2JA7G

Cpd lesion containing rna polymerase ii elongation complex c
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cpd Damage Recognition by Transcribing RNA Polymerase II.
pubmed doi rcsb
molecule tags Transferase
molecule keywords 5'-D(*TP*AP*AP*GP*TP*AP*CP*TP*TP*GP *AP*GP*CP*T)-3'
total genus 26
structure length 171
sequence length 171
chains with identical sequence S
ec nomenclature
pdb deposition date 2006-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2ja7G02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 2ja7G01
1MIUA 4IPDA 3PCOB 4ME3A 5JEAJ 4EX5A 1YHAA 2ZM6Q 1G51A 4AH6A 4APVA 1OXXK 4JOIC 1VQNA 3K81C 4JI8Q 3JAMi 3CC7A 4A3GH 2AHOB 4O2DA 1Q12A 3HKZE 5ELOA 1K3RA 4OWTB 1VQHA 1HH2P 2NZHA 2YTYA 3KF6B 5HY6A 1A63A 4JI4Q 1IBMQ 3RZOH 2NVTH 3HOZG 2JJQA 2MNAA 1QZGA 1JJCB 1A8VA 4JBWA 3M3YH 4IPGA 4DNIA 1VQ9A 4DUYQ 3GTMH 1Q7YC 3KYHC 1NY4A 5AJ3Q 2VS1A 1MJEA 2GVAA 3BJUA 4TQUS 4A3MG 2ATWA 2N8NA 4PZ6A 4RG1A 2AMCB 4X62Q 2XGTA 2UUAQ 1PH4A 4HJAA 2HHHQ 4YY3L 1XJVA 1NE3A 5BR8Q 2NN6G 1JE5A 3F8TA 2JA7G 4C2MH 3PF4A 1SFOH 3I2ZA 3A5ZB 3NBHB 2WB1G 4X65Q 1EIFA 4L5TA 4DV7L 3J81c 3PO2H 3PSIA 2K5VA 1HNWL 1VCIA 3UDFA 3OTOQ 1IL2A 4DV0Q 2UU9Q 4BXXG 4B3TL 3CPFA 3CP0A 4BBRH 2JA5H 4DV3L 4LF6Q 1I3QH 4GN5A 2VZAA 2MQHA 2RHQB 4OWXB 2IY5B 4AYBE 4JI7Q 1X55A 4HJ8A 3HOXH 5IYBH 1IBKL 1PH6A 1JT8A 1QVFA 3FKIH 1J5EQ 1RL2A 5IP7H 4JCVE 1WCMG 3T1YL 2ZTEA 1VQDA 1PA6A 3EN2A 5DLQE 4LF9Q 1KRTA 3CAMA 3WWVA 1Q1BA 1TXYA 3DLLA 1TWFH 1TWGH 3CCVA 4DR3L 2UUCQ 4GOPC 3VDYA 4DR5Q 5LMNL 4LUZA 4IJHA 4A3IG 1NJIC 1XPUA 3CD6A 4K0KL 5IWAL 1HJPA 5C44H 1SMXA 1WOCA 3ULJA 2VUMG 4LF7Q 4A3EH 1VQ8A 4DK6C 5C3EG 1I94Q 4JV5Q 2CKZB 1PVOA 5JJIA 4DV4L 4FDBA 4DR1Q 1UE1A 1V43A 3G6EA 1K83H 1TWAH 1X6OA 1VQFA 5JEAG 3ULLA 4QY7A 5FLMH 1X65A 1YNXA 4IFDI 2JA8H 1KIXA 4WJ4A 5IYCH 4JBKA 1OTCA 5GAGC 1XNQQ 2I5HA 4GNXB 4A76A 3AEVA 3J7A5 2WFWA 5JJLA 2VW9A 3GTGH 3K80C 3T1HQ 2UXBQ 3RN2A 1V9PA 2E5LL 4X6AH 2ID0A 2Y0SE 1A62A 4LF8Q 1EYGA 3I56A 4DR6L 1PH5A 1JB7A 2IT1A 5GADC 3A74A 1VQ6A 3D0FA 1GVPA 1SRUA 3U58A 4C3HH 4LFBL 3PV0A 4JI3Q 4JI2L 1YVCA 3I4NG 4OX9L 4IO9A 4IJLA 1VQLA 3PIPA 2ZJPA 3NELA 3BZKA 1HNZL 3M4QA 4NXNQ 4RMFA 3KJPA 3M4PA 2HIVA 4KHZA 3GDEA 4LFAQ 3EBEA 2ALYB 1VQ4A 5M5XH 4GKJQ 4A3DH 1Q8KA 2NZOA 1X3EA 4TVAB 1HR0Q 2OQKA 4X64Q 1PH7A 4JOIA 1OXSC 1PV4A 1HR0W 4DV5Q 1VQ5A 2MO1A 2VQEL 3I4NH 2NVQH 4DR7L 1X9NA 1SN8A 1VQPA 3CF5A 5IYCG 1G291 3I55A 3GTLH 1N36Q 1N8RC 4X66L 5FJ8G 2DGYA 1W2BA 1CUKA 1YJ9A 1Y1WH 2PQAA 2D0OA 4POFA 4LFCQ 3CXCA 1XNRQ 4DR4Q 1X3FA 2I0QA 2BH2A 4AQYQ 3H3VH 3HOUH 4JI1L 2OTJA 4KHPQ 5E7NA 1YHBA 1PYSB 5IT9c 3U4ZA 3CC4A 1CKMA 1B7YB 1PH8A 1NMGA 3HOZH 4A3CH 3JAMc 2JQOA 3A0JA 3BZCA 4KLKA 1N33Q 1SROA 4LF4L 3S2HH 3CCLA 4LF4Q 1KC8C 1N33L 2Q2HA 1PYBA 3DM3A 1Y1WG 2EIFA 3E9HA 4L5RC 4A93G 1SLJA 1S3OA 1UE6A 4YCVA 5M3FG 2LXKA 3PGZA 4LNQA 4PZ8A 3GTOH 3CQZH 1L1OB 2KENA 2JK8A 4PMWA 2PQAB 3KFUA 4NB3A 4AYBG 4KHPL 1X3GA 4JI1Q 1E24A 1WI5A 4AQYL 1JJ2A 4UP7A 4DR4L 4LFCL 3CCUA 1IZ6A 3SGIA 4C3IH 1XNRL 4XIGS 4X66Q 1N36L 4A3BH 3UDIA 2K4KA 2R7FA 2R7ZH 1GD7A 2VQEQ 4DR7Q 1VQCA 1K9MC 5IP9H 4DV5L 1E1TA 2ZTDA 4DPGA 2AWNA 4X64L 4BY1G 2K5NA 1HR0L 3B6YA 1RIPA 4JBJA 2RF4A 2A1AA 4GKJL 4BY7H 4GOPB 3L0OA 1V1QA 3NENA 2N3SA 3S24A 3KDFB 4LFAL 2IHFA 4A4IA 4NXNL 1N9WA 1HNZQ 2GN5A 3CW2C 1E3PA 2K75A 4IPHA 5C4XH 1KAWA 5IP9G 4HIOA 1K8AC 3EIVA 4OX9Q 4JI2Q 4JI3L 3KDFA 4LFBQ 4YWKA 1ASZA 3S14H 2C35B 4GN3B 3RLOA 1VQOA 1LTLA 1HZ9A 3W1BA 1FVIA 4BA2I 4DR6Q 1VQAA 2PI2E 1YIJA 3K0XA 4LF8L 4PG3A 2CFMA 1QVCA 2E5LQ 3G71A 4Y52H 2UXBL 3T1HL 4YWLA 5M3MG 2Q2UA 1E22A 3HKSA 1HZCA 3KF6A 1TWHH 1XNQL 4WJ3M 3CMAA 2HQLA 1PH1A 2JA6G 2KCMA 2VY3A 1HZBA 1PFSA 1VQBA 2L15A 2OWOA 3GD7A 5H1SE 3K7UC 3PO3G 4DR1L 1AH9A 4DV4Q 1B70B 1I94L 1O7IA 1MJCA 4LF7L 4IOAA 4JV5L 3FKIG 3F1ZA 5IWAQ 1EQRA 3H0GH 1H95A 1WYDA 3ULPA 4K0KQ 5LMNQ 3I7FA 4DR5L 4BBSG 2IX1A 4HIDA 2UUCL 4DR3Q 4A3JH 4UPAA 1LM0A 1X56A 1Y1VG 2E2HH 2R92G 4LF9L 3I4OA 3F2BA 5C0XJ 3PO3H 3T1YQ 4BXXH 3F2DA 1YI2A 4C3JH 3MEFA 1XTDA 1J5EL 5FJ8H 1IBKQ 2NN6I 3CMEA 2BA1A 2D62A 4JI7L 1XPOA 1B8AA 1E1OA 2MFIA 2R7DA 1LUZA 3RR5A 1GKHA 4LF6L 4DV3Q 3RNUA 3I4MH 3S2DH 2I5LX 2B63H 3S1MH 3OW2A 1J6QA 4J15A 2WAQG 4B3TQ 1I5FA 1WCMH 2UU9L 4DV0L 3OTOL 2NVXH 3TRZA 1HNWQ 4DKAC 3CC2A 1EWIA 4UY8C 1VQGA 2YYZA 1VQMA 4DV7Q 1NTGA 2EXDA 3CCMA 3H15A 2KBNA 4X65L 4L5SA 2YU9H 1DGSA 1D8LA 3ICEA 2VNUD 3LGJA 5M5YH 3F2CA 3RLFA 4GLVB 2K50A 5BR8L 5C4JH 1S72A 2QGQA 3BU2A 4YY3Q 1OXVA 3FP9A 3G4SA 2A19A 1OXUA 2HHHL 2UUAL 3HOVH 4BY7G 3UDXA 4X62L 4QQBX 1FGUA 1Z47A 2ES2A 1YITA 1YJWA 4LUVA 5K36G 1CSQA 4IPCA 5AJ3L 4OO1G 3S17H 2IX0A 1UE5A 2EQSA 4DUYL 1YBYA 4YCUA 3TEHB 3ZJYC 2DUDA 1M1KC 1HZAA 1PH2A 1IBML 3AFPA 4BY1H 4JI4L 3L2PA 4PZ7A 3RLNA 2AWOA 2PI2A 4R4OA 3J80i 3UDGA 3GTPH 3U4VA 2N49A 2AKWB 5M5WH 4HIMA 1YJNA 4JI8L 3CCQA 2PMZE 1R9TH 2ZJQA 1VQJA 3A5UA 1BBWA 3HOYG 4OO1I 3FHWA 1VS0A 1CKNA 1C7YA 4OONA 2Z6KA 2ZM6L 2R6GA 1I6HH 1EUJA 1T9HA 3AFQA 2E2JH 3CCJA 4DR2L 1CKNB 1Q82C 1IBLL 2D0PA 1QUQA 3W5OA 2ZTCA 2WAQE 4DV2L 4B3RL 5LMNW 3RZDH 1KD1C 3TS0A 2F4VQ 2UXDQ 2F3IA 4DV6Q 1PH3A 3HKZG 4A3CG 1QUQB 2HIXA 3UE0A 2JA9A 4BBSH 1XMOQ 1UE7A 3J7ZC 3J80c 3H0GG 1SR3A 4R4CA 2OTLA 4JYAQ 3GTKH 3CCSA 1UEBA 1SE8A 3MXNB 3PUWA 4DV1Q 4POGA 3HOYH 4A3DG 2N78A 3CPWA 1IYJB 3M9BA 4LUOA 2YTVA 3HOVG 4A75A 3E9IA 4JG2A 1GO3E 1U0LA 1WFQA 3ER0A 3PUVA 1Y14B 3S16H 2VL6A 1EOVA 3S1QH 4IFDG 4A3MH 2IHEA 3NEMA 3RN5A 1N34L 2CWPA 2K5HA 3STBC 3I4MG 1G6PA 1XMQQ 1GM5A 3TREA 3HFZB 1EQQA 3PUYA 3CCRA 4DUZQ 1ASYA 1N32Q 3S15H 2FXQA 5IY0A 1WJJA 3J81i 2JA7H 3UE1A 2JA5G 2KCTA 3KF8B 3PUXA 4LF5L 2WB1E 3M7NA 1JJGA 1UWVA 1VQ7A 1MKHA 3JC66 1P16A 4H02A 3GTJH 4GNXA 4ALPA 4QGUA 4GLXA 4JI6L 4A3LG 1XPRA 1AE3A 3M85A 3PO2G 2YV5A 1YHQA 4IFDJ 1L0WA 4A3GG 1NBWA 2CQOA 4P74A 2ZJRA 4OWWB 1LYLA 2Q2IA 3U50C 4NXML 5C4XG 2Z6KC 1P8LA 1AE2A 2Z0SA 3G48A 1Q81C 4JBMA 2K52A 4QL5A 2UUBQ 4A3LH 2H5XA 3AQQA 4AIMA 4HJ5A 1HNXQ 1TWCH 3KOJA 1E7ZA 4KI0A 2VQFL 4GKKQ 2UXCQ 4JI5L 1U5KA 1KHIA 5GQOA 1JMCA 1Y1VH 4R1JA 4B3SL 2VUMH 1VQEA 4YHHL 4XTCS 5LMUL 2R7ZG 1D7QA 2K14A 1CSPA 1CKOA 2CCZA 1YEZA 4JI0L 1I50H 4YWMA 3S1RH 2B3GA 2PNHA 1C9OA 2Q2TA 4GN4B 4B3ML 5FLXc 5IE8A 5EAYA 1L2FA 4GNXC 4A3KH 1FJGQ 2KHIA 3M4OH 4DAYB 3AYHB 4A3FH 1FJGL 3D31A 1L1OA 5ELNA 4B3MQ 4A3EG 2JA6H 5GAHC 3HOXG 4A3JG 3STBD 1BKBA 4P71A 4JI0Q 4L5QA 2HT1A 1FL0A 5LMUQ 2LSSA 5M3FH 4HIKA 1Q86C 1C0AA 4YHHQ 5FLMG 1M90C 2BH8A 2GVBA 4BBRG 4B3SQ 3J81j 1QVGA 3H3VI 4JI5Q 2UXCL 2XTIA 1VQIA 1W3SA 2OCEA 1X54A 2V1CC 4GKKL 2VQFQ 5IYDH 1HNXL 1Z9FA 5C3EH 2NVYH 1A0IA 5IP7G 2RHSB 2E8GA 4MNOA 1Q46A 4QJFA 2QEXA 4IOCA 5C44G 3TQYA 5IYBG 4NPSA 2UUBL 2Y0SG 3IRBA 4LWCA 3L7ZC 4A3IH 2WP8J 1Q1EA 4NXMQ 4QIWE 2BA0A 4P73A 5M3MH 5JJKA 4GS3A 4DAMA 4GOPA 1EIYB 3HOUG 4Y7NH 4JI6Q 1OXTA 1L1OC 3PUZA 2JEBI 1BVSA 4HJ7A 4BA1I 1YZ6A 2JEAI 4LF5Q 2B63G 1EFWA 1S40A 3HOWH 4P75A 5GAEC 2OQ0A 4O0AA 1N32L 4DUZL 5J3BA 3PF5A 5HGQA 5C0XI 1XMQL 1PH9A 1N34Q 1K8GA 1K0RA 1VQKA 3HOWG 1NMFA 4MTNA 2JA8G 3S1NH 2LXJA 1KRSA 2QA4A 2R93G 4LW1A 4A3FG 4UP9A 1QZHA 3OYYA 1IXRA 4R4TA 2R92H 2JE6I 4A3KG 5GROA 2I5MX 3KJOA 3K7AH 2A8VA 4DV1L 3W1GA 1BBUA 2KHJA 4OXPA 4JC0A 4R4QA 3Q8DA 4JYAL 4YCWA 5C0XG 2MO0A 2CWAA 2B29A 2RCNA 3E0EA 4UP8A 1XMOL 3PIOA 4A3BG 4A93H 3CCEA 1K73C 2R93H 4P72A 2YTXA 4GLAC 4HJ9A 4DV6L 4DR2Q 3K8AA 1KQSA 2F4VL 2UXDL 2ASBA 5IYDG 3TS2A 4B3RQ 4DV2Q 1KXLA 4DK3C 1PHJA 3KLWA 2E2IH 1IBLQ 3GTQH 2F52A 3GO5A 3ERSX 4R4IA 4EQ5A 4MZ9A 1KL9A
chains in the Genus database with same CATH superfamily
1MIUA 3RJ0A 4ME3A 2M00A 5C0XH 1KNAA 5BN4A 1D6EC 2B63A 1VQNA 4MV3A 3JAMi 1F77A 3CC7A 2AHOB 2X6LA 5IWAH 1VQHA 2UUCH 2NZHA 1BCPC 3HRZC 1DCZA 3KF6B 3HS0C 4XXEA 4JI4Q 5CA1F 2BOSA 1U9RA 2NVTH 3RZOH 3VPDA 3HOZG 2JJQA 2MNAA 3GTOB 2C22A 3M3YH 4DNIA 1STYA 3VA7A 5AJ3Q 1NY4A 2C5CA 2VS1A 4TQRA 1IW7D 4X3SA 4A3MG 4TQUS 3GTMA 3N41B 4RG1A 2WV6D 4ZAIA 5IYZF 4LAAA 5BR8Q 2DPIA 2KVMA 4F4YA 4S3SA 3I2ZA 3MWDA 3MVVA 4CKBA 5C3WA 1S5ED 2EYFA 2HHHH 2ZXOA 2FINB 3GIDA 1EIFA 1FR3A 4DV7L 3J81c 1PMRA 2WE6A 3GIPA 3TP7A 2F0SA 1IL2A 1V1PB 3KK7A 1II3A 3CP0A 2JA5H 2RBMA 4DV3L 3D6CA 4GN5A 2RHQB 2MHVA 2XIWA 3CU7A 3VR3A 1GSAA 4MA0A 4DR1H 2V9WA 1JXLA 3JRXA 1JT8A 1QVFA 2J9GA 1S9FA 1J5EQ 1RL2A 5JEAH 4YBZB 1VQDA 1PA6A 4LF9Q 5DLQE 1KRTA 1TWFH 3P1HA 5CC4A 1TWGH 4FF3A 1TY0A 1V1OA 1Z2PX 4B3RH 3VYUA 2RSOA 3PMFA 5I2XA 1CQIB 4DK6C 1HTPA 2VA3A 2EYMA 2Z4HA 1EU3A 4FDBA 5D3DA 1AEXA 1HFGA 1UE1A 1V43A 1WTHA 3Q8RB 3FDTA 5EWFA 2ZJTA 1YNJC 3K5OA 3MC0B 1PZKD 5FLMH 3AMUA 1B50A 4JBKA 1EEID 2HDLA 5KFZA 5KG0A 4I7AA 2I5HA 1JICA 5JJLA 1LV9A 3K7AB 1EY9A 1JLLB 4G57A 5LL6b 1V9PA 4X6AH 1KLUD 2NU6B 5KG7A 4G3IA 3D4WA 1A62A 2L11A 4LF8Q 1BO0A 1EYGA 5M9OA 3I56A 1JB3A 5M3FB 1PH5A 1JB7A 4O4HF 1PRTD 3I73A 4QW9A 3E5NA 4LFBL 4O3OA 4JI3Q 4IO9A 4IJLA 2PNRC 1STAA 1HQRD 4K6DA 1E4EA 3M4QA 2FK3A 4RMFA 2HIVA 2A68D 4LFAQ 2YU9A 5EWGA 1VQ4A 5M5XH 3S16B 4GKJQ 2RQXA 3DXJC 2B2VA 3V05A 4KV6A 2W9BA 4JOIA 1ENFA 2Q8TA 1S0OA 4MHEA 1IKMA 1F2YA 4A3IB 3O13A 4RGTA 1ENCA 1N36Q 5JQWA 4QW8A 3WOFA 1PTOC 4POFA 5C4JB 1XNRQ 1RKNA 2R7LA 4ECTA 2OTJA 2FE3A 4JI1L 3RZDB 3J7AK 5EOYA 3KHHA 3N6XA 2BQUA 2R7NA 4DV2H 1V51A 1SE4A 3GTQA 4EGVA 2DIKA 5CB4F 3A8JE 5KFEA 1SROA 4KY7A 3CCLA 3H3VC 3M4YA 1Y1WG 3DM3A 4J8QA 1SLJA 1KEEA 3TZUA 1FYCA 3GTOH 5KG4A 2H4OA 1H9SA 2JK8A 4WRDA 5JVH3 4LFCH 1IL8A 1I4PA 4HSVA 1E2WA 2DNEA 2Q8IB 4OGQC 2JEFA 2IJ0A 1EY4A 1WR2A 1C48A 3H40A 4KHPH 2IW3A 4J9PA 1TVXA 2R82A 5C3XA 4JVZA 3UDIA 2CQAA 3BA9A 2B2TC 4LJZC 1HR0H 1VQCA 1F2ZA 3K0YA 1AUVA 4RCNA 4I50F 1F9QA 1BUVT 1VBGA 1RIPA 2K04A 1HHVA 4BY7H 5LP6F 4GOPB 3L0OA 4YR2A 4DFAA 2IHFA 5A2QL 3OHBA 1LT4D 3GP7A 2GN5A 2J7ZA 4A3DH 4CHTB 4ULLA 4NDXA 2F1MA 2ZT9C 4KJOA 4K2KA 1LTLA 1MI2A 3VR4A 3W1BA 1BOSA 1EYZA 1S0NA 4DR6Q 4YB8B 3L4JA 1YIJA 3SXHA 2E2IB 2D9UA 2E5LQ 4JI0H 3T1HL 4YWLA 3M9NB 2Q2UA 3KUPA 5KFTA 5KFIA 3HKSA 2C9OA 2FJ2A 1XWEA 1PLFA 3RGZA 5FO8B 4WJ3M 4O42A 3CMAA 3MFGA 2KCMA 3J81E 3OHAA 1HZBA 1TS5A 1VQBA 3TINA 5H1SE 3K7UC 3PO3G 1DV1A 4DV4Q 1Z6HA 2KUMA 1LTAD 1I94L 1MJCA 1GXDC 2B2VC 5D14A 4UCTA 3RTXA 4DR5L 4HIDA 4F50A 1PDQA 4M9UA 4A3JH 1Y1VG 3X3NA 4UFZA 3F2BA 5C0XJ 3FPPA 3N8DA 3T1YQ 4ZQ3A 1LT6D 2P0AA 5KFNA 3F2DA 4C3JH 4LF6H 1I3QA 3R2IA 2A69D 4EVOA 1GOZA 1LTRD 3P75A 5EZYF 1JR0D 4C5AA 3W3AA 3I4MH 3S17B 2B63H 5DG7A 1MSHA 2WAQG 4KN7C 3PW5A 1WCMH 2UU9L 3JAMW 2C2RA 3OTOL 2AGQA 1JWSD 4DN4M 4BWSC 3CC2A 4UY8C 3H91A 2FJZA 2HJWA 1I50B 4BY7B 1NTGA 2B2YC 3CRLC 3H15A 2EY6A 4L5SA 5F9NA 1D8LA 1GGOA 4V190 5CORA 4NMZA 5BN5A 5JH7F 2W9CB 4GLVB 5C4JH 2DLNA 4I7HA 2QGQA 3BU2A 2R84A 3HKZA 4DLKA 3G4SA 4ED1A 1OXUA 2JA6B 4QQBX 4X62L 1Z47A 2ES2A 3VR5A 2RDIA 2W6OA 3LMLA 3OSNA 5JJZA 4LUVA 5DQHA 1CSQA 4ZLTF 4OO1G 3QZ7A 2AQ2B 2A5HA 2F4VH 3TEHB 4UDUC 2UXDH 3GLKA 1PFMA 2MCTA 3Q8QB 2R7ZA 1N48A 2DUDA 3MTSA 1PH2A 1M6VA 1IBML 3NQIA 4N9TA 2L55A 4PZ7A 3DUZA 1TWHA 2PI2A 4UCVA 4J0MA 3J80i 1LABA 2EYHA 3U4VA 5CV9A 2YRWA 1KTKA 4JI4H 4HIMA 1YJNA 2R7MA 3N6RA 2PMZE 4J6HA 1CFMA 3A5UA 1OO9B 1VS0A 2JA5A 2HQEA 1I6HH 4HAEA 2AU0A 5D1PA 2K01A 3TZDA 3K5MA 5KIXA 5JPMC 5LMNW 3I91A 3HGBA 3TS0A 3RZDH 3KLRA 4O3SA 5C3EH 3HKZG 4A3CG 2R7ZB 4B3MH 1QUQB 4F4ZA 2JA9A 4BBSH 5FLXL 2KJXA 3ETJA 2SNSA 2EY1A 5KEEA 2OTLA 2NVYB 1Y1VA 