A;  1N34 L;  3D4D A;  4R1J A;  3X3M A;  2HHH L;  4RFB A;  4UCT A;  4EYI B;  2OQK A;  2XWB B;  1B9N A;  4DR5 H;  2CQY A;  1B1Z A;  1BNC A;  2KHS A;  2L4N A;  5KND A;  2F0F A;  1PYB A;  1A3T A;  2YTV A;  2HVR A;  2PMZ E;  2BR0 A;  2B2T A;  5IY0 A;  1GJX A;  1VQP A;  3N8D A;  2EYM A;  2X0S A;  5J39 A;  5JPM C;  1NJI C;  1ET6 A;  4X65 Q;  1LTS D;  3HKS A;  4C3I B;  1EZ1 A;  2CW0 C;  3HBL A;  3J80 W;  4OO1 H;  3HP3 A;  2E76 C;  1VBH A;  1PZK D;  4LFA L;  1KRT A;  1LYL A;  3JAM c;  2B8F A;  4OEL B;  4R8U A;  1WCM H;  4ZLT F;  5IGE A;  4JI7 H;  5DQG A;  3M85 A;  2VOB A;  4DV7 L;  2UUC Q;  1X9N A;  4IRC A;  1L0X B;  5JJZ A;  5A2Q L;  1S5E D;  5FLX W;  4DV3 H;  4Y52 H;  2FLL A;  3BJU A;  1IHZ A;  4A3I H;  1YBY A;  3OW7 A;  4ZCK A;  4DR5 L;  1S0N A;  3RD4 A;  1UE6 A;  1JE5 A;  1JOQ A;  5J3B A;  5BN4 A;  2F0I A;  5EKK A;  4LF8 H;  1GSA A;  4ZKC B;  3S1R B;  3MXN B;  2EJG C;  1CKN A;  3KYH C;  4YHH Q;  4R7R A;  1V4Y A;  4G57 A;  4JI8 H;  2HCC A;  3KXY T;  4UP9 A;  1QNU A;  4MA0 A;  2IX3 A;  1SFO H;  4A3M B;  2B63 B;  1EY6 A;  3M9B A;  4PZ8 A;  4BY7 G;  4KK7 A;  2JA8 B;  2X6L A;  1J9O A;  3Q8D A;  1X54 A;  3OWF A;  4Y7N H;  3I55 A;  3CC2 A;  5BMV F;  3A74 A;  3ORR A;  2UUA Q;  4GKJ Q;  4JI7 L;  2YL2 A;  1SEI A;  5FD5 A;  2HDL A;  2I87 A;  5LL6 b;  4FXK C;  1YZ6 A;  4J1M A;  1WD0 A;  2NVX H;  3Q22 A;  3GTM H;  2YS6 A;  5KFZ A;  3WO1 A;  3HOZ H;  1I4H A;  3S1N H;  3DF7 A;  3F1Z A;  4DR7 Q;  3HOY H;  4KY7 A;  1STN A;  4GZY C;  4FDB A;  2EXD A;  5DQH A;  4K2K A;  1TU2 B;  1ENF A;  2WFW A;  2Z6B A;  3VR6 A;  2JA5 H;  4MV7 A;  2VQE H;  2HUG A;  4LF8 L;  1CM9 A;  4KKS A;  3RGX A;  1L0W A;  3S2D B;  4KKT A;  1ESF A;  3OUZ A;  1N48 A;  3N44 B;  4QJF A;  3PR4 A;  4JI8 L;  4ME3 A;  3MVV A;  5IYC H;  4XYQ A;  1L1O B;  3HOV G;  2WB1 E;  1M90 C;  5KG1 A;  2ZJT A;  4XX0 B;  2D2C C;  1PTO F;  2IHF A;  4A3I G;  4BY1 G;  1EQR A;  2E2H A;  5ELC A;  3QJY A;  3ETJ A;  3DHQ A;  3RFC A;  1GYF A;  1SNP A;  3CRL C;  5C4Z A;  1FKA H;  1U5K A;  1TS2 A;  5EPL A;  3TQ1 A;  1I4X A;  5CV7 A;  4CKB A;  4K2L A;  2VQF H;  2MP1 A;  3FHW A;  3SXH A;  4K14 A;  1MJC A;  5C5J A;  3GTO A;  3M7G A;  3L0O A;  2GA4 B;  4WJ4 A;  2CH4 W;  2IWH A;  3VYU A;  5L1J A;  3CCJ A;  1I50 A;  3UE0 A;  4LUO A;  2XC9 A;  1QJO A;  1XWE A;  1BF4 A;  2VQE L;  2KUM A;  5KFP A;  1PH1 A;  4ZQ3 A;  3PSI A;  4RGO S;  5KFS A;  1SNC A;  2R7Z B;  3NEM A;  1HHV A;  1N9W A;  4UCR A;  2W7P A;  3BQ2 A;  3EVQ A;  3JAM i;  2HGS A;  3HOZ G;  4GLA C;  2EJM A;  3NBI A;  3HOY G;  1IKM A;  1S10 A;  2NU9 B;  5KFA A;  1JCK B;  3MEH A;  2AWN A;  1KJ9 A;  3BG3 A;  1XPR A;  5IWA Q;  2JA5 G;  1GD7 A;  4AQY Q;  4LFB Q;  5G3L D;  1HUN A;  2B2W A;  4EEY A;  4YIJ A;  2F0Q A;  4WBN F;  2C2E A;  2NTT A;  1G29 1;  3IRB A;  2VQF L;  3GII A;  2HCI A;  2OXP A;  2C22 A;  2QW7 A;  1FJG H;  2VUG A;  1C3O A;  4C3I H;  4B3M H;  2I5H A;  5KFR A;  3W1B A;  4QB4 A;  3OMG A;  2Z8L A;  4A4I A;  1JQY D;  3K7U C;  5KG0 A;  4L8J A;  1QZG A;  2J7Z A;  3IN5 A;  4RAY A;  3KLS X;  1B9M A;  4ED1 A;  5TSS A;  1ZHQ A;  2EY1 A;  5AJ3 Q;  5IP7 G;  5KFV A;  4EGQ A;  4PNY A;  3N6X A;  5FO7 B;  3CW2 C;  4L1K A;  1E22 A;  2E2D C;  1B04 A;  3K5O A;  3W5O A;  3BZD B;  1ROD A;  3CC4 A;  1Q1E A;  3MJF A;  5D8D A;  3CCQ A;  2ZDQ A;  3DWA A;  4KHV A;  5CBE E;  1KD1 C;  1YEZ A;  4HSP A;  4EBC A;  2YU9 A;  3OYY A;  1Y1V B;  4QUC A;  4YWK A;  3RB6 A;  4I50 F;  1SYX B;  3URY A;  2XNA C;  5I9P A;  3HOX B;  3PW2 A;  1PVO A;  2YRW A;  4JI0 H;  1FJG L;  2FK3 A;  3RTX A;  4A3M H;  2B63 H;  3STB D;  5KNC A;  4B3M L;  1NCV A;  2PVP A;  5KFL A;  4QIW A;  2BCO A;  1JC7 A;  5C0X J;  2JA8 H;  2OF1 A;  5IE8 A;  5KFI A;  3FPP A;  5DG9 A;  1RTN A;  1K1S A;  5ELE A;  4HTH A;  2L15 A;  5C5L A;  1E0B A;  4F4Y A;  1J5E H;  1NBW A;  4DKA C;  1AH9 A;  1Z47 A;  3D8G A;  3PIP A;  2F0J A;  4HID A;  4FO2 A;  4B3S H;  2B39 A;  4C3I G;  3S17 B;  3KHH A;  5KYI A;  5L9X A;  3ZJY C;  4N8X 1;  5FK9 C;  2K01 A;  2E5L H;  2B2W C;  1SR3 A;  1EWC A;  4P73 A;  1QIL A;  3CCE A;  3QFF A;  5LYJ F;  4IRK A;  3PZP A;  1ICW A;  3NTI A;  1TWA B;  2YYZ A;  1TWF A;  5JVL A;  3I73 A;  4HNT A;  3U9T A;  1IYV A;  3E9H A;  4GOP B;  4M7E A;  1W3S A;  2PZU A;  5CR3 A;  3RF2 A;  3PN1 A;  2FLN A;  5L1K A;  4DPG A;  4A3C H;  1KHI A;  5IOD A;  4H7B A;  3GTL B;  3P7J A;  2Z0S A;  2UXB Q;  4OWW B;  2BDO A;  4M8A A;  3D6W A;  1DGS A;  1L0Y B;  4A3F B;  1SCU B;  4X66 H;  5FLX L;  2N8N A;  3GTG B;  2A68 C;  2AGO A;  4O42 A;  2ZJQ A;  1YJW A;  1J5E L;  1LM0 A;  1GUS A;  2NU8 B;  2IJ0 A;  2RDG A;  2NZ1 D;  5COR A;  1N34 Q;  3QWN A;  3GTJ B;  4FBU A;  2UUB H;  4B3S L;  2B63 G;  3KF8 B;  2VW9 A;  5IYD H;  1UNN C;  2FPG B;  3W2D A;  3KFU A;  4MZ9 A;  