2JA7J

Cpd lesion containing rna polymerase ii elongation complex c
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*TP*AP*AP*GP*TP*AP*CP*TP*TP*GP *AP*GP*CP*T)-3'
publication title Cpd Damage Recognition by Transcribing RNA Polymerase II.
pubmed doi rcsb
molecule tags Transferase
total genus 13
structure length 65
sequence length 65
chains with identical sequence V
ec nomenclature
pdb deposition date 2006-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2ja7J00
5C4XJ 1P7JA 2CUEA 1P7IA 1FJLA 3GTKJ 3IV5A 4V2GA 4HNVA 3ZQLA 4AUXA 2K40A 1OFCX 3A03A 1HDPA 5DS9A 2B63J 2Y0SN 2YS9A 1WI3A 3TW7A 1WH7A 1SANA 4A3IJ 2XRLA 1BJZA 2TCTA 4A3JJ 2CU7A 2LTPA 4X1EA 4UUTA 5K7HA 3S16J 2R92J 2Y30A 3ZQHA 4JX4A 1XS9A 4MLOA 3BR2A 4EEFG 3JRFA 1RR7A 1XC5A 3LSRA 2L7FP 1MBFA 2DA4A 1LE8A 1I6HJ 1JKOC 1IGNA 5FKMA 1HCRA 1POGA 1LFBA 3HOWJ 1ETYA 5FLVA 3ZOBA 1AKHA 3LOCA 5M5YJ 3BQYA 1A5JA 1XG1A 2VKEA 3GTLJ 3D1NI 2W48A 3BG5A 2L7ZA 3PM1A 2WB1N 5J1UA 2XPWA 2JA5J 1O4XA 4BY1J 5JLXA 1A6IA 3OSFA 4MFDA 5E3MA 3M3YJ 3QQAA 3C2BA 1RPWA 3S14J 4XIDA 2OPTA 3JRDA 4JYKA 3PO2J 3BTCA 3CCYA 1X58A 4C3JJ 1B8IB 5M3MJ 2O8KA 4DYQA 5JLWA 3RZDJ 5F27A 4XRMA 2Y31A 5IYDJ 5E3LA 1Q1VA 2NVYJ 4A3MJ 1ETVA 3K2AA 2DA5A 2LVSA 2E1OA 4I6ZA 3VPRA 5FLMJ 2GBYA 4XRSA 2XSDC 1BW5A 4FE4A 3GTGJ 2E19A 5M5WJ 1JT6A 2DTZA 2IEKA 2JJ7A 5DTDA 2MW8A 4C2MJ 2L0KA 2XGEA 5FKOA 3RZOJ 1DU6A 1BW6A 1FTTA 5EGOB 2ME0A 4XICA 4Y7NJ 3S1MJ 2GLOA 3Q3SA 1H89C 1E3OC 1MSFC 3ZQGA 3SDGA 1RKWA 4Y52J 2DMNA 4JX6A 1MBGA 1Z0XA 1ZQ3P 1I3QJ 1X2NA 3W6VA 2X9DA 1JJ6C 2HQ5A 1IDYA 5EGOA 2ID3A 1UHSA 1D5YA 1ZR2A 1ZTRA 3IH2A 1F36A 1I50J 1ORKA 4M3BA 3FIWA 2FX0A 5F0FA 3H3VK 2EH3A 2X48A 3IH3A 1T33A 3HGGA 4FTHA 2VKVA 3HB9A 5F0HA 4BY7J 4M3GA 3SJMA 2YU9J 4UUSA 1MBKA 2HI3A 2LR8A 3O8HA 4A3GJ 4S0HB 3BTLA 3MN2A 1IJWC 1G2HA 3TP3A 1UMQA 1MBJA 3FISA 5K7FA 4A3CJ 1VF9A 2DA6A 1RKTA 2EBIA 1W0TA 1OJLA 3GBGA 5EZHA 2D5VA 2VUMJ 2RAEA 1QVUA 1U8BA 4V2FA 4BBRJ 2I10A 4MO7A 1IC8A 2DA3A 3I4NJ 4A93J 4LOCA 4A3DJ 5M5XJ 3CMYA 4M6VA 3JRGA 3BR5A 2L9RA 3LSJA 3A02A 1HOMA 2NS7A 1UG2A 2ECBA 5BNGA 2O7OA 5K7ZA 5E3NA 4DZPA 5EDNA 1EF4A 3LSGA 2JK3A 1BL0A 2L7MP 1JKPC 4XK4A 4IHWA 4BKXA 2E2HJ 1IDZA 4D7MA 5HODA 1MBHA 3BR1A 3HM5A 2CQQA 3I4MJ 2FD5A 3NAUA 1GV5A 2JWTA 1MBEA 2XGCA 4DZJA 3G1LA 2XB5A 2AO9A 2H1KA 5IOYA 5F08A 5C4JJ 2K9NA 2XB0X 1ETOA 1VI0A 2LFBA 3E7LA 1T56A 2JMWA 1GDTA 5FKNA 1MSEC 1IRZA 2VPRA 1VFCA 1NTCA 1BA5A 2HOTA 4GFBA 2M9HA 4M3FA 3BG3A 1S7EA 3L1PA 4CYCB 1IUFA 3GTJJ 2K9QA 1ZKGA 3ZQIA 2EZKA 2CQXA 3TP0A 3JRCA 2TRTA 5M3FJ 2M8GX 1FIPA 3SFIA 3ZQCA 3OSGA 3ZQFA 1U9OA 4W97A 3DEWA 2NVXJ 4AC0A 4CYCA 2DA7A 2QCOA 1GVDA 1MNMC 2LD5A 4IHXA 1B8IA 5EG0B 1F43A 3DCFA 1VNDA 2LY9A 2MGQA 4A69C 3GTPJ 3HEFA 5IYBJ 4G12A 1HLVA 1RESA 4AYBN 3H0GJ 2R0QC 3OIOA 5EZGA 3HOUJ 3HOVJ 3FK7A 3HOXJ 2EZHA 3RQIA 2R5YB 1JJ8C 2LK2A 1APLC 1WH5A 1JTYA 4DW6A 4RDUA 4A3FJ 1PUFB 5EG0A 1B72B 2VI6A 1SFOJ 2DA2A 2FQ4A 4BXXJ 2R93J 3IH4A 2CRGA 2JA6J 1JGGA 2GM4A 4MFEA 5FKLA 3CQZJ 1PUFA 1TWAJ 3FK6A 2IAIA 2AHQA 3Q0VA 4DYCA 3LSPA 1B72A 2N8GA 1MH4A 2NS8A 5C3EJ 4A3EJ 3LNQA 3S1QJ 5F1JA 1H8AC 2HXOA 3QPLA 1IV6A 2XPVA 3TEDA 5F0CA 3NARA 2JN6A 1R9TJ 1ZK8A 1DU0A 2NOGA 1FEXA 5GPAA 2Y9YA 2R5ZB 1TC3C 1WCMJ 1YRNB 4MIMA 3WHBA 2EZIA 3TW6A 3JRIA 2ECCA 2MG4A 1JTXA 1QPIA 2HXIA 2ME6A 1U78A 3JREA 3HGYA 5J1YA 2CJJA 2ZB9A 3UKGA 2DMQA 2XGDA 2NVQJ 3MVPA 1JUMA 2M0CA 2R7ZJ 1NK2P 3HBLA 1YRNA 3G1MA 1CQTA 3G1OA 4FISA 5IP9J 3F0CA 3HOZJ 2COBA 5EYRA 2DMUA 3HKZN 2DA1A 5IOZA 9ANTA 5GPCA 2HOSA 5EF6A 3RKQA 1ZR4A 5IP6A 4BBSJ 1LE8B 3S17J 2CUFA 2LKXA 4D5CA 1JKRC 5FJ8J 4C3HJ 2K9SA 3MKLA 4FE7A 4X6AJ 3JRAA 1AKHB 1TWGJ 1K61A 2M2EA 3BT9A 2HOAA 4D5FA 2EZLA 3K7AJ 2JA8J 3GTMJ 3S2DJ 2DJNA 1MH3A 2IBDA 4XRSG 1AHDP 1HDDC 4JP0A 2Y2ZA 1H88C 3HDDA 4A3LJ 1JT0A 2QF7A 2MSYA 4IHVA 4FCYA 1GV2A 4NDLA 4QSHA 2E2JJ 2HDDA 1K83J 3GTQJ 3Q0WA 1QRYA 1NK3P 3B6CA 1ZGWA 2PMZN 5J3LA 4J19A 5F04A 1IG7A 3A01B 2DMTA 4IEJA 3BQZA 4QTRA 5FKKA 3BTJA 5IP7J 1HF0A 2FJ1A 3JRBA 1JUPA 2DMPA 4M3DA 5IPAA 3B6AA 1WGXA 3WHCA 4RBOA 1ITYA 1ETKA 3S1RJ 1JUSA 3A01A 1TWCJ 2KDZA 3BTIA 5C44J 2E2IJ 2O9LA 2YUSA 1W0UA 1GUUA 3BG9A 4B4CA 1Y1WJ 1WPKA 2LLKA 3S1NJ 2R5YA 3BR6A 4QIWN 3FKIJ 1FIAA 4B1RA 2G0EA 4JX5A 4L5EA 1U9NA 3BR0A 2XPUA 2WV1A 1TWHJ 2OF7A 2X6OA 1X2MA 2WAQN 1AU7A 4C3IJ 3HOYJ 4M3EA 1Y1VJ 2EQRA 1RETA 2P81A 5E3OA 1QVTA 5GP9A 3QPSA 3OOUA 3S2HJ 4DYRA 4A3KJ 4UUSB 1FTZA 4W1UA 4I76A 4IHYA 3PO3J 2KT0A 3GTOJ 2ELKA 3JRHA 3O8GA 1GT0C 2H8RA 2LP0A 1ETXA 5IYCJ 1ENHA 1ETWA 1ETQA 2ID6A 2M34A 3BR3A 1LFUP 1TWFJ 3JR9A 2Y9ZA 4ABZA 3CDLA 2JA7J 3Q0UA 5J1RA 5EEAA 2HYJA 2R5ZA 1OCTC 3S15J 1OCPA 4B3AA 1JKQC 4D7NA 1Z77A 2NVTJ 2DN0A 3M4OJ 4A3BJ