2C2EA 3HOYH 3PUWA 3GIQA 4J9NA 1DOKA 2N78A 3SHLA 3PR4A 1IYJB 1CQVA 3QJYA 4F88A 1LTID 4RUAA 1U0LA 3PUVA 1EIHA 4EG0A 3S16H 1EOVA 3S1QH 1VMPA 2JEIA 2JP1A 1N34L 4MV8A 1G6PA 2K5HA 4BBRB 3PUYA 3H20A 3S15H 1EY7A 2O2LD 4IFDH 3UE1A 2JA5G 3KF8B 3KHLA 3PUXA 2WB1E 3M7NA 4IZ8A 1DM0B 1VQ7A 4IWXA 3GTJH 4ALPA 4A3LG 2XCPA 5T14A 3RFCA 2RDGA 2DY8A 4U7CA 2SDFA 2R3ZA 4ZK9B 4J9MA 2EZVA 4OWWB 1SJHD 1LYLA 2Q2IA 3RD4A 2Z6KC 1Q81C 5D8DA 2K52A 3RAXA 4QL5A 3NP8A 5BPHA 3M9MB 3G6JB 4A3LH 2OF1A 2EPBA 4ZRZA 1E7ZA 2B63B 2XNAC 2B39A 2KQ3A 1H9KA 1MD2D 4B3SL 1IYUA 2MUYA 4IUUA 2FB9A 5KFAA 2QKIC 4XTCS 3SK6A 3VR6A 2YU9B 1D7QA 3R5FA 1CSPA 1W96A 2W8KA 1V1PA 4YWMA 3ND9A 1FJGH 1NCVA 3E6ZX 2PNHA 1C9OA 4DL7A 2MP1A 2Q2TA 4B3ML 2CHBD 4EQNA 4K6LA 2KHIA 5DLGA 3MR3A 3M4OH 3J7AF 2LY7A 1B33N 1XYIA 1L1OA 4B3MQ 2TMPA 5K5PA 2KEEA 2KCCA 4KMUC 3STBD 4IRCA 4P71A 4IWYA 2DJFC 4L5QA 4QB4A 2RDJA 3LP8A 4EFBA 4PMBA 3Q2OA 2EJGC 2GVBA 4B3SQ 4YAJB 2PZTA 1ESRA 3N52A 3TIGA 1BGWA 1VQIA 1X54A 5E4XA 1CZWA 1HNXL 4MV7A 1WD1A 1A0IA 1ZETA 2RHSB 2E8GA 4DF7A 3J80E 2QEXA 4JI2H 3FEWX 3MWYW 4LWCA 1H9RA 1Q1EA 1D5XC 4ECZA 2V5AA 4ECXA 4GKJH 5JJKA 2X0SA 1ET6A 5JVDF 3HOUG 2QILA 5EPJA 1K28A 5LHY1 1DYQA 2JEBI 3K5LA 3L4KA 4MIUA 3KLSX 3H6MA 2HD3A 1EFWA 4P75A 1QNUA 4O0AA 4IHJF 4C3HB 1D1IA 2AUJD 4JK1C 2NUAB 1NUCA 1L0YB 4R7RA 4XYMB 3T4AC 1I7NA 2VR1A 2QA4A 1RYRA 2UXBH 3PVXA 1RJTA 4UP9A 4KKSA 3OYYA 1IXRA 1QZHA 1BDOA 2JE6I 2N55A 4A3KG 1B6SA 4DV7H 2XWJB 1S97A 2R8KA 2RA4A 2EY5A 3KF8A 3W1GA 3J80L 4DV1L 3PIOA 4A3BG 3K3VA 1SNOA 2R93H 4P72A 1I94H 3K8AA 2KSWA 5LXTF 4EYHB 1PYWD 3TS2A 2V58A 3G6YA 5CAEB 1RK5A 3GO5A 2QYZA 3L2PA 3BJYA 1KL9A 4BY1G 4IPDA 1B3AA 3PCOB 4EX5A 3J80W 3K3PA 3RGXA 5DNFA 4A3GH 4O2DA 3I12A 4EYIB 1Q12A 5T1IA 5J2UF 4DNRB 5ELOA 4OWTB 1KJ9A 1IBMQ 1AUXA 5KFQA 4O4IF 1QZGA 3BS1A 3OWFA 4N8X1 1GSHA 4ECWA 4X3TA 2O5JC 1J5EH 2EYPA 4XT3B 1STHA 4ABNA 3KYHC 3NHHA 1Q7YC 1I3QB 1EL0A 4PMCA 3RIZA 1PK8A 2IPKD 4L8JA 2HCIA 2IBKA 4PZ6A 3HOWB 2XGTA 4LSAA 3A8IE 3RF2A 1TWFA 3V6KA 1JE5A 4C2MH 3PF4A 1SFOH 3A5ZB 2PW7A 2WB1G 3URYA 3JSNA 3V96A 3ZYYX 1SYDA 3FKIA 2K03A 3OUUA 1GLVA 4K2LA 1BCPF 4F87A 3NWTA 1WCMA 4DU9A 4XYOA 2OH2A 1R9TB 2UU9Q 4ED8A 1SEIA 1WCMB 4BBRH 1BXRA 1QOHA 2WB1B 2K5DA 1GSOA 1XMOH 4DAVA 1R9TA 1I3QH 2MQHA 2IY5B 2XGPA 1DV2A 3NK9A 1X3QA 1RJQA 3HOXH 1JWUD 3GTJB 2JEGA 3QR8A 3SDZA 4YIJA 3EN2A 4KTAA 2F4IA 4EFEA 4DR3L 4GOPC 2WACA 4ETSA 3HOZB 1NJIC 2XIGA 2ALZA 1HJPA 1F2LA 2EXZA 4FF1A 3E3XA 1PVOA 1RJPA 1AN8A 3N43B 4FVMA 4DR1Q 2QDBA 4RZQA 3BDCA 5JEAG 1X65A 1YNXA 1S5DD 1KIXA 2JA8H 2NVXB 5DQIA 4RB2C 1S0MA 1OTCA 5GAGC 1XNQQ 4YR0A 2JEJA 2JA7B 2W6PA 3I90A 3K80C 3NTKA 5HURA 4IR1A 4RCOA 1N34H 4CDEC 2XD4A 4IN3A 2IT1A 1JDBB 1VQ6A 3OSPA 1HNZH 1ULZA 4IALA 1SRUA 1XNRH 4CBVA 1FD7D 4C3HH 1SFOA 1TS2A 3I4NG 2ZJPA 1BCPB 2D5DA 3HB9A 3GDEA 2EDGA 3T51B 1VF5C 3T5HA 5T1GA 1DONA 3BDLA 1RTNA 4N8FA 3RB3A 1X3EA 1E4GT 3BA8A 4OIKA 5KKNB 2XN9C 4DV5Q 1VQ5A 2MO1A 1U4RA 1X9NA 1SN8A 1VQPA 2F0UA 3CKIB 4ID6A 1G291 3I55A 1WVLA 1DXMA 4X66L 2DGYA 1CUKA 5KNBA 3AU7A 5I2YA 2D0OA 4ED6A 4LFCQ 3CXCA 4HR7A 3H3VH 2FMMA 1K8OA 2NTTA 2R8GA 3IL8A 4LH7A 2YRXA 4U673 2M05A 4ED0A 3QZ8A 1LO5D 2KA7A 3HP3A 1B7YB 2PYKA 1H9JA 1PTOB 4HTHA 3HOZH 4A3CH 5FPOA 4KLKA 2H1EA 3S2HB 5KT2A 1WTRA 4LF4L 4AYBB 2KEDA 4Q45A 1KC8C 3EROA 1X32A 3E9HA 4A93G 1S3OA 4YCVA 3PGZA 1HCZA 4PZ8A 5IT9L 1MHWC 2KENA 4PMWA 1ENAA 3KFUA 3LX0A 3KBGA 2PO4A 4NB3A 4AYBG 1EZ8A 1TA8A 4JI1Q 3IKJA 4UP7A 1N36H 5IGEA 1XNRL 3SGIA 2BQ3A 3GTLA 3ETHA 4XIGS 3TQTA 4KKUA 4A3BH 2K4KA 4XQJA 2R7FA 1UC9A 1GD7A 2I87A 3SEBA 2XC9A 4DR7Q 5IP9H 2OT2A 3TMEA 2HVQA 2NN6H 4X64L 4RNNA 2K5NA 4QWEA 1I4GA 1HR0L 2GPWA 5CV5A 2RF4A 2A1AA 4GKJL 2VA2A 5M5XB 3GV8B 5DAUA 4LFAL 1TU2B 4A4IA 1N9WA 4O2AF 3OSOA 4IPHA 1E3PA 4HIOA 3KTMA 2PQEA 5IP9G 4KK7A 3S15B 1TWCA 1JORA 4LFBQ 4YWKA 1ASZA 3GTPB 5HGTA 3S14H 3RBDA 2WAQB 4K5XA 2HUGA 5KGUA 5DQGA 1FGBD 3N44B 2BE5C 2PI2E 4LF8L 1WTPA 5IT9E 1ESFA 5IGDA 1QVCA 5L37A 4QWCA 3GIMA 3G71A 4Y52H 1PTOD 2QEJC 1EUCB 2UXBL 5EWEA 1SYBA 4UCUA 1F9PA 1TWHH 3NBIA 1D2BA 2HQLA 1PH1A 2VY3A 2V4DA 1PFSA 4LF7H 4H44C 1JIHA 4RUCA 1AH9A 1PRTB 2R92B 1KJJA 5EBCA 2W8LA 2K5QA 1RHPA 3QOLA 3W2DA 4IOAA 4JV5L 3P7JA 4A2BA 3FKIG 3BQ1A 4FM9A 4FBTA 3H0GH 3Q23A 1H95A 3QG1A 3I7FA 5L9XA 4GKKH 2IX1A 3V4ZA 2E2IA 2I46A 4C3IB 1LM0A 1WTOA 1TWGB 1M0WA 2CW8A 2PCFB 3EJIA 2R92G 1JKJB 1I4RA 3I4OA 4J1MA 4LF9L 1ZXTA 4BXXH 3FKIB 2F0GA 1XDNA 2FLNA 1YI2A 1J5EL 4ECYA 3VPCA 3MFHA 2NN6I 1QILA 2D62A 1E4FT 1Z2OX 4YR3A 4G4KA 4K5WA 1XPOA 3DF7A 1E1OA 4ZKCB 2R7DA 3FMCA 1ONLA 1GKHA 4LF6L 3IG0A 2I5LX 4KKTA 1J6QA 4J15A 2EJFC 4X65H 2NVXH 3TRZA 5FO7B 4DKAC 1EYCA 4HCSA 2YYZA 2OLSA 3GV6A 2FFKB 5KFPA 4PDBA 4DV7Q 2EXDA 2UU9H 1BQQT 2CVRA 1KDBA 1MZBA 2B2TA 3LGJA 2QDLA 4LF8H 4UCSA 1EWHA 1T3NA 3F2CA 2ZXRA 3CQZB 5BR8L 2K50A 4RGOS 1NNXA 1EYDA 4Q8EA 1OXVA 3FP9A 2A19A 4C56C 2UUAL 5KFCA 4JV2A 4FXDA 2Z6BA 1FGUA 1JQYD 1YJWA 3I4MB 2NU7B 4DUYL 3GTJA 1DJRD 1LTBD 1PTOF 2ZDGA 1S5BD 3GTGA 2O4XA 4R9WA 1M1KC 1Y8NB 4BY1H 3AFPA 1BNCA 1Y1VB 5A35A 1ZHSA 3GTPH 4K0KH 2N49A 3UQ8A 5M5WH 3RUZA 2ZJQA 4JI8L 1R9TH 2R93G 1VQJA 4DR2H 1CKNA 3KAKA 4IZOA 2Z6KA 2ZM6L 2R6GA 3AFQA 4ED3A 3H0GB 2E2JH 1CKNB 4DGZA 5LMNH 1Q82C 4IQZA 1SNMA 1IBLL 1CK1A 3G7LA 2ZTCA 2WAQE 5J39A 1L2ZA 2F4VQ 2UXDQ 2F3IA 4DV6Q 1E4EB 2FPIB 5DGAA 3UE0A 4HYKA 5COYA 3D8GA 1XMOQ 4R4CA 1TWHB 4JYAQ 5KT7A 2F0EA 4N9PA 1SE8A 4KN4C 3DWPA 1RD9D 2FLLA 1E2ZA 4A3DG 1KDCA 3HBLA 5DG9A 4XYLB 3IAYA 4A75A 4JV1A 2YZMA 1FNWA 1WFQA 3KLSA 1SYEA 5JVG3 4A3MH 4O3NA 2CWPA 5BR8H 1HNXH 1GM5A 4A3DB 1DZ1A 4YQWA 5M5WB 3PN1A 1N32Q 1RDPD 1WTXA 4LMQD 4C1NI 3J81i 3HOVB 1SMYD 1JJGA 3C1EA 1MKHA 3JC66 1F9SA 2NBFA 4H02A 3T5LA 4KY5A 4GLXA 1K1SA 1K8MA 4DUYH 2VUMA 3GTQB 1W93A 1Z7TA 2P5ZX 1NBWA 4P74A 4LSXA 1M7JA 2B2WC 2ZJRA 3C3LA 4H13C 1YNND 1S10A 1P8LA 1AE2A 2Z0SA 3HOUB 3G6XA 2ASJA 4JI3H 2K6AA 3BG3A 5KT3A 1KC7A 1PRTF 4KI0A 1O7LA 2Y0SA 3NXWA 4GKKQ 2UXCQ 4X66H 5GQOA 5FPRA 1Y1VH 3Q22A 1MBYA 4XDXA 4R8NA 3MZ5A 1EQTA 2E2JB 1IBLH 1CKOA 4H0LC 2B3GA 2OEOA 5FO9B 1O80A 2F03A 3QB3A 5IE8A 1L2FA 2BDNA 4A3KH 1XNQH 4A3KB 4DAYB 3K59A 4A3FH 3D4DA 3OMCA 1DOLA 1CQFA 5ELNA 1PTOH 4DK1A 1C4QA 4LH6A 1FNVA 4QUFA 5E1FA 2KHSA 1KAAA 3EVQA 4L63B 5CYUA 4CJ2C 2LSSA 4O1NA 5CBAE 1C0AA 4IUNA 5FLMG 2BH8A 4OL7A 4Q43A 3J81j 1QVGA 1J8IA 2R7KA 4YP3A 2UXCL 2J6TA 2J0TD 4RAYA 2V1CC 4ODGA 5IYDH 1SEBD 1Z9FA 1SYFA 2NVYH 5IP7G 1STNA 3HZXA 4MNOA 4WFN3 4QJFA 1PH8A 2CW7A 5C44G 4DV5H 4F4XA 5IYBG 3DHQA 2VOBA 4DAPA 2R61A 3SE7A 3L7ZC 2WP8J 4G7HC 4QIWE 5KFUA 2EY2A 2BA0A 2HDMA 1O75A 5KFLA 3KAJA 4DL2A 1VBHA 2QW7A 4Y7NH 2IX3A 4RB1A 3KHRA 4J9LA 5C5MA 1BVSA 5HV6A 1YZ6A 2JEAI 1ZKOA 3GQBA 5KT6A 3MWMA 1HXYD 3R5HA 4IRKA 2OQ0A 1BNZA 2L9HA 1E0BA 1SE2A 4ZQIA 1PH9A 2G5DA 3RB0A 1K8GA 1K0RA 1VQKA 5I6WA 2LXJA 5DEHA 1A2TA 2IL8A 2ICIA 4A3FG 1AFPA 2HVSA 2A8VA 3K7AH 1CQJB 1BBUA 2KHJA 4WJWA 4JC0A 4CDDC 4YCWA 4A3JB 5C0XG 1B9MA 3EPIA 2B29A 2RCNA 3E0EA 1XMOL 2JA8B 3GTKA 1GYFA 3WNZA 2R86A 4A93H 3CCEA 1K73C 2VPSA 4DV6L 1KQSA 5EPKA 2ASBA 4JUZA 5IYDG 4DV2Q 4CJ1B 4DK3C 4J9RA 1IBLQ 3GTQH 2F52A 3ERSX 1JOKA 3S1NB 4Q8FA 3DWAA 2ZM6Q 1K1QA 1G51A 4AH6A 4MTEA 3T56B 2F0IA 1A15A 4DR3H 4JI8Q 3OW7A 5TSSA 1L0XB 1HH2P 4ZUIA 4A3MB 5BPFA 5HY6A 1A63A 4RB3C 2R8HA 3S1RB 3PW4A 3I72A 2F0TA 1EYAA 5KFGA 1LT5D 2ZXPA 1K0SA 4DL6A 1K3BC 1A8VA 2B2UC 4R8UA 4IPGA 1C8CA 3ITPA 1VQ9A 4DUYQ 3S14B 3GTMH 4EEQA 5F2DA 3MHBA 2F0PA 4M8AA 5LYJF 1MJEA 2ATWA 2N8NA 5FKAC 4IUVA 2UUAQ 1KJIA 1PH4A 1V8QA 2HHHQ 1GHKA 1XJVA 5GONF 2NN6G 2BDOA 3F8TA 2JA7G 4RH6A 3CHBD 4J9KA 1PZJD 1R4QB 3T16A 4C2MB 2W6QA 4UCRA 4ME5A 3PO2H 3Q24A 3PSIA 4EGQA 4DV0Q 5KRUA 3PQIA 3J81W 4YAKB 4RGMA 2F0NA 3CPFA 3U9SA 2I8CA 5KFFA 2JA6A 4LF6Q 1G2TA 1ML0D 5EKIA 2F0WA 3IFTA 2VZAA 4C1NK 4JI7Q 1X55A 3C1FA 4HJ8A 2NVTB 5JUMA 1IBKL 3DM1A 2XWBB 1PH6A 3FKIH 2SNMA 3K6OA 5IP7H 2MPMA 4JCVE 2VB3X 3QIAA 2ZTEA 1I6VC 2E2HB 4WORA 3MXNA 3K5IA 1GUWA 2A73B 2G9DA 3WWVA 4DL3A 1Q1BA 4ZI7F 1GJXA 2UUCQ 3VDYA 1XPUA 5LMNL 4LUZA 1IHZA 4IJHA 4K0KL 4DV4H 3OPOA 1UAPA 1NSNS 3J7AV 3MR5A 3BG5A 3V6HA 4JI8H 2VUMG 4YHHH 3I4LA 1CZGA 1K83B 1TWAB 4A3EH 5C3EG 4JV5Q 4O4LF 2CKZB 1BCPD 4K8JA 1X6OA 1CA6A 5KFDA 3WDNA 1HA6A 5KFXA 3WO0A 3G8CA 4IFDI 3IN5A 4CKEA 4A2AA 4G7OC 3AEVA 4A76A 1HUMA 3SI8A 2WFWA 1SE3A 5C3EB 2PMZB 2VW9A 5D1OA 2UXBQ 3RN2A 2W6ZA 2NUCA 2Y0SE 1D5ZC 4C3JB 5C5LA 5GADC 4EGJA 2YS7A 3U58A 5J2TF 5FD5A 1JX4A 1YVCA 4OX9L 1BXTA 3N42B 4WBNF 3Q6SA 3NELA 3BZKA 1HNZL 2FHTA 2UUBH 3M4PA 2ALYB 3ONAB 3H94A 1HQMC 4EQOA 3KBXA 4X64H 1Q8KA 4TVAB 1HR0Q 1ZHQA 1V4YA 4X64Q 1PH7A 3D4RA 2XGQA 4EBEA 1PV4A 1HR0W 4EBCA 2DPJA 4DR7L 1PRTC 4XT1B 3R8BA 4MV9A 3CF5A 5IYCG 2PBZA 4NXNH 3MWEA 3GTLH 3KXYT 4NKLA 5FJ8G 3M4IA 1W2BA 2FMCA 1XMQH 3FPUB 1Y1WH 2PQAA 1TY2A 4DR4Q 1X3FA 2BH2A 3HOUH 4IUTA 4AQYQ 2UVUA 1SCUB 3I70A 5E7NA 1YHBA 3CQZA 5HBRB 1IOVA 2EYJA 2L0CA 3MJFA 4H7BA 2IWHA 5G3LD 4DAYA 3V6JA 1QWYA 4RWSC 3JAMc 4Q44A 3A0JA 3BZCA 2PW5A 4KJNA 2I80A 1SYXB 3ND8A 3F2UA 2RGRA 4LF4Q 5EKLA 1N33L 4B08A 2Q2HA 2JN4A 1UE6A 1HA5A 1XTCD 2A6ED 2LXKA 2SEBD 3BVGA 3S1QB 3OIPA 2PQAB 2CH4A 5J22A 5CV4A 2AQ4A 4ZKBB 4QCLA 1C30A 2WYOA 4FU0A 2WTFA 4KHPL 4C5CA 4IRDA 1WSCA 1E24A 1WI5A 1RF2D 2Z1CA 1Y1WB 3OUZA 4LFCL 3NPPA 5EKKA 1IZ6A 4RGNA 2W6NA 2F0HA 4DL4A 4RU9A 4X66Q 2B8GA 4K5VA 4XYQA 2R7ZH 3RBEA 3C0FB 2VQEQ 2MJ8A 4DV5L 2ZTDA 5KNCA 2YS6A 2O03A 3B6YA 5EBDA 1LTTD 5DGBA 3RB4A 1V1QA 3NENA 5LOVF 2D2CC 2N3SA 4NXNL 3A7LA 3CW2C 2K75A 2VUGA 1K8AC 1KAWA 4RFBA 4I65A 4JI2Q 3KDFA 3IFDA 3VYRA 1LTSD 2C35B 4GN3B 3RLOA 3JAME 1HRJA 2DWCA 1HZ9A 2F0JA 4XQQA 1FVIA 4BA2I 1EUDB 4DUZH 1I6UA 4Y7NB 4GC7A 4ECQA 4J9OA 3K0XA 4MV6A 2K1BA 1WTVA 1GUGA 3PO3B 4CGYB 1WD0A 3R2TA 4ILWA 3U9TA 1EY6A 1SNQA 5M3MG 3PIP3 5FLXW 2L12A 1HZCA 2F3WA 3KF6A 3K5NA 1E2VA 1XNQL 4OHJA 5KG5A 4RA8A 1AN7A 4BBSB 1STBA 2L15A 4PV1C 2OWOA 2RVLA 5KG3A 2QCPX 4ZHQF 4ECUA 3DWQA 4DR1L 1EY8A 1B70B 4HNUA 3E5SA 1O7IA 4LF7L 1Y8OB 2L5TA 1I7LA 1KNEA 2A6HD 1I6HB 5IWAQ 3ULPA 3GIJA 4BBSG 1M4VA 1Q90A 2BQRA 2NB0A 4LMYA 4DR3Q 4B9XA 1CS0A 4UPAA 4O3PA 2F0MA 1H9SB 2E2HH 1B04A 4DR5H 4O2BF 1IW7C 3PO3H 4IUPA 1QG7A 2FPPB 2EYLA 4Q0YA 3PW0A 3UFXB 4Q5VA 2PN1A 3K58A 5LL6S 4DV0H 5DLFA 1LUZA 2F0QA 1UNNC 4CC6A 3S1MH 1I50A 4B3TQ 2HGSA 2C2DA 2RGVA 4RHRA 1HNWQ 3A8KE 1VQGA 1VQMA 4BS9A 1FKAH 3CCMA 5J1ZA 3QOJA 1EEFD 4X65L 2YU9H 1DGSA 4QWBA 1MSGA 3DEOA 2YZGA 3PW2A 2VNUD 2A69C 4K14A 5CGKA 5M5YH 4X62H 3RUPA 3UI2A 4B3TH 2NTSA 1S72A 3LNNA 4YY3Q 3JSLA 4C2MA 2C28A 1RYSA 4BY7G 3UDXA 4HCEA 3H0GA 2A6EC 2CW0C 1YITA 1VAJA 3EA6A 3S17H 2IX0A 1UE5A 2EE1A 1RJRA 4JI6H 5ELEA 3OWEB 5I9PA 1VKZA 4YCUA 2I07B 4KY6A 3H4DA 1HZAA 3P20A 4FXGC 2QF7A 4TV8F 3H4BA 3RLNA 2F0VA 3UDGA 4A3GB 5KFJA 5A2QW 4ZUJA 3CCQA 1BJTA 4OO1I 1Z2NX 1BBWA 1I4QA 1C7YA 3GTLB 4HMIA 1T9HA 2R8JA 5DM63 4YJ2F 3VPBA 3D6WA 1KJ8A 5IT9W 1EIGA 1QE6A 4FO2A 1H9MA 2ATLA 4HMJA 1QUQA 5FD6A 2BE5D 3GTGB 1SYCA 3NE5B 2W57A 4DA2A 1KBLA 2Z9HA 5KFOA 5E4WC 2A74C 2R93A 2FK1A 4XQNA 2YL2A 3SVMA 3CCSA 1UEBA 3M7GA 3TSSA 4DV1Q 4I55F 4R8IA 3CPWA 2K32A 1RODA 3M9BA 4LUOA 4G7ZC 2YTVA 4A3EB 1GO3E 5KFWA 3ER0A 1Y14B 4OIJA 5DG8A 2VL6A 3T53B 2UXCH 2DJGC 3TP8A 4DR4H 3N40P 3MR2A 3I4MG 1B9NA 1XMQQ 4HR7B 3HFZB 5D3IB 4FNFA 4DUZQ 4TUYF 3GV7B 1ASYA 1TR5A 1HUNA 