4ZK9 B;  5M5X B;  4K0K Q;  1BVS A;  4U68 A;  1E2W A;  1X3E A;  2RSO A;  3C46 A;  1O7Y A;  2XCA A;  1O75 A;  5J1Z A;  3SK8 A;  2L0C A;  1GO3 E;  3Q6S A;  2R7Z H;  3C1F A;  4C3H B;  1GOZ A;  1VQ9 A;  4JK1 C;  1D5X C;  2NB0 A;  1WI5 A;  2HD3 A;  3GTQ B;  1E4E A;  2G9H D;  3I56 A;  2R7N A;  3FDS A;  3PF4 A;  2YTX A;  2O2L D;  2SCU B;  1BR9 A;  2WIN B;  1F2Y A;  1EOT A;  1K8G A;  2Z4I A;  3VR3 A;  2ENB A;  1EL0 A;  3MWE A;  2Z6K C;  2SNS A;  1LAC A;  2MUY A;  2H4O A;  3KAK A;  1SYB A;  2LSS A;  4X66 L;  2R61 A;  2A5H A;  1PH6 A;  3PO3 G;  4LFC H;  3HOW B;  1GXD C;  3RAX A;  2W6Z A;  1BCP C;  5CV8 A;  2H5X A;  1XYI A;  3R5X A;  1K83 A;  1ZQ7 A;  2F0E A;  1QVG A;  4LSA A;  4C3J H;  1X3F A;  4A75 A;  4P2C B;  3S1Q B;  4EBD A;  1K8M A;  5CV4 A;  1V51 A;  3CC7 A;  3U9S A;  1TWH B;  1STE A;  5KG6 A;  3SI8 A;  3HRZ C;  4YB8 B;  4ZHQ F;  1NMF A;  1SLJ A;  1Q7Y C;  3IFT A;  4H44 C;  2B2U A;  1XNR H;  5KFF A;  2N55 A;  4HIM A;  3F8T A;  3I8Z A;  4IJH A;  1UE5 A;  1EYA A;  1Y1V H;  3MAQ A;  1IBK H;  3NE5 B;  3GTK B;  1ONL A;  4R4Q A;  5LXT F;  5KFU A;  1B8A A;  1VAJ A;  4DLK A;  5D65 A;  4EFB A;  1LTA D;  4I7H A;  4XTC S;  4LFC L;  4C56 C;  4N9P A;  1B53 A;  5KEE A;  4DV2 Q;  2R7Z G;  2DZD A;  5KG7 A;  3HOX H;  1S5F D;  5FPO A;  3K59 A;  1D8L A;  3CCM A;  4LJZ C;  4A3D H;  3DM1 A;  1XXG A;  4DV3 Q;  3RBE A;  3MFH A;  2AQ2 B;  3BZC A;  2OTJ A;  3GV7 B;  4HIO A;  3J81 W;  4L63 B;  5H1S E;  5KFO A;  5DLF A;  3RB0 A;  2C28 A;  3DM3 A;  1DXM A;  4DV6 Q;  1YI2 A;  3V6J A;  3RBD A;  2QCP X;  1KDB A;  1YNJ D;  1VQJ A;  4IFD G;  4IPC A;  2AQ4 A;  3S17 H;  1AE2 A;  1OXT A;  4CKE A;  4KHP H;  5GQO A;  1XNR L;  1R4Q B;  1D5Z C;  4DUY Q;  2RGV A;  5LMU H;  2LS0 1;  3NPP A;  3F2U A;  4OL7 A;  1IBK L;  4MTE A;  4KV6 A;  1MIU A;  1JOR A;  2RSN A;  4LWC A;  5DM7 3;  1CE8 A;  2VR1 A;  1GUG A;  1EWH A;  2QDB A;  4OX9 Q;  4DR3 H;  3G6V A;  1PFS A;  3FP9 A;  5CGK A;  2B63 A;  3GTL H;  2FHT A;  2EYJ A;  3BA9 A;  3BDL A;  1VQ4 A;  4ECY A;  1Q90 A;  2IX0 A;  2F1M A;  3D31 A;  4A3F H;  1KJ8 A;  1Y1V G;  3TS2 A;  4A3B B;  1HNW H;  1SRU A;  2DUD A;  2FE3 A;  1SDF A;  3MR3 A;  4BXX H;  3GTJ H;  3CCL A;  3H94 A;  4KHP L;  3PUV A;  1GLV A;  4DL5 A;  3OPO A;  2R92 A;  4B3T H;  1TWG B;  2WAQ B;  3CQZ B;  4N9T A;  4X62 Q;  5LMU L;  4FYD A;  4H02 A;  4XQQ A;  3GV6 A;  1EIF A;  3AYH B;  3M4Q A;  4YR2 A;  2C5C A;  4FP5 D;  5D1O A;  3R5H A;  4UPA A;  2EXZ A;  5IGC A;  3L4K A;  4J9L A;  2VQF Q;  2W6Q A;  3K5H A;  2KJX A;  1V1Q A;  3GTQ H;  2C00 A;  1DV1 A;  4R8I A;  1JR0 D;  1L1O A;  1PTO B;  3KTM A;  1ILQ A;  4I7Z C;  4ZUI A;  1FR3 A;  3NWS A;  1STY A;  4JG2 A;  4ZYS A;  1STH A;  4B9W A;  1HNW L;  2MGS A;  3I4N G;  3A8K E;  3HKZ E;  4HCS A;  3J7Z C;  3HOW H;  4DV1 L;  1Q82 C;  5JJK A;  2WE6 A;  3FMC A;  1PX2 A;  1A9X A;  2NZO A;  3K7A B;  1WTX A;  2EYF A;  4V19 0;  2F0L A;  2A69 D;  2L5T A;  2WB1 B;  2W9A A;  5C4J B;  4UAI A;  4B3T L;  3Q8R B;  1FNU A;  1VCI A;  5HBR B;  2B2V C;  4NXM Q;  3GTP B;  1TWH H;  1HNX H;  4H0L C;  1RKN A;  2O5J C;  1Y69 U;  3H0G B;  1E2Z A;  3G6J B;  1FJG Q;  2QEJ C;  4MV1 A;  1RYR A;  4LF9 H;  3K0Y A;  2HDM A;  4B3M Q;  1PFN A;  1N32 H;  4RA8 A;  4FF4 A;  2DPI A;  1WTH A;  1IYJ B;  4P71 A;  3GTK H;  3LWU A;  4RWS C;  2VA3 A;  2PNH A;  1H95 A;  5BR8 Q;  3HFZ B;  4C5A A;  4G7H C;  2R87 A;  2R8J A;  1E2V A;  1FGU A;  4Q0F A;  4C3H G;  1R9T H;  1XMO H;  3AMU A;  1DM0 B;  2BH8 A;  3A8I E;  4EQP A;  2E74 C;  2K75 A;  4HCE A;  2IL8 A;  3UFX B;  3S9W A;  2OCE A;  3NSW A;  1KDA A;  4MAM A;  4DXG A;  4R4C A;  1H9S A;  1FL0 A;  3WWV A;  4KLK A;  2DY8 A;  1Z9F A;  1HNX L;  4AYB G;  3HOW G;  2FMA A;  4CKC A;  2RCF A;  2JA7 B;  4Z9C B;  1NY4 A;  1CK1 A;  2ZJP A;  2ZJR A;  3L2P A;  3RV4 A;  5EGT A;  4JI0 Q;  5FO8 B;  4IUU A;  4KKU A;  1Q81 C;  4LF9 L;  4HMI A;  1PH9 A;  1N32 L;  1I3Q H;  2ICE C;  1B6R A;  1SYF A;  4K6D A;  2BQU A;  3H91 A;  5FPR A;  1M1K C;  2DNE A;  3PV0 A;  1TAE A;  4LF5 H;  2KBN A;  1Y1V A;  2W8L A;  4PMW A;  4L5Q A;  3DXJ C;  4RHR A;  1KC7 A;  3PW0 A;  1XMO L;  2MCT A;  1Q8K A;  5LMN Q;  1WTP A;  2PCF B;  4DV5 H;  4X64 H;  3KDF B;  3CVZ A;  4X3U A;  4B3S Q;  2SNM A;  3CMA A;  4HJ9 A;  4NXN Q;  5EWG A;  2IA6 A;  4IR1 A;  2RA4 A;  3K8A A;  4DK1 A;  5K2M A;  3LGJ A;  1WCM B;  2JEA I;  1BJT A;  3CCR A;  2WKC A;  2E5L Q;  3OTO Q;  2O03 A;  1W6K A;  3ERQ A;  3QB3 A;  3J7A F;  1EYC A;  2QF7 A;  5D3I B;  2OQ0 A;  3Q0A A;  1QVC A;  4LF6 Q;  4GKK H;  1PTO D;  5C1P A;  3VYS A;  2EY2 A;  1QVF A;  4DR2 Q;  3AU7 A;  1STB A;  1DYQ A;  4RU9 A;  3T1H H;  4ECQ A;  1TWG H;  2FK1 A;  3T16 A;  3MZ5 A;  1SE3 A;  3E0E A;  1X3G A;  1C9O A;  3BU2 A;  3FKI G;  4QF4 A;  4A3L H;  1KJI A;  