chains in the Genus database with same CATH superfamily
1KZHA 5C4XJ 1U3EM 3BC8A 1W4MA 1SD7A 3E5UA 3KFWX 3NRVA 2IGOA 4BHBA 2B63J 2Y0SN 1MMNA 3KPHA 3LSIA 1F5TA 2H6CA 4RS8A 3TW7A 1P4XA 1XDSA 5E20A 2LH9A 4A3JJ 2L5QA 1P2FA 2LTPA 4X1EA 3BP8A 2HYGD 4A2UA 2OTJI 3QYEA 2BW3B 4BE2A 4JX4A 4B8XA 4HX7A 4FX0A 4ENJA 3K9TA 1YI2I 3EUAA 1VQPI 2I5UA 4BAYA 5F6FA 1RR7A 2IJLA 2KKOA 3OYIA 3TBIA 4UVCA 1I6HJ 5LHHA 1SD4A 2BY2A 3AKZA 4EM1A 1HCRA 5GAHJ 4XLCA 4FASD 1ETYA 2BW3A 3ZOBA 1AKHA 3LQQA 4IRGA 3ECHA 4B3XA 1A5JA 1XG1A 3RDIA 3DFGA 3S3OA 2K9LA 3LA3A 3D1NI 1OCCH 3SQNA 2XPWA 1A6IA 4CCOA 5EEHA 5KAIC 4L18B 1KQ9A 3WTYC 1RPWA 3E6MA 3S14J 2E1MB 2CW7A 4LD5A 2OPTA 3PFIA 2Q8KA 3CMEI 4CICA 1SD6A 2UXNA 1K4TA 2Y31A 1ETVA 1A36A 3AL0B 2KQRA 3VEPA 4DBRA 1GHCA 4KJZA 1MW7A 1MJBA 3ISPA 4XRSA 2XSDC 1ZYRF 4XLNF 1IN6A 4OAZA 4XN0A 4DJAA 4ZYEA 5DCFA 2DBBA 2CMPA 3H0DA 3K70C 4EJOA 5CQGA 5M5WJ 1WJ5A 1R58A 2CUJA 2JUGA 3L09A 2E5NA 3OS0A 5BOXA 3CUQC 1FTTA 2X1DA 5EGOB 3HOSA 1T6SA 2KRFA 2GLOA 2Y48A 1H89C 1I27A 1E3OC 1VQ7I 2OBPA 2L02A 2LNBA 2MABA 2DMNA 5A2QZ 1A35A 4JX6A 1XSXA 2LKSA 1Z0XA 2ZC2A 3LMMA 1ZQ3P 3VWBA 2FMLA 4HBLA 2Y0MA 2WAQA 2KP6A 3GEZA 1JJ6C 2P8TA 5EGOA 1R4MB 2VB6A 1Z7UA 4E4HA 2CYYA 3GZ6A 2OZUA 2DYRH 2Q2EA 2K86A 2KJBA 2KRHA 2XAGA 1DGRM 1QHHD 5F0FA 1RUOA 1IZ1A 2VKVA 3FMQA 3E3VA 4Q4ZF 4S0HB 3BTLA 3QYBA 1P4AA 1OCZH 2GXBA 3L7WA 5K7FA 5E1ZB 1FBQA 2VBYA 1W7PD 2EBIA 2ELHA 2ZXJA 4RM2A 5ICFA 2V9VA 2P5VA 1XX5A 3D5LA 1QVUA 1T95A 2D5VA 3CTAA 3H9GA 2VUMJ 4YRVA 1U8BA 4RGUA 5DDGA 4BBRJ 3W2WA 1YJNI 1JI8A 2EFQA 4MO7A 4BH9A 2P6SA 3C3WA 3CJTB 1RIOH 1IV8A 5BPIA 1R6RA 1V3FA 4O5VA 4A93J 2GWRA 4NB5A 3CMYA 2OD5A 1GXQA 4OINF 1TW3A 2L9RA 1LDJA 1N78A 3A02A 5AIQA 5K7ZA 1QQIA 3I55I 1ZRCA 3HL2A 4DZPA 5ILUA 3BPVA 3CCQI 4E7ZA 3W2AA 2JK3A 1QZEA 1XTAA 3DBHB 3OYJA 1J09A 3KP5A 4BKXA 4MTEA 3HPHA 2E2HJ 4D7MA 1UAAA 4XLEA 3HM5A 3ZPLA 2DOAA 4RB3C 1YHQI 1MBEA 2XGCA 2DFHA 2YX4A 3G1LA 4U88A 4WK8F 2ZMEB 2VN2A 2GXAA 2XB0X 3ZMSA 4WCGA 4GYIA 2XAUA 2GQQA 1T56A 3K4BA 2ZXHA 1IRZA 2DT6A 2WV0A 2W7NA 1OCOH 1SVMA 3PUFA 2ZMEA 2ZSIB 4HF1A 4GFBA 3H35A 1FLIA 3DU5A 3FBNB 4XR6A 3CCSI 2DODA 3A0HC 4XLPF 4E7JA 2E1NA 4CYCB 2C6YA 4U0WA 3M07A 4D9JA 3LA7A 4M9ZA 4A5MA 1E17A 2CQXA 2PG4A 4IX7A 5H20A 3TP0A 2HVSA 5FD5A 2K7LA 1J5YA 4N9HA 1FNNA 3SFIA 3OSGA 4ITVA 1WQ2A 2BY0A 2EIJH 4AC0A 4CYCA 1GVDA 4IHXA 3SEQA 3DCFA 4HPQA 1S72I 1ZLJA 3TMOA 1HLVA 1RESA 2VXZA 2X6WA 3H0GJ 5E8IA 3GX4X 1R71A 2F4OB 5D5WB 3WTWC 3HOVJ 3FM5A 1B9NA 3FK7A 5IT9Z 2GXGA 4HA8A 4HSTA 2EZHA 2HS5A 5CJ9A 3GUDA 1APLC 2ZJQF 4RDUA 2VIXA 3E6CC 3VB2A 2VI6A 4PJ0C 2E7WA 2QSHX 3BCBA 3ZQQA 3L00A 1ZLKA 2P5LC 4IQJA 1JGGA 2V6EA 3RIRA 4MFEA 3FX3A 1T39A 4EM0B 1XGSA 3CQZJ 2VLAA 2XKOA 1WJCA 2NS8A 1QHGA 2P0WA 2W24A 2VOPA 5CLSA 2VJ5A 3LNQA 1FOKA 1ZAOA 5F1JA 4P9UA 1DP3A 5J8CA 1FBUA 4KNYA 1X1BA 1R9TJ 2WAFA 2H09A 1ZK8A 1Y0NA 5FROA 5HLHA 3IWZA 1D5VA 2Q1ZB 2G7HA 1FOYA 5JVGF 1BC8C 3B73A 1KQ8A 2O6GE 1Z3XA 4MQVA 5IT3A 1YRNB 1G6NA 5GTHC 4CDGA 3WHBA 2EA2A 3TW6A 3JRIA 2X85A 2P7VB 2MG4A 1HQCA 4NQWB 3G3ZA 4H0EA 4CA0A 5ILSA 4PUSA 1U78A 2QGUA 4E6KG 5B5EC 2RDPA 3AAFA 3UKGA 2IVMA 2M0CA 3VODA 3HBLA 1YRNA 1CQTA 2X0LA 3G1OA 3LSTA 4FISA 2R7VA 3F0CA 4KMUX 4NQWA 5EYRA 1LDKB 2FA5A 3HKZN 1S8NA 1Z91A 3OYNA 1IN5A 5GPCA 2HOSA 2FOKA 2K3PA 2K4JA 3HHGA 3T8TA 1FSHA 1USSA 2M7AA 1FX7A 3H92A 1R5ID 2XHKA 2E71A 2CUFA 1IN7A 2DAOA 5K5RA 3HTUA 2QUFA 1JKRC 3L2RA 1MGTA 2NAZA 4XLFA 3IKVA 4PZJA 2XRNA 1TWGJ 2VQGA 4F55A 1E2XA 1TQIA 4PGGA 3DP7A 2HOAA 4ASNA 1VQ5I 4M72A 4D5FA 2EZLA 