1WJJA 4FS1A 4LF5L 1RTOA 2X6GA 2IMWP 3RMHA 1UWVA 1B44D 1B4OA 3Q1KA 5CV8A 1P16A 4QGUA 4JI6L 4MN3A 1AE3A 5K2MA 1YHQA 4IFDJ 1L0WA 1S5FD 2CW0D 1IBKH 2ASDA 3TN2A 3U50C 3A7AB 4NXML 5C4XG 3EYYA 4JBMA 3G48A 3HOYB 4K8IA 5ELBA 2AQ1B 5H80A 4OEMB 3VA5A 4DR7H 3SK4A 2H5XA 4FBUA 4AIMA 1HNXQ 2K7VA 3KOJA 3S1MB 1CHQD 4RAUC 5LMUH 3T5KA 1JMCA 2VUMH 3J7YW 5C4ZA 1VQEA 1SDFA 3BYTB 3JZIA 5L1JA 3J81L 3V2TA 4AYBA 3LWBA 4GN4B 1LT3D 4A3FB 5FLXc 4GNXC 5EDWA 4J9QA 3M4OB 1FJGQ 1B6RA 5CA0F 2W70A 1GUNA 1IKLA 1FJGL 2VXWA 1GHJA 3EQLC 2JA6H 5GAHC 1G6ZA 4A3JG 1DOMA 1BKBA 2PVPA 2Y0SB 2HT1A 1STGA 5M3FH 5CR3A 4OX9H 4V0BA 3WOEA 1M90C 2Z8LA 2CZGA 1T5XD 4IAJA 3H3VI 5EGTA 1W3SA 2OCEA 2XTIA 1ZQ7A 2WAQA 1S4ZA 1Q46A 4NPSA 1A3TA 2Y0SG 3SK8A 3IRBA 1AZPA 1WTQA 1TS4A 5CV7A 1RK6A 4A3IH 4LF5H 3E0JA 4NXMQ 4E6IA 1O78A 5C5JA 1CI3M 4I7ZC 3GTMB 1JDEA 2W71A 3BVMA 1SNCA 4GS3A 2LMCB 4C3HG 4DAMA 1DD2A 5F9LA 1PFNA 2PZWA 2OXPA 4JI6Q 5E3FA 4JPBW 4HJ7A 4UCOA 4LF5Q 3HOWH 3OHXC 1JOOA 1S5CD 3HG9A 3OTOH 3VYSA 4DUZL 1GUSA 3NGDA 1Y1WA 5J3BA 1XMQL 5HGQA 5C0XI 2AGOA 4KD3A 2VQFH 1N34Q 1D1KA 2GLTA 1FNUA 4CDCC 4MV1A 4MTNA 2AQ3B 3FRPB 3S1NH 1YNJD 3MXUA 1KRSA 1ICWA 1Q3LA 4LW1A 4R4TA 2R92H 5GROA 5KYIA 4FXKC 3RAQA 3BDOA 3Q8DA 1CT1D 4DXFA 2B2WA 4DXGA 4EQPA 2MO0A 2CWAA 1W6KA 4UP8A 4LF4H 1KLGD 2L4NA 3BVZA 2YTXA 4HJ9A 1CTMA 2K5WA 1KXLA 1PHJA 2E2IH 3KALA 3Q0AA 4R4IA 1B2TA 2YYAA 4HNVA 4FYDA 4EQ5A 4XX0B 2DZDA 2V59A 2DNCA 2J6SA 1A2UA 3TDQA 5JEAJ 5C44B 1YHAA 4A3BB 5FK9C 2XRSD 4APVA 1OXXK 4JOIC 3ORQA 3K81C 1S03G 3MXPA 1SNPA 3HKZE 5A2QE 2MGSA 1K3RA 4J9SA 4JI7H 5EQ0A 4BY1B 2YTYA 2W9CA 2CH4W 2HVRA 4NW2A 1JJCB 4JBWA 2FK2A 3RZOB 1GUTA 4CDFC 1O7YA 2VUMB 3DEPA 5LL6X 5ELFA 2QK4A 1M0TA 4LFAH 2GVAA 3BJUA 1O7ZA 4F7XA 4X62Q 2AMCB 2NYZD 4HJAA 5ISRA 4YY3L 1R4PB 1NE3A 3QWNA 2A6HC 3OMGA 3NBHB 5L1IA 3JAML 1EU4A 4ECRA 2NU9B 4X65Q 1GUOA 3V4SA 4L5TA 4M7EA 2NU8B 5IGFA 2K5VA 4C3JG 1SJED 1VCIA 3UDFA 1HNWL 2EYOA 3OTOQ 2K05A 2WIIB 4RHSA 3CVZA 4BXXG 4B3TL 4JYAH 1T5EA 5KT4A 4Q0FA 2XVSA 4ECVA 1D5MC 2EJMA 1M8AA 4OWXB 3M3YB 1KDAA 5ELDA 2NWGA 3EFXD 4AYBE 2A68C 1LACA 1QB5D 1VDZA 5IYBH 1EWCA 4DL5A 4JV5H 5C6AA 1WCMG 3T1YL 4JW0A 1EFID 5IGGA 3RV3A 4P2CB 3CAMA 5CMDA 2ICEC 4TSSA 1TXYA 3DLLA 3CCVA 3R3OA 2M9VA 2E2HA 5LA6F 2R92A 4DR5Q 4A3IG 3PW7A 4RAZA 4CC5A 3CD6A 1BR9A 5IWAL 5C44H 1SMXA 1WOCA 2LFNA 3ULJA 4LF7Q 4C5BA 1VQ8A 1I94Q 5JJIA 4HQ6A 1UC8A 3BQ0A 4DV4L 1LLRD 3G6EA 1K83H 1TWAH 1J9OA 5C8YF 1VQFA 3ULLA 4QY7A 4RKLA 3C2PA 4RKBA 4WJ4A 5IYCH 4IURA 4RNMA 1NR4A 4GNXB 3J7A5 1F2MA 3GIIA 4IUQA 3T1HQ 3GTGH 4UHVA 4TV9F 5K36H 4YY3H 4ECSA 5KYLA 3I4NB 1A6XA 2E5LL 4CKCA 2JA7A 2ID0A 2IA6A 1UEAB 2F0KA 4DR6L 3Q8PB 4FF2A 2AUKA 2EOTA 3VR2A 3A74A 4AQYH 3D0FA 1GVPA 2NZ1D 3Q8SB 2B2UA 3PV0A 4JI2L 1TWFB 1VF7A 3ORRA 4ZYSA 2R87A 1VQLA 3PIPA 2UVVA 2PPBC 2W6MA 4NXNQ 4QF4A 4KHZA 3KJPA 3K5HA 3EBEA 3FMAA 4DV3H 1ICFB 4R8UB 4RNOA 2W7PA 3FDSA 2NZOA 2E74C 2OQKA 2B2YA 1B1ZA 1OXSC 2F0LA 5I9OA 4RZRA 2R8IA 2VQEL 3I4NH 2NVQH 4QIWA 3BABA 5CBEE 5JAVA 2F0FA 3MXGA 1N8RC 1IYVA 1N32H 4JI5H 1IOWA 1A3UA 4KHVA 1YJ9A 2I0QA 4L6TB 3MAQA 1JWMD 5I6YA 4KHPQ 2TSSA 1PYSB 2E2DC 5IT9c 3GIKA 4CJ0B 3U4ZA 3CC4A 1N56A 4O3RA 1CKMA 1NMGA 3BZDB 4OELB 2BR0A 3I3CA 4DV1H 2E75C 2JQOA 3GTOA 1N33Q 3GV3A 2Z4IA 3S2HH 3S9WA 2WKCA 2C00A 3LWUA 3SK5A 1U4PA 2DY7A 1PYBA 2V4QA 2EIFA 1Y8PB 4L5RC 2YCHA 3RB6A 5M3FG 3KHGA 4B9WA 3CRKC 5KG6A 4LNQA 1KJQA 4FF4A 2K33A 3CQZH 1L1OB 1N33H 2SCUB 2WDTA 2LS01 4HN7A 2AGPA 4DR6H 1PZID 1HPCA 1X3GA 4AQYL 1JJ2A 4DR4L 3CCUA 4C3IH 4A93B 3R5XA 3GTPA 3SR1A 1N36L 1TWAA 1K83A 1BBXC 2KCNA 1K9MC 3HXLA 1E1TA 4DPGA 2ENBA 1LTGD 2AWNA 5BMVF 1WH2A 1DIKA 3PZPA 1SAPA 1SYGA 4JBJA 1PXUA 5IODA 1EOTA 2ZDQA 4O3QA 3NBHA 5JPNC 3S24A 3KDFB 1U4MA 4F8MA 2SOBA 3VMMA 3A55A 1HNZQ 5C4XH 4X3KA 3G6VA 4OX9Q 3EIVA 4JI3L 3VYTA 3U9OA 3H09A 2RKSA 2L1BA 3NUCA 3GV5B 1VQOA 2RDHA 1KABA 1EZ1A 2G9HD 2WINB 3TP5A 1VQAA 1SBBB 3OOCA 1F9RA 4PG3A 2K28A 2CFMA 1AW7A 5KT5A 1SMYC 2HCCA 1UUPA 4MAMA 3GTKB 3X3MA 3DMUA 1MGSA 4NP5A 4ED2A 1E22A 1G2SA 1TKWB 1VMCA 2JA6G 4PWQA 5JVLA 4MA5A 5NUCA 3GD7A 5KFSA 1TQOA 4C3IG 4ZOLF 3FVQA 4Z9CB 2FP4B 1NAPA 3NTHA 4MTDA 5AFWA 3F1ZA 1EQRA 1TWGA 1WYDA 5IIFA 5LMNQ 4K0KQ 2UVWA 2J4XA 2UUCL 3R23A 1TS3A 5IOCA 3MA2B 1EQVA 1X56A 3ERQA 2FLPA 4TRDA 4UAIA 3TIIA 3TBIB 5KNDA 5FOBB 1QJOA 1XTDA 3MEFA 5FJ8H 1IBKQ 2NVYA 2E76C 2RCFA 3L3OC 2BA1A 3CMEA 1BF4A 4LF9H 2CQYA 4JI7L 5IGCA 1B8AA 1PFBA 2MFIA 4BWGB 3K57A 1HFNA 3BQ2A 4RB0A 3RR5A 2FPGB 4DV3Q 3RNUA 3S2DH 4NLGA 3OW2A 3PR5B 2O5IC 1I5FA 4EBDA 4DV0L 1XX8A 2VQDA 1EWIA 1A3VA 1NR2A 2NVQB 2KBNA 5EJWA 2YZNA 5M5YB 1SXTA 3ICEA 1EY0A 2BCOA 5M3MB 4DNTB 3D3RA 3RLFA 2XSCA 1CM9A 4LFBH 1CHPD 1ET9A 2HHHL 3NQTA 3HOVH 1SSOA 4GC6A 3T5JA 3T13A 5K36G 1JE4A 3R93A 5BN3A 4IPCA 5AJ3L 1TAEA 2UUAH 3NWSA 2EQSA 1YBYA 3T1YH 4I4TF 3ZJYC 3JRWA 3C46A 1I4XA 4KD4A 1G8ZD 1JCKB 3NSWA 4JI4L 4JV0A 3MFIA 1EZ6A 4TKOB 4PNYA 2AWOA 4R4OA 3L9AX 2W9AA 2AKWB 3EPGA 5C4XB 4U6PA 3HOYG 3OIQA 3FHWA 4YJ3F 4OONA 4F4WA 2GPSA 4MTKA 5KFKA 1S68A 1EUJA 1SNDA 5KFHA 3TQ1A 3GQCA 1CE8A 3CCJA 4DR2L 2FMAA 1RCVD 2RSNA 3AB9A 1X3PA 4DK0A 2D0PA 2ZM6H 3W5OA 4DV2L 4B3RL 2JYOA 1KD1C 2R93B 4E4TA 2DN8A 3M9OB 1EY5A 2GA4B 4QUCA 2ASLA 1PH3A 2HIXA 1U4LA 1UE7A 5L1LA 3J7ZC 3J80c 3H0GG 1ZYRC 1SR3A 1AP0A 1G91A 3GTKH 4POGA 3MXNB 4QWDA 5C1PA 1OWTA 2X69A 1ZEQX 3HOVG 3QFFA 3E9IA 3MFYA 4JG2A 4EEYA 2F3VA 4L1KA 4QWAA 5KFBA 4IFDG 3BAAA 2IHEA 3NEMA 3QO2A 2ZDHA 1ILQA 3RN5A 2UVRA 3STBC 2LKVA 5CV6A 1QNKA 5KX5F 3TREA 1EQQA 4GZYC 5IGBA 2EVBA 3CCRA 1UNSA 2B8FA 4OO1H 2FXQA 5FLXE 5IY0A 2JA7H 1STEA 2KCTA 2W9BB 4FP5D 5I4DA 4GNXA 1T94A 2VQEH 3BYYB 1XPRA 2PMZA 5D1OB 5KFMA 3M85A 1HTLD 2YV5A 4QMGA 3PO2G 4A3GG 1A9XA 2CQOA 2JSOA 5D65A 5JOBA 1IBMH 4FS2A 1TT2A 2FKLA 2UUBQ 2W7OA 2KOLA 1XXGA 4JI1H 5KFVA 4X3UA 1EHIA 4B3SH 3AQQA 5EPLA 4HJ5A 4NXMH 1TWCH 3TP6A 2VQFL 3PO2B 1B3QA 3F8NA 4JI5L 1U5KA 1KHIA 2RDFA 4R1JA 1ZYRD 1PX2A 4YHHL 3A56A 3GILA 4ED7A 3HKZB 5LMUL 2R7ZG 2K14A 3HOXB 3SE0A 2CCZA 1YEZA 4JI0L 1I50H 3S1RH 5L1KA 3T1HH 2IP4A 4LK1C 5EAYA 4Y8VB 2M2LA 4U68A 3HEJA 2N88A 3AYHB 4QIWB 3D31A 4A3EG 1C3OA 3HOXG 4JI0Q 2E5LH 5I47A 1WTWA 1FL0A 5LMUQ 4HIKA 1Q86C 4APMA 4YHHQ 5KG1A 4BBRG 1CA5A 5C1OA 5KG2A 2YW2A 2VPQA 1QCBD 1Q8IA 4JI5Q 3A54A 5KFYA 1I4HA 1TWCB 4GKKL 2XCAA 4PQXA 5C4HA 2VQFQ 2JA5B 1TIID 2Q8RE 4IOCA 2J6UA 3TQYA 2UUBL 1W6JA 2F0DA 3LWEA 5DM73 4P73A 5M3MH 2VB2X 1ILPA 4MV4A 3NTIA 4GOPA 1EIYB 4TQSA 1SFOB 2NVXA 4WD3A 1OXTA 4HNTA 1L1OC 3PUZA 2PZUA 4BA1I 4HSPA 2B63G 4M1UB 3I8ZA 1S40A 2R6FA 2XCLA 5GAEC 2R85A 1N32L 2F0OA 5KFRA 1T36A 3S2DB 3PF5A 2WKDA 4IR9A 4XZ3B 3RV4A 1JOQA 3HOWG 1B53A 1NMFA 2JA8G 2WB1A 4ME6A 2I5MX 3PIO3 3KJOA 1HNWH 4OXPA 4R4QA 4JYAL 2V4RA 4DV6H 5ELCA 4ZCKA 1Y69U 1YNNC 4GLAC 2XRQD 2JXMB 2KECA 2F4VL 2UXDL 4B3RQ 3MEHA 3KLWA 1AZQA 3WO1A 5G3LF 4HEDA 3MR6A 4DR2Q 1JC7A 4MZ9A
chains in the Genus database with same CATH topology
1MIUA 4IPDA 3PCOB 4ME3A 5JEAJ 4EX5A 1YHAA 2ZM6Q 1G51A 4AH6A 4APVA 1OXXK 4JOIC 1VQNA 3K81C 4JI8Q 3JAMi 3CC7A 4A3GH 2AHOB 4O2DA 1Q12A 3HKZE 5ELOA 1K3RA 4OWTB 1VQHA 1HH2P 2NZHA 2YTYA 3KF6B 5HY6A 1A63A 4JI4Q 1IBMQ 3RZOH 2NVTH 3HOZG 2JJQA 2MNAA 1QZGA 1JJCB 1A8VA 4JBWA 3M3YH 4IPGA 4DNIA 1VQ9A 4DUYQ 3GTMH 1Q7YC 3KYHC 1NY4A 5AJ3Q 2VS1A 1MJEA 2GVAA 3BJUA 4TQUS 4A3MG 2ATWA 2N8NA 4PZ6A 4RG1A 2AMCB 4X62Q 2XGTA 2UUAQ 1PH4A 4HJAA 2HHHQ 4YY3L 1XJVA 1NE3A 5BR8Q 2NN6G 1JE5A 3F8TA 2JA7G 4C2MH 3PF4A 1SFOH 3I2ZA 3A5ZB 3NBHB 2WB1G 4X65Q 1EIFA 4L5TA 4DV7L 3J81c 3PO2H 3PSIA 2K5VA 1HNWL 1VCIA 3UDFA 3OTOQ 1IL2A 4DV0Q 2UU9Q 4BXXG 4B3TL 3CPFA 3CP0A 4BBRH 2JA5H 4DV3L 4LF6Q 1I3QH 4GN5A 2VZAA 2MQHA 2RHQB 4OWXB 2IY5B 4AYBE 4JI7Q 1X55A 4HJ8A 3HOXH 5IYBH 1IBKL 1PH6A 1JT8A 1QVFA 3FKIH 1J5EQ 1RL2A 5IP7H 4JCVE 1WCMG 3T1YL 2ZTEA 1VQDA 1PA6A 3EN2A 5DLQE 4LF9Q 1KRTA 3CAMA 3WWVA 1Q1BA 1TXYA 3DLLA 1TWFH 1TWGH 3CCVA 4DR3L 2UUCQ 4GOPC 3VDYA 4DR5Q 5LMNL 4LUZA 4IJHA 4A3IG 1NJIC 1XPUA 3CD6A 4K0KL 5IWAL 1HJPA 5C44H 1SMXA 1WOCA 3ULJA 2VUMG 4LF7Q 4A3EH 1VQ8A 4DK6C 5C3EG 1I94Q 4JV5Q 2CKZB 1PVOA 5JJIA 4DV4L 4FDBA 4DR1Q 1UE1A 1V43A 3G6EA 1K83H 1TWAH 1X6OA 1VQFA 5JEAG 3ULLA 4QY7A 5FLMH 1X65A 1YNXA 4IFDI 2JA8H 1KIXA 4WJ4A 5IYCH 4JBKA 1OTCA 5GAGC 1XNQQ 2I5HA 4GNXB 4A76A 3AEVA 3J7A5 2WFWA 5JJLA 2VW9A 3GTGH 3K80C 3T1HQ 2UXBQ 3RN2A 1V9PA 2E5LL 4X6AH 2ID0A 2Y0SE 1A62A 4LF8Q 1EYGA 3I56A 4DR6L 1PH5A 1JB7A 2IT1A 5GADC 3A74A 1VQ6A 3D0FA 1GVPA 1SRUA 3U58A 4C3HH 4LFBL 3PV0A 4JI3Q 4JI2L 1YVCA 3I4NG 4OX9L 4IO9A 4IJLA 1VQLA 3PIPA 2ZJPA 3NELA 3BZKA 1HNZL 3M4QA 4NXNQ 4RMFA 3KJPA 3M4PA 2HIVA 4KHZA 3GDEA 4LFAQ 3EBEA 2ALYB 1VQ4A 5M5XH 4GKJQ 4A3DH 1Q8KA 2NZOA 1X3EA 4TVAB 1HR0Q 2OQKA 4X64Q 1PH7A 4JOIA 1OXSC 1PV4A 1HR0W 4DV5Q 1VQ5A 2MO1A 2VQEL 3I4NH 2NVQH 4DR7L 1X9NA 1SN8A 1VQPA 3CF5A 5IYCG 1G291 3I55A 3GTLH 1N36Q 1N8RC 4X66L 5FJ8G 2DGYA 1W2BA 1CUKA 1YJ9A 1Y1WH 2PQAA 2D0OA 4POFA 4LFCQ 3CXCA 1XNRQ 4DR4Q 1X3FA 2I0QA 2BH2A 4AQYQ 3H3VH 3HOUH 4JI1L 2OTJA 4KHPQ 5E7NA 1YHBA 1PYSB 5IT9c 3U4ZA 3CC4A 1CKMA 1B7YB 1PH8A 1NMGA 3HOZH 4A3CH 3JAMc 2JQOA 3A0JA 3BZCA 4KLKA 1N33Q 1SROA 4LF4L 3S2HH 3CCLA 4LF4Q 1KC8C 1N33L 2Q2HA 1PYBA 3DM3A 1Y1WG 2EIFA 3E9HA 4L5RC 4A93G 1SLJA 1S3OA 1UE6A 4YCVA 5M3FG 2LXKA 3PGZA 4LNQA 4PZ8A 3GTOH 3CQZH 1L1OB 2KENA 2JK8A 4PMWA 2PQAB 3KFUA 4NB3A 4AYBG 4KHPL 1X3GA 4JI1Q 1E24A 1WI5A 4AQYL 1JJ2A 4UP7A 4DR4L 4LFCL 3CCUA 1IZ6A 3SGIA 4C3IH 1XNRL 4XIGS 4X66Q 1N36L 4A3BH 3UDIA 2K4KA 2R7FA 2R7ZH 1GD7A 2VQEQ 4DR7Q 1VQCA 1K9MC 5IP9H 4DV5L 1E1TA 2ZTDA 4DPGA 2AWNA 4X64L 4BY1G 2K5NA 1HR0L 3B6YA 1RIPA 4JBJA 2RF4A 2A1AA 4GKJL 4BY7H 4GOPB 3L0OA 1V1QA 3NENA 2N3SA 3S24A 3KDFB 4LFAL 2IHFA 4A4IA 4NXNL 1N9WA 1HNZQ 2GN5A 3CW2C 1E3PA 2K75A 4IPHA 5C4XH 1KAWA 5IP9G 4HIOA 1K8AC 3EIVA 4OX9Q 4JI2Q 4JI3L 3KDFA 4LFBQ 4YWKA 1ASZA 3S14H 2C35B 4GN3B 3RLOA 1VQOA 1LTLA 1HZ9A 3W1BA 1FVIA 4BA2I 4DR6Q 1VQAA 2PI2E 1YIJA 3K0XA 4LF8L 4PG3A 2CFMA 1QVCA 2E5LQ 3G71A 4Y52H 2UXBL 3T1HL 4YWLA 5M3MG 2Q2UA 1E22A 3HKSA 1HZCA 3KF6A 1TWHH 1XNQL 4WJ3M 3CMAA 2HQLA 1PH1A 2JA6G 2KCMA 2VY3A 1HZBA 1PFSA 1VQBA 2L15A 2OWOA 3GD7A 5H1SE 3K7UC 3PO3G 4DR1L 1AH9A 4DV4Q 1B70B 1I94L 1O7IA 1MJCA 4LF7L 4IOAA 4JV5L 3FKIG 3F1ZA 5IWAQ 1EQRA 3H0GH 1H95A 1WYDA 3ULPA 4K0KQ 5LMNQ 3I7FA 4DR5L 4BBSG 2IX1A 4HIDA 2UUCL 4DR3Q 4A3JH 4UPAA 1LM0A 1X56A 1Y1VG 2E2HH 2R92G 4LF9L 3I4OA 3F2BA 5C0XJ 3PO3H 3T1YQ 4BXXH 3F2DA 1YI2A 4C3JH 3MEFA 1XTDA 1J5EL 5FJ8H 1IBKQ 2NN6I 3CMEA 2BA1A 2D62A 4JI7L 1XPOA 1B8AA 1E1OA 2MFIA 2R7DA 1LUZA 3RR5A 1GKHA 4LF6L 4DV3Q 3RNUA 3I4MH 3S2DH 2I5LX 2B63H 3S1MH 3OW2A 1J6QA 4J15A 2WAQG 4B3TQ 1I5FA 1WCMH 2UU9L 4DV0L 3OTOL 2NVXH 3TRZA 1HNWQ 4DKAC 3CC2A 1EWIA 4UY8C 1VQGA 2YYZA 1VQMA 4DV7Q 1NTGA 2EXDA 3CCMA 3H15A 2KBNA 4X65L 4L5SA 2YU9H 1DGSA 1D8LA 3ICEA 2VNUD 3LGJA 5M5YH 3F2CA 3RLFA 4GLVB 2K50A 5BR8L 5C4JH 1S72A 2QGQA 3BU2A 4YY3Q 1OXVA 3FP9A 3G4SA 2A19A 1OXUA 2HHHL 2UUAL 3HOVH 4BY7G 3UDXA 4X62L 4QQBX 1FGUA 1Z47A 2ES2A 1YITA 1YJWA 4LUVA 5K36G 1CSQA 4IPCA 5AJ3L 4OO1G 3S17H 2IX0A 1UE5A 2EQSA 4DUYL 1YBYA 4YCUA 3TEHB 3ZJYC 2DUDA 1M1KC 1HZAA 1PH2A 1IBML 3AFPA 4BY1H 4JI4L 3L2PA 4PZ7A 3RLNA 2AWOA 2PI2A 4R4OA 3J80i 3UDGA 3GTPH 3U4VA 2N49A 2AKWB 5M5WH 4HIMA 1YJNA 4JI8L 3CCQA 2PMZE 1R9TH 2ZJQA 1VQJA 3A5UA 1BBWA 3HOYG 4OO1I 