3K3P A;  3LP8 A;  3VR2 A;  1NR4 A;  4IUT A;  4LF5 L;  1SMY D;  1HFG A;  2K4K A;  4X66 Q;  3PQI A;  4A3G H;  1C0A A;  1Y1W B;  1TWA A;  3EA6 A;  4XYL B;  2M05 A;  5KFM A;  1SFO B;  4X64 L;  4L6T B;  3RNU A;  2UUB Q;  1BCP B;  3J81 L;  4O0A A;  4DL3 A;  4X3K A;  4Y7N B;  4L5S A;  2BDN A;  3VR5 A;  1OTC A;  3EJI A;  3BDC A;  1VQ7 A;  1SNQ A;  3OWE B;  5FD6 A;  3GTG A;  1TWC A;  2E2I B;  3G8C A;  2W7O A;  1VDZ A;  5IP9 H;  1MZB A;  4ECT A;  1T5X D;  3T1H L;  5C4J H;  2F0W A;  4O4H F;  2W6O A;  5JJL A;  1UC8 A;  5DM6 3;  1A8V A;  3GTP H;  1EIH A;  4A3B G;  2K1B A;  1AN8 A;  3TII A;  3DEO A;  1JB3 A;  1SE4 A;  2K5W A;  3H0G H;  4ED3 A;  1U4R A;  3A7L A;  2AUJ D;  3VMM A;  2K32 A;  4HSV A;  1W2B A;  4Q45 A;  2EQS A;  2LXK A;  2BA0 A;  4IUP A;  1NR2 A;  2I8C A;  3GTQ A;  4C5B A;  3CXC A;  2RDF A;  2OWO A;  2F52 A;  1JWM D;  2A6E C;  3DMU A;  1HQM C;  5LA6 F;  1DCZ A;  4DL4 A;  3MWY W;  1G6Z A;  4AYB A;  1S72 A;  1SNM A;  4ED6 A;  2D0P A;  4EQ5 A;  3GIM A;  3TZD A;  4LFA H;  1TS5 A;  1XNR Q;  4B3R H;  1LAB A;  1ZYR C;  4HAE A;  3GIQ A;  5DGB A;  2B8G A;  3HEJ A;  4XT3 B;  1DZ1 A;  5KT7 A;  1IBK Q;  2VUM B;  1YNX A;  5C6A A;  4DAV A;  5LOV F;  5IGB A;  2JA7 H;  1TWH A;  4TV8 F;  2CFM A;  5E3F A;  4YY3 H;  1RK6 A;  3G4S A;  1D1I A;  4CJ1 B;  2LY7 A;  1HPC A;  3N42 B;  1PRT C;  2C9O A;  1WTW A;  2WB1 G;  5EAY A;  4HR7 A;  3MWD A;  4MV9 A;  4TQU S;  4PG3 A;  5C4H A;  4XYO A;  1O7I A;  3CCU A;  4ECW A;  5KFQ A;  5M5Y B;  2UXC H;  3M4I A;  1CSP A;  2XIW A;  1GKH A;  1V1P A;  4OON A;  1ULZ A;  4QWC A;  3T1Y Q;  3H0G G;  1SYC A;  4K8J A;  3FEW X;  4LF4 Q;  1N33 Q;  1HNZ Q;  4KHP Q;  4B3R L;  1CS0 A;  1EEI D;  5EPK A;  3M9N B;  2KED A;  5LMU Q;  5EKL A;  1HR0 W;  5KYL A;  3FKI A;  2RF4 A;  3M4Y A;  3H4D A;  4J9P A;  1OXX K;  1WSC A;  5JH7 F;  4DR4 H;  1S4Z A;  4TRD A;  2DJF C;  4KN4 C;  3J81 E;  2PMZ A;  4DR3 Q;  4O2D A;  5KG4 A;  4YY3 L;  2WII B;  4WOR A;  5GAD C;  4GN5 A;  3RUP A;  1TKW B;  1Q3L A;  1GGO A;  1G6P A;  2TSS A;  2AHO B;  4DNI A;  1CSQ A;  2SOB A;  1W93 A;  4MHE A;  1M0W A;  3MR5 A;  2EYP A;  1S9F A;  3RB4 A;  4ECS A;  1HNW Q;  4MV4 A;  4UP7 A;  1Y1W H;  1JDE A;  2NN6 H;  2UXC L;  1J6Q A;  3H6M A;  1Q8I A;  1J8I A;  1C4Q A;  2JA7 G;  2C2D A;  2WAQ E;  4ODG A;  2QDL A;  2JEI A;  1LTL A;  3RZO B;  4FS1 A;  1WVL A;  5DLQ E;  1G2T A;  2XGP A;  4DUZ H;  3LWE A;  4TQS A;  3EIV A;  4X3T A;  4CDD C;  5GAG C;  4B3T Q;  3K80 C;  3H3V C;  2W6M A;  5EJW A;  1IXR A;  4GNX A;  1XPO A;  1JLL B;  4MTN A;  4DL2 A;  1UUP A;  4DR4 L;  3ULL A;  2A6H D;  2M2L A;  3P20 A;  2CQA A;  2E2I H;  2C35 B;  2N3S A;  4E6I A;  1RJR A;  1ILP A;  5JQW A;  4QCL A;  4GLX A;  2F3V A;  4KI0 A;  4OO1 G;  2NU6 B;  2NVY A;  4ED2 A;  4YP3 A;  4JV5 H;  2B2T C;  3UDI A;  1ASZ A;  4XIG S;  1WCM G;  1GUT A;  2A69 C;  1HA5 A;  3CQZ A;  3J80 i;  1XPU A;  5DG7 A;  5J22 A;  1A6X A;  1FD7 D;  3GIK A;  3BDO A;  1WJJ A;  1HZ9 A;  1D2B A;  4HJ7 A;  2ALY B;  1QG7 A;  4HQ6 A;  4DUZ L;  1IL8 A;  1H9R A;  2F0P A;  2ZM6 Q;  4IFD I;  4EBE A;  2CWP A;  2IMW P;  2UXD H;  4MN3 A;  5I6Y A;  2W57 A;  1IW7 D;  1AE3 A;  5T1G A;  3HG9 A;  1Y1W G;  5CV5 A;  5C5M A;  1TA8 A;  3T5J A;  1Y8N B;  2GLT A;  1WR2 A;  1B33 N;  1KAB A;  4LF9 Q;  3HB9 A;  1PFM A;  5KG3 A;  5IGF A;  1JWS D;  4JV5 L;  3N40 P;  4JV2 A;  2AQ3 B;  2WB1 A;  5I9O A;  3K5L A;  3WOF A;  5KX5 F;  2VUM H;  3PW4 A;  1PH4 A;  2DNC A;  3GTP A;  2HIX A;  4IOA A;  4QWB A;  3I91 A;  1TS4 A;  3HKZ B;  4KD3 A;  1CT1 D;  4QY7 A;  3O13 A;  2HT1 A;  1EYZ A;  5HUR A;  1YHQ A;  3PF5 A;  1BNZ A;  1TXY A;  3NBH B;  4P75 A;  4RGM A;  2BOS A;  2RKS A;  1B7Y B;  4PMB A;  4HED A;  4ME5 A;  2UXD L;  5C4X B;  2KCM A;  4IWX A;  4NW2 A;  1EIG A;  5M5Y H;  4A76 A;  3MEF A;  3A8J E;  5IYC G;  4LSX A;  4ULL A;  3OSP A;  2PW7 A;  3CPW A;  3K0X A;  1FYC A;  4MTD A;  3NP8 A;  2PN1 A;  3EFX D;  3GLK A;  4C3J B;  1LLR D;  3U9O A;  5C44 B;  3Q8P B;  1A62 A;  4C2M H;  2VS1 A;  1U0L A;  1EU3 A;  1QB5 D;  2J0T D;  3HXL A;  5DLG A;  5FOB B;  1XMQ Q;  5BPF A;  2JA7 A;  1CHP D;  4R8N A;  2ZXR A;  4X64 Q;  4DV5 Q;  2L55 A;  1ML0 D;  2R6F A;  2MPM A;  2WDT A;  1XX8 A;  3KF6 B;  1SBB B;  1Y8P B;  5L37 A;  3W1G A;  1X6O A;  5GRO A;  4RHS A;  4F88 A;  2Y0S E;  4GN4 B;  2VY3 A;  2VUM G;  1KXL A;  2UU9 Q;  3V4Z A;  2W9C B;  3GIJ A;  2MHV A;  1SMY C;  4CGY B;  4OWT B;  4A3D B;  4GKK Q;  1HR0 H;  4QWE A;  4DK3 C;  1YHA A;  3RZO H;  3G6Y A;  3H40 A;  1MGS A;  4RGN A;  3T1H Q;  2Q8T A;  2CW8 A;  3GD7 A;  1VQH A;  3AFQ A;  2YTY A;  2PI2 A;  1HTP A;  1RTO A;  1WCM A;  3S16 B;  1S5C D;  4U67 3;  2EZV A;  4DNT B;  3SHL A;  2P0A A;  2J6U A;  2ATW A;  4RNO A;  4XZ3 B;  3GID A;  4O3S A;  1JT8 A;  3S15 H;  3PCO