3OS1A 2WB1A 5H6RA 3JAMK 3GFLA 1D3YA 2DJNA 3LSKA 2EV0A 2MLGA 1FOXA 5L3FA 1D0ZA 3P9CA 2Y2ZA 3QAHA 3FDYA 1JT0A 4UY8I 1UFMA 3AG3H 4NDLA 2FBKA 3P9KA 1HW1A 3WGGA 4DGWB 4PFOA 4HF0A 1K83J 4EV0A 1XMXA 2A05A 1OPCA 5J40A 5J3LA 2OQGA 1W5SA 5F04A 3ZR8X 2QM3A 3S32A 4E7SA 2Z16A 1HC8A 1ZRDA 2KIQA 3J81K 2DK8A 4P96A 3H3ZA 2JRTA 4HSRA 4LJZF 1EV7A 3PQJA 4FETA 4BXUA 3JRBA 3MZHA 4PJJA 1JUPA 2DMPA 2F6CA 2HR3A 1X1CA 5IPAA 3I56I 3B6AA 4LLLA 2JZYA 4G7HF 2HEOA 1WGXA 2UZKA 2Q0OA 2QWWA 3A0BC 4M9XA 2RN7A 4L9JA 3J7AO 2KDZA 3FXOA 2KZVA 4BNCA 4CCNA 4EJTA 2O9LA 2VL8A 4IL6C 3CESA 2LLKA 4HDVA 2A5WA 2R5YA 3K1NA 2MYSA 3P5JA 1OKRA 5K5QA 1Y8QB 4N0BA 3HOTA 1FIAA 3Q9VA 4WX9A 4OWRB 4B1RA 1X1PA 4L5EA 1UCRA 2DYSH 2H6BA 4ENMA 2QSGX 4PK4A 3Q9SA 2WV1A 5HS8A 3DU6A 5L3EA 1YJ9I 2J5OA 2FQ3A 2WWYA 4M3EA 2EQRA 4IQ4A 1RETA 1SMYF 2VC0A 1QVTA 5GP9A 3GZNB 4IZZA 3S93A 1FTZA 3CLQA 1QA6A 1WJDA 1Z21A 2B0LA 3TO7A 4HQEA 3V4GA 2FSWA 4U7DA 4N4OB 3KP3A 2H8RA 2LP0A 1ETXA 3NEUA 3ERED 4NHJA 2WY8Q 4BQNA 1IUYA 2AXTC 3F21A 3HRTA 3JTHA 4ABZA 1PP7U 3Q0UA 5B3SH 2L4AA 1R7JA 5GTIC 3EDPA 3A1YA 2DU9A 2F4IA 2X6YA 4B3AA 3VDXA 2NVTJ 3UNGC 2Z9OA 3PJRA 4A3BJ 1P7JA 2Z99A 3LA2A 2LF7A 3H9JA 4V2GA 2V1UA 2K40A 4PJNA 3BZKA 2BVMA 3TL4X 2DQRA 1KYZA 3KZIC 3RTRA 4AD9A 3J7AY 3OL4A 1WH7A 2E1MC 4A3IJ 4PFPA 3CO6C 1MMGA 4XOTA 1P4WA 2PEXA 3KP2A 4IOAF 1FYLA 1XDUA 4UUTA 5K7HA 2Y30A 3ZQHA 4PDKA 5E18F 5HLIA 1ZRFA 1ULYA 1G3SA 5CVUA 4MLOA 1JE8A 5FFXA 3AL0C 3JRFA 1XC5A 2W00A 1MBFA 4HYEA 4KMFA 1MIJA 2VQLA 2FF4A 2VASA 1IXRC 1RZ4A 4ENKA 1JKOC 1LE8A 1IGNA 3HPGA 5FKMA 2XDVA 4KN7X 4BJ6C 1IXCA 3HOWJ 4LB6B 2IT0A 2VPLA 3ESWB 2KMUA 2XAQA 4CHUA 3KYLA 3WE3A 3VYRB 3GTLJ 2ELJA 2EFPA 5FGMA 3BG5A 2IP2A 4AIDA 1IF1A 4ZYAA 2VE8A 2HVRA 2W85A 3KYCB 1Q1HA 3H1CA 2EV6A 4AVZA 3HHHA 5ERIA 1NG7A 5HLGA 3PO2J 4JYKA 5K5OA 2DDBA 1PJRA 1TT0A 1U2WA 2K85A 3DTIA 3EETA 2BV6A 1RR8C 1B8IB 4M74A 2O8KA 4LG0A 5JLWA 3RZDJ 4I09A 4XRMA 5E3LA 1Q1VA 4BEHB 4OMYA 3DXJF 2LVSA 2KRCA 4I6ZA 1VTNC 2AS5F 4LFUA 3F3XA 2WTEA 1BW5A 3KE2A 1MNEA 1JT6A 5IY5H 1FBSA 5B1BH 1EKEA 2IEKA 3FXUA 4E7KA 2JJ7A 1MJ9A 4C2MJ 1G3YA 1J75A 1LNWA 5FKOA 1X1DA 3IKTA 1BW6A 3M9AA 1N25A 2FEZA 4XICA 3S1MJ 1D1AA 3E0JB 3EUKL 4FQGA 4EJWA 1X19A 3SDGA 1FMVA 3MMYB 2IS4A 4UHTA 5L3CA 5D5VB 5CPRB 1X2NA 2JT1A 4NC7A 4RAGA 4Y33A 2PI0A 2A6EF 4BQQA 2HFHA 2VBWA 1J59A 2ID3A 1UHSA 3CCEI 5E1WA 3N4MA 4KIBA 4C30A 1S3JA 2M1BA 5JFRA 1ORKA 2CFOA 1DGWY 2FX0A 2EH3A 2X48A 3IH3A 2QQ9A 4HZFA 5KAFC 4CSWA 3U1KA 4BY7J 2QBYA 1ZELA 3SJMA 4YFXF 5LHGA 1UELB 3ZMTA 2HI3A 2DXIA 4U7BA 3IP4B 2RVCA 4MQ9F 1IJWC 1G2HA 3GXOA 3TP3A 1UMQA 2HQRA 1MBJA 5D8KB 4A3CJ 5A2QK 4I99C 2EFWA 4J00A 1RKTA 1TW2A 5JHFA 4L5IA 1IAWA 5EZHA 1UB9A 2V1XA 4F7ZA 4Y4RA 2I10A 1ZHFA 4M6XA 5HDNA 4HOBA 2DDAA 2RQPA 2LDUA 3FXJA 5LD2C 3HRSA 3PNYA 3G71I 2CGPA 3PSFA 1DP7P 1BR2A 1J2XA 2K3FA 4PSWA 4BE0A 2NS7A 4JK1X 4C9YA 4O3MA 2O7OA 2KLOA 5E3NA 2OJED 2CW8A 2H27A 5LFAA 4CXFA 5EDNA 1LB2A 3IL2A 2BEOA 1BL0A 2EFNA 3FF5A 2PQ8A 2PMHA 4GDFA 3WTSC 4XK4A 2RQQA 2RKHA 4YEJA 3WU1B 1MDMB 4KT5C 1JGSA 1JKPC 4XOPA 3WODF 5DD4A 5HODA 1MBHA 3BR1A 2CQQA 3I4MJ 2JWTA 3T5XA 1XB4A 4DZJA 1YO5C 2LREA 4EQQA 2KIUA 5LHIA 1LQ1A 2VC1A 2K9NA 2E36A 2YX7A 2D2WA 5GADJ 2UUZA 2EV5A 1MDMA 1K78B 2GIVA 2JMWA 1KA8A 3D5SC 3RYRA 3J7YJ 5FKNA 4FX4A 1GDTA 1ONVA 3FXLA 1DQUA 2VPRA 1PYVA 2IW5A 3GLXA 1D1BA 5L3GA 1NTCA 1I1SA 3WU2C 4U0VA 1BA5A 2HOTA 2ZXIA 3QODA 3J80K 4M3FA 2XF5A 3BWGA 1S7EA 2NRAC 3K4JA 1NG6A 3KX2A 4KIFA 1IUFA 5JVTA 2XF7A 4NUBA 4BGDA 1ZKGA 3PUBA 3ZQIA 5ICGA 2NNYA 2EZKA 3F8FA 2R7OA 4BE1A 1EH7A 3QU6A 2TRTA 2LY2A 1XSDA 2M8GX 4D1QA 4MGRA 3ZQCA 2OTLI 1FMWA 2QYOA 4W97A 1LEAA 2RNGA 3DEWA 1VQLI 2NVXJ 1F4KA 2LD5A 4XLAA 5EG0B 1VNDA 2LY9A 1VZ0A 3KLNA 2QA4I 2BXYA 3EYYA 2ESNA 2STWA 3KIOA 4AYBN 2VOOA 3DV8A 5KK1A 1EJ9A 3I0TA 5EZGA 4CCJA 1X1AA 1TP4A 4CCMA 3HOXJ 1JJ8C 3MQ0A 4DW6A 4A3FJ 3N97A 1PUFB 1JHHA 4XKBA 5EG0A 1NHAA 2FOWA 1V5GA 2L4MA 1AWCA 2ETHA 2O8XA 3IWFA 2HQNA 4BXXJ 1T38A 2R93J 2YR2A 2CRGA 3DF8A 2FE3A 3FKJA 3ZRGA 2BE5F 1G4DA 3H5RA 3BOQA 5JR3A 2OCCH 1PUFA 3E5QA 4RM3A 2IAIA 3Q0VA 4IF4A 2N8GA 2QENA 