3FHWA 1VS0A 1CKNA 1C7YA 4OONA 2Z6KA 2ZM6L 2R6GA 1I6HH 1EUJA 1T9HA 3AFQA 2E2JH 3CCJA 4DR2L 1CKNB 1Q82C 1IBLL 2D0PA 1QUQA 3W5OA 2ZTCA 2WAQE 4DV2L 4B3RL 5LMNW 3RZDH 1KD1C 3TS0A 2F4VQ 2UXDQ 2F3IA 4DV6Q 1PH3A 3HKZG 4A3CG 1QUQB 2HIXA 3UE0A 2JA9A 4BBSH 1XMOQ 1UE7A 3J7ZC 3J80c 3H0GG 1SR3A 4R4CA 2OTLA 4JYAQ 3GTKH 3CCSA 1UEBA 1SE8A 3MXNB 3PUWA 4DV1Q 4POGA 3HOYH 4A3DG 2N78A 3CPWA 1IYJB 3M9BA 4LUOA 2YTVA 3HOVG 4A75A 3E9IA 4JG2A 1GO3E 1U0LA 1WFQA 3ER0A 3PUVA 1Y14B 3S16H 2VL6A 1EOVA 3S1QH 4IFDG 4A3MH 2IHEA 3NEMA 3RN5A 1N34L 2CWPA 2K5HA 3STBC 3I4MG 1G6PA 1XMQQ 1GM5A 3TREA 3HFZB 1EQQA 3PUYA 3CCRA 4DUZQ 1ASYA 1N32Q 3S15H 2FXQA 5IY0A 1WJJA 3J81i 2JA7H 3UE1A 2JA5G 2KCTA 3KF8B 3PUXA 4LF5L 2WB1E 3M7NA 1JJGA 1UWVA 1VQ7A 1MKHA 3JC66 1P16A 4H02A 3GTJH 4GNXA 4ALPA 4QGUA 4GLXA 4JI6L 4A3LG 1XPRA 1AE3A 3M85A 3PO2G 2YV5A 1YHQA 4IFDJ 1L0WA 4A3GG 1NBWA 2CQOA 4P74A 2ZJRA 4OWWB 1LYLA 2Q2IA 3U50C 4NXML 5C4XG 2Z6KC 1P8LA 1AE2A 2Z0SA 3G48A 1Q81C 4JBMA 2K52A 4QL5A 2UUBQ 4A3LH 2H5XA 3AQQA 4AIMA 4HJ5A 1HNXQ 1TWCH 3KOJA 1E7ZA 4KI0A 2VQFL 4GKKQ 2UXCQ 4JI5L 1U5KA 1KHIA 5GQOA 1JMCA 1Y1VH 4R1JA 4B3SL 2VUMH 1VQEA 4YHHL 4XTCS 5LMUL 2R7ZG 1D7QA 2K14A 1CSPA 1CKOA 2CCZA 1YEZA 4JI0L 1I50H 4YWMA 3S1RH 2B3GA 2PNHA 1C9OA 2Q2TA 4GN4B 4B3ML 5FLXc 5IE8A 5EAYA 1L2FA 4GNXC 4A3KH 1FJGQ 2KHIA 3M4OH 4DAYB 3AYHB 4A3FH 1FJGL 3D31A 1L1OA 5ELNA 4B3MQ 4A3EG 2JA6H 5GAHC 3HOXG 4A3JG 3STBD 1BKBA 4P71A 4JI0Q 4L5QA 2HT1A 1FL0A 5LMUQ 2LSSA 5M3FH 4HIKA 1Q86C 1C0AA 4YHHQ 5FLMG 1M90C 2BH8A 2GVBA 4BBRG 4B3SQ 3J81j 1QVGA 3H3VI 4JI5Q 2UXCL 2XTIA 1VQIA 1W3SA 2OCEA 1X54A 2V1CC 4GKKL 2VQFQ 5IYDH 1HNXL 1Z9FA 5C3EH 2NVYH 1A0IA 5IP7G 2RHSB 2E8GA 4MNOA 1Q46A 4QJFA 2QEXA 4IOCA 5C44G 3TQYA 5IYBG 4NPSA 2UUBL 2Y0SG 3IRBA 4LWCA 3L7ZC 4A3IH 2WP8J 1Q1EA 4NXMQ 4QIWE 2BA0A 4P73A 5M3MH 5JJKA 4GS3A 4DAMA 4GOPA 1EIYB 3HOUG 4Y7NH 4JI6Q 1OXTA 1L1OC 3PUZA 2JEBI 1BVSA 4HJ7A 4BA1I 1YZ6A 2JEAI 4LF5Q 2B63G 1EFWA 1S40A 3HOWH 4P75A 5GAEC 2OQ0A 4O0AA 1N32L 4DUZL 5J3BA 3PF5A 5HGQA 5C0XI 1XMQL 1PH9A 1N34Q 1K8GA 1K0RA 1VQKA 3HOWG 1NMFA 4MTNA 2JA8G 3S1NH 2LXJA 1KRSA 2QA4A 2R93G 4LW1A 4A3FG 4UP9A 1QZHA 3OYYA 1IXRA 4R4TA 2R92H 2JE6I 4A3KG 5GROA 2I5MX 3KJOA 3K7AH 2A8VA 4DV1L 3W1GA 1BBUA 2KHJA 4OXPA 4JC0A 4R4QA 3Q8DA 4JYAL 4YCWA 5C0XG 2MO0A 2CWAA 2B29A 2RCNA 3E0EA 4UP8A 1XMOL 3PIOA 4A3BG 4A93H 3CCEA 1K73C 2R93H 4P72A 2YTXA 4GLAC 4HJ9A 4DV6L 4DR2Q 3K8AA 1KQSA 2F4VL 2UXDL 2ASBA 5IYDG 3TS2A 4B3RQ 4DV2Q 1KXLA 4DK3C 1PHJA 3KLWA 2E2IH 1IBLQ 3GTQH 2F52A 3GO5A 3ERSX 4R4IA 4EQ5A 4MZ9A 1KL9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MIU A;  4IPD A;  3PCO B;  4ME3 A;  5JEA J;  4EX5 A;  1YHA A;  2ZM6 Q;  1G51 A;  4AH6 A;  4APV A;  1OXX K;  4JOI C;  1VQN A;  3K81 C;  4JI8 Q;  3JAM i;  3CC7 A;  4A3G H;  2AHO B;  4O2D A;  1Q12 A;  3HKZ E;  5ELO A;  1K3R A;  4OWT B;  1VQH A;  1HH2 P;  2NZH A;  2YTY A;  3KF6 B;  5HY6 A;  1A63 A;  4JI4 Q;  1IBM Q;  3RZO H;  2NVT H;  3HOZ G;  2JJQ A;  2MNA A;  1QZG A;  1JJC B;  1A8V A;  4JBW A;  3M3Y H;  4IPG A;  4DNI A;  1VQ9 A;  4DUY Q;  3GTM H;  1Q7Y C;  3KYH C;  1NY4 A;  5AJ3 Q;  2VS1 A;  1MJE A;  2GVA A;  3BJU A;  4TQU S;  4A3M G;  2ATW A;  2N8N A;  4PZ6 A;  4RG1 A;  2AMC B;  4X62 Q;  2XGT A;  2UUA Q;  1PH4 A;  4HJA A;  2HHH Q;  4YY3 L;  1XJV A;  1NE3 A;  5BR8 Q;  2NN6 G;  1JE5 A;  3F8T A;  2JA7 G;  4C2M H;  3PF4 A;  1SFO H;  3I2Z A;  3A5Z B;  3NBH B;  2WB1 G;  4X65 Q;  1EIF A;  4L5T A;  4DV7 L;  3J81 c;  3PO2 H;  3PSI A;  2K5V A;  1HNW L;  1VCI A;  3UDF A;  3OTO Q;  1IL2 A;  4DV0 Q;  2UU9 Q;  4BXX G;  4B3T L;  3CPF A;  3CP0 A;  4BBR H;  2JA5 H;  4DV3 L;  4LF6 Q;  1I3Q H;  4GN5 A;  2VZA A;  2MQH A;  2RHQ B;  4OWX B;  2IY5 B;  4AYB E;  4JI7 Q;  1X55 A;  4HJ8 A;  3HOX H;  5IYB H;  1IBK L;  1PH6 A;  1JT8 A;  1QVF A;  3FKI H;  1J5E Q;  1RL2 A;  5IP7 H;  4JCV E;  1WCM G;  3T1Y L;  2ZTE A;  1VQD A;  1PA6 A;  3EN2 A;  5DLQ E;  4LF9 Q;  1KRT A;  3CAM A;  3WWV A;  1Q1B A;  1TXY A;  3DLL A;  1TWF H;  1TWG H;  3CCV A;  4DR3 L;  2UUC Q;  4GOP C;  3VDY A;  4DR5 Q;  5LMN L;  4LUZ A;  4IJH A;  4A3I G;  1NJI C;  1XPU A;  3CD6 A;  4K0K L;  5IWA L;  1HJP A;  5C44 H;  1SMX A;  1WOC A;  3ULJ A;  2VUM G;  4LF7 Q;  4A3E H;  1VQ8 A;  4DK6 C;  5C3E G;  1I94 Q;  4JV5 Q;  2CKZ B;  1PVO A;  5JJI A;  4DV4 L;  4FDB A;  4DR1 Q;  1UE1 A;  1V43 A;  3G6E A;  1K83 H;  1TWA H;  1X6O A;  1VQF A;  5JEA G;  3ULL A;  4QY7 A;  5FLM H;  1X65 A;  1YNX A;  4IFD I;  2JA8 H;  1KIX A;  4WJ4 A;  5IYC H;  4JBK A;  1OTC A;  5GAG C;  1XNQ Q;  2I5H A;  4GNX B;  4A76 A;  3AEV A;  3J7A 5;  2WFW A;  5JJL A;  2VW9 A;  3GTG H;  3K80 C;  3T1H Q;  2UXB Q;  3RN2 A;  1V9P A;  2E5L L;  4X6A H;  2ID0 A;  2Y0S E;  1A62 A;  4LF8 Q;  1EYG A;  3I56 A;  4DR6 L;  1PH5 A;  1JB7 A;  2IT1 A;  5GAD C;  3A74 A;  1VQ6 A;  3D0F A;  1GVP A;  1SRU A;  3U58 A;  4C3H H;  4LFB L;  3PV0 A;  4JI3 Q;  4JI2 L;  1YVC A;  3I4N G;  4OX9 L;  4IO9 A;  4IJL A;  1VQL A;  3PIP A;  2ZJP A;  3NEL A;  3BZK A;  1HNZ L;  3M4Q A;  4NXN Q;  4RMF A;  3KJP A;  3M4P A;  2HIV A;  4KHZ A;  3GDE A;  4LFA Q;  3EBE A;  2ALY B;  1VQ4 A;  5M5X H;  4GKJ Q;  4A3D H;  1Q8K A;  2NZO A;  1X3E A;  4TVA B;  1HR0 Q;  2OQK A;  4X64 Q;  1PH7 A;  4JOI A;  1OXS C;  1PV4 A;  1HR0 W;  4DV5 Q;  1VQ5 A;  2MO1 A;  2VQE L;  3I4N H;  2NVQ H;  4DR7 L;  1X9N A;  1SN8 A;  1VQP A;  3CF5 A;  5IYC G;  1G29 1;  3I55 A;  3GTL H;  1N36 Q;  1N8R C;  4X66 L;  5FJ8 G;  2DGY A;  1W2B A;  1CUK A;  1YJ9 A;  1Y1W H;  2PQA A;  2D0O A;  4POF A;  4LFC Q;  3CXC A;  1XNR Q;  4DR4 Q;  1X3F A;  2I0Q A;  2BH2 A;  4AQY Q;  3H3V H;  3HOU H;  4JI1 L;  2OTJ A;  4KHP Q;  5E7N A;  1YHB A;  1PYS B;  5IT9 c;  3U4Z A;  3CC4 A;  1CKM A;  1B7Y B;  1PH8 A;  1NMG A;  3HOZ H;  4A3C H;  3JAM c;  2JQO A;  3A0J A;  3BZC A;  4KLK A;  1N33 Q;  1SRO A;  4LF4 L;  3S2H H;  3CCL A;  4LF4 Q;  1KC8 C;  1N33 L;  2Q2H A;  1PYB A;  3DM3 A;  1Y1W G;  2EIF A;  3E9H A;  4L5R C;  4A93 G;  1SLJ A;  1S3O A;  1UE6 A;  4YCV A;  5M3F G;  2LXK A;  3PGZ A;  4LNQ A;  4PZ8 A;  3GTO H;  3CQZ H;  1L1O B;  2KEN A;  2JK8 A;  4PMW A;  2PQA B;  3KFU A;  4NB3 A;  4AYB G;  4KHP L;  1X3G A;  4JI1 Q;  1E24 A;  1WI5 A;  4AQY L;  1JJ2 A;  4UP7 A;  4DR4 L;  4LFC L;  3CCU A;  1IZ6 A;  3SGI A;  4C3I H;  1XNR L;  4XIG S;  4X66 Q;  1N36 L;  4A3B H;  3UDI A;  2K4K A;  2R7F A;  2R7Z H;  1GD7 A;  2VQE Q;  4DR7 Q;  1VQC A;  1K9M C;  5IP9 H;  4DV5 L;  1E1T A;  2ZTD A;  4DPG A;  2AWN A;  4X64 L;  4BY1 G;  2K5N A;  1HR0 L;  3B6Y A;  1RIP A;  4JBJ A;  2RF4 A;  2A1A A;  4GKJ L;  4BY7 H;  4GOP B;  3L0O A;  1V1Q A;  3NEN A;  2N3S A;  3S24 A;  3KDF B;  4LFA L;  2IHF A;  4A4I A;  4NXN L;  1N9W A;  1HNZ Q;  2GN5 A;  3CW2 C;  1E3P A;  2K75 A;  4IPH A;  5C4X H;  1KAW A;  5IP9 G;  4HIO A;  1K8A C;  3EIV A;  4OX9 Q;  4JI2 Q;  4JI3 L;  3KDF A;  4LFB Q;  4YWK A;  1ASZ A;  3S14 H;  2C35 B;  4GN3 B;  3RLO A;  1VQO A;  1LTL A;  1HZ9 A;  3W1B A;  1FVI A;  4BA2 I;  4DR6 Q;  1VQA A;  2PI2 E;  1YIJ A;  3K0X A;  4LF8 L;  4PG3 A;  2CFM A;  1QVC A;  2E5L Q;  3G71 A;  4Y52 H;  2UXB L;  3T1H L;  4YWL A;  5M3M G;  2Q2U A;  1E22 A;  3HKS A;  1HZC A;  3KF6 A;  1TWH H;  1XNQ L;  4WJ3 M;  3CMA A;  2HQL A;  1PH1 A;  2JA6 G;  2KCM A;  2VY3 A;  1HZB A;  1PFS A;  1VQB A;  2L15 A;  2OWO A;  3GD7 A;  5H1S E;  3K7U C;  3PO3 G;  4DR1 L;  1AH9 A;  4DV4 Q;  1B70 B;  1I94 L;  1O7I A;  1MJC A;  4LF7 L;  4IOA A;  4JV5 L;  3FKI G;  3F1Z A;  5IWA Q;  1EQR A;  3H0G H;  1H95 A;  1WYD A;  3ULP A;  4K0K Q;  5LMN Q;  3I7F A;  4DR5 L;  4BBS G;  2IX1 A;  4HID A;  2UUC L;  4DR3 Q;  4A3J H;  4UPA A;  1LM0 A;  1X56 A;  1Y1V G;  2E2H H;  2R92 G;  4LF9 L;  3I4O A;  3F2B A;  5C0X J;  3PO3 H;  3T1Y Q;  4BXX H;  3F2D A;  1YI2 A;  4C3J H;  3MEF A;  1XTD A;  1J5E L;  5FJ8 H;  1IBK Q;  2NN6 I;  3CME A;  2BA1 A;  2D62 A;  4JI7 L;  1XPO A;  1B8A A;  1E1O A;  2MFI A;  2R7D A;  1LUZ A;  3RR5 A;  1GKH A;  4LF6 L;  4DV3 Q;  3RNU A;  3I4M H;  3S2D H;  2I5L X;  2B63 H;  3S1M H;  3OW2 A;  1J6Q A;  4J15 A;  2WAQ G;  4B3T Q;  1I5F A;  1WCM H;  2UU9 L;  4DV0 L;  3OTO L;  2NVX H;  3TRZ A;  1HNW Q;  4DKA C;  3CC2 A;  1EWI A;  4UY8 C;  1VQG A;  2YYZ A;  1VQM A;  4DV7 Q;  1NTG A;  2EXD A;  3CCM A;  3H15 A;  2KBN A;  4X65 L;  4L5S A;  2YU9 H;  1DGS A;  1D8L A;  3ICE A;  2VNU D;  3LGJ A;  5M5Y H;  3F2C A;  3RLF A;  4GLV B;  2K50 A;  5BR8 L;  5C4J H;  1S72 A;  2QGQ A;  3BU2 A;  4YY3 Q;  1OXV A;  3FP9 A;  3G4S A;  2A19 A;  1OXU A;  2HHH L;  2UUA L;  3HOV H;  4BY7 G;  3UDX A;  4X62 L;  4QQB X;  1FGU A;  1Z47 A;  2ES2 A;  1YIT A;  1YJW A;  4LUV A;  5K36 G;  1CSQ A;  4IPC A;  5AJ3 L;  4OO1 G;  3S17 H;  2IX0 A;  1UE5 A;  2EQS A;  4DUY L;  1YBY A;  4YCU A;  3TEH B;  3ZJY C;  2DUD A;  1M1K C;  1HZA A;  1PH2 A;  1IBM L;  3AFP A;  4BY1 H;  4JI4 L;  3L2P A;  4PZ7 A;  3RLN A;  2AWO A;  2PI2 A;  4R4O A;  3J80 i;  3UDG A;  3GTP H;  3U4V A;  2N49 A;  2AKW B;  5M5W H;  4HIM A;  1YJN A;  4JI8 L;  3CCQ A;  2PMZ E;  1R9T H;  2ZJQ A;  1VQJ A;  3A5U A;  1BBW A;  3HOY G;  4OO1 I;  3FHW A;  1VS0 A;  1CKN A;  1C7Y A;  4OON A;  2Z6K A;  2ZM6 L;  2R6G A;  1I6H H;  1EUJ A;  1T9H A;  3AFQ A;  2E2J H;  3CCJ A;  4DR2 L;  1CKN B;  1Q82 C;  1IBL L;  2D0P A;  1QUQ A;  3W5O A;  2ZTC A;  2WAQ E;  4DV2 L;  4B3R L;  5LMN W;  3RZD H;  1KD1 C;  3TS0 A;  2F4V Q;  2UXD Q;  2F3I A;  4DV6 Q;  1PH3 A;  3HKZ G;  4A3C G;  1QUQ B;  2HIX A;  3UE0 A;  2JA9 A;  4BBS H;  1XMO Q;  1UE7 A;  3J7Z C;  3J80 c;  3H0G G;  1SR3 A;  4R4C A;  2OTL A;  4JYA Q;  3GTK H;  3CCS A;  1UEB A;  1SE8 A;  3MXN B;  3PUW A;  4DV1 Q;  4POG A;  3HOY H;  4A3D G;  2N78 A;  3CPW A;  1IYJ B;  3M9B A;  4LUO A;  2YTV A;  3HOV G;  4A75 A;  3E9I A;  4JG2 A;  1GO3 E;  1U0L A;  1WFQ A;  3ER0 A;  3PUV A;  1Y14 B;  3S16 H;  2VL6 A;  1EOV A;  3S1Q H;  4IFD G;  4A3M H;  2IHE A;  3NEM A;  3RN5 A;  1N34 L;  2CWP A;  2K5H A;  3STB C;  3I4M G;  1G6P A;  1XMQ Q;  1GM5 A;  3TRE A;  3HFZ B;  1EQQ A;  3PUY A;  3CCR A;  4DUZ Q;  1ASY A;  1N32 Q;  3S15 H;  2FXQ A;  5IY0 A;  1WJJ A;  3J81 i;  2JA7 H;  3UE1 A;  2JA5 G;  2KCT A;  3KF8 B;  3PUX A;  4LF5 L;  2WB1 E;  3M7N A;  1JJG A;  1UWV A;  1VQ7 A;  1MKH A;  3JC6 6;  1P16 A;  4H02 A;  3GTJ H;  4GNX A;  4ALP A;  4QGU A;  4GLX A;  4JI6 L;  4A3L G;  1XPR A;  1AE3 A;  3M85 A;  3PO2 G;  2YV5 A;  1YHQ A;  4IFD J;  1L0W A;  4A3G G;  1NBW A;  2CQO A;  4P74 A;  2ZJR A;  4OWW B;  1LYL A;  2Q2I A;  3U50 C;  4NXM L;  5C4X G;  2Z6K C;  1P8L A;  1AE2 A;  2Z0S A;  3G48 A;  1Q81 C;  4JBM A;  2K52 A;  4QL5 A;  2UUB Q;  4A3L H;  2H5X A;  3AQQ A;  4AIM A;  4HJ5 A;  1HNX Q;  1TWC H;  3KOJ A;  1E7Z A;  4KI0 A;  2VQF L;  4GKK Q;  2UXC Q;  4JI5 L;  1U5K A;  1KHI A;  5GQO A;  1JMC A;  1Y1V H;  4R1J A;  4B3S L;  2VUM H;  1VQE A;  4YHH L;  4XTC S;  5LMU L;  2R7Z G;  1D7Q A;  2K14 A;  1CSP A;  1CKO A;  2CCZ A;  1YEZ A;  4JI0 L;  1I50 H;  4YWM A;  3S1R H;  2B3G A;  2PNH A;  1C9O A;  2Q2T A;  4GN4 B;  4B3M L;  5FLX c;  5IE8 A;  5EAY A;  1L2F A;  4GNX C;  4A3K H;  1FJG Q;  2KHI A;  3M4O H;  4DAY B;  3AYH B;  4A3F H;  1FJG L;  3D31 A;  1L1O A;  5ELN A;  4B3M Q;  4A3E G;  2JA6 H;  