B;  4Q0Y A;  4RB1 A;  4DR6 H;  1D7Q A;  2UVR A;  3A54 A;  4FM9 A;  4FVM A;  2ATL A;  2V5A A;  2JEF A;  1LV9 A;  1ICF B;  4OXP A;  1OXV A;  2ES2 A;  4O3O A;  4HIK A;  2FIN B;  1S97 A;  1G2S A;  4RCN A;  4RGT A;  2F4V H;  3R93 A;  1WOC A;  1EIY B;  1Y1W A;  1HR0 L;  1O7L A;  1BCP F;  3ETH A;  1T9H A;  3K58 A;  1I94 Q;  3CU7 A;  1S5B D;  1SFO A;  4ILW A;  1PYW D;  1M7J A;  2MFI A;  3NEL A;  5EOY A;  2PZT A;  4MV3 A;  1WTQ A;  3OOC A;  4CHT B;  5CV6 A;  3RR5 A;  1VMC A;  4F4Z A;  4GC6 A;  4QW8 A;  2K52 A;  1JJC B;  4PZ7 A;  2W9B A;  3VYT A;  2HHH Q;  3KLW A;  2NVX A;  3NTH A;  4A3M G;  3GTM A;  2AUK A;  5IGD A;  1NTG A;  3J7Y W;  4DR6 L;  3SE0 A;  3OHX C;  2XTI A;  2JA8 G;  1G51 A;  2XVS A;  1MD2 D;  2R84 A;  4KMU C;  1EUD B;  5EBC A;  2JA5 A;  4O3R A;  1YNN C;  2R7F A;  3G48 A;  1AZP A;  2ZDG A;  4A3J B;  3T51 B;  2OT2 A;  1HJP A;  5KFG A;  2F4V L;  1Z2O X;  2FJZ A;  3MR6 A;  5ELO A;  3TDQ A;  1RL2 A;  1UC9 A;  2DPJ A;  4YWL A;  1SEB D;  1CA5 A;  5EDW A;  1WTO A;  2RDI A;  1UNS A;  1VQB A;  4PZ6 A;  4LFA Q;  4CJ2 C;  1AUX A;  3OHB A;  3KHR A;  2R8I A;  1U4M A;  1E3P A;  1MSG A;  5C4X H;  1SXT A;  3MFI A;  3BJY A;  2FB9 A;  4JV1 A;  2BE5 D;  1DOM A;  2B2Y A;  4DV7 Q;  2QKI C;  2V9W A;  4TV9 F;  1PXU A;  2K7V A;  1MHW C;  2TMP A;  2ZTC A;  4BA1 I;  3AQQ A;  5H80 A;  4RNM A;  5NUC A;  4DR5 Q;  2CCZ A;  2O4X A;  3GDE A;  1CFM A;  2N88 A;  3J81 c;  3SDZ A;  4A3C G;  4YJ3 F;  1TS3 A;  5C44 H;  4IN3 A;  3GP7 A;  2A74 C;  3TP6 A;  1KDC A;  1BDO A;  3Q8Q B;  4J8Q A;  4ECV A;  1S03 G;  2VUM A;  3F2C A;  2G9D A;  4K8I A;  2ASJ A;  3BVG A;  4IWY A;  4RKL A;  3Q24 A;  3KJP A;  5IYD G;  1CKM A;  3QOL A;  4LH7 A;  5LL6 S;  2MQH A;  4MV6 A;  5L1I A;  3EBE A;  4JVZ A;  4JI7 Q;  1EHI A;  1KL9 A;  5KFJ A;  2X69 A;  1VQ6 A;  5CBA E;  1R9T B;  3N6R A;  1A2U A;  2LKV A;  2X6G A;  4DR4 Q;  4UCS A;  4JI1 H;  3HKZ G;  2FFK B;  5FKA C;  4AIM A;  5C0X H;  3JRX A;  1LTR D;  3V6K A;  5LHY 1;  5EKI A;  1M4V A;  5I47 A;  3CKI B;  5HV6 A;  1N56 A;  1CQI B;  3FPU B;  4LF8 Q;  1CQJ B;  3S16 H;  5I2Y A;  3TIN A;  5C4X G;  2F3I A;  4YWM A;  3VPB A;  1I7N A;  3D6C A;  5E4W C;  1I4P A;  1Z6H A;  4POF A;  1S68 A;  4JI8 Q;  5CA1 F;  2WV6 D;  4G4K A;  2N49 A;  2F3W A;  1IBM L;  1EFW A;  4EQN A;  3A56 A;  2XN9 C;  4J9O A;  1LTT D;  2A6H C;  3ERO A;  1QWY A;  4RG1 A;  1JJ2 A;  1I3Q B;  1YJN A;  4EEQ A;  3PVX A;  4DK6 C;  1VF5 C;  1A3V A;  4LNQ A;  3FRP B;  5C8Y F;  1W6J A;  3MTS A;  4C3J G;  4DUZ Q;  3VDY A;  1RJQ A;  3CCV A;  1EYG A;  1OXU A;  4IZO A;  2JEJ A;  4ECU A;  1CZG A;  1L2Z A;  3MXN A;  2VB3 X;  2HVS A;  5ELN A;  2E2J B;  4JI1 L;  3C2P A;  1X55 A;  4J15 A;  5G3L F;  4X65 H;  1N8R C;  1DJR D;  2C2R A;  2R86 A;  2V58 A;  3Q8S B;  3I7F A;  1KTK A;  5FLM H;  3MHB A;  4JV5 Q;  2R7D A;  2VQE Q;  2AU0 A;  1VQD A;  1G91 A;  5KFN A;  3FDT A;  4DV1 H;  1EWI A;  4RB3 C;  1QUQ B;  3E5N A;  1GUO A;  2UUC H;  3MA2 B;  2B2U C;  1V9P A;  2YYA A;  3K5I A;  4P74 A;  3HOX G;  4RB2 C;  1B4O A;  2CW0 D;  4YAK B;  3X3N A;  2CQO A;  3L3O C;  4A3D G;  2R93 B;  3NQI A;  2Z1C A;  5C0X G;  3VA7 A;  1F9R A;  5EBD A;  1PH8 A;  4PQX A;  3LNN A;  1S5D D;  5E7N A;  3V6H A;  4XXE A;  5JVD F;  3JC6 6;  4V0B A;  5C3E B;  4Q44 A;  4UCV A;  5KFK A;  2DGY A;  2NZH A;  3I2Z A;  2UXD Q;  4A3J H;  4ZUJ A;  4A3G B;  4YHH H;  3TRZ A;  2D0O A;  2M9V A;  5I6W A;  5ELF A;  4WD3 A;  3RZD B;  3BQ0 A;  4BBR B;  5M5W H;  4CDF C;  3J81 i;  5K5P A;  4X65 L;  2L11 A;  3PO2 B;  3KOJ A;  3RN5 A;  1AN7 A;  5KFW A;  5CB4 F;  3PUX A;  2PPB C;  2R6G A;  1I5F A;  3PUW A;  3SK6 A;  1NNX A;  3ZYY X;  2VNU D;  3JRW A;  1U9R A;  1PDQ A;  4WJ3 M;  4EGJ A;  1II3 A;  2UUC L;  4F4X A;  3HZX A;  2RDJ A;  3OW2 A;  1ENA A;  4IQZ A;  3I90 A;  2YV5 A;  4J9M A;  3ERS X;  3MR2 A;  1K8O A;  1TY2 A;  1NAP A;  4YQW A;  1K3B C;  4Q8E A;  4EG0 A;  3V4S A;  1EQV A;  5FLM G;  1E4F T;  5KT3 A;  1EUC B;  3RLF A;  4CBV A;  4A3F G;  5JEA J;  4XDX A;  5T1I A;  2FLP A;  1VKZ A;  1PMR A;  3BQ1 A;  4YHH L;  2XRQ D;  4BXX G;  1F2L A;  2R7Z A;  3U58 A;  5EWE A;  1VQE A;  3GTO B;  3CRK C;  3I12 A;  4YBZ B;  2BQ3 A;  1BXR A;  4EX5 A;  4X3S A;  4LUZ A;  1XTC D;  2NYZ D;  2R8G A;  1AEX A;  1IL2 A;  5D14 A;  3H3V H;  1EEF D;  2F0O A;  4OO1 I;  4A3J G;  1DON A;  2IT1 A;  2CH4 A;  1A0I A;  4YJ2 F;  3CAM A;  5FJ8 H;  4J9K A;  3MFG A;  4IZ8 A;  3NHH A;  2VZA A;  1KAW A;  5JPN C;  4RMF A;  4A3E B;  3STB C;  2K03 A;  4IUN A;  1GVP A;  5KT2 A;  2V59 A;  4IJL A;  3J81 j;  1FVI A;  3QR8 A;  2DJG C;  5KFB A;  4EGV A;  1KRS A;  4QQB X;  1T94 A;  1QZH A;  1L1O C;  2ASB A;  4DNR B;  3D4R A;  4KY5 A;  2JE6 I;  4JOI A;  2OTL A;  1HR0 Q;  2IBK A;  4IUV A;  5IYB H;  2VL6 A;  4MV8 A;  1UAP