4NBQA 4KYWA 3CD6I 4A3EJ 1LDDA 1QZYA 1D0YA 3MCZA 3F6OA 4PGHA 3S1QJ 3F8NA 1L3LA 5D4SA 3JTGA 1H8AC 2HXOA 5IT9K 1IV6A 2O0YA 3D0SA 4XL9A 4EGYA 3FXMA 2ICWG 1AA7A 1DU0A 4MTDA 4OOIA 3IUOA 2WA0A 5J6XA 5JI6A 2MFZA 1FC3A 3OMYA 2P6TA 2LYCA 2Y9YA 4OU0A 3QU3A 1BIBA 1Z6RA 5D5UB 1XPXA 3VSLA 1WCMJ 4G6TB 3PQKA 3RPQA 4MIMA 3TOAA 1YX5A 4LLNA 1ZH5A 1LVAA 4PJLA 1QPIA 4LGWA 5K1YA 2HXIA 3CCRI 3L2WA 2W84A 2XAFA 3ABLH 3HGYA 2M5WA 2W1OA 2HQAA 2ZB9A 1JUMA 2DQLA 4II2A 1PDNC 5D8LB 1BI1A 3G1MA 3RQ4A 3UR3C 4BL0B 2XF6A 2HVQA 5ICEA 2CFXA 4OMZA 3HXLA 2CW0F 3J80Z 2DA1A 5FFZA 1Z05A 1S5LC 3LQRA 5LEKA 1IN8A 2R7UA 3K4MA 3DLAA 3RI4A 3WGHA 1T98A 1VQ6I 3E6DA 3S17J 3F8BA 4CCKA 2A6HF 2K9SA 3DBLB 3GFJA 3GLLA 3PIOF 4X6AJ 3JRAA 3L2CA 2Z5UA 1MMAA 4UVAA 1AOYA 2JPCA 2L01A 2A68F 4IRIA 4ZDLA 2NXNB 3LSMA 2XV4S 3KP7A 1TNTA 2R7TA 2IBDA 3V7CA 1YIJI 1R1TA 1KU3A 2R7WA 3G4SI 2K9MA 1YIOA 2CSOA 3HDDA 4A3LJ 3HTSB 4WXCA 1UHWA 4IHVA 2CUZA 5J8FA 3SZPA 2VE9A 4HLYA 1BI2A 3AG2H 4HQMA 2PBIA 4CO8A 2MC4A 1TQPA 4XN3A 1WZ2A 1W5CC 2I8DA 5FLXK 2KIFA 3C7JA 3OS2A 1G59A 2PJRB 3ZMVA 2E60A 4HNUA 1HKTA 2DMTA 3G6EI 2M3AA 1A31A 2KL4A 1E3HA 3BQZA 2V7FA 3E6BA 2O03A 2PMUA 1SVLA 5E8GA 2Z33A 2BBYA 2F5EA 2X1EA 4ON0A 3J7ZI 1Y39A 2PJRA 4L9VA 1QGPA 1IO2A 4DIQA 2VKHA 5LGUA 1TTYA 1IRXA 2AQFA 1LUJB 1J9IA 1GUUA 3BG9A 3PIPF 3I9V2 3C2HA 4KFCA 4G9YA 2QSFX 3KYDB 2H1LA 4N9IA 3U21A 1S6LA 5DCMB 1QZZA 4HX8A 5HDKA 4Y15A 1O57A 2QVOA 2G0EA 4JX5A 4ESBA 3WTXC 4UUVA 4RB1A 1R49A 3IAS2 2LKPA 3PFYA 1VQ9I 5LBQA 3BJOA 1G3WA 3WGIA 4IRHA 3HOYJ 1Y1VJ 2P81A 4N4NB 3K70D 3QPSA 5CVRA 2VJIA 3SYTA 3HSFA 2VODA 4KUMA 1O7LA 4UUSB 1S9HA 3L9FA 4I76A 2F5FA 2L9NA 4XSXF 4G8XA 2GOMA 5L3DA 4AVPA 3DWLE 2EK5A 5IYCJ 5HOOA 1ETWA 3EUHA 2R7XA 3HSRA 4XRFA 5CVVA 4ZZDA 3JR9A 3LAPA 3I71A 5J1RA 1ACIA 4B48A 2A07F 3OYFA 3K0LA 3RKXA 2BHZA 3QP6A 5DUKA 1Y8RB 1OCPA 1USTA 3PNVA 3OOPA 4BQAA 1TLHB 2Z1DA 3BY6A 3K10A 2KFDA 3ZMUA 3AG4H 3BZCA 1FJLA 3GTKJ 3ZQLA 4HNVA 3HKZA 4Z6YA 2HTJA 4AUXA 4ZJZA 1OFCX 4NC8A 3F23A 1S29A 3A03A 5DS9A 3NQOA 1X3UA 2YS9A 1HSTA 1PVEA 1WI3A 3H9QA 4KA4A 1SANA 1Y6IA 1BJZA 3M8EA 2TCTA 4KISA 3FZVA 5FLXZ 3S16J 4XBFA 2R92J 3OYMA 1V54H 2IXSA 4S04A 3VYSB 2CV2A 2BGCA 1F9NA 4KIGA 4E7HA 1I5ZA 3KP4A 4O6JA 3LSRA 1QNTA 2UWMA 2L7FP 4R79A 2OV7A 3EQLF 3CF5F 1X4OA 1U5TB 1JHFA 3Q5FA 1T08B 3OL3A 2HZTA 3L2QA 2VONA 1POGA 2HWVA 1LFBA 1KU2A 5F64A 1Z67A 3DTKA 3SHFA 3E97A 3WG9A 4BHCA 3CC2I 3LOCA 2ISZA 1RC9A 4BACA 3BQYA 4D0PA 1U5TA 2K02A 2RV8A 2Y69H 4XMYA 4EM2A 3PM1A 2WB1N 5J1UA 4ESFA 1QBJA 2JA5J 1EH6A 5JLXA 3OSFA 4MFDA 1TNSA 5E3MA 3M3YJ 3QQAA 4QPQA 1LVKA 2FNPA 2ZJ2A 4XIDA 4Q48A 3JRDA 3P7NA 3A4CA 4RGSA 3BTCA 1X58A 3TKYA 3CDHA 2VBZA 1OMIA 3M8JA 4R1HA 2YU3A 1A6QA 5IYDJ 4RA2A 4A3MJ 2V1NA 1I1GA 5TRDA 1S7AA 3SEZA 1SFUA 2E1OA 1LFPA 3JW4A 3ABKH 3VPRA 1I3AA 4H4KC 5FLMJ 2GBYA 2MD5A 3QWLA 5LEJA 2F2EA 4FE4A 4G6DA 2E19A 1FYKA 1X3ZB 3WTVC 3ELKA 1BJAA 2DTZA 4XORA 4XQFA 3GZ5A 5CVJA 5DTDA 5CYVA 1E0EA 4CZZA 2L0KA 2XGEA 3W6JB 4DNCA 3RZOJ 3ULQB 5BQTA 4II3A 3TOBA 2ME0A 3HIFA 2XAHA 1XGOA 1GLNA 4J01A 2L54A 4A12A 2GA1A 4ZTFA 3OYBA 1I3QJ 2XVCA 3W6VA 2X9DA 4EGZA 2NNNA 1KU7A 4A0YA 4EJVA 4OAYA 2XUBA 5KHDA 1IDYA 2F48A 4I0AA 1D5YA 1ZR2A 1TZLA 3TGNA 3IH2A 1F36A 1I50J 1RNLA 1E3PA 4NNJA 4M3BA 3AG1H 3KETA 1B9MA 3ZXSA 1XSVA 5ICCA 1P6RA 4BDZA 4RAYA 3DPLC 1TT5B 4I98B 1T33A 3HGGA 4FTHA 5F0HA 3R61A 3RKYA 4M71A 2FU4A 3CJRB 2MH2A 2LR8A 3O8HA 1U8RA 2CV0A 2K5CA 2LOOA 3GVAA 3H3UA 3W6KB 3FISA 1Z9CA 1VF9A 4EVIA 1OJLA 1S7OA 3IC7A 3BPXA 1HKSA 4V2FA 4ETSA 3KZYA 4OIPF 2HTSA 3TQNA 2F5CA 2WY7Q 4PJMA 1ZG5A 1IC8A 2NYXA 3T0YA 3GYHX 3CP2A 4UNOA 4A3DJ 5M5XJ 3ZMDA 4M6VA 5AIPA 4WXDA 2RGVA 1IXSB 3FHZA 2F5VA 2TDXA 2ECBA 2J5PA 2JTVA 5BNGA 1LEBA 2QKMB 1EF4A 3HUGB 1UZCA 3A2KA 3LSGA 2JVHA 5DEQA 2KDOA 1SEUA 4IHWA 2FRHA 1U6GA 4X0GA 4A5NA 1IDZA 3OIQA 3QP5A 1YQAA 4LMYA 4A6EA 2FMYA 1KGSA 3NAUA 4HAMA 3KP6A 4L5JA 1LKXA 2XB5A 2DFEA 4I7HA 3I54A 5IOYA 5C4JJ 4GCVA 4JOMA 4HW0A 3IHUA 1KQ0A 3PSIA 5EEGA 3E7LA 3T1BA 4ZC3A 3VFZA 2GIZA 3BLYA 3DBRB 2A5YB 2IA0A 4XKWA 2PMZA 2DJIA 1ON2A 1V4RA 1G3TA 2M9HA 3V8KA 4JBAA 4F91B 3L1PA 