5GAH C;  3HOX G;  4A3J G;  3STB D;  1BKB A;  4P71 A;  4JI0 Q;  4L5Q A;  2HT1 A;  1FL0 A;  5LMU Q;  2LSS A;  5M3F H;  4HIK A;  1Q86 C;  1C0A A;  4YHH Q;  5FLM G;  1M90 C;  2BH8 A;  2GVB A;  4BBR G;  4B3S Q;  3J81 j;  1QVG A;  3H3V I;  4JI5 Q;  2UXC L;  2XTI A;  1VQI A;  1W3S A;  2OCE A;  1X54 A;  2V1C C;  4GKK L;  2VQF Q;  5IYD H;  1HNX L;  1Z9F A;  5C3E H;  2NVY H;  1A0I A;  5IP7 G;  2RHS B;  2E8G A;  4MNO A;  1Q46 A;  4QJF A;  2QEX A;  4IOC A;  5C44 G;  3TQY A;  5IYB G;  4NPS A;  2UUB L;  2Y0S G;  3IRB A;  4LWC A;  3L7Z C;  4A3I H;  2WP8 J;  1Q1E A;  4NXM Q;  4QIW E;  2BA0 A;  4P73 A;  5M3M H;  5JJK A;  4GS3 A;  4DAM A;  4GOP A;  1EIY B;  3HOU G;  4Y7N H;  4JI6 Q;  1OXT A;  1L1O C;  3PUZ A;  2JEB I;  1BVS A;  4HJ7 A;  4BA1 I;  1YZ6 A;  2JEA I;  4LF5 Q;  2B63 G;  1EFW A;  1S40 A;  3HOW H;  4P75 A;  5GAE C;  2OQ0 A;  4O0A A;  1N32 L;  4DUZ L;  5J3B A;  3PF5 A;  5HGQ A;  5C0X I;  1XMQ L;  1PH9 A;  1N34 Q;  1K8G A;  1K0R A;  1VQK A;  3HOW G;  1NMF A;  4MTN A;  2JA8 G;  3S1N H;  2LXJ A;  1KRS A;  2QA4 A;  2R93 G;  4LW1 A;  4A3F G;  4UP9 A;  1QZH A;  3OYY A;  1IXR A;  4R4T A;  2R92 H;  2JE6 I;  4A3K G;  5GRO A;  2I5M X;  3KJO A;  3K7A H;  2A8V A;  4DV1 L;  3W1G A;  1BBU A;  2KHJ A;  4OXP A;  4JC0 A;  4R4Q A;  3Q8D A;  4JYA L;  4YCW A;  5C0X G;  2MO0 A;  2CWA A;  2B29 A;  2RCN A;  3E0E A;  4UP8 A;  1XMO L;  3PIO A;  4A3B G;  4A93 H;  3CCE A;  1K73 C;  2R93 H;  4P72 A;  2YTX A;  4GLA C;  4HJ9 A;  4DV6 L;  4DR2 Q;  3K8A A;  1KQS A;  2F4V L;  2UXD L;  2ASB A;  5IYD G;  3TS2 A;  4B3R Q;  4DV2 Q;  1KXL A;  4DK3 C;  1PHJ A;  3KLW A;  2E2I H;  1IBL Q;  3GTQ H;  2F52 A;  3GO5 A;  3ERS X;  4R4I A;  4EQ5 A;  4MZ9 A;  1KL9 A; 
#chains in the Genus database with same CATH topology
 1MIU A;  3RJ0 A;  4ME3 A;  2M00 A;  5C0X H;  1KNA A;  5BN4 A;  1D6E C;  2B63 A;  1VQN A;  4MV3 A;  3JAM i;  1F77 A;  3CC7 A;  2AHO B;  2X6L A;  5IWA H;  1VQH A;  2UUC H;  2NZH A;  1BCP C;  3HRZ C;  1DCZ A;  3KF6 B;  3HS0 C;  4XXE A;  4JI4 Q;  5CA1 F;  2BOS A;  1U9R A;  2NVT H;  3RZO H;  3VPD A;  3HOZ G;  2JJQ A;  2MNA A;  3GTO B;  2C22 A;  3M3Y H;  4DNI A;  1STY A;  3VA7 A;  5AJ3 Q;  1NY4 A;  2C5C A;  2VS1 A;  4TQR A;  1IW7 D;  4X3S A;  4A3M G;  4TQU S;  3GTM A;  3N41 B;  4RG1 A;  2WV6 D;  4ZAI A;  5IYZ F;  4LAA A;  5BR8 Q;  2DPI A;  2KVM A;  4F4Y A;  4S3S A;  3I2Z A;  3MWD A;  3MVV A;  4CKB A;  5C3W A;  1S5E D;  2EYF A;  2HHH H;  2ZXO A;  2FIN B;  3GID A;  1EIF A;  1FR3 A;  4DV7 L;  3J81 c;  1PMR A;  2WE6 A;  3GIP A;  3TP7 A;  2F0S A;  1IL2 A;  1V1P B;  3KK7 A;  1II3 A;  3CP0 A;  2JA5 H;  2RBM A;  4DV3 L;  3D6C A;  4GN5 A;  2RHQ B;  2MHV A;  2XIW A;  3CU7 A;  3VR3 A;  1GSA A;  4MA0 A;  4DR1 H;  2V9W A;  1JXL A;  3JRX A;  1JT8 A;  1QVF A;  2J9G A;  1S9F A;  1J5E Q;  1RL2 A;  5JEA H;  4YBZ B;  1VQD A;  1PA6 A;  4LF9 Q;  5DLQ E;  1KRT A;  1TWF H;  3P1H A;  5CC4 A;  1TWG H;  4FF3 A;  1TY0 A;  1V1O A;  1Z2P X;  4B3R H;  3VYU A;  2RSO A;  3PMF A;  5I2X A;  1CQI B;  4DK6 C;  1HTP A;  2VA3 A;  2EYM A;  2Z4H A;  1EU3 A;  4FDB A;  5D3D A;  1AEX A;  1HFG A;  1UE1 A;  1V43 A;  1WTH A;  3Q8R B;  3FDT A;  5EWF A;  2ZJT A;  1YNJ C;  3K5O A;  3MC0 B;  1PZK D;  5FLM H;  3AMU A;  1B50 A;  4JBK A;  1EEI D;  2HDL A;  5KFZ A;  5KG0 A;  4I7A A;  2I5H A;  1JIC A;  5JJL A;  1LV9 A;  3K7A B;  1EY9 A;  1JLL B;  4G57 A;  5LL6 b;  1V9P A;  4X6A H;  1KLU D;  2NU6 B;  5KG7 A;  4G3I A;  3D4W A;  1A62 A;  2L11 A;  4LF8 Q;  1BO0 A;  1EYG A;  5M9O A;  3I56 A;  1JB3 A;  5M3F B;  1PH5 A;  1JB7 A;  4O4H F;  1PRT D;  3I73 A;  4QW9 A;  3E5N A;  4LFB L;  4O3O A;  4JI3 Q;  4IO9 A;  4IJL A;  2PNR C;  1STA A;  1HQR D;  4K6D A;  1E4E A;  3M4Q A;  2FK3 A;  4RMF A;  2HIV A;  2A68 D;  4LFA Q;  2YU9 A;  5EWG A;  1VQ4 A;  5M5X H;  3S16 B;  4GKJ Q;  2RQX A;  3DXJ C;  2B2V A;  3V05 A;  4KV6 A;  2W9B A;  4JOI A;  1ENF A;  2Q8T A;  1S0O A;  4MHE A;  1IKM A;  1F2Y A;  4A3I B;  3O13 A;  4RGT A;  1ENC A;  1N36 Q;  5JQW A;  4QW8 A;  3WOF A;  1PTO C;  4POF A;  5C4J B;  1XNR Q;  1RKN A;  2R7L A;  4ECT A;  2OTJ A;  2FE3 A;  4JI1 L;  3RZD B;  3J7A K;  5EOY A;  3KHH A;  3N6X A;  2BQU A;  2R7N A;  4DV2 H;  1V51 A;  1SE4 A;  3GTQ A;  4EGV A;  2DIK A;  5CB4 F;  3A8J E;  5KFE A;  1SRO A;  4KY7 A;  3CCL A;  3H3V C;  3M4Y A;  1Y1W G;  3DM3 A;  4J8Q A;  1SLJ A;  1KEE A;  3TZU A;  1FYC A;  3GTO H;  5KG4 A;  2H4O A;  1H9S A;  2JK8 A;  4WRD A;  5JVH 3;  4LFC H;  1IL8 A;  1I4P A;  4HSV A;  1E2W A;  2DNE A;  2Q8I B;  4OGQ C;  2JEF A;  2IJ0 A;  1EY4 A;  1WR2 A;  1C48 A;  3H40 A;  4KHP H;  2IW3 A;  4J9P A;  1TVX A;  2R82 A;  5C3X A;  4JVZ A;  3UDI A;  2CQA A;  3BA9 A;  2B2T C;  4LJZ C;  1HR0 H;  1VQC A;  1F2Z A;  3K0Y A;  1AUV A;  4RCN A;  4I50 F;  1F9Q A;  1BUV T;  1VBG A;  1RIP A;  2K04 A;  1HHV A;  4BY7 H;  5LP6 F;  4GOP B;  3L0O A;  4YR2 A;  4DFA A;  2IHF A;  5A2Q L;  3OHB A;  1LT4 D;  3GP7 A;  2GN5 A;  2J7Z A;  4A3D H;  4CHT B;  4ULL A;  4NDX A;  2F1M A;  2ZT9 C;  4KJO A;  4K2K A;  1LTL A;  1MI2 A;  3VR4 A;  3W1B A;  1BOS A;  1EYZ A;  1S0N A;  4DR6 Q;  4YB8 B;  3L4J A;  1YIJ A;  3SXH A;  2E2I B;  2D9U A;  2E5L Q;  4JI0 H;  3T1H L;  4YWL A;  3M9N B;  2Q2U A;  3KUP A;  5KFT A;  5KFI A;  3HKS A;  2C9O A;  2FJ2 A;  1XWE A;  1PLF A;  3RGZ A;  5FO8 B;  4WJ3 M;  4O42 A;  3CMA A;  3MFG A;  2KCM A;  3J81 E;  3OHA A;  1HZB A;  1TS5 A;  1VQB A;  3TIN A;  5H1S E;  3K7U C;  3PO3 G;  1DV1 A;  4DV4 Q;  1Z6H A;  2KUM A;  1LTA D;  1I94 L;  1MJC A;  1GXD C;  2B2V C;  5D14 A;  4UCT A;  3RTX A;  4DR5 L;  4HID A;  4F50 A;  1PDQ A;  4M9U A;  4A3J H;  1Y1V G;  3X3N A;  4UFZ A;  3F2B A;  5C0X J;  3FPP A;  3N8D A;  3T1Y Q;  4ZQ3 A;  1LT6 D;  2P0A A;  5KFN A;  3F2D A;  4C3J H;  4LF6 H;  1I3Q A;  3R2I A;  2A69 D;  4EVO A;  1GOZ A;  1LTR D;  3P75 A;  5EZY F;  1JR0 D;  4C5A A;  3W3A A;  3I4M H;  3S17 B;  2B63 H;  5DG7 A;  1MSH A;  2WAQ G;  4KN7 C;  3PW5 A;  1WCM H;  2UU9 L;  3JAM W;  2C2R A;  3OTO L;  2AGQ A;  1JWS D;  4DN4 M;  4BWS C;  3CC2 A;  4UY8 C;  3H91 A;  2FJZ A;  2HJW A;  1I50 B;  4BY7 B;  1NTG A;  2B2Y C;  3CRL C;  3H15 A;  2EY6 A;  4L5S A;  5F9N A;  1D8L A;  1GGO A;  4V19 0;  5COR A;  4NMZ A;  5BN5 A;  5JH7 F;  2W9C B;  4GLV B;  5C4J H;  2DLN A;  4I7H A;  2QGQ A;  3BU2 A;  2R84 A;  3HKZ A;  4DLK A;  3G4S A;  4ED1 A;  1OXU A;  2JA6 B;  4QQB X;  4X62 L;  1Z47 A;  2ES2 A;  3VR5 A;  2RDI A;  2W6O A;  3LML A;  3OSN A;  5JJZ A;  4LUV A;  5DQH A;  1CSQ A;  4ZLT F;  4OO1 G;  3QZ7 A;  2AQ2 B;  2A5H A;  2F4V H;  3TEH B;  4UDU C;  2UXD H;  3GLK A;  1PFM A;  2MCT A;  3Q8Q B;  2R7Z A;  1N48 A;  2DUD A;  3MTS A;  1PH2 A;  1M6V A;  1IBM L;  3NQI A;  4N9T A;  2L55 A;  4PZ7 A;  3DUZ A;  1TWH A;  2PI2 A;  4UCV A;  4J0M A;  3J80 i;  1LAB A;  2EYH A;  3U4V A;  5CV9 A;  2YRW A;  1KTK A;  4JI4 H;  4HIM A;  1YJN A;  2R7M A;  3N6R A;  2PMZ E;  4J6H A;  1CFM A;  3A5U A;  1OO9 B;  1VS0 A;  2JA5 A;  2HQE A;  1I6H H;  4HAE A;  2AU0 A;  5D1P A;  2K01 A;  3TZD A;  3K5M A;  5KIX A;  5JPM C;  5LMN W;  3I91 A;  3HGB A;  3TS0 A;  3RZD H;  3KLR A;  4O3S A;  5C3E H;  3HKZ G;  4A3C G;  2R7Z B;  4B3M H;  1QUQ B;  4F4Z A;  2JA9 A;  4BBS H;  5FLX L;  2KJX A;  3ETJ A;  2SNS A;  2EY1 A;  5KEE A;  2OTL A;  2NVY B;  1Y1V A;  2C2E A;  3HOY H;  3PUW A;  3GIQ A;  4J9N A;  1DOK A;  2N78 A;  3SHL A;  3PR4 A;  1IYJ B;  1CQV A;  3QJY A;  4F88 A;  1LTI D;  4RUA A;  1U0L A;  3PUV A;  1EIH A;  4EG0 A;  3S16 H;  1EOV A;  3S1Q H;  1VMP A;  2JEI A;  2JP1 A;  1N34 L;  4MV8 A;  1G6P A;  2K5H A;  4BBR B;  3PUY A;  3H20 A;  3S15 H;  1EY7 A;  2O2L D;  4IFD H;  3UE1 A;  2JA5 G;  3KF8 B;  3KHL A;  3PUX A;  2WB1 E;  3M7N A;  4IZ8 A;  1DM0 B;  1VQ7 A;  4IWX A;  3GTJ H;  4ALP A;  4A3L G;  2XCP A;  5T14 A;  3RFC A;  2RDG A;  2DY8 A;  4U7C A;  2SDF A;  2R3Z A;  4ZK9 B;  4J9M A;  2EZV A;  4OWW B;  1SJH D;  1LYL A;  2Q2I A;  3RD4 A;  2Z6K C;  1Q81 C;  5D8D A;  2K52 A;  3RAX A;  4QL5 A;  3NP8 A;  5BPH A;  3M9M B;  3G6J B;  4A3L H;  2OF1 A;  2EPB A;  4ZRZ A;  1E7Z A;  2B63 B;  2XNA C;  2B39 A;  2KQ3 A;  1H9K A;  1MD2 D;  4B3S L;  1IYU A;  2MUY A;  4IUU A;  2FB9 A;  5KFA A;  2QKI C;  4XTC S;  3SK6 A;  3VR6 A;  2YU9 B;  1D7Q A;  3R5F A;  1CSP A;  1W96 A;  2W8K A;  1V1P A;  4YWM A;  3ND9 A;  1FJG H;  1NCV A;  3E6Z X;  2PNH A;  1C9O A;  4DL7 A;  2MP1 A;  2Q2T A;  4B3M L;  2CHB D;  4EQN A;  4K6L A;  2KHI A;  5DLG A;  3MR3 A;  3M4O H;  3J7A F;  2LY7 A;  1B33 N;  1XYI A;  1L1O A;  4B3M Q;  2TMP A;  5K5P A;  2KEE A;  2KCC A;  4KMU C;  3STB D;  4IRC A;  4P71 A;  4IWY A;  2DJF C;  4L5Q A;  4QB4 A;  2RDJ A;  3LP8 A;  4EFB A;  4PMB A;  3Q2O A;  2EJG C;  2GVB A;  4B3S Q;  4YAJ B;  2PZT A;  1ESR A;  3N52 A;  3TIG A;  1BGW A;  1VQI A;  1X54 A;  5E4X A;  1CZW A;  1HNX L;  4MV7 A;  1WD1 A;  1A0I A;  1ZET A;  2RHS B;  2E8G A;  4DF7 A;  3J80 E;  2QEX A;  4JI2 H;  3FEW X;  3MWY W;  4LWC A;  1H9R A;  1Q1E A;  1D5X C;  4ECZ A;  2V5A A;  4ECX A;  4GKJ H;  5JJK A;  2X0S A;  1ET6 A;  5JVD F;  3HOU G;  2QIL A;  5EPJ A;  1K28 A;  5LHY 1;  1DYQ A;  2JEB I;  3K5L A;  3L4K A;  4MIU A;  3KLS X;  3H6M A;  2HD3 A;  1EFW A;  4P75 A;  1QNU A;  4O0A A;  4IHJ F;  4C3H B;  1D1I A;  2AUJ D;  4JK1 C;  2NUA B;  1NUC A;  1L0Y B;  4R7R A;  4XYM B;  3T4A C;  1I7N A;  2VR1 A;  2QA4 A;  1RYR A;  2UXB H;  3PVX A;  1RJT A;  4UP9 A;  4KKS A;  3OYY A;  1IXR A;  1QZH A;  1BDO A;  2JE6 I;  2N55 A;  4A3K G;  1B6S A;  4DV7 H;  2XWJ B;  1S97 A;  2R8K A;  2RA4 A;  2EY5 A;  3KF8 A;  3W1G A;  3J80 L;  4DV1 L;  3PIO A;  4A3B G;  3K3V A;  1SNO A;  2R93 H;  4P72 A;  1I94 H;  3K8A A;  2KSW A;  5LXT F;  4EYH B;  1PYW D;  3TS2 A;  2V58 A;  3G6Y A;  5CAE B;  1RK5 A;  3GO5 A;  2QYZ A;  3L2P A;  3BJY A;  1KL9 A;  4BY1 G;  4IPD A;  1B3A A;  3PCO B;  4EX5 A;  3J80 W;  3K3P A;  3RGX A;  5DNF A;  4A3G H;  4O2D A;  3I12 A;  4EYI B;  1Q12 A;  5T1I A;  5J2U F;  4DNR B;  5ELO A;  4OWT B;  1KJ9 A;  1IBM Q;  1AUX A;  5KFQ A;  4O4I F;  1QZG A;  3BS1 A;  3OWF A;  4N8X 1;  1GSH A;  4ECW A;  4X3T A;  2O5J C;  1J5E H;  2EYP A;  4XT3 B;  1STH A;  4ABN A;  3KYH C;  3NHH A;  1Q7Y C;  1I3Q B;  1EL0 A;  4PMC A;  3RIZ A;  1PK8 A;  2IPK D;  4L8J A;  2HCI A;  2IBK A;  4PZ6 A;  3HOW B;  2XGT A;  4LSA A;  3A8I E;  3RF2 A;  1TWF A;  3V6K A;  1JE5 A;  4C2M H;  3PF4 A;  1SFO H;  3A5Z B;  2PW7 A;  2WB1 G;  3URY A;  3JSN A;  3V96 A;  3ZYY X;  1SYD A;  3FKI A;  2K03 A;  3OUU A;  1GLV A;  4K2L A;  1BCP F;  4F87 A;  3NWT A;  1WCM A;  4DU9 A;  4XYO A;  2OH2 A;  1R9T B;  2UU9 Q;  4ED8 A;  1SEI A;  1WCM B;  4BBR H;  1BXR A;  1QOH A;  2WB1 B;  2K5D A;  1GSO A;  1XMO H;  4DAV A;  1R9T A;  1I3Q H;  2MQH A;  2IY5 B;  2XGP A;  1DV2 A;  3NK9 A;  1X3Q A;  1RJQ A;  3HOX H;  1JWU D;  3GTJ B;  2JEG A;  3QR8 A;  3SDZ A;  4YIJ A;  3EN2 A;  4KTA A;  2F4I A;  4EFE A;  4DR3 L;  4GOP C;  2WAC A;  4ETS A;  3HOZ B;  1NJI C;  2XIG A;  2ALZ A;  1HJP A;  1F2L A;  2EXZ A;  4FF1 A;  3E3X A;  1PVO A;  1RJP A;  1AN8 A;  3N43 B;  4FVM A;  4DR1 Q;  2QDB A;  4RZQ A;  3BDC A;  5JEA G;  1X65 A;  1YNX A;  1S5D D;  1KIX A;  2JA8 H;  2NVX B;  5DQI A;  4RB2 