A;  4DAM A;  1X3Q A;  3JZI A;  1BBU A;  2AGP A;  3WNZ A;  4XQN A;  3TME A;  5IWA H;  3F8N A;  2EYO A;  3KF6 A;  4LFB H;  3CF5 A;  1J5E Q;  3OSO A;  2E2J H;  3RAQ A;  2W9C A;  1VQA A;  3MWM A;  1EY8 A;  2F0U A;  2HQE A;  4DR6 Q;  1IZ6 A;  3HS0 C;  3ND9 A;  3T13 A;  1B6S A;  3TEH B;  4LK1 C;  4BY7 B;  2YU9 B;  4F87 A;  2DN8 A;  1IOW A;  1C8C A;  3MXU A;  4FF2 A;  4R4I A;  4F7X A;  1GHJ A;  1PZI D;  3Q1K A;  4OHJ A;  1P16 A;  2Y0S B;  2F4V Q;  2F4I A;  2RGR A;  3PMF A;  2R93 H;  2AGQ A;  4CC5 A;  3KAJ A;  3DLL A;  4DV4 H;  4DL6 A;  4I65 A;  5C3E H;  4OIK A;  3Q23 A;  2JYO A;  4IR9 A;  5IWA L;  1KIX A;  4DN4 M;  3C3L A;  4LFB L;  2PQA B;  3RJ0 A;  2RHQ B;  3RV3 A;  1XTD A;  2F0G A;  2ZXP A;  3M3Y H;  2KEC A;  3RZD H;  4BBR H;  1Z2N X;  2KEE A;  4GOP A;  2NVQ H;  4B9X A;  3HOV B;  3PO2 H;  2RDH A;  5BN3 A;  5CAE B;  1JOO A;  5IYB G;  4BY1 B;  4FU0 A;  2K28 A;  4IAJ A;  3GTL A;  2K5Q A;  1QOH A;  2D62 A;  1PA6 A;  4K5V A;  4HN7 A;  1TWF B;  1JJG A;  5AJ3 L;  1ZXT A;  1K1Q A;  1PH5 A;  3ICE A;  2J4X A;  2GPS A;  1F2Z A;  3MC0 B;  1SMX A;  1Q1B A;  2KHI A;  3T56 B;  4DV4 L;  3GTJ A;  1PYS B;  2E2H H;  2I5M X;  3R8B A;  3KF8 A;  5JEA H;  1PRT F;  4JYA H;  5JVH 3;  1ASY A;  5KFE A;  1VBG A;  3G6X A;  3KK7 A;  2JEB I;  4LFC Q;  5IIF A;  5ELB A;  3GTO H;  1IBL H;  1KBL A;  1M0T A;  1X3P A;  4JUZ A;  2KCC A;  1VQK A;  1QNK A;  2R93 G;  4DR1 H;  1I50 H;  1RJT A;  3L7Z C;  4ECX A;  4IAL A;  5HGT A;  2HQL A;  2WAQ G;  2BQR A;  3M9O B;  4DL7 A;  4A3L G;  5C3E G;  1C48 A;  2UXB H;  1RIP A;  5EQ0 A;  3SR1 A;  4PDB A;  1EYD A;  2KHJ A;  2R7K A;  3QZ8 A;  5GAE C;  4A3G G;  1RYS A;  1Z2P X;  1R4P B;  2FXQ A;  1E4E B;  1MI2 A;  3M9M B;  1O7Z A;  3P75 A;  4JI6 H;  2JQO A;  3PO2 G;  1RF2 D;  4A3E H;  2SDF A;  4K0K H;  4Q5V A;  4RUA A;  5KFT A;  2ZDH A;  1WTR A;  2JA6 B;  4JYA L;  1B3A A;  2R7M A;  1I4G A;  3CD6 A;  4C5C A;  4O4I F;  4A2B A;  2RCN A;  4JI3 H;  1SE2 A;  5KRU A;  2QGQ A;  1EUJ A;  5CMD A;  1IBL L;  4JI1 Q;  3TBI B;  1X56 A;  2K04 A;  1K83 B;  3SEB A;  4UY8 C;  5IP9 G;  4DR1 L;  1YNJ C;  2DLN A;  4HJA A;  2CZG A;  5F2D A;  3EQL C;  3PW5 A;  1C7Y A;  1XDN A;  2UXB L;  3D0F A;  3PGZ A;  1K28 A;  3UDX A;  2NWG A;  3GTK A;  2ASD A;  4KN7 C;  2I5L X;  4G7O C;  3WO0 A;  1KLU D;  2XGT A;  1SYG A;  4IUQ A;  4DF7 A;  4ZAI A;  2IW3 A;  3DWQ A;  2OLS A;  1SNO A;  2PZW A;  5KFH A;  1R9T A;  2R8K A;  5KFC A;  2R85 A;  1STA A;  5DG8 A;  4JI6 L;  3KHL A;  2Q8I B;  3T5L A;  5DNF A;  4BY7 H;  2CVR A;  2YU9 H;  4K0K L;  1K0R A;  1O78 A;  1CHQ D;  3U50 C;  2FPI B;  4C2M B;  4JI3 L;  1JIC A;  3M4O H;  4ED7 A;  1BCP D;  4YCU A;  4POG A;  4I4T F;  2VXW A;  3E5S A;  3W3A A;  5D3D A;  3PIO 3;  2A73 B;  3TS0 A;  1CZW A;  3R3O A;  2W70 A;  4A3E G;  3N41 B;  1I3Q A;  1VQI A;  3J7A V;  4ETS A;  1E7Z A;  2QYZ A;  1BQQ T;  2A19 A;  1IKL A;  4KD4 A;  4J9R A;  5I4D A;  3DEP A;  3S14 B;  1S0M A;  4DV1 Q;  4DV2 H;  3PIP 3;  4O4L F;  3SE7 A;  3RLO A;  3QO2 A;  4ZQI A;  4QGU A;  3HOV H;  2B3G A;  1B3Q A;  1BO0 A;  3JSL A;  4O1N A;  3QG1 A;  4GC7 A;  1BOS A;  3V05 A;  4BY1 H;  2K5N A;  1WTV A;  2W71 A;  3D4W A;  2VA2 A;  4MNO A;  4ZKB B;  5LMN W;  2GVB A;  3DUZ A;  4ED8 A;  4FF1 A;  4H13 C;  1TWF H;  2UVV A;  2F0S A;  4YCW A;  3JSN A;  4DV6 H;  1JWU D;  3GQB A;  2YZN A;  1H9J A;  1QUQ A;  4HJ8 A;  4J9S A;  2W6N A;  3S15 B;  1SE8 A;  2YS7 A;  3GV8 B;  4JI5 H;  4Q43 A;  4ECZ A;  3K57 A;  5EPJ A;  4JPB W;  2R93 A;  1BBX C;  5C3X A;  4JC0 A;  4DUY H;  4KJN A;  1RK5 A;  5KT6 A;  1TWG A;  2WAQ A;  1ET9 A;  4EFE A;  1Q12 A;  3T5H A;  2JK8 A;  1HZC A;  1HRJ A;  3JAM W;  2AQ1 B;  1NMG A;  4DV2 L;  3GQC A;  2Y0S G;  2F0N A;  1JXL A;  4OX9 H;  5EZY F;  4GS3 A;  4FXD A;  4A3K B;  4DV3 L;  3SK4 A;  2R92 B;  3K5M A;  5HY6 A;  5IT9 c;  1B50 A;  1I4Q A;  1MKH A;  5J2T F;  3A7A B;  5D1O B;  2I0Q A;  3C1E A;  3PO3 B;  4DV6 L;  1HNX Q;  2NN6 G;  5M3F B;  4IPH A;  1I6H B;  3NGD A;  2KVM A;  4RB0 A;  4IPG A;  3OUU A;  4JI5 L;  3F2D A;  1VQG A;  2KQ3 A;  4FNF A;  4RKB A;  1N32 Q;  3BAB A;  1YHB A;  4LAA A;  4DUY L;  4X62 H;  2JA6 H;  1HZB A;  1LT5 D;  4HJ5 A;  4OWX B;  3AFP A;  3HOU B;  5JVG 3;  4QUF A;  2KA7 A;  1OO9 B;  5IP7 H;  1XMO Q;  3T4A C;  3I72 A;  3G7L A;  3NXW A;  1P8L A;  3H0G A;  1K83 H;  4OX9 L;  1WH2 A;  1YIJ A;  2YCH A;  4XQJ A;  2JEG A;  4BWS C;  2FK2 A;  1N36 H;  4RAU C;  4GNX C;  2Q8R E;  3D3R A;  3UQ8 A;  4F8M A;  2VQD A;  2F0K A;  5IT9 W;  1VQC A;  2KSW A;  5C0X I;  5M3M B;  4RZQ A;  2FPP B;  1K8A C;  1IOV A;  4ZRZ A;  1QCB D;  2PNR C;  4JCV E;  2FP4 B;  3OHA A;  2VPS A;  1JE4 A;  1B70 B;  4WRD A;  4KHZ A;  5BN5 A;  4ZOL F;  1GUN A;  2XSC A;  2XWJ B;  2DIK A;  3T53 B;  4X62 L;  4DGZ A;  4LF5 Q;  