2ZNYA 4IKFA 3ABTA 2W57A 3X2QH 5CVIA 1LJ9A 1YG2A 4ZYHA 3JRCA 5M3FJ 1R36A 1OLTA 2WADA 3HRUA 3ZQFA 2HGCA 3PL8A 3LL7A 4BS9A 2ISYA 2ZBKA 1RI7A 2DA7A 1MNMC 1B8IA 1F43A 2MGQA 3SFZA 1BN5A 4A69C 5FRNA 2DT7B 3HEFA 4DOZA 4BEHA 2ZJRF 1SFXA 3OIOA 2BOLA 3HOUJ 1ZG1A 3QPTA 4A0ZA 3LFUA 1B6AA 1WH5A 1BM9A 2XAJA 4HEA2 2G9WA 5BPDA 1SMTA 2L2OA 3KEOA 3CLOA 4GYGA 1XCVA 4HRIA 1FOWA 3F22A 2DA2A 4B47A 4CYDA 2AXLA 3OR1C 2QQAA 3OR2C 2HYFA 3OYDA 2JA6J 2FNAA 3S3NA 3F6VA 2RREA 4YFKF 4P1WA 4ANJA 1IRFA 1TWAJ 2QQBA 3FK6A 5HNHA 2AHQA 4Z2YA 3W3CA 3LSPA 2OC6A 3CCUI 4YIFA 4Y17A 1YITI 3RPUA 5FB2A 2X1CA 4YIRX 1R00A 3QPLA 2JN6A 3MEXA 1WJBA 2JUCA 5TISC 1VQMI 2NOGA 1HW2A 2HOEA 2ZNZA 2L9VA 1V5EA 3DEUA 1FEXA 1HBXG 3SXYA 2R5ZB 2MH9A 2A61A 2QKLB 1CF7B 5KVRA 4A0XA 1B4AA 4B09A 5HNFA 2EZIA 2IA1A 3KEYA 3AFHA 3K1MA 2M87A 3DPUA 3MAJA 5EJCA 2VT2A 5LLQA 2O5RA 2ME6A 3NWTA 2DPUA 5J1YA 4ZDOA 1UJ8A 2Y0SA 2CJJA 1XGMA 3F8CA 5GAEJ 2XGDA 3MVPA 2ZJPF 2R7ZJ 3COAC 1R5GA 4G94A 1ZN2A 2CO5A 2QZ8A 1H9TA 4LB5A 1ON1A 3V8JA 1O3RA 3SDBA 5LRSA 2DMUA 4M9SA 3K1PA 4LLGF 2CH0A 1W36C 1XGNA 2LRDA 4G7OF 4QLCU 1VQOI 5EF6A 1M1EB 1U0JA 3GFMA 3G2BA 5IP6A 4ZYDA 3G73A 4BBSJ 2DT5A 2K27A 2GAUA 3I53A 4ZH4F 2HPMA 1YOVB 3FXKA 4D5CA 3DKYA 2JQ7A 2V26A 3MKLA 4FE7A 3K69A 4NC6A 1B1BA 1AKHB 1XD7A 1K61A 3BT9A 3GF2A 1YX3A 3K7AJ 4XONA 5TJJA 3GTMJ 4B44A 1MH3A 4XRSG 1AHDP 2DW4A 1WJEA 2M7BA 4BQOA 1QU3A 4JP0A 1BOBA 4LK0F 1K78A 1K7AA 3VOEA 3BCAA 4AWXB 4RLFA 3I3LA 2DI3A 1BIAA 3FM3A 2E2JJ 2H8WA 2AQEA 3MKWB 1PUEE 3HZJA 3F8MA 1ZREA 3RSNA 3WG7H 3Q0WA 1NK3P 1HA8A 1ZGWA 4YIIA 3CC7I 4CH7A 4MEXF 4IHTA 1IG7A 4F3QA 3A01B 5HS9A 2PFBA 3EUHC 3ECOA 3GWZA 2H94A 5FKKA 4YG2F 4WWCA 1ZG3A 1KU9A 3QPHA 5IP7J 2FJ1A 3JCUC 2IGMA 1JXSA 2KISA 4AYBA 4M3DA 4L9NA 4UB6C 2LG4A 3VYTB 2F4MB 2JRMA 4RBOA 1ITYA 2JSPA 3CJNA 1JUSA 2IS6A 1G8XA 3A01A 1SAUA 5C44J 1Y56A 3FMRA 4HX4A 4I01A 3I64A 1VQNI 3H5NA 2HKXA 4B4CA 2HPIA 1WPKA 3K2ZA 2WC2A 2E34A 4CGZA 4QIWN 1Y0UA 3QOEA 1FPQA 4U87A 4HLXA 2UV1A 3MD2A 3LFKA 3GMEA 4IVNA 3E1SA 5LRRA 5D5XB 2RNJA 3BR0A 2Y75A 2G7UA 2L9SA 2EINH 2XPUA 2Q2EB 2ACJA 1SAXA 2X6OA 1EH8A 1X2MA 2WAQN 1AU7A 3HJEA 4IJAA 1VQ8I 5E3OA 3CMAI 1O7FA 4LIVA 1I6XA 1YYVA 3OOUA 4DYRA 4A3KJ 1ERDA 2XKPA 2DFIA 2Z2SB 2R4GA 4W1UA 2DO7A 2EWNA 2ELKA 2HU9A 2KPMA 3O8GA 2CQ7A 3SZTA 3JRHA 4IHSA 3B02A 1T8IA 5KNLA 1T0FA 2DTRA 4AIHA 1TWFJ 1YS7A 4RGRA 4MNUA 1RUNA 1BI3A 1U5TC 5EEAA 4XSZF 2HYJA 4ZYGA 2EILH 3S15J 4UV9A 1OR7A 1JKQC 4D7NA 2PN6A 2O3FA 5TGTA 1W7PB 2X51A 2DN0A 4QWQA 2XC7A 4BXFA 3R60A 1EA3A 4XNFA 2CUEA 1P7IA 2OA4A 2V9KA 3IV5A 2JPBA 3V8LA 4GXOA 6PAXA 1YW7A 3CUOA 3REOA 5HLTA 4ENNA 1HDPA 4IOCF 1R1UA 2X6XA 4F93B 2R7FA 1CGPA 1W7PA 3DEEA 5FD6A 1F1ZA 4I02A 2XRLA 1BR4A 1W5TA 3RJPA 4EATA 5GAGJ 2CU7A 2ADUA 2OUMA 2FXAA 2CS3A 2LY1A 2UXXA 4HV5A 1A04A 5H6QA 1XS9A 1DDNA 1H0MA 3BR2A 4EEFG 3DTEA 1WJAA 2DA4A 5JHUA 5E17F 3K6GA 2ZFWA 3V7SA 4UV8A 4R8HA 2JSCA 4BU2A 1Z3YA 3NWSA 5FLVA 2BY1A 1O3QA 4AM3A 5B66C 1XMKA 5M5YJ 2FBIA 3CDIA 1I39A 2VKEA 2BZTA 2JVGA 3OYAA 4BYYA 2IS1A 1W36D 2W48A 1FSEA 2L7ZA 4M73A 4LK1F 3ASNH 1K79A 2D1HA 5D6FA 3ABMH 5BMZA 1O4XA 4BY1J 3RYPA 3C2BA 2VKDA 2DPDA 1R4NB 1PP8F 4KDPA 1Z7LA 1OYYA 4ZDPA 3CCYA 1OCRH 1LPQA 4C3JJ 5M3MJ 1O3TA 4DYQA 2V6CA 2KHMA 5F27A 4FT8A 3QRFF 4K2EA 2NVYJ 4CCLA 3SZGA 2R7QA 3OYLA 2DA5A 3K2AA 3L2VA 2DCEA 3GCMA 2YSRA 2IGKA 2VT3A 1H9GA 2BHYA 1TQMA 1YLFA 1QPMA 3GTGJ 5CKTA 2R7SA 3DKXA 3U9GA 2OU2A 1UG0A 2QLZA 1YTYA 3LSHA 1NH3A 2MW8A 3BZ6A 3ZCOA 1XCBA 4MHGA 1DU6A 4FHTA 3K4CA 3QOPA 4Y7NJ 3Q3SA 3ONQA 3S3MA 1MSFC 3ZQGA 3ROUA 5H2FC 2EIMH 3P9IA 1RKWA 4Y52J 2L3DA 4XLHA 2M45A 1MBGA 3OV8A 1WHUA 2HZDA 2XIGA 1BC7C 1WI9A 5DCMA 3MZYA 3N05A 2HQ5A 1SFEA 3CMMA 3FXQA 3CF2A 3EPZA 3K4KA 5L3BA 2CV1A 2B9SA 3FWEA 1WVRA 1SVOA 4RAFA 1ZTRA 1KYWA 2XGXA 2L7KA 2ZCWA 3FIWA 3OYEA 3GW2A 1Z1DA 4UB8C 3IRQA 3H3VK 3BDDA 4KICA 4BDYA 2VBXA 3HB9A 4M3GA 3V7RA 2YU9J 2EB7A 4UUSA 1ODDA 4DQ2A 1MBKA 4KITB 3HYIA 4A3GJ 3MN2A 2GOXB 4A6DA 3CCVI 4BUPA 3WTZA 2V1DA 2W4SA 2GA2A 2DA6A 3CUQB 4M6YA 2WAEA 2NVUB 1W0TA 1ZARA 2A6TA 3GBGA 3PNTA 2RAEA 3BROA 3KLOA 3K4NA 3CP8A 3CCJI 2XSJC 