C;  1S0M A;  1OTC A;  5GAG C;  1XNQ Q;  4YR0 A;  2JEJ A;  2JA7 B;  2W6P A;  3I90 A;  3K80 C;  3NTK A;  5HUR A;  4IR1 A;  4RCO A;  1N34 H;  4CDE C;  2XD4 A;  4IN3 A;  2IT1 A;  1JDB B;  1VQ6 A;  3OSP A;  1HNZ H;  1ULZ A;  4IAL A;  1SRU A;  1XNR H;  4CBV A;  1FD7 D;  4C3H H;  1SFO A;  1TS2 A;  3I4N G;  2ZJP A;  1BCP B;  2D5D A;  3HB9 A;  3GDE A;  2EDG A;  3T51 B;  1VF5 C;  3T5H A;  5T1G A;  1DON A;  3BDL A;  1RTN A;  4N8F A;  3RB3 A;  1X3E A;  1E4G T;  3BA8 A;  4OIK A;  5KKN B;  2XN9 C;  4DV5 Q;  1VQ5 A;  2MO1 A;  1U4R A;  1X9N A;  1SN8 A;  1VQP A;  2F0U A;  3CKI B;  4ID6 A;  1G29 1;  3I55 A;  1WVL A;  1DXM A;  4X66 L;  2DGY A;  1CUK A;  5KNB A;  3AU7 A;  5I2Y A;  2D0O A;  4ED6 A;  4LFC Q;  3CXC A;  4HR7 A;  3H3V H;  2FMM A;  1K8O A;  2NTT A;  2R8G A;  3IL8 A;  4LH7 A;  2YRX A;  4U67 3;  2M05 A;  4ED0 A;  3QZ8 A;  1LO5 D;  2KA7 A;  3HP3 A;  1B7Y B;  2PYK A;  1H9J A;  1PTO B;  4HTH A;  3HOZ H;  4A3C H;  5FPO A;  4KLK A;  2H1E A;  3S2H B;  5KT2 A;  1WTR A;  4LF4 L;  4AYB B;  2KED A;  4Q45 A;  1KC8 C;  3ERO A;  1X32 A;  3E9H A;  4A93 G;  1S3O A;  4YCV A;  3PGZ A;  1HCZ A;  4PZ8 A;  5IT9 L;  1MHW C;  2KEN A;  4PMW A;  1ENA A;  3KFU A;  3LX0 A;  3KBG A;  2PO4 A;  4NB3 A;  4AYB G;  1EZ8 A;  1TA8 A;  4JI1 Q;  3IKJ A;  4UP7 A;  1N36 H;  5IGE A;  1XNR L;  3SGI A;  2BQ3 A;  3GTL A;  3ETH A;  4XIG S;  3TQT A;  4KKU A;  4A3B H;  2K4K A;  4XQJ A;  2R7F A;  1UC9 A;  1GD7 A;  2I87 A;  3SEB A;  2XC9 A;  4DR7 Q;  5IP9 H;  2OT2 A;  3TME A;  2HVQ A;  2NN6 H;  4X64 L;  4RNN A;  2K5N A;  4QWE A;  1I4G A;  1HR0 L;  2GPW A;  5CV5 A;  2RF4 A;  2A1A A;  4GKJ L;  2VA2 A;  5M5X B;  3GV8 B;  5DAU A;  4LFA L;  1TU2 B;  4A4I A;  1N9W A;  4O2A F;  3OSO A;  4IPH A;  1E3P A;  4HIO A;  3KTM A;  2PQE A;  5IP9 G;  4KK7 A;  3S15 B;  1TWC A;  1JOR A;  4LFB Q;  4YWK A;  1ASZ A;  3GTP B;  5HGT A;  3S14 H;  3RBD A;  2WAQ B;  4K5X A;  2HUG A;  5KGU A;  5DQG A;  1FGB D;  3N44 B;  2BE5 C;  2PI2 E;  4LF8 L;  1WTP A;  5IT9 E;  1ESF A;  5IGD A;  1QVC A;  5L37 A;  4QWC A;  3GIM A;  3G71 A;  4Y52 H;  1PTO D;  2QEJ C;  1EUC B;  2UXB L;  5EWE A;  1SYB A;  4UCU A;  1F9P A;  1TWH H;  3NBI A;  1D2B A;  2HQL A;  1PH1 A;  2VY3 A;  2V4D A;  1PFS A;  4LF7 H;  4H44 C;  1JIH A;  4RUC A;  1AH9 A;  1PRT B;  2R92 B;  1KJJ A;  5EBC A;  2W8L A;  2K5Q A;  1RHP A;  3QOL A;  3W2D A;  4IOA A;  4JV5 L;  3P7J A;  4A2B A;  3FKI G;  3BQ1 A;  4FM9 A;  4FBT A;  3H0G H;  3Q23 A;  1H95 A;  3QG1 A;  3I7F A;  5L9X A;  4GKK H;  2IX1 A;  3V4Z A;  2E2I A;  2I46 A;  4C3I B;  1LM0 A;  1WTO A;  1TWG B;  1M0W A;  2CW8 A;  2PCF B;  3EJI A;  2R92 G;  1JKJ B;  1I4R A;  3I4O A;  4J1M A;  4LF9 L;  1ZXT A;  4BXX H;  3FKI B;  2F0G A;  1XDN A;  2FLN A;  1YI2 A;  1J5E L;  4ECY A;  3VPC A;  3MFH A;  2NN6 I;  1QIL A;  2D62 A;  1E4F T;  1Z2O X;  4YR3 A;  4G4K A;  4K5W A;  1XPO A;  3DF7 A;  1E1O A;  4ZKC B;  2R7D A;  3FMC A;  1ONL A;  1GKH A;  4LF6 L;  3IG0 A;  2I5L X;  4KKT A;  1J6Q A;  4J15 A;  2EJF C;  4X65 H;  2NVX H;  3TRZ A;  5FO7 B;  4DKA C;  1EYC A;  4HCS A;  2YYZ A;  2OLS A;  3GV6 A;  2FFK B;  5KFP A;  4PDB A;  4DV7 Q;  2EXD A;  2UU9 H;  1BQQ T;  2CVR A;  1KDB A;  1MZB A;  2B2T A;  3LGJ A;  2QDL A;  4LF8 H;  4UCS A;  1EWH A;  1T3N A;  3F2C A;  2ZXR A;  3CQZ B;  5BR8 L;  2K50 A;  4RGO S;  1NNX A;  1EYD A;  4Q8E A;  1OXV A;  3FP9 A;  2A19 A;  4C56 C;  2UUA L;  5KFC A;  4JV2 A;  4FXD A;  2Z6B A;  1FGU A;  1JQY D;  1YJW A;  3I4M B;  2NU7 B;  4DUY L;  3GTJ A;  1DJR D;  1LTB D;  1PTO F;  2ZDG A;  1S5B D;  3GTG A;  2O4X A;  4R9W A;  1M1K C;  1Y8N B;  4BY1 H;  3AFP A;  1BNC A;  1Y1V B;  5A35 A;  1ZHS A;  3GTP H;  4K0K H;  2N49 A;  3UQ8 A;  5M5W H;  3RUZ A;  2ZJQ A;  4JI8 L;  1R9T H;  2R93 G;  1VQJ A;  4DR2 H;  1CKN A;  3KAK A;  4IZO A;  2Z6K A;  2ZM6 L;  2R6G A;  3AFQ A;  4ED3 A;  3H0G B;  2E2J H;  1CKN B;  4DGZ A;  5LMN H;  1Q82 C;  4IQZ A;  1SNM A;  1IBL L;  1CK1 A;  3G7L A;  2ZTC A;  2WAQ E;  5J39 A;  1L2Z A;  2F4V Q;  2UXD Q;  2F3I A;  4DV6 Q;  1E4E B;  2FPI B;  5DGA A;  3UE0 A;  4HYK A;  5COY A;  3D8G A;  1XMO Q;  4R4C A;  1TWH B;  4JYA Q;  5KT7 A;  2F0E A;  4N9P A;  1SE8 A;  4KN4 C;  3DWP A;  1RD9 D;  2FLL A;  1E2Z A;  4A3D G;  1KDC A;  3HBL A;  5DG9 A;  4XYL B;  3IAY A;  4A75 A;  4JV1 A;  2YZM A;  1FNW A;  1WFQ A;  3KLS A;  1SYE A;  5JVG 3;  4A3M H;  4O3N A;  2CWP A;  5BR8 H;  1HNX H;  1GM5 A;  4A3D B;  1DZ1 A;  4YQW A;  5M5W B;  3PN1 A;  1N32 Q;  1RDP D;  1WTX A;  4LMQ D;  4C1N I;  3J81 i;  3HOV B;  1SMY D;  1JJG A;  3C1E A;  1MKH A;  3JC6 6;  1F9S A;  2NBF A;  4H02 A;  3T5L A;  4KY5 A;  4GLX A;  1K1S A;  1K8M A;  4DUY H;  2VUM A;  3GTQ B;  1W93 A;  1Z7T A;  2P5Z X;  1NBW A;  4P74 A;  4LSX A;  1M7J A;  2B2W C;  2ZJR A;  3C3L A;  4H13 C;  1YNN D;  1S10 A;  1P8L A;  1AE2 A;  2Z0S A;  3HOU B;  3G6X A;  2ASJ A;  4JI3 H;  2K6A A;  3BG3 A;  5KT3 A;  1KC7 A;  1PRT F;  4KI0 A;  1O7L A;  2Y0S A;  3NXW A;  4GKK Q;  2UXC Q;  4X66 H;  5GQO A;  5FPR A;  1Y1V H;  3Q22 A;  1MBY A;  4XDX A;  4R8N A;  3MZ5 A;  1EQT A;  2E2J B;  1IBL H;  1CKO A;  4H0L C;  2B3G A;  2OEO A;  5FO9 B;  1O80 A;  2F03 A;  3QB3 A;  5IE8 A;  1L2F A;  2BDN A;  4A3K H;  1XNQ H;  4A3K B;  4DAY B;  3K59 A;  4A3F H;  3D4D A;  3OMC A;  1DOL A;  1CQF A;  5ELN A;  1PTO H;  4DK1 A;  1C4Q A;  4LH6 A;  1FNV A;  4QUF A;  5E1F A;  2KHS A;  1KAA A;  3EVQ A;  4L63 B;  5CYU A;  4CJ2 C;  2LSS A;  4O1N A;  5CBA E;  1C0A A;  4IUN A;  5FLM G;  2BH8 A;  4OL7 A;  4Q43 A;  3J81 j;  1QVG A;  1J8I A;  2R7K A;  4YP3 A;  2UXC L;  2J6T A;  2J0T D;  4RAY A;  2V1C C;  4ODG A;  5IYD H;  1SEB D;  1Z9F A;  1SYF A;  2NVY H;  5IP7 G;  1STN A;  3HZX A;  4MNO A;  4WFN 3;  4QJF A;  1PH8 A;  2CW7 A;  5C44 G;  4DV5 H;  4F4X A;  5IYB G;  3DHQ A;  2VOB A;  4DAP A;  2R61 A;  3SE7 A;  3L7Z C;  2WP8 J;  4G7H C;  4QIW E;  5KFU A;  2EY2 A;  2BA0 A;  2HDM A;  1O75 A;  5KFL A;  3KAJ A;  4DL2 A;  1VBH A;  2QW7 A;  4Y7N H;  2IX3 A;  4RB1 A;  3KHR A;  4J9L A;  5C5M A;  1BVS A;  5HV6 A;  1YZ6 A;  2JEA I;  1ZKO A;  3GQB A;  5KT6 A;  3MWM A;  1HXY D;  3R5H A;  4IRK A;  2OQ0 A;  1BNZ A;  2L9H A;  1E0B A;  1SE2 A;  4ZQI A;  1PH9 A;  2G5D A;  3RB0 A;  1K8G A;  1K0R A;  1VQK A;  5I6W A;  2LXJ A;  5DEH A;  1A2T A;  2IL8 A;  2ICI A;  4A3F G;  1AFP A;  2HVS A;  2A8V A;  3K7A H;  1CQJ B;  1BBU A;  2KHJ A;  4WJW A;  4JC0 A;  4CDD C;  4YCW A;  4A3J B;  5C0X G;  1B9M A;  3EPI A;  2B29 A;  2RCN A;  3E0E A;  1XMO L;  2JA8 B;  3GTK A;  1GYF A;  3WNZ A;  2R86 A;  4A93 H;  3CCE A;  1K73 C;  2VPS A;  4DV6 L;  1KQS A;  5EPK A;  2ASB A;  4JUZ A;  5IYD G;  4DV2 Q;  4CJ1 B;  4DK3 C;  4J9R A;  1IBL Q;  3GTQ H;  2F52 A;  3ERS X;  1JOK A;  3S1N B;  4Q8F A;  3DWA A;  2ZM6 Q;  1K1Q A;  1G51 A;  4AH6 A;  4MTE A;  3T56 B;  2F0I A;  1A15 A;  4DR3 H;  4JI8 Q;  3OW7 A;  5TSS A;  1L0X B;  1HH2 P;  4ZUI A;  4A3M B;  5BPF A;  5HY6 A;  1A63 A;  4RB3 C;  2R8H A;  3S1R B;  3PW4 A;  3I72 A;  2F0T A;  1EYA A;  5KFG A;  1LT5 D;  2ZXP A;  1K0S A;  4DL6 A;  1K3B C;  1A8V A;  2B2U C;  4R8U A;  4IPG A;  1C8C A;  3ITP A;  1VQ9 A;  4DUY Q;  3S14 B;  3GTM H;  4EEQ A;  5F2D A;  3MHB A;  2F0P A;  4M8A A;  5LYJ F;  1MJE A;  2ATW A;  2N8N A;  5FKA C;  4IUV A;  2UUA Q;  1KJI A;  1PH4 A;  1V8Q A;  2HHH Q;  1GHK A;  1XJV A;  5GON F;  2NN6 G;  2BDO A;  3F8T A;  2JA7 G;  4RH6 A;  3CHB D;  4J9K A;  1PZJ D;  1R4Q B;  3T16 A;  4C2M B;  2W6Q A;  4UCR A;  4ME5 A;  3PO2 H;  3Q24 A;  3PSI A;  4EGQ A;  4DV0 Q;  5KRU A;  3PQI A;  3J81 W;  4YAK B;  4RGM A;  2F0N A;  3CPF A;  3U9S A;  2I8C A;  5KFF A;  2JA6 A;  4LF6 Q;  1G2T A;  1ML0 D;  5EKI A;  2F0W A;  3IFT A;  2VZA A;  4C1N K;  4JI7 Q;  1X55 A;  3C1F A;  4HJ8 A;  2NVT B;  5JUM A;  1IBK L;  3DM1 A;  2XWB B;  1PH6 A;  3FKI H;  2SNM A;  3K6O A;  5IP7 H;  2MPM A;  4JCV E;  2VB3 X;  3QIA A;  2ZTE A;  1I6V C;  2E2H B;  4WOR A;  3MXN A;  3K5I A;  1GUW A;  2A73 B;  2G9D A;  3WWV A;  4DL3 A;  1Q1B A;  4ZI7 F;  1GJX A;  2UUC Q;  3VDY A;  1XPU A;  5LMN L;  4LUZ A;  1IHZ A;  4IJH A;  4K0K L;  4DV4 H;  3OPO A;  1UAP A;  1NSN S;  3J7A V;  3MR5 A;  3BG5 A;  3V6H A;  4JI8 H;  2VUM G;  4YHH H;  3I4L A;  1CZG A;  1K83 B;  1TWA B;  4A3E H;  5C3E G;  4JV5 Q;  4O4L F;  2CKZ B;  1BCP D;  4K8J A;  1X6O A;  1CA6 A;  5KFD A;  3WDN A;  1HA6 A;  5KFX A;  3WO0 A;  3G8C A;  4IFD I;  3IN5 A;  4CKE A;  4A2A A;  4G7O C;  3AEV A;  4A76 A;  1HUM A;  3SI8 A;  2WFW A;  1SE3 A;  5C3E B;  2PMZ B;  2VW9 A;  5D1O A;  2UXB Q;  3RN2 A;  2W6Z A;  2NUC A;  2Y0S E;  1D5Z C;  4C3J B;  5C5L A;  5GAD C;  4EGJ A;  2YS7 A;  3U58 A;  5J2T F;  5FD5 A;  1JX4 A;  1YVC A;  4OX9 L;  1BXT A;  3N42 B;  4WBN F;  3Q6S A;  3NEL A;  3BZK A;  1HNZ L;  2FHT A;  2UUB H;  3M4P A;  2ALY B;  3ONA B;  3H94 A;  1HQM C;  4EQO A;  3KBX A;  4X64 H;  1Q8K A;  4TVA B;  1HR0 Q;  1ZHQ A;  1V4Y A;  4X64 Q;  1PH7 A;  3D4R A;  2XGQ A;  4EBE A;  1PV4 A;  1HR0 W;  4EBC A;  2DPJ A;  4DR7 L;  1PRT C;  4XT1 B;  3R8B A;  4MV9 A;  3CF5 A;  5IYC G;  2PBZ A;  4NXN H;  3MWE A;  3GTL H;  3KXY T;  4NKL A;  5FJ8 G;  3M4I A;  1W2B A;  2FMC A;  1XMQ H;  3FPU B;  1Y1W H;  2PQA A;  1TY2 A;  4DR4 Q;  1X3F A;  2BH2 A;  3HOU H;  4IUT A;  4AQY Q;  2UVU A;  1SCU B;  3I70 A;  5E7N A;  1YHB A;  3CQZ A;  5HBR B;  1IOV A;  2EYJ A;  2L0C A;  3MJF A;  4H7B A;  2IWH A;  5G3L D;  4DAY A;  3V6J A;  1QWY A;  4RWS C;  3JAM c;  4Q44 A;  3A0J A;  3BZC A;  2PW5 A;  4KJN A;  2I80 A;  1SYX B;  3ND8 A;  3F2U A;  2RGR A;  4LF4 Q;  5EKL A;  1N33 L;  4B08 A;  2Q2H A;  2JN4 A;  1UE6 A;  1HA5 A;  1XTC D;  2A6E D;  2LXK A;  2SEB D;  3BVG A;  3S1Q B;  3OIP A;  2PQA B;  2CH4 A;  5J22 A;  5CV4 A;  2AQ4 A;  4ZKB B;  4QCL A;  1C30 A;  2WYO A;  4FU0 A;  2WTF A;  4KHP L;  4C5C A;  4IRD A;  1WSC A;  1E24 A;  1WI5 A;  1RF2 D;  2Z1C A;  1Y1W B;  3OUZ A;  4LFC L;  3NPP A;  5EKK A;  1IZ6 A;  4RGN A;  2W6N A;  2F0H A;  4DL4 A;  4RU9 A;  4X66 Q;  2B8G A;  4K5V A;  4XYQ A;  2R7Z H;  3RBE A;  3C0F B;  2VQE Q;  2MJ8 A;  4DV5 L;  2ZTD A;  5KNC A;  2YS6 A;  2O03 A;  3B6Y A;  5EBD A;  1LTT D;  5DGB A;  3RB4 A;  1V1Q A;  3NEN A;  5LOV F;  2D2C C;  2N3S A;  4NXN L;  3A7L A;  3CW2 C;  2K75 A;  2VUG A;  1K8A C;  1KAW A;  4RFB A;  4I65 A;  4JI2 Q;  3KDF A;  3IFD A;  3VYR A;  1LTS D;  2C35 B;  4GN3 B;  3RLO A;  3JAM E;  1HRJ A;  2DWC A;  1HZ9 A;  2F0J A;  4XQQ A;  1FVI A;  4BA2 I;  1EUD B;  4DUZ H;  1I6U A;  4Y7N B;  4GC7 A;  4ECQ A;  4J9O A;  3K0X A;  4MV6 A;  2K1B A;  1WTV A;  1GUG A;  3PO3 B;  4CGY B;  1WD0 A;  3R2T A;  4ILW A;  3U9T A;  1EY6 A;  1SNQ A;  5M3M G;  3PIP 3;  5FLX W;  2L12 A;  1HZC A;  2F3W A;  3KF6 A;  3K5N A;  1E2V A;  1XNQ L;  4OHJ A;  5KG5 A;  4RA8 A;  1AN7 A;  4BBS B;  1STB A;  2L15 A;  4PV1 C;  2OWO A;  2RVL A;  5KG3 A;  2QCP X;  4ZHQ F;  4ECU A;  3DWQ A;  4DR1 L;  1EY8 A;  1B70 B;  4HNU A;  3E5S A;  1O7I A;  4LF7 L;  1Y8O B;  2L5T A;  1I7L A;  1KNE A;  2A6H D;  1I6H B;  5IWA Q;  3ULP A;  3GIJ A;  4BBS G;  1M4V A;  1Q90 A;  2BQR A;  2NB0 A;  4LMY A;  4DR3 Q;  4B9X A;  1CS0 A;  4UPA A;  4O3P A;  2F0M A;  1H9S B;  2E2H H;  1B04 A;  4DR5 H;  4O2B F;  1IW7 