1HA6 A;  4NXM H;  1O80 A;  5A2Q E;  4APM A;  1HXY D;  2B29 A;  3SGI A;  4RUC A;  3EPI A;  1EZ8 A;  2EDG A;  2XCL A;  1JX4 A;  4LF7 H;  2ALZ A;  4K6L A;  1EQQ A;  4JW0 A;  1PTO C;  4IFD J;  2ZT9 C;  1CI3 M;  1Z7T A;  1N36 L;  1H9M A;  1E1O A;  1SND A;  5CYU A;  1H9S B;  4RNN A;  3A0J A;  1AZQ A;  5HGQ A;  2JA6 G;  4M9U A;  4MTK A;  4OGQ C;  3S14 H;  5BR8 H;  5M9O A;  1S3O A;  1KLG D;  2I46 A;  1C30 A;  4QIW E;  4K5X A;  5J2U F;  5F9N A;  3U4Z A;  3RB3 A;  1UE1 A;  4ABN A;  5LL6 X;  4HNU A;  2J6T A;  3KDF A;  4FS2 A;  4DV4 Q;  2PI2 E;  2EY6 A;  3IFD A;  1RJP A;  4DFA A;  1NSN S;  2KCT A;  3PUZ A;  4JI2 H;  2GPW A;  4MA5 A;  4NXM L;  1VQN A;  4NLG A;  3S1R H;  1MSH A;  1JKJ B;  2F0H A;  3A5Z B;  4NPS A;  4XYM B;  2NBF A;  4NP5 A;  2K5D A;  4LF7 L;  5DQI A;  2D9U A;  3J7A K;  2Y0S A;  2CHB D;  2WYO A;  4JBW A;  4BWG B;  1U4P A;  1F2M A;  4QWD A;  1SN8 A;  4TKO B;  3RLN A;  1LT6 D;  1RCV D;  2SEB D;  1U4L A;  3PIO A;  2JA9 A;  2MNA A;  1K9M C;  4Q8F A;  3PUY A;  1LUZ A;  1HH2 P;  3AB9 A;  1TQO A;  2KEN A;  5KGU A;  5BR8 L;  5COY A;  2Z6K A;  3HGB A;  2PQA A;  2UVW A;  1PLF A;  2K50 A;  5LMN H;  4A3K H;  1GSO A;  1SJH D;  4FBT A;  2LXJ A;  3NWT A;  2R92 H;  2JXM B;  3NUC A;  1Q46 A;  1KQS A;  1JMC A;  4NXN H;  3L9A X;  4IUR A;  2P5Z X;  4U6P A;  2EPB A;  3BVM A;  4JYA Q;  1W96 A;  1RHP A;  1JB7 A;  4QL5 A;  2E75 C;  4JI2 L;  1Y8O B;  3OTO H;  1SYE A;  3S2D H;  2LMC B;  4E4T A;  3GIL A;  1VQL A;  3I4N B;  3PO3 H;  5M3F H;  1I6H H;  4DV0 H;  3CME A;  5D1P A;  2L12 A;  3E6Z X;  3J80 L;  1KJJ A;  3OSN A;  4LF6 H;  4RH6 A;  1F9S A;  1IBL Q;  5F9L A;  2V4D A;  5I2X A;  4LMQ D;  4DR2 H;  2E2I A;  1D1K A;  4JI0 L;  1M6V A;  2JJQ A;  3A55 A;  2EYL A;  4IOC A;  2RHS B;  4DR1 Q;  4QWA A;  3GV3 A;  2VB2 X;  2XRS D;  1KJQ A;  1EFI D;  2NVT B;  3BG5 A;  1PRT B;  2HIV A;  3TP5 A;  3HOU H;  5JJI A;  1YJ9 A;  4RCO A;  1T36 A;  2YZG A;  1TWC B;  1B2T A;  3QOJ A;  5M5W B;  1GSH A;  4G7Z C;  3V2T A;  5FO9 B;  5LMN L;  4UCO A;  5KFX A;  2CW7 A;  5GON F;  1SJE D;  4XT1 B;  5JOB A;  4JI6 Q;  4JI4 H;  3H3V I;  4B3R Q;  4NXN L;  2NU7 B;  5KT5 A;  4MIU A;  2JN4 A;  3TIG A;  5E4X A;  1I6V C;  2E5L L;  3OTO L;  4Y8V B;  5M3M H;  1WD1 A;  4J6H A;  4DAY B;  3R23 A;  1BGW A;  5KT4 A;  4JI3 Q;  1M8A A;  2EOT A;  4DV0 L;  2KOL A;  3EN2 A;  4PWQ A;  4ME6 A;  1EY0 A;  4LF6 L;  4GLV B;  4BBS B;  3GO5 A;  4YY3 Q;  4DR2 L;  1HZA A;  1AW7 A;  1BKB A;  3ULJ A;  4A3K G;  1HFN A;  1Q86 C;  2R92 G;  1RDP D;  3JAM L;  1D5M C;  2KCN A;  2EIF A;  1V1O A;  1VF7 A;  3S1M B;  1GUW A;  2JA6 A;  2XD4 A;  5IOC A;  3F2B A;  4RZR A;  1ZHS A;  1LT4 D;  4UFZ A;  2UXC Q;  2K6A A;  1IBM H;  2K5H A;  5KIX A;  5M3F G;  4AYB B;  1DOK A;  3KLR A;  4IFD H;  4NMZ A;  5JUM A;  3NEN A;  1T3N A;  4JBM A;  2FMM A;  5DAU A;  4K5W A;  3ONA B;  2NTS A;  2UUB L;  4JI4 L;  4A93 B;  4J9N A;  3IG0 A;  4J0M A;  1PH3 A;  4ALP A;  4J9Q A;  1DD2 A;  1XNQ H;  3HOU G;  4HYK A;  3J7A 5;  3MXP A;  3FMA A;  3ORQ A;  4PMC A;  2F0M A;  1LTG D;  1VQO A;  1I6U A;  4HR7 B;  2OH2 A;  3IL8 A;  3L4J A;  1SSO A;  3PR5 B;  4R4O A;  2A6E D;  4C1N I;  1CUK A;  4C2M A;  1V8Q A;  3S2H B;  2VPQ A;  5M3M G;  1K0S A;  1V1P B;  3TP7 A;  4CJ0 B;  3I4M B;  4HNV A;  3BZK A;  1UEB A;  3VYR A;  1ZYR D;  5IT9 L;  3WDN A;  4DU9 A;  2Q2I A;  4R8U B;  3BVZ A;  3TP8 A;  3BA8 A;  2B2Y C;  2YRX A;  5KKN B;  1EY9 A;  3FKI B;  2F0D A;  3TSS A;  3DWP A;  5C44 G;  1VQ5 A;  1AP0 A;  2W8K A;  4O3N A;  3J80 E;  1XNQ L;  2M00 A;  3Q2O A;  4LUV A;  5LP6 F;  3UI2 A;  1STG A;  2QK4 A;  2PMZ B;  5CC4 A;  3UDF A;  2CKZ B;  3T1Y H;  4UDU C;  4JI5 Q;  1PRT D;  4LF4 H;  1N33 H;  3V96 A;  4IO9 A;  1GM5 A;  4KY6 A;  2MO0 A;  3LWB A;  1HNZ H;  3K81 C;  4I55 F;  5FLX E;  1CKN B;  3MFY A;  2ICI A;  3I4N H;  1TWA H;  4HMJ A;  2EVB A;  1IW7 C;  2JP1 A;  2B2V A;  2GN5 A;  5C3W A;  2V4Q A;  5KNB A;  2Q2T A;  2I80 A;  5AFW A;  1WFQ A;  4C1N K;  3KLS A; 
#chains in the Genus database with same CATH homology
 4DR4 L;  3PO2 H;  3ULL A;  2NVT H;  1A63 A;  2IY5 B;  2E2I H;  2YYZ A;  2C35 B;  2N3S A;  5IYB G;  4GNX B;  3E9H A;  4GLX A;  4GOP B;  4KI0 A;  4LW1 A;  1W3S A;  3GTG H;  4OO1 G;  1TWC H;  2D62 A;  1PA6 A;  1PH7 A;  3UDI A;  1ASZ A;  1JJG A;  4XIG S;  1WCM G;  4DPG A;  5AJ3 L;  3T1Y L;  4A3C H;  2QA4 A;  3UE1 A;  3J80 i;  1KHI A;  1XPU A;  4LF4 L;  1PH5 A;  2Z0S A;  1N33 L;  4OWW B;  3ICE A;  2UXB Q;  1S40 A;  1HNZ L;  1DGS A;  5M5X H;  1SMX A;  3ULP A;  1Q1B A;  2N8N A;  2KHI A;  4DV4 L;  1PYS B;  2E2H H;  2I5M X;  2ZJQ A;  1WJJ A;  1YJW A;  1LM0 A;  1J5E L;  1HZ9 A;  4HJ7 A;  3CPF A;  2ALY B;  1N34 Q;  1ASY A;  4C3H H;  4B3S L;  4DUZ L;  4BBS H;  2B63 G;  3KF8 B;  2VW9 A;  2JEB I;  