1D8JA 2MA3A 3OYGA 2BY3A 3RKWA 3WTTC 3I58A 3I4NJ 2DA3A 2IA2A 5FO5A 2V9PA 4UXNA 1C0WA 4LOCA 3LWFA 3CUQA 3JRGA 1HXDA 3BR5A 2QEXI 4Q5SF 3LSJA 1HOMA 4OIQF 1UG2A 2M0MA 3BJAA 5E79C 2DLLA 2LBFB 3MFKA 1DUXC 1MNDA 3IRRA 1D1CA 2HKOA 1WJFA 3JSOA 2WBMA 4G7ZF 2DFFA 2L7MP 1YJWI 3HG9A 1ZGJA 2FD5A 3R0JA 1J0RA 1GV5A 2LBFA 4XKVA 3U1DA 1OYWA 2AO9A 2H1KA 2PJPA 5F08A 3ZN0A 2ZXWH 1V5FA 2EA4A 1ETOA 2BXZA 2QQ8A 3K4LA 4AIKA 1TBXA 1DPUA 3CC4I 1VI0A 2EPFA 2LFBA 3MKZA 4E7LA 2A69F 2D45A 4RB2C 1WFXA 5DYMA 1MSEC 3H36A 2ESHA 4G6QA 4GRIA 5J4YA 5DUIA 1VFCA 1QO0D 3O6BB 2KZGA 3DPTA 2FUG2 4OIRF 4AU7A 3O3KA 2W82A 3BG3A 4BJTA 2JA2A 3M1EA 2O61A 3GTJJ 2K9QA 4L9TA 2R7RA 3OYKA 1HKQA 3F9KA 2P5KA 4IO9F 1L0OC 4GO1A 3TDUC 2VJJA 4U0YA 2STTA 1FIPA 2HDWA 1U9OA 3FHNA 2OZ6A 3OYHA 1MZBA 3R0AA 4HG2A 2Z3YA 3OYCA 1BOAA 2QCOA 2COMA 3M7GA 1W1WE 2NS0A 1SFKA 1WWXA 3GTPJ 5IYBJ 5LGNA 3CCLI 4G12A 3L2UA 2LSOA 3EYIA 2R0QC 3E5XA 4Y13A 3KEQA 5HDGA 2KIMA 4LITA 2ZKZA 3RQIA 2R5YB 1N75A 4C2TA 2LK2A 1JTYA 5HVQC 1WKMA 2DOFA 1B59A 1B72B 1R23A 3ABUA 1X4PA 3CO7C 2PLYA 1SFOJ 3S8PA 2B7EA 2FQ4A 1R5HA 3ML6A 1IW7F 5J47A 2K4BA 4BJ5C 1FYMA 4KN4X 3ZQ7A 3IH4A 3T8RA 2GM4A 1D8KA 5D4RA 3BJ6A 4E7IA 3FXRA 5FKLA 2E5ZA 2NOJB 3HRMA 4DYCA 2HDCA 1B72A 1MH4A 3OIPA 2RC4A 1N77A 4RGXA 5C3EJ 4V19K 2A3SA 3JSPA 1SC7A 4AIJA 2BVLA 1FZPB 3GFIA 1HW5A 2EIKH 2OAZA 2XPVA 3TEDA 5F0CA 3NARA 3MZ8A 3TDZC 4I0BA 1OISA 3CZ6A 2DOEA 3TO6A 2P4WA 3ZN1A 2IPQX 1MMDA 2CWEA 4HV6A 5GPAA 1KONA 2MLKA 3VSKA 1TC3C 1DPRA 1XN7A 1YW8A 3H5AA 3MWMA 2ECCA 2M4GA 1JTXA 2ZFUA 1V55H 4DBQA 4RAZA 3DQVC 3JREA 4PCQA 2M8EA 3WE2A 1FP1D 2DMQA 1K6OA 2NVQJ 5KCMA 3CCMI 4P9FA 1NK2P 3KCCA 2R7DA 3S2WA 5J4VA 3IAM2 5IP9J 3HOZJ 2COBA 3JAMZ 4F92B 1VQKI 3W2VA 2LC2A 5IOZA 4IPAA 4GGGA 9ANTA 3D5RC 3C1DA 2MD0A 2OCEA 3DKWA 2CQKA 3RKQA 1ZR4A 2VQHA 1O3SA 4KT6A 5CQEA 1MJAA 2F5DA 1R1VA 1LE8B 2IRFG 1BR1A 5FRMA 2VQCA 2LKXA 1T2KA 3HUGA 3GO5A 4EMSA 5FJ8J 4C3HJ 3M8FA 2E35A 1TL8A 4EJUA 3I5UA 2P7CB 2PX9A 1REPC 1BI0A 3ASOH 3TO9A 3FBIB 3J81Z 2M2EA 2KJCA 2FBHA 2ZO4A 1RRJA 3R6SA 3V42A 2JA8J 3S2DJ 3HSEA 2W25A 2LMDA 1HDDC 1WSUA 1J7KA 3DLLF 1MMSA 4MEYF 1ZGAA 3WTUC 3OY9A 3U2RA 1H88C 2QF7A 4YELA 4B43A 2MSYA 5DM7F 1FWZA 5LGTA 4FCYA 1GV2A 3QYFA 4QSHA 1FY7A 3LAJA 4P5OA 2HDDA 4RMNA 4LG0B 3GTQJ 2EFOA 1QRYA 3B6CA 1YFHA 4HF2A 2PMZN 4J19A 5ILVA 1T0FC 5D6EA 3BG6A 4IEJA 4LIUA 4QTRA 1D0XA 4I2OA 1WRJA 3BTJA 4PSXA 4ZTJA 1FP2A 4WXHA 1R22A 1X3WB 3BG7A 2D1VA 1HF0A 1UHMA 2ZSHB 1P92A 2VXDA 1MD0A 2VJ4A 1STZA 4XM3A 1OR7C 3HC7A 3WHCA 4L0YB 4HDUA 3MKYB 5DV5A 1VQ4I 4ESJA 1ETKA 3S1RJ 4WF2A 1TWCJ 3BTIA 4BHPA 2EJRA 3OWTA 4QPOA 5HS7A 3I59B 2LF8A 2E2IJ 1OYIA 3CJQB 3VYUB 1Z6TA 2YUSA 3RPUD 2MC3A 1W0UA 1K6YA 5DD8A 5BS6A 1Y1WJ 1SD5A 4XKCA 3S1NJ 5B1AH 4Y3OA 3BR6A 4F52A 4S05A 3WU0A 4Q47A 3F72A 3M1CA 3FKIJ 5E1XA 4P55A 4OIOF 4UVBA 1YE9A 1OQYA 1XMAA 2BYVE 4JQFA 1K4SA 3I59A 1U9NA 1GXPA 1BBYA 2M4KA 2E7XA 4C2UA 2XROA 2HNHA 3FMSA 3C18A 1TWHJ 4E70A 1YS6A 2CQNA 2OF7A 2V4JC 2IGNA 4LG3A 3ZMZA 1IRGA 4C3IJ 2V79A 3R4KA 1GVJA 3S2HJ 1HSJA 5ED4A 3ERMA 2QBYB 3C2GA 3O2PE 4CZCA 3ZP5A 1IN4A 4IHYA 3PO3J 2KT0A 4ZZLA 2X4HA 2CG4A 3GTOJ 4RLQA 1GT0C 4TV7A 2E1CA 1ENHA 2YPRA 1ETQA 2ID6A 2M34A 3BR3A 1P9QC 4HNTA 1YW9A 1LFUP 3ZGKA 2Y9ZA 4YFNF 2M30A 3CDLA 4L0ZB 2JA7J 2GZWA 4RB0A 2DK5A 2OQRA 5F1RA 2R5ZA 1OCTC 4IXAA 5DM6F 5AONA 3I4PA 3RCOA 4CUGA 1CF7A 2IS2A 2MBFA 3KZZA 1Z77A 2XASA 1FT9A 2ZMEC 3M4OJ 1MKMA 2R3SA
chains in the Genus database with same CATH topology
5C4XJ 1P7JA 2CUEA 1P7IA 1FJLA 3GTKJ 3IV5A 4V2GA 4HNVA 3ZQLA 4AUXA 2K40A 1OFCX 3A03A 1HDPA 5DS9A 2B63J 2Y0SN 2YS9A 1WI3A 3TW7A 1WH7A 1SANA 4A3IJ 2XRLA 1BJZA 2TCTA 4A3JJ 2CU7A 2LTPA 4X1EA 4UUTA 5K7HA 3S16J 2R92J 2Y30A 3ZQHA 4JX4A 1XS9A 4MLOA 3BR2A 4EEFG 3JRFA 1RR7A 1XC5A 3LSRA 2L7FP 1MBFA 2DA4A 1LE8A 1I6HJ 1JKOC 1IGNA 5FKMA 1HCRA 1POGA 1LFBA 3HOWJ 1ETYA 5FLVA 3ZOBA 1AKHA 3LOCA 5M5YJ 3BQYA 1A5JA 1XG1A 2VKEA 3GTLJ 3D1NI 2W48A 3BG5A 2L7ZA 3PM1A 2WB1N 5J1UA 2XPWA 2JA5J 1O4XA 4BY1J 5JLXA 1A6IA 3OSFA 4MFDA 5E3MA 3M3YJ 3QQAA 3C2BA 1RPWA 3S14J 4XIDA 2OPTA 3JRDA 4JYKA 3PO2J 3BTCA 3CCYA 