C;  3PO3 H;  4IUP A;  1QG7 A;  2FPP B;  2EYL A;  4Q0Y A;  3PW0 A;  3UFX B;  4Q5V A;  2PN1 A;  3K58 A;  5LL6 S;  4DV0 H;  5DLF A;  1LUZ A;  2F0Q A;  1UNN C;  4CC6 A;  3S1M H;  1I50 A;  4B3T Q;  2HGS A;  2C2D A;  2RGV A;  4RHR A;  1HNW Q;  3A8K E;  1VQG A;  1VQM A;  4BS9 A;  1FKA H;  3CCM A;  5J1Z A;  3QOJ A;  1EEF D;  4X65 L;  2YU9 H;  1DGS A;  4QWB A;  1MSG A;  3DEO A;  2YZG A;  3PW2 A;  2VNU D;  2A69 C;  4K14 A;  5CGK A;  5M5Y H;  4X62 H;  3RUP A;  3UI2 A;  4B3T H;  2NTS A;  1S72 A;  3LNN A;  4YY3 Q;  3JSL A;  4C2M A;  2C28 A;  1RYS A;  4BY7 G;  3UDX A;  4HCE A;  3H0G A;  2A6E C;  2CW0 C;  1YIT A;  1VAJ A;  3EA6 A;  3S17 H;  2IX0 A;  1UE5 A;  2EE1 A;  1RJR A;  4JI6 H;  5ELE A;  3OWE B;  5I9P A;  1VKZ A;  4YCU A;  2I07 B;  4KY6 A;  3H4D A;  1HZA A;  3P20 A;  4FXG C;  2QF7 A;  4TV8 F;  3H4B A;  3RLN A;  2F0V A;  3UDG A;  4A3G B;  5KFJ A;  5A2Q W;  4ZUJ A;  3CCQ A;  1BJT A;  4OO1 I;  1Z2N X;  1BBW A;  1I4Q A;  1C7Y A;  3GTL B;  4HMI A;  1T9H A;  2R8J A;  5DM6 3;  4YJ2 F;  3VPB A;  3D6W A;  1KJ8 A;  5IT9 W;  1EIG A;  1QE6 A;  4FO2 A;  1H9M A;  2ATL A;  4HMJ A;  1QUQ A;  5FD6 A;  2BE5 D;  3GTG B;  1SYC A;  3NE5 B;  2W57 A;  4DA2 A;  1KBL A;  2Z9H A;  5KFO A;  5E4W C;  2A74 C;  2R93 A;  2FK1 A;  4XQN A;  2YL2 A;  3SVM A;  3CCS A;  1UEB A;  3M7G A;  3TSS A;  4DV1 Q;  4I55 F;  4R8I A;  3CPW A;  2K32 A;  1ROD A;  3M9B A;  4LUO A;  4G7Z C;  2YTV A;  4A3E B;  1GO3 E;  5KFW A;  3ER0 A;  1Y14 B;  4OIJ A;  5DG8 A;  2VL6 A;  3T53 B;  2UXC H;  2DJG C;  3TP8 A;  4DR4 H;  3N40 P;  3MR2 A;  3I4M G;  1B9N A;  1XMQ Q;  4HR7 B;  3HFZ B;  5D3I B;  4FNF A;  4DUZ Q;  4TUY F;  3GV7 B;  1ASY A;  1TR5 A;  1HUN A;  1WJJ A;  4FS1 A;  4LF5 L;  1RTO A;  2X6G A;  2IMW P;  3RMH A;  1UWV A;  1B44 D;  1B4O A;  3Q1K A;  5CV8 A;  1P16 A;  4QGU A;  4JI6 L;  4MN3 A;  1AE3 A;  5K2M A;  1YHQ A;  4IFD J;  1L0W A;  1S5F D;  2CW0 D;  1IBK H;  2ASD A;  3TN2 A;  3U50 C;  3A7A B;  4NXM L;  5C4X G;  3EYY A;  4JBM A;  3G48 A;  3HOY B;  4K8I A;  5ELB A;  2AQ1 B;  5H80 A;  4OEM B;  3VA5 A;  4DR7 H;  3SK4 A;  2H5X A;  4FBU A;  4AIM A;  1HNX Q;  2K7V A;  3KOJ A;  3S1M B;  1CHQ D;  4RAU C;  5LMU H;  3T5K A;  1JMC A;  2VUM H;  3J7Y W;  5C4Z A;  1VQE A;  1SDF A;  3BYT B;  3JZI A;  5L1J A;  3J81 L;  3V2T A;  4AYB A;  3LWB A;  4GN4 B;  1LT3 D;  4A3F B;  5FLX c;  4GNX C;  5EDW A;  4J9Q A;  3M4O B;  1FJG Q;  1B6R A;  5CA0 F;  2W70 A;  1GUN A;  1IKL A;  1FJG L;  2VXW A;  1GHJ A;  3EQL C;  2JA6 H;  5GAH C;  1G6Z A;  4A3J G;  1DOM A;  1BKB A;  2PVP A;  2Y0S B;  2HT1 A;  1STG A;  5M3F H;  5CR3 A;  4OX9 H;  4V0B A;  3WOE A;  1M90 C;  2Z8L A;  2CZG A;  1T5X D;  4IAJ A;  3H3V I;  5EGT A;  1W3S A;  2OCE A;  2XTI A;  1ZQ7 A;  2WAQ A;  1S4Z A;  1Q46 A;  4NPS A;  1A3T A;  2Y0S G;  3SK8 A;  3IRB A;  1AZP A;  1WTQ A;  1TS4 A;  5CV7 A;  1RK6 A;  4A3I H;  4LF5 H;  3E0J A;  4NXM Q;  4E6I A;  1O78 A;  5C5J A;  1CI3 M;  4I7Z C;  3GTM B;  1JDE A;  2W71 A;  3BVM A;  1SNC A;  4GS3 A;  2LMC B;  4C3H G;  4DAM A;  1DD2 A;  5F9L A;  1PFN A;  2PZW A;  2OXP A;  4JI6 Q;  5E3F A;  4JPB W;  4HJ7 A;  4UCO A;  4LF5 Q;  3HOW H;  3OHX C;  1JOO A;  1S5C D;  3HG9 A;  3OTO H;  3VYS A;  4DUZ L;  1GUS A;  3NGD A;  1Y1W A;  5J3B A;  1XMQ L;  5HGQ A;  5C0X I;  2AGO A;  4KD3 A;  2VQF H;  1N34 Q;  1D1K A;  2GLT A;  1FNU A;  4CDC C;  4MV1 A;  4MTN A;  2AQ3 B;  3FRP B;  3S1N H;  1YNJ D;  3MXU A;  1KRS A;  1ICW A;  1Q3L A;  4LW1 A;  4R4T A;  2R92 H;  5GRO A;  5KYI A;  4FXK C;  3RAQ A;  3BDO A;  3Q8D A;  1CT1 D;  4DXF A;  2B2W A;  4DXG A;  4EQP A;  2MO0 A;  2CWA A;  1W6K A;  4UP8 A;  4LF4 H;  1KLG D;  2L4N A;  3BVZ A;  2YTX A;  4HJ9 A;  1CTM A;  2K5W A;  1KXL A;  1PHJ A;  2E2I H;  3KAL A;  3Q0A A;  4R4I A;  1B2T A;  2YYA A;  4HNV A;  4FYD A;  4EQ5 A;  4XX0 B;  2DZD A;  2V59 A;  2DNC A;  2J6S A;  1A2U A;  3TDQ A;  5JEA J;  5C44 B;  1YHA A;  4A3B B;  5FK9 C;  2XRS D;  4APV A;  1OXX K;  4JOI C;  3ORQ A;  3K81 C;  1S03 G;  3MXP A;  1SNP A;  3HKZ E;  5A2Q E;  2MGS A;  1K3R A;  4J9S A;  4JI7 H;  5EQ0 A;  4BY1 B;  2YTY A;  2W9C A;  2CH4 W;  2HVR A;  4NW2 A;  1JJC B;  4JBW A;  2FK2 A;  3RZO B;  1GUT A;  4CDF C;  1O7Y A;  2VUM B;  3DEP A;  5LL6 X;  5ELF A;  2QK4 A;  1M0T A;  4LFA H;  2GVA A;  3BJU A;  1O7Z A;  4F7X A;  4X62 Q;  2AMC B;  2NYZ D;  4HJA A;  5ISR A;  4YY3 L;  1R4P B;  1NE3 A;  3QWN A;  2A6H C;  3OMG A;  3NBH B;  5L1I A;  3JAM L;  1EU4 A;  4ECR A;  2NU9 B;  4X65 Q;  1GUO A;  3V4S A;  4L5T A;  4M7E A;  2NU8 B;  5IGF A;  2K5V A;  4C3J G;  1SJE D;  1VCI A;  3UDF A;  1HNW L;  2EYO A;  3OTO Q;  2K05 A;  2WII B;  4RHS A;  3CVZ A;  4BXX G;  4B3T L;  4JYA H;  1T5E A;  5KT4 A;  4Q0F A;  2XVS A;  4ECV A;  1D5M C;  2EJM A;  1M8A A;  4OWX B;  3M3Y B;  1KDA A;  5ELD A;  2NWG A;  3EFX D;  4AYB E;  2A68 C;  1LAC A;  1QB5 D;  1VDZ A;  5IYB H;  1EWC A;  4DL5 A;  4JV5 H;  5C6A A;  1WCM G;  3T1Y L;  4JW0 A;  1EFI D;  5IGG A;  3RV3 A;  4P2C B;  3CAM A;  5CMD A;  2ICE C;  4TSS A;  1TXY A;  3DLL A;  3CCV A;  3R3O A;  2M9V A;  2E2H A;  5LA6 F;  2R92 A;  4DR5 Q;  4A3I G;  3PW7 A;  4RAZ A;  4CC5 A;  3CD6 A;  1BR9 A;  5IWA L;  5C44 H;  1SMX A;  1WOC A;  2LFN A;  3ULJ A;  4LF7 Q;  4C5B A;  1VQ8 A;  1I94 Q;  5JJI A;  4HQ6 A;  1UC8 A;  3BQ0 A;  4DV4 L;  1LLR D;  3G6E A;  1K83 H;  1TWA H;  1J9O A;  5C8Y F;  1VQF A;  3ULL A;  4QY7 A;  4RKL A;  3C2P A;  4RKB A;  4WJ4 A;  5IYC H;  4IUR A;  4RNM A;  1NR4 A;  4GNX B;  3J7A 5;  1F2M A;  3GII A;  4IUQ A;  3T1H Q;  3GTG H;  4UHV A;  4TV9 F;  5K36 H;  4YY3 H;  4ECS A;  5KYL A;  3I4N B;  1A6X A;  2E5L L;  4CKC A;  2JA7 A;  2ID0 A;  2IA6 A;  1UEA B;  2F0K A;  4DR6 L;  3Q8P B;  4FF2 A;  2AUK A;  2EOT A;  3VR2 A;  3A74 A;  4AQY H;  3D0F A;  1GVP A;  2NZ1 D;  3Q8S B;  2B2U A;  3PV0 A;  4JI2 L;  1TWF B;  1VF7 A;  3ORR A;  4ZYS A;  2R87 A;  1VQL A;  3PIP A;  2UVV A;  2PPB C;  2W6M A;  4NXN Q;  4QF4 A;  4KHZ A;  3KJP A;  3K5H A;  3EBE A;  3FMA A;  4DV3 H;  1ICF B;  4R8U B;  4RNO A;  2W7P A;  3FDS A;  2NZO A;  2E74 C;  2OQK A;  2B2Y A;  1B1Z A;  1OXS C;  2F0L A;  5I9O A;  4RZR A;  2R8I A;  2VQE L;  3I4N H;  2NVQ H;  4QIW A;  3BAB A;  5CBE E;  5JAV A;  2F0F A;  3MXG A;  1N8R C;  1IYV A;  1N32 H;  4JI5 H;  1IOW A;  1A3U A;  4KHV A;  1YJ9 A;  2I0Q A;  4L6T B;  3MAQ A;  1JWM D;  5I6Y A;  4KHP Q;  2TSS A;  1PYS B;  2E2D C;  5IT9 c;  3GIK A;  4CJ0 B;  3U4Z A;  3CC4 A;  1N56 A;  4O3R A;  1CKM A;  1NMG A;  3BZD B;  4OEL B;  2BR0 A;  3I3C A;  4DV1 H;  2E75 C;  2JQO A;  3GTO A;  1N33 Q;  3GV3 A;  2Z4I A;  3S2H H;  3S9W A;  2WKC A;  2C00 A;  3LWU A;  3SK5 A;  1U4P A;  2DY7 A;  1PYB A;  2V4Q A;  2EIF A;  1Y8P B;  4L5R C;  2YCH A;  3RB6 A;  5M3F G;  3KHG A;  4B9W A;  3CRK C;  5KG6 A;  4LNQ A;  1KJQ A;  4FF4 A;  2K33 A;  3CQZ H;  1L1O B;  1N33 H;  2SCU B;  2WDT A;  2LS0 1;  4HN7 A;  2AGP A;  4DR6 H;  1PZI D;  1HPC A;  1X3G A;  4AQY L;  1JJ2 A;  4DR4 L;  3CCU A;  4C3I H;  4A93 B;  3R5X A;  3GTP A;  3SR1 A;  1N36 L;  1TWA A;  1K83 A;  1BBX C;  2KCN A;  1K9M C;  3HXL A;  1E1T A;  4DPG A;  2ENB A;  1LTG D;  2AWN A;  5BMV F;  1WH2 A;  1DIK A;  3PZP A;  1SAP A;  1SYG A;  4JBJ A;  1PXU A;  5IOD A;  1EOT A;  2ZDQ A;  4O3Q A;  3NBH A;  5JPN C;  3S24 A;  3KDF B;  1U4M A;  4F8M A;  2SOB A;  3VMM A;  3A55 A;  1HNZ Q;  5C4X H;  4X3K A;  3G6V A;  4OX9 Q;  3EIV A;  4JI3 L;  3VYT A;  3U9O A;  3H09 A;  2RKS A;  2L1B A;  3NUC A;  3GV5 B;  1VQO A;  2RDH A;  1KAB A;  1EZ1 A;  2G9H D;  2WIN B;  3TP5 A;  1VQA A;  1SBB B;  3OOC A;  1F9R A;  4PG3 A;  2K28 A;  2CFM A;  1AW7 A;  5KT5 A;  1SMY C;  2HCC A;  1UUP A;  4MAM A;  3GTK B;  3X3M A;  3DMU A;  1MGS A;  4NP5 A;  4ED2 A;  1E22 A;  1G2S A;  1TKW B;  1VMC A;  2JA6 G;  4PWQ A;  5JVL A;  4MA5 A;  5NUC A;  3GD7 A;  5KFS A;  1TQO A;  4C3I G;  4ZOL F;  3FVQ A;  4Z9C B;  2FP4 B;  1NAP A;  3NTH A;  4MTD A;  5AFW A;  3F1Z A;  1EQR A;  1TWG A;  1WYD A;  5IIF A;  5LMN Q;  4K0K Q;  2UVW A;  2J4X A;  2UUC L;  3R23 A;  1TS3 A;  5IOC A;  3MA2 B;  1EQV A;  1X56 A;  3ERQ A;  2FLP A;  4TRD A;  4UAI A;  3TII A;  3TBI B;  5KND A;  5FOB B;  1QJO A;  1XTD A;  3MEF A;  5FJ8 H;  1IBK Q;  2NVY A;  2E76 C;  2RCF A;  3L3O C;  2BA1 A;  3CME A;  1BF4 A;  4LF9 H;  2CQY A;  4JI7 L;  5IGC A;  1B8A A;  1PFB A;  2MFI A;  4BWG B;  3K57 A;  1HFN A;  3BQ2 A;  4RB0 A;  3RR5 A;  2FPG B;  4DV3 Q;  3RNU A;  3S2D H;  4NLG A;  3OW2 A;  3PR5 B;  2O5I C;  1I5F A;  4EBD A;  4DV0 L;  1XX8 A;  2VQD A;  1EWI A;  1A3V A;  1NR2 A;  2NVQ B;  2KBN A;  5EJW A;  2YZN A;  5M5Y B;  1SXT A;  3ICE A;  1EY0 A;  2BCO A;  5M3M B;  4DNT B;  3D3R A;  3RLF A;  2XSC A;  1CM9 A;  4LFB H;  1CHP D;  1ET9 A;  2HHH L;  3NQT A;  3HOV H;  1SSO A;  4GC6 A;  3T5J A;  3T13 A;  5K36 G;  1JE4 A;  3R93 A;  5BN3 A;  4IPC A;  5AJ3 L;  1TAE A;  2UUA H;  3NWS A;  2EQS A;  1YBY A;  3T1Y H;  4I4T F;  3ZJY C;  3JRW A;  3C46 A;  1I4X A;  4KD4 A;  1G8Z D;  1JCK B;  3NSW A;  4JI4 L;  4JV0 A;  3MFI A;  1EZ6 A;  4TKO B;  4PNY A;  2AWO A;  4R4O A;  3L9A X;  2W9A A;  2AKW B;  3EPG A;  5C4X B;  4U6P A;  3HOY G;  3OIQ A;  3FHW A;  4YJ3 F;  4OON A;  4F4W A;  2GPS A;  4MTK A;  5KFK A;  1S68 A;  1EUJ A;  1SND A;  5KFH A;  3TQ1 A;  3GQC A;  1CE8 A;  3CCJ A;  4DR2 L;  2FMA A;  1RCV D;  2RSN A;  3AB9 A;  1X3P A;  4DK0 A;  2D0P A;  2ZM6 H;  3W5O A;  4DV2 L;  4B3R L;  2JYO A;  1KD1 C;  2R93 B;  4E4T A;  2DN8 A;  3M9O B;  1EY5 A;  2GA4 B;  4QUC A;  2ASL A;  1PH3 A;  2HIX A;  1U4L A;  1UE7 A;  5L1L A;  3J7Z C;  3J80 c;  3H0G G;  1ZYR C;  1SR3 A;  1AP0 A;  1G91 A;  3GTK H;  4POG A;  3MXN B;  4QWD A;  5C1P A;  1OWT A;  2X69 A;  1ZEQ X;  3HOV G;  3QFF A;  3E9I A;  3MFY A;  4JG2 A;  4EEY A;  2F3V A;  4L1K A;  4QWA A;  5KFB A;  4IFD G;  3BAA A;  2IHE A;  3NEM A;  3QO2 A;  2ZDH A;  1ILQ A;  3RN5 A;  2UVR A;  3STB C;  2LKV A;  5CV6 A;  1QNK A;  5KX5 F;  3TRE A;  1EQQ A;  4GZY C;  5IGB A;  2EVB A;  3CCR A;  1UNS A;  2B8F A;  4OO1 H;  2FXQ A;  5FLX E;  5IY0 A;  2JA7 H;  1STE A;  2KCT A;  2W9B B;  4FP5 D;  5I4D A;  4GNX A;  1T94 A;  2VQE H;  3BYY B;  1XPR A;  2PMZ A;  5D1O B;  5KFM A;  3M85 A;  1HTL D;  2YV5 A;  4QMG A;  3PO2 G;  4A3G G;  1A9X A;  2CQO A;  2JSO A;  5D65 A;  5JOB A;  1IBM H;  4FS2 A;  1TT2 A;  2FKL A;  2UUB Q;  2W7O A;  2KOL A;  1XXG A;  4JI1 H;  5KFV A;  4X3U A;  1EHI A;  4B3S H;  3AQQ A;  5EPL A;  4HJ5 A;  4NXM H;  1TWC H;  3TP6 A;  2VQF L;  3PO2 B;  1B3Q A;  3F8N A;  4JI5 L;  1U5K A;  1KHI A;  2RDF A;  4R1J A;  1ZYR D;  1PX2 A;  4YHH L;  3A56 A;  3GIL A;  4ED7 A;  3HKZ B;  5LMU L;  2R7Z G;  2K14 A;  3HOX B;  3SE0 A;  2CCZ A;  1YEZ A;  4JI0 L;  1I50 H;  3S1R H;  5L1K A;  3T1H H;  2IP4 A;  4LK1 C;  5EAY A;  4Y8V B;  2M2L A;  4U68 A;  3HEJ A;  2N88 A;  3AYH B;  4QIW B;  3D31 A;  4A3E G;  1C3O A;  3HOX G;  4JI0 Q;  2E5L H;  5I47 A;  1WTW A;  1FL0 A;  5LMU Q;  4HIK A;  1Q86 C;  4APM A;  4YHH Q;  5KG1 A;  4BBR G;  1CA5 A;  5C1O A;  5KG2 A;  2YW2 A;  2VPQ A;  1QCB D;  1Q8I A;  4JI5 Q;  3A54 A;  5KFY A;  1I4H A;  1TWC B;  4GKK L;  2XCA A;  4PQX A;  5C4H A;  2VQF Q;  2JA5 B;  1TII D;  2Q8R E;  4IOC A;  2J6U A;  3TQY A;  2UUB L;  1W6J A;  2F0D A;  3LWE A;  5DM7 3;  4P73 A;  5M3M H;  2VB2 X;  1ILP A;  4MV4 A;  3NTI A;  4GOP A;  1EIY B;  4TQS A;  1SFO B;  2NVX A;  4WD3 A;  1OXT A;  4HNT A;  1L1O C;  3PUZ A;  2PZU A;  4BA1 I;  4HSP A;  2B63 G;  4M1U B;  3I8Z A;  1S40 A;  2R6F A;  2XCL A;  5GAE C;  2R85 A;  1N32 L;  2F0O A;  5KFR A;  1T36 A;  3S2D B;  3PF5 A;  2WKD A;  4IR9 A;  4XZ3 B;  3RV4 A;  1JOQ A;  3HOW G;  1B53 A;  1NMF A;  2JA8 G;  2WB1 A;  4ME6 A;  2I5M X;  3PIO 3;  3KJO A;  1HNW H;  4OXP A;  4R4Q A;  4JYA L;  2V4R A;  4DV6 H;  5ELC A;  4ZCK A;  1Y69 U;  1YNN C;  4GLA C;  2XRQ D;  2JXM B;  2KEC A;  2F4V L;  2UXD L;  4B3R Q;  3MEH A;  3KLW A;  1AZQ A;  3WO1 A;  5G3L F;  4HED A;  3MR6 A;  4DR2 Q;  1JC7 A;  4MZ9 A; 