2ZM6 Q;  4LFC Q;  4UP8 A;  4IFD I;  5IYD H;  3KFU A;  2CWP A;  4MZ9 A;  4K0K Q;  4DR3 L;  1BVS A;  3GTO H;  1X3E A;  1AE3 A;  1VQK A;  1N36 Q;  2R93 G;  1Y1W G;  1I50 H;  1GO3 E;  2NVQ H;  3L7Z C;  2R7Z H;  3S1M H;  1XJV A;  1VQF A;  2HQL A;  2WAQ G;  1VQ9 A;  2V1C C;  4LF9 Q;  2CWA A;  5C3E G;  1WI5 A;  4A3L G;  1RIP A;  4APV A;  2A8V A;  3I56 A;  1YVC A;  4JV5 L;  3M7N A;  3PF4 A;  2KHJ A;  2YTX A;  5GAE C;  4A3G G;  3A5U A;  1L2F A;  2AKW B;  1K8G A;  3M4P A;  2VUM H;  2FXQ A;  1PH4 A;  2Z6K C;  2A1A A;  2HIX A;  2LSS A;  4IOA A;  4A93 H;  4X66 L;  2JQO A;  3PO2 G;  4A3E H;  1VQ8 A;  1PH6 A;  4QY7 A;  3PO3 G;  2UUA L;  2HT1 A;  4GKJ L;  3S1Q H;  2GVA A;  1YHQ A;  3PF5 A;  4JYA L;  1TXY A;  1OXS C;  3NBH B;  4P75 A;  2H5X A;  3KJO A;  1KC8 C;  3CD6 A;  1B7Y B;  4A3G H;  2RCN A;  4IPD A;  4LF7 Q;  1QVG A;  2UXD L;  2KCM A;  4DR7 L;  2QGQ A;  1EUJ A;  4C3J H;  1IBL L;  1X3F A;  4JI1 Q;  4A75 A;  1X56 A;  2BA1 A;  5M5Y H;  4UY8 C;  4A76 A;  5IP9 G;  3CC7 A;  4DR1 L;  3MEF A;  2ZTE A;  5IYC G;  4HJA A;  4NB3 A;  2MO1 A;  3S2H H;  1C7Y A;  3CPW A;  3K0X A;  2UXB L;  1NMF A;  1SLJ A;  3D0F A;  3PGZ A;  3I4M H;  3UDX A;  1Q7Y C;  4L5R C;  2I5L X;  4HIM A;  2XGT A;  3ER0 A;  3F8T A;  1A62 A;  3TQY A;  4C2M H;  4BBS G;  2VS1 A;  4IJH A;  1UE5 A;  1Y1V H;  1U0L A;  2NN6 I;  4R4Q A;  3G6E A;  4AH6 A;  2N78 A;  1B8A A;  3FKI H;  1XMQ Q;  4JI6 L;  4XTC S;  4LFC L;  2ZM6 L;  4DV2 Q;  2YU9 H;  2R7Z G;  4BY7 H;  4K0K L;  1K0R A;  1NE3 A;  4JI2 Q;  3HOX H;  3U50 C;  4X64 Q;  4DV5 Q;  4R4T A;  1D8L A;  3CCM A;  4A3D H;  1E1T A;  4DV3 Q;  3KF6 B;  2ZTD A;  4JI3 L;  3M4O H;  3W1G A;  1X6O A;  2Q2H A;  4YCU A;  5GRO A;  4POG A;  2Y0S E;  4GN4 B;  3CCS A;  2VY3 A;  2VUM G;  1KXL A;  2UU9 Q;  3BZC A;  2OTJ A;  3TS0 A;  4HIO A;  5H1S E;  4OWT B;  4A93 G;  3DM3 A;  4GKK Q;  2AMC B;  4DV6 Q;  1YI2 A;  3B6Y A;  4A3E G;  2Q2U A;  1VQI A;  4DK3 C;  1YHA A;  3H15 A;  3RN2 A;  3RZO H;  1VQJ A;  3T1H Q;  1E7Z A;  4IPC A;  1PV4 A;  2A19 A;  4IFD G;  3S17 H;  4P72 A;  1AE2 A;  1OXT A;  3GD7 A;  5GQO A;  1XNR L;  1CKO A;  1VQH A;  4GN3 B;  3AFQ A;  5FJ8 G;  4DV1 Q;  2YTY A;  2PI2 A;  4DUY Q;  3RLO A;  4QGU A;  3HOV H;  2B3G A;  3CP0 A;  1IBK L;  1MIU A;  1E24 A;  2ATW A;  1JT8 A;  4LWC A;  4BY1 H;  4AQY L;  3S15 H;  2K5N A;  3PCO B;  4MNO A;  4A3B H;  5LMN W;  1V43 A;  1BBW A;  2GVB A;  4OX9 Q;  2AWO A;  1D7Q A;  1TWF H;  4TVA B;  1EOV A;  1PFS A;  4JBJ A;  4DV0 Q;  3I4M G;  4YCW A;  1WYD A;  3FP9 A;  2IX1 A;  3GTL H;  4OXP A;  1OXV A;  2NVY H;  2ES2 A;  4HIK A;  1QUQ A;  4HJ8 A;  2IX0 A;  1VQ4 A;  4BA2 I;  1SE8 A;  3D31 A;  4A3F H;  1Y1V G;  3TS2 A;  3TRE A;  1SRU A;  1WOC A;  2DUD A;  3CQZ H;  3UDG A;  1EIY B;  1HR0 L;  2ID0 A;  4JC0 A;  4L5T A;  4BXX H;  3G71 A;  1T9H A;  2IHE A;  1I94 Q;  4JOI C;  3GTJ H;  2WP8 J;  2MFI A;  1Q12 A;  1UE7 A;  1PHJ A;  3CCL A;  2JK8 A;  1HZC A;  3NEL A;  3PUV A;  1XMQ L;  4KHP L;  1NMG A;  4DV2 L;  4X62 Q;  1K3R A;  5LMU L;  2Y0S G;  3E9I A;  4DV5 L;  4H02 A;  3RR5 A;  1EIF A;  3AYH B;  4GS3 A;  3M4Q A;  4JI4 Q;  5K36 G;  4DV3 L;  2K52 A;  1UWV A;  1JJC B;  4PZ7 A;  4UPA A;  3AEV A;  2HHH Q;  1K73 C;  3KLW A;  5HY6 A;  5IT9 c;  4A3M G;  2VQF Q;  4X6A H;  1NTG A;  1PH2 A;  4DR6 L;  1V1Q A;  3GTQ H;  1MKH A;  2UU9 L;  2XTI A;  4P73 A;  1SRO A;  2JA8 G;  1G51 A;  4YCV A;  2I0Q A;  2K5V A;  1L1O A;  4GKK L;  4DV6 L;  1HNX Q;  2NN6 G;  3K7A H;  4IPH A;  2R7F A;  3G48 A;  4IPG A;  4JG2 A;  1HJP A;  4JI5 L;  3F2D A;  2BH2 A;  2F4V L;  1VQG A;  1Y14 B;  3I4O A;  1HNW L;  4MTN A;  3I4N G;  1N32 Q;  3HKZ E;  5ELO A;  3J7Z C;  3HOW H;  4DV1 L;  1YHB A;  1RL2 A;  1VQM A;  1Q82 C;  4YWL A;  4DUY L;  4AYB E;  1HZB A;  2JA6 H;  5JJK A;  1VS0 A;  4HJ5 A;  4OWX B;  1YIT A;  3AFP A;  1VQB A;  2NZO A;  4PZ6 A;  4LFA Q;  3S24 A;  4BBR G;  1IBM Q;  5IP7 H;  1E3P A;  1XMO Q;  5C4X H;  4B3T L;  1VCI A;  1P8L A;  4DV7 Q;  1K83 H;  4OX9 L;  1X65 A;  4NXM Q;  1YIJ A;  2ZTC A;  3U4V A;  1TWH H;  4BA1 I;  5GAH C;  4GNX C;  3AQQ A;  2QEX A;  4GOP C;  4DR5 Q;  2CCZ A;  1XNQ Q;  4A3C G;  3GDE A;  3J81 c;  1FJG Q;  1VQC A;  5C0X I;  3J80 c;  5C44 H;  4B3M Q;  1K8A C;  4JCV E;  1IYJ B;  1MJE A;  1I94 L;  4P71 A;  3GTK H;  2K14 A;  2PNH A;  1H95 A;  1B70 B;  3HFZ B;  2E8G A;  5BR8 Q;  5JEA G;  4KHZ A;  3F2C A;  1FGU A;  1R9T H;  4X62 L;  3KJP A;  2BH8 A;  1CKM A;  5IYD G;  4JBK A;  5FLX c;  4LF5 Q;  2K75 A;  2MQH A;  1N34 L;  4R1J A;  2B29 A;  3EBE A;  2OCE A;  3SGI A;  2HHH L;  4JI7 Q;  1KL9 A;  2OQK A;  1VQ6 A;  4R4C A;  1EQQ A;  4DR4 Q;  1FL0 A;  3WWV A;  4KLK A;  4IFD J;  3HKZ G;  1PYB A;  1N36 L;  4AIM A;  1Z9F A;  2YTV A;  1E1O A;  2PMZ E;  1HNX L;  4AYB G;  3HOW G;  5IY0 