1X58A 4C3JJ 1B8IB 5M3MJ 2O8KA 4DYQA 5JLWA 3RZDJ 5F27A 4XRMA 2Y31A 5IYDJ 5E3LA 1Q1VA 2NVYJ 4A3MJ 1ETVA 3K2AA 2DA5A 2LVSA 2E1OA 4I6ZA 3VPRA 5FLMJ 2GBYA 4XRSA 2XSDC 1BW5A 4FE4A 3GTGJ 2E19A 5M5WJ 1JT6A 2DTZA 2IEKA 2JJ7A 5DTDA 2MW8A 4C2MJ 2L0KA 2XGEA 5FKOA 3RZOJ 1DU6A 1BW6A 1FTTA 5EGOB 2ME0A 4XICA 4Y7NJ 3S1MJ 2GLOA 3Q3SA 1H89C 1E3OC 1MSFC 3ZQGA 3SDGA 1RKWA 4Y52J 2DMNA 4JX6A 1MBGA 1Z0XA 1ZQ3P 1I3QJ 1X2NA 3W6VA 2X9DA 1JJ6C 2HQ5A 1IDYA 5EGOA 2ID3A 1UHSA 1D5YA 1ZR2A 1ZTRA 3IH2A 1F36A 1I50J 1ORKA 4M3BA 3FIWA 2FX0A 5F0FA 3H3VK 2EH3A 2X48A 3IH3A 1T33A 3HGGA 4FTHA 2VKVA 3HB9A 5F0HA 4BY7J 4M3GA 3SJMA 2YU9J 4UUSA 1MBKA 2HI3A 2LR8A 3O8HA 4A3GJ 4S0HB 3BTLA 3MN2A 1IJWC 1G2HA 3TP3A 1UMQA 1MBJA 3FISA 5K7FA 4A3CJ 1VF9A 2DA6A 1RKTA 2EBIA 1W0TA 1OJLA 3GBGA 5EZHA 2D5VA 2VUMJ 2RAEA 1QVUA 1U8BA 4V2FA 4BBRJ 2I10A 4MO7A 1IC8A 2DA3A 3I4NJ 4A93J 4LOCA 4A3DJ 5M5XJ 3CMYA 4M6VA 3JRGA 3BR5A 2L9RA 3LSJA 3A02A 1HOMA 2NS7A 1UG2A 2ECBA 5BNGA 2O7OA 5K7ZA 5E3NA 4DZPA 5EDNA 1EF4A 3LSGA 2JK3A 1BL0A 2L7MP 1JKPC 4XK4A 4IHWA 4BKXA 2E2HJ 1IDZA 4D7MA 5HODA 1MBHA 3BR1A 3HM5A 2CQQA 3I4MJ 2FD5A 3NAUA 1GV5A 2JWTA 1MBEA 2XGCA 4DZJA 3G1LA 2XB5A 2AO9A 2H1KA 5IOYA 5F08A 5C4JJ 2K9NA 2XB0X 1ETOA 1VI0A 2LFBA 3E7LA 1T56A 2JMWA 1GDTA 5FKNA 1MSEC 1IRZA 2VPRA 1VFCA 1NTCA 1BA5A 2HOTA 4GFBA 2M9HA 4M3FA 3BG3A 1S7EA 3L1PA 4CYCB 1IUFA 3GTJJ 2K9QA 1ZKGA 3ZQIA 2EZKA 2CQXA 3TP0A 3JRCA 2TRTA 5M3FJ 2M8GX 1FIPA 3SFIA 3ZQCA 3OSGA 3ZQFA 1U9OA 4W97A 3DEWA 2NVXJ 4AC0A 4CYCA 2DA7A 2QCOA 1GVDA 1MNMC 2LD5A 4IHXA 1B8IA 5EG0B 1F43A 3DCFA 1VNDA 2LY9A 2MGQA 4A69C 3GTPJ 3HEFA 5IYBJ 4G12A 1HLVA 1RESA 4AYBN 3H0GJ 2R0QC 3OIOA 5EZGA 3HOUJ 3HOVJ 3FK7A 3HOXJ 2EZHA 3RQIA 2R5YB 1JJ8C 2LK2A 1APLC 1WH5A 1JTYA 4DW6A 4RDUA 4A3FJ 1PUFB 5EG0A 1B72B 2VI6A 1SFOJ 2DA2A 2FQ4A 4BXXJ 2R93J 3IH4A 2CRGA 2JA6J 1JGGA 2GM4A 4MFEA 5FKLA 3CQZJ 1PUFA 1TWAJ 3FK6A 2IAIA 2AHQA 3Q0VA 4DYCA 3LSPA 1B72A 2N8GA 1MH4A 2NS8A 5C3EJ 4A3EJ 3LNQA 3S1QJ 5F1JA 1H8AC 2HXOA 3QPLA 1IV6A 2XPVA 3TEDA 5F0CA 3NARA 2JN6A 1R9TJ 1ZK8A 1DU0A 2NOGA 1FEXA 5GPAA 2Y9YA 2R5ZB 1TC3C 1WCMJ 1YRNB 4MIMA 3WHBA 2EZIA 3TW6A 3JRIA 2ECCA 2MG4A 1JTXA 1QPIA 2HXIA 2ME6A 1U78A 3JREA 3HGYA 5J1YA 2CJJA 2ZB9A 3UKGA 2DMQA 2XGDA 2NVQJ 3MVPA 1JUMA 2M0CA 2R7ZJ 1NK2P 3HBLA 1YRNA 3G1MA 1CQTA 3G1OA 4FISA 5IP9J 3F0CA 3HOZJ 2COBA 5EYRA 2DMUA 3HKZN 2DA1A 5IOZA 9ANTA 5GPCA 2HOSA 5EF6A 3RKQA 1ZR4A 5IP6A 4BBSJ 1LE8B 3S17J 2CUFA 2LKXA 4D5CA 1JKRC 5FJ8J 4C3HJ 2K9SA 3MKLA 4FE7A 4X6AJ 3JRAA 1AKHB 1TWGJ 1K61A 2M2EA 3BT9A 2HOAA 4D5FA 2EZLA 3K7AJ 2JA8J 3GTMJ 3S2DJ 2DJNA 1MH3A 2IBDA 4XRSG 1AHDP 1HDDC 4JP0A 2Y2ZA 1H88C 3HDDA 4A3LJ 1JT0A 2QF7A 2MSYA 4IHVA 4FCYA 1GV2A 4NDLA 4QSHA 2E2JJ 2HDDA 1K83J 3GTQJ 3Q0WA 1QRYA 1NK3P 3B6CA 1ZGWA 2PMZN 5J3LA 4J19A 5F04A 1IG7A 3A01B 2DMTA 4IEJA 3BQZA 4QTRA 5FKKA 3BTJA 5IP7J 1HF0A 2FJ1A 3JRBA 1JUPA 2DMPA 4M3DA 5IPAA 3B6AA 1WGXA 3WHCA 4RBOA 1ITYA 1ETKA 3S1RJ 1JUSA 3A01A 1TWCJ 2KDZA 3BTIA 5C44J 2E2IJ 2O9LA 2YUSA 1W0UA 1GUUA 3BG9A 4B4CA 1Y1WJ 1WPKA 2LLKA 3S1NJ 2R5YA 3BR6A 4QIWN 3FKIJ 1FIAA 4B1RA 2G0EA 4JX5A 4L5EA 1U9NA 3BR0A 2XPUA 2WV1A 1TWHJ 2OF7A 2X6OA 1X2MA 2WAQN 1AU7A 4C3IJ 3HOYJ 4M3EA 1Y1VJ 2EQRA 1RETA 2P81A 5E3OA 1QVTA 5GP9A 3QPSA 3OOUA 3S2HJ 4DYRA 4A3KJ 4UUSB 1FTZA 4W1UA 4I76A 4IHYA 3PO3J 2KT0A 3GTOJ 2ELKA 3JRHA 3O8GA 1GT0C 2H8RA 2LP0A 1ETXA 5IYCJ 1ENHA 1ETWA 1ETQA 2ID6A 2M34A 3BR3A 1LFUP 1TWFJ 3JR9A 2Y9ZA 4ABZA 3CDLA 2JA7J 3Q0UA 5J1RA 5EEAA 2HYJA 2R5ZA 1OCTC 3S15J 1OCPA 4B3AA 1JKQC 4D7NA 1Z77A 2NVTJ 2DN0A 3M4OJ 4A3BJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C4X J;  1P7J A;  2CUE A;  1P7I A;  1FJL A;  3GTK J;  3IV5 A;  4V2G A;  4HNV A;  3ZQL A;  4AUX A;  2K40 A;  1OFC X;  3A03 A;  1HDP A;  5DS9 A;  2B63 J;  2Y0S N;  2YS9 A;  1WI3 A;  3TW7 A;  1WH7 A;  1SAN A;  4A3I J;  2XRL A;  1BJZ A;  2TCT A;  4A3J J;  2CU7 A;  2LTP A;  4X1E A;  4UUT A;  5K7H A;  3S16 J;  2R92 J;  2Y30 A;  3ZQH A;  4JX4 A;  1XS9 A;  4MLO A;  3BR2 A;  4EEF G;  3JRF A;  1RR7 A;  1XC5 A;  3LSR A;  2L7F P;  1MBF A;  2DA4 A;  1LE8 A;  1I6H J;  1JKO C;  