#chains in the Genus database with same CATH homology
 1MIU A;  4IPD A;  3PCO B;  4ME3 A;  5JEA J;  4EX5 A;  1YHA A;  2ZM6 Q;  1G51 A;  4AH6 A;  4APV A;  1OXX K;  4JOI C;  1VQN A;  3K81 C;  4JI8 Q;  3JAM i;  3CC7 A;  4A3G H;  2AHO B;  4O2D A;  1Q12 A;  3HKZ E;  5ELO A;  1K3R A;  4OWT B;  1VQH A;  1HH2 P;  2NZH A;  2YTY A;  3KF6 B;  5HY6 A;  1A63 A;  4JI4 Q;  1IBM Q;  3RZO H;  2NVT H;  3HOZ G;  2JJQ A;  2MNA A;  1QZG A;  1JJC B;  1A8V A;  4JBW A;  3M3Y H;  4IPG A;  4DNI A;  1VQ9 A;  4DUY Q;  3GTM H;  1Q7Y C;  3KYH C;  1NY4 A;  5AJ3 Q;  2VS1 A;  1MJE A;  2GVA A;  3BJU A;  4TQU S;  4A3M G;  2ATW A;  2N8N A;  4PZ6 A;  4RG1 A;  2AMC B;  4X62 Q;  2XGT A;  2UUA Q;  1PH4 A;  4HJA A;  2HHH Q;  4YY3 L;  1XJV A;  1NE3 A;  5BR8 Q;  2NN6 G;  1JE5 A;  3F8T A;  2JA7 G;  4C2M H;  3PF4 A;  1SFO H;  3I2Z A;  3A5Z B;  3NBH B;  2WB1 G;  4X65 Q;  1EIF A;  4L5T A;  4DV7 L;  3J81 c;  3PO2 H;  3PSI A;  2K5V A;  1HNW L;  1VCI A;  3UDF A;  3OTO Q;  1IL2 A;  4DV0 Q;  2UU9 Q;  4BXX G;  4B3T L;  3CPF A;  3CP0 A;  4BBR H;  2JA5 H;  4DV3 L;  4LF6 Q;  1I3Q H;  4GN5 A;  2VZA A;  2MQH A;  2RHQ B;  4OWX B;  2IY5 B;  4AYB E;  4JI7 Q;  1X55 A;  4HJ8 A;  3HOX H;  5IYB H;  1IBK L;  1PH6 A;  1JT8 A;  1QVF A;  3FKI H;  1J5E Q;  1RL2 A;  5IP7 H;  4JCV E;  1WCM G;  3T1Y L;  2ZTE A;  1VQD A;  1PA6 A;  3EN2 A;  5DLQ E;  4LF9 Q;  1KRT A;  3CAM A;  3WWV A;  1Q1B A;  1TXY A;  3DLL A;  1TWF H;  1TWG H;  3CCV A;  4DR3 L;  2UUC Q;  4GOP C;  3VDY A;  4DR5 Q;  5LMN L;  4LUZ A;  4IJH A;  4A3I G;  1NJI C;  1XPU A;  3CD6 A;  4K0K L;  5IWA L;  1HJP A;  5C44 H;  1SMX A;  1WOC A;  3ULJ A;  2VUM G;  4LF7 Q;  4A3E H;  1VQ8 A;  4DK6 C;  5C3E G;  1I94 Q;  4JV5 Q;  2CKZ B;  1PVO A;  5JJI A;  4DV4 L;  4FDB A;  4DR1 Q;  1UE1 A;  1V43 A;  3G6E A;  1K83 H;  1TWA H;  1X6O A;  1VQF A;  5JEA G;  3ULL A;  4QY7 A;  5FLM H;  1X65 A;  1YNX A;  4IFD I;  2JA8 H;  1KIX A;  4WJ4 A;  5IYC H;  4JBK A;  1OTC A;  5GAG C;  1XNQ Q;  2I5H A;  4GNX B;  4A76 A;  3AEV A;  3J7A 5;  2WFW A;  5JJL A;  2VW9 A;  3GTG H;  3K80 C;  3T1H Q;  2UXB Q;  3RN2 A;  1V9P A;  2E5L L;  4X6A H;  2ID0 A;  2Y0S E;  1A62 A;  4LF8 Q;  1EYG A;  3I56 A;  4DR6 L;  1PH5 A;  1JB7 A;  2IT1 A;  5GAD C;  3A74 A;  1VQ6 A;  3D0F A;  1GVP A;  1SRU A;  3U58 A;  4C3H H;  4LFB L;  3PV0 A;  4JI3 Q;  4JI2 L;  1YVC A;  3I4N G;  4OX9 L;  4IO9 A;  4IJL A;  1VQL A;  3PIP A;  2ZJP A;  3NEL A;  3BZK A;  1HNZ L;  3M4Q A;  4NXN Q;  4RMF A;  3KJP A;  3M4P A;  2HIV A;  4KHZ A;  3GDE A;  4LFA Q;  3EBE A;  2ALY B;  1VQ4 A;  5M5X H;  4GKJ Q;  4A3D H;  1Q8K A;  2NZO A;  1X3E A;  4TVA B;  1HR0 Q;  2OQK A;  4X64 Q;  1PH7 A;  4JOI A;  1OXS C;  1PV4 A;  1HR0 W;  4DV5 Q;  1VQ5 A;  2MO1 A;  2VQE L;  3I4N H;  2NVQ H;  4DR7 L;  1X9N A;  1SN8 A;  1VQP A;  3CF5 A;  5IYC G;  1G29 1;  3I55 A;  3GTL H;  1N36 Q;  1N8R C;  4X66 L;  5FJ8 G;  2DGY A;  1W2B A;  1CUK A;  1YJ9 A;  1Y1W H;  2PQA A;  2D0O A;  4POF A;  4LFC Q;  3CXC A;  1XNR Q;  4DR4 Q;  1X3F A;  2I0Q A;  2BH2 A;  4AQY Q;  3H3V H;  3HOU H;  4JI1 L;  2OTJ A;  4KHP Q;  5E7N A;  1YHB A;  1PYS B;  5IT9 c;  3U4Z A;  3CC4 A;  1CKM A;  1B7Y B;  1PH8 A;  1NMG A;  3HOZ H;  4A3C H;  3JAM c;  2JQO A;  3A0J A;  3BZC A;  4KLK A;  1N33 Q;  1SRO A;  4LF4 L;  3S2H H;  3CCL A;  4LF4 Q;  1KC8 C;  1N33 L;  2Q2H A;  1PYB A;  3DM3 A;  1Y1W G;  2EIF A;  3E9H A;  4L5R C;  4A93 G;  1SLJ A;  1S3O A;  1UE6 A;  4YCV A;  5M3F G;  2LXK A;  3PGZ A;  4LNQ A;  4PZ8 A;  3GTO H;  3CQZ H;  1L1O B;  2KEN A;  2JK8 A;  4PMW A;  2PQA B;  3KFU A;  4NB3 A;  4AYB G;  4KHP L;  1X3G A;  4JI1 Q;  1E24 A;  1WI5 A;  4AQY L;  1JJ2 A;  4UP7 A;  4DR4 L;  4LFC L;  3CCU A;  1IZ6 A;  3SGI A;  4C3I H;  1XNR L;  4XIG S;  4X66 Q;  1N36 L;  4A3B H;  3UDI A;  2K4K A;  2R7F A;  2R7Z H;  1GD7 A;  2VQE Q;  4DR7 Q;  1VQC A;  1K9M C;  5IP9 H;  4DV5 L;  1E1T A;  2ZTD A;  4DPG A;  2AWN A;  4X64 L;  4BY1 G;  2K5N A;  1HR0 L;  3B6Y A;  1RIP A;  4JBJ A;  2RF4 A;  2A1A A;  4GKJ L;  4BY7 H;  4GOP B;  3L0O A;  1V1Q A;  3NEN A;  2N3S A;  3S24 A;  3KDF B;  4LFA L;  2IHF A;  4A4I A;  4NXN L;  1N9W A;  1HNZ Q;  2GN5 A;  3CW2 C;  1E3P A;  2K75 A;  4IPH A;  5C4X H;  1KAW A;  5IP9 G;  4HIO A;  1K8A C;  3EIV A;  4OX9 Q;  4JI2 Q;  4JI3 L;  3KDF A;  4LFB Q;  4YWK A;  1ASZ A;  3S14 H;  2C35 B;  4GN3 B;  3RLO A;  1VQO A;  1LTL A;  1HZ9 A;  3W1B A;  1FVI A;  4BA2 I;  4DR6 Q;  1VQA A;  2PI2 E;  1YIJ A;  3K0X A;  4LF8 L;  4PG3 A;  2CFM A;  1QVC A;  2E5L Q;  3G71 A;  4Y52 H;  2UXB L;  3T1H L;  4YWL A;  5M3M G;  2Q2U A;  1E22 A;  3HKS A;  1HZC A;  3KF6 A;  1TWH H;  1XNQ L;  4WJ3 M;  3CMA A;  2HQL A;  1PH1 A;  2JA6 G;  2KCM A;  2VY3 A;  1HZB A;  1PFS A;  1VQB A;  2L15 A;  2OWO A;  3GD7 A;  5H1S E;  3K7U C;  3PO3 G;  4DR1 L;  1AH9 A;  4DV4 Q;  1B70 B;  1I94 L;  1O7I A;  1MJC A;  4LF7 L;  4IOA A;  4JV5 L;  3FKI G;  3F1Z A;  5IWA Q;  1EQR A;  3H0G H;  1H95 A;  1WYD A;  3ULP A;  4K0K Q;  5LMN Q;  3I7F A;  4DR5 L;  4BBS G;  2IX1 A;  4HID A;  2UUC L;  4DR3 Q;  4A3J H;  4UPA A;  1LM0 A;  1X56 A;  1Y1V G;  2E2H H;  2R92 G;  4LF9 L;  3I4O A;  3F2B A;  5C0X J;  3PO3 H;  3T1Y Q;  4BXX H;  3F2D A;  1YI2 A;  4C3J H;  3MEF A;  1XTD A;  1J5E L;  5FJ8 H;  1IBK Q;  2NN6 I;  3CME A;  2BA1 A;  2D62 A;  4JI7 L;  1XPO A;  1B8A A;  1E1O A;  2MFI A;  2R7D A;  1LUZ A;  3RR5 A;  1GKH A;  4LF6 L;  4DV3 Q;  3RNU A;  3I4M H;  3S2D H;  2I5L X;  2B63 H;  3S1M H;  3OW2 A;  1J6Q A;  4J15 A;  2WAQ G;  4B3T Q;  1I5F A;  1WCM H;  2UU9 L;  4DV0 L;  3OTO L;  2NVX H;  3TRZ A;  1HNW Q;  4DKA C;  3CC2 A;  1EWI A;  4UY8 C;  1VQG A;  2YYZ A;  1VQM A;  4DV7 Q;  1NTG A;  2EXD A;  3CCM A;  3H15 A;  2KBN A;  4X65 L;  4L5S A;  2YU9 H;  1DGS A;  1D8L A;  3ICE A;  2VNU D;  3LGJ A;  5M5Y H;  3F2C A;  3RLF A;  4GLV B;  2K50 A;  5BR8 L;  5C4J H;  1S72 A;  2QGQ A;  3BU2 A;  4YY3 Q;  1OXV A;  3FP9 A;  3G4S A;  2A19 A;  1OXU A;  2HHH L;  2UUA L;  3HOV H;  4BY7 G;  3UDX A;  4X62 L;  4QQB X;  1FGU A;  1Z47 A;  2ES2 A;  1YIT A;  1YJW A;  4LUV A;  5K36 G;  1CSQ A;  4IPC A;  5AJ3 L;  4OO1 G;  3S17 H;  2IX0 A;  1UE5 A;  2EQS A;  4DUY L;  1YBY A;  4YCU A;  3TEH B;  3ZJY C;  2DUD A;  1M1K C;  1HZA A;  1PH2 A;  1IBM L;  3AFP A;  4BY1 H;  4JI4 L;  3L2P A;  4PZ7 A;  3RLN A;  2AWO A;  2PI2 A;  4R4O A;  3J80 i;  3UDG A;  3GTP H;  3U4V A;  2N49 A;  2AKW B;  5M5W H;  4HIM A;  1YJN A;  4JI8 L;  3CCQ A;  2PMZ E;  1R9T H;  2ZJQ A;  1VQJ A;  3A5U A;  1BBW A;  3HOY G;  4OO1 I;  3FHW A;  1VS0 A;  1CKN A;  1C7Y A;  4OON A;  2Z6K A;  2ZM6 L;  2R6G A;  1I6H H;  1EUJ A;  1T9H A;  3AFQ A;  2E2J H;  3CCJ A;  4DR2 L;  1CKN B;  1Q82 C;  1IBL L;  2D0P A;  1QUQ A;  3W5O A;  2ZTC A;  2WAQ E;  4DV2 L;  4B3R L;  5LMN W;  3RZD H;  1KD1 C;  3TS0 A;  2F4V Q;  2UXD Q;  2F3I A;  4DV6 Q;  1PH3 A;  3HKZ G;  4A3C G;  1QUQ B;  2HIX A;  3UE0 A;  2JA9 A;  4BBS H;  1XMO Q;  1UE7 A;  3J7Z C;  3J80 c;  3H0G G;  1SR3 A;  4R4C A;  2OTL A;  4JYA Q;  3GTK H;  3CCS A;  1UEB A;  1SE8 A;  3MXN B;  3PUW A;  4DV1 Q;  4POG A;  3HOY H;  4A3D G;  2N78 A;  3CPW A;  1IYJ B;  3M9B A;  4LUO A;  2YTV A;  3HOV G;  4A75 A;  3E9I A;  4JG2 A;  1GO3 E;  1U0L A;  1WFQ A;  3ER0 A;  3PUV A;  1Y14 B;  3S16 H;  2VL6 A;  1EOV A;  3S1Q H;  4IFD G;  4A3M H;  2IHE A;  3NEM A;  3RN5 A;  1N34 L;  2CWP A;  2K5H A;  3STB C;  3I4M G;  1G6P A;  1XMQ Q;  1GM5 A;  3TRE A;  3HFZ B;  1EQQ A;  3PUY A;  3CCR A;  4DUZ Q;  1ASY A;  1N32 Q;  3S15 H;  2FXQ A;  5IY0 A;  1WJJ A;  3J81 i;  2JA7 H;  3UE1 A;  2JA5 G;  2KCT A;  3KF8 B;  3PUX A;  4LF5 L;  2WB1 E;  3M7N A;  1JJG A;  1UWV A;  1VQ7 A;  1MKH A;  3JC6 6;  1P16 A;  4H02 A;  3GTJ H;  4GNX A;  4ALP A;  4QGU A;  4GLX A;  4JI6 L;  4A3L G;  1XPR A;  1AE3 A;  3M85 A;  3PO2 G;  2YV5 A;  1YHQ A;  4IFD J;  1L0W A;  4A3G G;  1NBW A;  2CQO A;  4P74 A;  2ZJR A;  4OWW B;  1LYL A;  2Q2I A;  3U50 C;  4NXM L;  5C4X G;  2Z6K C;  1P8L A;  1AE2 A;  2Z0S A;  3G48 A;  1Q81 C;  4JBM A;  2K52 A;  4QL5 A;  2UUB Q;  4A3L H;  2H5X A;  3AQQ A;  4AIM A;  4HJ5 A;  1HNX Q;  1TWC H;  3KOJ A;  1E7Z A;  4KI0 A;  2VQF L;  4GKK Q;  2UXC Q;  4JI5 L;  1U5K A;  1KHI A;  5GQO A;  1JMC A;  1Y1V H;  4R1J A;  4B3S L;  2VUM H;  1VQE A;  4YHH L;  4XTC S;  5LMU L;  2R7Z G;  1D7Q A;  2K14 A;  1CSP A;  1CKO A;  2CCZ A;  1YEZ A;  4JI0 L;  1I50 H;  4YWM A;  3S1R H;  2B3G A;  2PNH A;  1C9O A;  2Q2T A;  4GN4 B;  4B3M L;  5FLX c;  5IE8 A;  5EAY A;  1L2F A;  4GNX C;  4A3K H;  1FJG Q;  2KHI A;  3M4O H;  4DAY B;  3AYH B;  4A3F H;  1FJG L;  3D31 A;  1L1O A;  5ELN A;  4B3M Q;  4A3E G;  2JA6 H;  5GAH C;  3HOX G;  4A3J G;  3STB D;  1BKB A;  4P71 A;  4JI0 Q;  4L5Q A;  2HT1 A;  1FL0 A;  5LMU Q;  2LSS A;  5M3F H;  4HIK A;  1Q86 C;  1C0A A;  4YHH Q;  5FLM G;  1M90 C;  2BH8 A;  2GVB A;  4BBR G;  4B3S Q;  3J81 j;  1QVG A;  3H3V I;  4JI5 Q;  2UXC L;  2XTI A;  1VQI A;  1W3S A;  2OCE A;  1X54 A;  2V1C C;  4GKK L;  2VQF Q;  5IYD H;  1HNX L;  1Z9F A;  5C3E H;  2NVY H;  1A0I A;  5IP7 G;  2RHS B;  2E8G A;  4MNO A;  1Q46 A;  4QJF A;  2QEX A;  4IOC A;  5C44 G;  3TQY A;  5IYB G;  4NPS A;  2UUB L;  2Y0S G;  3IRB A;  4LWC A;  3L7Z C;  4A3I H;  2WP8 J;  1Q1E A;  4NXM Q;  4QIW E;  2BA0 A;  4P73 A;  5M3M H;  5JJK A;  4GS3 A;  4DAM A;  4GOP A;  1EIY B;  3HOU G;  4Y7N H;  4JI6 Q;  1OXT A;  1L1O C;  3PUZ A;  2JEB I;  1BVS A;  4HJ7 A;  4BA1 I;  1YZ6 A;  2JEA I;  4LF5 Q;  2B63 G;  1EFW A;  1S40 A;  3HOW H;  4P75 A;  5GAE C;  2OQ0 A;  4O0A A;  1N32 L;  4DUZ L;  5J3B A;  3PF5 A;  5HGQ A;  5C0X I;  1XMQ L;  1PH9 A;  1N34 Q;  1K8G A;  1K0R A;  1VQK A;  3HOW G;  1NMF A;  4MTN A;  2JA8 G;  3S1N H;  2LXJ A;  1KRS A;  2QA4 A;  2R93 G;  4LW1 A;  4A3F G;  4UP9 A;  1QZH A;  3OYY A;  1IXR A;  4R4T A;  2R92 H;  2JE6 I;  4A3K G;  5GRO A;  2I5M X;  3KJO A;  3K7A H;  2A8V A;  4DV1 L;  3W1G A;  1BBU A;  2KHJ A;  4OXP A;  4JC0 A;  4R4Q A;  3Q8D A;  4JYA L;  4YCW A;  5C0X G;  2MO0 A;  2CWA A;  2B29 A;  2RCN A;  3E0E A;  4UP8 A;  1XMO L;  3PIO A;  4A3B G;  4A93 H;  3CCE A;  1K73 C;  2R93 H;  4P72 A;  2YTX A;  4GLA C;  4HJ9 A;  4DV6 L;  4DR2 Q;  3K8A A;  1KQS A;  2F4V L;  2UXD L;  2ASB A;  5IYD G;  3TS2 A;  4B3R Q;  4DV2 Q;  1KXL A;  4DK3 C;  1PHJ A;  3KLW A;  2E2I H;  1IBL Q;  3GTQ H;  2F52 A;  3GO5 A;  3ERS X;  4R4I A;  4EQ5 A;  4MZ9 A;  1KL9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...