A;  3A0J A;  2JA6 G;  1NY4 A;  5HGQ A;  2ZJP A;  1VQP A;  2ZJR A;  3L2P A;  4JI0 Q;  3S14 H;  4LF9 L;  1Q81 C;  1S3O A;  1NJI C;  1PH9 A;  4LF8 Q;  4X65 Q;  1I3Q H;  1N32 L;  3HKS A;  3S16 H;  4QIW E;  5C4X G;  2F3I A;  4YWM A;  3U4Z A;  1M1K C;  1UE1 A;  3PV0 A;  4LFA L;  2KBN A;  1KRT A;  1LYL A;  4POF A;  4JI8 Q;  3JAM c;  4PMW A;  3KDF A;  1WCM H;  2N49 A;  4DV4 Q;  1IBM L;  2PI2 E;  4L5Q A;  1EFW A;  1XMO L;  4RG1 A;  1JJ2 A;  1Q8K A;  3M85 A;  5LMN Q;  2KCT A;  3PUZ A;  4DV7 L;  1YJN A;  1X9N A;  2UUC Q;  4DK6 C;  4NXM L;  4LNQ A;  3KDF B;  1VQN A;  3S1R H;  4B3S Q;  4DUZ Q;  3VDY A;  3CCV A;  3CMA A;  1OXU A;  4HJ9 A;  3A5Z B;  4NPS A;  3BJU A;  1EYG A;  4NXN Q;  4Y52 H;  3K8A A;  4A3I H;  3LGJ A;  1YBY A;  4LF7 L;  2JEA I;  3CCR A;  4DR5 L;  2E5L Q;  1UE6 A;  3OTO Q;  5ELN A;  4JBW A;  1JE5 A;  5J3B A;  4JI1 L;  1X55 A;  4J15 A;  1SN8 A;  3RLN A;  2OQ0 A;  1N8R C;  3PIO A;  1QVC A;  4LF6 Q;  2JA9 A;  3MXN B;  1CKN A;  3KYH C;  4YHH Q;  3I7F A;  5FLM H;  2MNA A;  1K9M C;  3PUY A;  1QVF A;  4DR2 Q;  1LUZ A;  1HH2 P;  4JV5 Q;  2KEN A;  4UP9 A;  5BR8 L;  2R7D A;  2VQE Q;  1C0A A;  2Z6K A;  1TWG H;  2PQA A;  1VQD A;  1SFO H;  3E0E A;  1X3G A;  3FKI G;  1C9O A;  1EWI A;  3BU2 A;  2K50 A;  1QUQ B;  4A3L H;  3M9B A;  4PZ8 A;  4BY7 G;  4A3K H;  4LF5 L;  1V9P A;  2K4K A;  2LXJ A;  3Q8D A;  4P74 A;  4X66 Q;  3HOX G;  1X54 A;  2R92 H;  4Y7N H;  1Q46 A;  3I55 A;  2CQO A;  1KQS A;  3A74 A;  1JMC A;  2UUA Q;  3CC2 A;  4A3D G;  4JI7 L;  4GKJ Q;  5C0X G;  1PH8 A;  4JYA Q;  5E7N A;  1JB7 A;  4QL5 A;  4JI2 L;  4X64 L;  1YZ6 A;  3JC6 6;  3S2D H;  2NVX H;  3RNU A;  1VQL A;  2UUB Q;  3GTM H;  3PO3 H;  2DGY A;  4O0A A;  5M3F H;  1I6H H;  2NZH A;  3CME A;  3S1N H;  3I2Z A;  3HOZ H;  2UXD Q;  4A3J H;  3F1Z A;  4DR7 Q;  3HOY H;  4L5S A;  1IBL Q;  4FDB A;  2EXD A;  1OTC A;  2D0O A;  3TRZ A;  4JI0 L;  2JJQ A;  2WFW A;  5M5W H;  4IOC A;  2RHS B;  4DR1 Q;  2JA5 H;  1VQ7 A;  4LF8 L;  3J81 i;  4X65 L;  1L0W A;  3KOJ A;  3RN5 A;  2HIV A;  3PUX A;  3HOU H;  5JJI A;  4QJF A;  5IP9 H;  2R6G A;  1YJ9 A;  4JI8 L;  4ME3 A;  1I5F A;  5IYC H;  3T1H L;  3PUW A;  1L1O B;  5C4J H;  3HOV G;  2WB1 E;  1M90 C;  5JJL A;  2VNU D;  2IHF A;  1A8V A;  4A3I G;  4WJ3 M;  5LMN L;  4BY1 G;  3GTP H;  2UUC L;  1EQR A;  3OW2 A;  4A3B G;  4JI6 Q;  2YV5 A;  3H3V I;  3ERS X;  4B3R Q;  4NXN L;  1U5K A;  3H0G H;  1W2B A;  2E5L L;  2EQS A;  5FLM G;  3OTO L;  2LXK A;  2BA0 A;  5M3M H;  3FHW A;  4DAY B;  3RLF A;  1MJC A;  5JEA J;  4A3F G;  4JI3 Q;  4DV0 L;  3L0O A;  4WJ4 A;  3EN2 A;  3CXC A;  4LF6 L;  4GLV B;  3CCJ A;  3GO5 A;  4YHH L;  2OWO A;  4YY3 Q;  3UE0 A;  4LUO A;  1HZA A;  2F52 A;  4DR2 L;  3U58 A;  4BXX G;  4A3K G;  1BKB A;  1VQE A;  3ULJ A;  2VQE L;  1Q86 C;  2R92 G;  1PH1 A;  4EX5 A;  2EIF A;  3PSI A;  4LUZ A;  1S72 A;  2D0P A;  4EQ5 A;  3F2B A;  3NEM A;  1N9W A;  1XNR Q;  1IL2 A;  2UXC Q;  3JAM i;  2K5H A;  5M3F G;  3H3V H;  3HOZ G;  4OO1 I;  4GLA C;  4A3J G;  2IT1 A;  3NEN A;  3HOY G;  1A0I A;  1IBK Q;  4JBM A;  1YNX A;  2AWN A;  3CAM A;  5FJ8 H;  1XPR A;  2UUB L;  4JI4 L;  5IWA Q;  2JA5 G;  1GD7 A;  4AQY Q;  4LFB Q;  2VZA A;  2JA7 H;  1KAW A;  2CFM A;  4RMF A;  1PH3 A;  4ALP A;  3IRB A;  1G29 1;  3STB C;  2VQF L;  3HOU G;  1GVP A;  3G4S A;  3J7A 5;  4IJL A;  3J81 j;  4C3I H;  2WB1 G;  1FVI A;  5EAY A;  2I5H A;  3W1B A;  1KRS A;  1VQO A;  4QQB X;  4TQU S;  4A4I A;  3K7U C;  1QZH A;  1L1O C;  4PG3 A;  2ASB A;  1QZG A;  1O7I A;  3CCU A;  2JE6 I;  4JOI A;  2OTL A;  1HR0 Q;  1CSP A;  1GKH A;  4OON A;  5IYB H;  5AJ3 Q;  5IP7 G;  2VL6 A;  3H0G G;  3T1Y Q;  4R4O A;  4DAM A;  3CW2 C;  1E22 A;  1BBU A;  1CUK A;  4LF4 Q;  1N33 Q;  3W5O A;  1HNZ Q;  4KHP Q;  5M3M G;  3CC4 A;  1Q1E A;  4B3R L;  3KF6 A;  3CF5 A;  3CCQ A;  5LMU Q;  1HR0 W;  3BZK A;  1J5E Q;  1UEB A;  2RF4 A;  1KD1 C;  1YEZ A;  2E2J H;  1OXX K;  3OYY A;  4YWK A;  1VQA A;  2Q2I A;  5C44 G;  4DR6 Q;  1IZ6 A;  1VQ5 A;  4DR3 Q;  4O2D A;  3TEH B;  4YY3 L;  5GAD C;  1XNQ L;  4GN5 A;  4LUV A;  1PVO A;  1FJG L;  1G6P A;  4A3M H;  2B63 H;  3STB D;  4B3M L;  2AHO B;  4DNI A;  1CSQ A;  2CKZ B;  4R4I A;  3UDF A;  2JA8 H;  5C0X J;  4JI5 Q;  1P16 A;  2F4V Q;  5IE8 A;  4IO9 A;  1GM5 A;  1HNW Q;  2MO0 A;  2R93 H;  4UP7 A;  1Y1W H;  3DLL A;  3K81 C;  2UXC L;  1J6Q A;  2L15 A;  2JA7 G;  1CKN B;  1NBW A;  2WAQ E;  5C3E H;  4DKA C;  1AH9 A;  3I4N H;  1LTL A;  1Z47 A;  3PIP A;  1TWA H;  5DLQ E;  5IWA L;  4HID A;  1KIX A;  2GN5 A;  4LFB L;  3EIV A;  4B3T Q;  2PQA B;  5GAG C;  2RHQ B;  3K80 C;  1XTD A;  2Q2T A;  3ZJY C;  3M3Y H;  1IXR A;  4GNX A;  4BBR H;  3RZD H;  1XPO A;  1WFQ A;  1SR3 A;  3CCE A;  4GOP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...