1IGN A;  5FKM A;  1HCR A;  1POG A;  1LFB A;  3HOW J;  1ETY A;  5FLV A;  3ZOB A;  1AKH A;  3LOC A;  5M5Y J;  3BQY A;  1A5J A;  1XG1 A;  2VKE A;  3GTL J;  3D1N I;  2W48 A;  3BG5 A;  2L7Z A;  3PM1 A;  2WB1 N;  5J1U A;  2XPW A;  2JA5 J;  1O4X A;  4BY1 J;  5JLX A;  1A6I A;  3OSF A;  4MFD A;  5E3M A;  3M3Y J;  3QQA A;  3C2B A;  1RPW A;  3S14 J;  4XID A;  2OPT A;  3JRD A;  4JYK A;  3PO2 J;  3BTC A;  3CCY A;  1X58 A;  4C3J J;  1B8I B;  5M3M J;  2O8K A;  4DYQ A;  5JLW A;  3RZD J;  5F27 A;  4XRM A;  2Y31 A;  5IYD J;  5E3L A;  1Q1V A;  2NVY J;  4A3M J;  1ETV A;  3K2A A;  2DA5 A;  2LVS A;  2E1O A;  4I6Z A;  3VPR A;  5FLM J;  2GBY A;  4XRS A;  2XSD C;  1BW5 A;  4FE4 A;  3GTG J;  2E19 A;  5M5W J;  1JT6 A;  2DTZ A;  2IEK A;  2JJ7 A;  5DTD A;  2MW8 A;  4C2M J;  2L0K A;  2XGE A;  5FKO A;  3RZO J;  1DU6 A;  1BW6 A;  1FTT A;  5EGO B;  2ME0 A;  4XIC A;  4Y7N J;  3S1M J;  2GLO A;  3Q3S A;  1H89 C;  1E3O C;  1MSF C;  3ZQG A;  3SDG A;  1RKW A;  4Y52 J;  2DMN A;  4JX6 A;  1MBG A;  1Z0X A;  1ZQ3 P;  1I3Q J;  1X2N A;  3W6V A;  2X9D A;  1JJ6 C;  2HQ5 A;  1IDY A;  5EGO A;  2ID3 A;  1UHS A;  1D5Y A;  1ZR2 A;  1ZTR A;  3IH2 A;  1F36 A;  1I50 J;  1ORK A;  4M3B A;  3FIW A;  2FX0 A;  5F0F A;  3H3V K;  2EH3 A;  2X48 A;  3IH3 A;  1T33 A;  3HGG A;  4FTH A;  2VKV A;  3HB9 A;  5F0H A;  4BY7 J;  4M3G A;  3SJM A;  2YU9 J;  4UUS A;  1MBK A;  2HI3 A;  2LR8 A;  3O8H A;  4A3G J;  4S0H B;  3BTL A;  3MN2 A;  1IJW C;  1G2H A;  3TP3 A;  1UMQ A;  1MBJ A;  3FIS A;  5K7F A;  4A3C J;  1VF9 A;  2DA6 A;  1RKT A;  2EBI A;  1W0T A;  1OJL A;  3GBG A;  5EZH A;  2D5V A;  2VUM J;  2RAE A;  1QVU A;  1U8B A;  4V2F A;  4BBR J;  2I10 A;  4MO7 A;  1IC8 A;  2DA3 A;  3I4N J;  4A93 J;  4LOC A;  4A3D J;  5M5X J;  3CMY A;  4M6V A;  3JRG A;  3BR5 A;  2L9R A;  3LSJ A;  3A02 A;  1HOM A;  2NS7 A;  1UG2 A;  2ECB A;  5BNG A;  2O7O A;  5K7Z A;  5E3N A;  4DZP A;  5EDN A;  1EF4 A;  3LSG A;  2JK3 A;  1BL0 A;  2L7M P;  1JKP C;  4XK4 A;  4IHW A;  4BKX A;  2E2H J;  1IDZ A;  4D7M A;  5HOD A;  1MBH A;  3BR1 A;  3HM5 A;  2CQQ A;  3I4M J;  2FD5 A;  3NAU A;  1GV5 A;  2JWT A;  1MBE A;  2XGC A;  4DZJ A;  3G1L A;  2XB5 A;  2AO9 A;  2H1K A;  5IOY A;  5F08 A;  5C4J J;  2K9N A;  2XB0 X;  1ETO A;  1VI0 A;  2LFB A;  3E7L A;  1T56 A;  2JMW A;  1GDT A;  5FKN A;  1MSE C;  1IRZ A;  2VPR A;  1VFC A;  1NTC A;  1BA5 A;  2HOT A;  4GFB A;  2M9H A;  4M3F A;  3BG3 A;  1S7E A;  3L1P A;  4CYC B;  1IUF A;  3GTJ J;  2K9Q A;  1ZKG A;  3ZQI A;  2EZK A;  2CQX A;  3TP0 A;  3JRC A;  2TRT A;  5M3F J;  2M8G X;  1FIP A;  3SFI A;  3ZQC A;  3OSG A;  3ZQF A;  1U9O A;  4W97 A;  3DEW A;  2NVX J;  4AC0 A;  4CYC A;  2DA7 A;  2QCO A;  1GVD A;  1MNM C;  2LD5 A;  4IHX A;  1B8I A;  5EG0 B;  1F43 A;  3DCF A;  1VND A;  2LY9 A;  2MGQ A;  4A69 C;  3GTP J;  3HEF A;  5IYB J;  4G12 A;  1HLV A;  1RES A;  4AYB N;  3H0G J;  2R0Q C;  3OIO A;  5EZG A;  3HOU J;  3HOV J;  3FK7 A;  3HOX J;  2EZH A;  3RQI A;  2R5Y B;  1JJ8 C;  2LK2 A;  1APL C;  1WH5 A;  1JTY A;  4DW6 A;  4RDU A;  4A3F J;  1PUF B;  5EG0 A;  1B72 B;  2VI6 A;  1SFO J;  2DA2 A;  2FQ4 A;  4BXX J;  2R93 J;  3IH4 A;  2CRG A;  2JA6 J;  1JGG A;  2GM4 A;  4MFE A;  5FKL A;  3CQZ J;  1PUF A;  1TWA J;  3FK6 A;  2IAI A;  2AHQ A;  3Q0V A;  4DYC A;  3LSP A;  1B72 A;  2N8G A;  1MH4 A;  2NS8 A;  5C3E J;  4A3E J;  3LNQ A;  3S1Q J;  5F1J A;  1H8A C;  2HXO A;  3QPL A;  1IV6 A;  2XPV A;  3TED A;  5F0C A;  3NAR A;  2JN6 A;  1R9T J;  1ZK8 A;  1DU0 A;  2NOG A;  1FEX A;  5GPA A;  2Y9Y A;  2R5Z B;  1TC3 C;  1WCM J;  1YRN B;  4MIM A;  3WHB A;  2EZI A;  3TW6 A;  3JRI A;  2ECC A;  2MG4 A;  1JTX A;  1QPI A;  2HXI A;  2ME6 A;  1U78 A;  3JRE A;  3HGY A;  5J1Y A;  2CJJ A;  2ZB9 A;  3UKG A;  2DMQ A;  2XGD A;  2NVQ J;  3MVP A;  1JUM A;  2M0C A;  2R7Z J;  1NK2 P;  3HBL A;  1YRN A;  3G1M A;  1CQT A;  3G1O A;  4FIS A;  5IP9 J;  3F0C A;  3HOZ J;  2COB A;  5EYR A;  2DMU A;  3HKZ N;  2DA1 A;  5IOZ A;  9ANT A;  5GPC A;  2HOS A;  5EF6 A;  3RKQ A;  1ZR4 A;  5IP6 A;  4BBS J;  1LE8 B;  3S17 J;  2CUF A;  2LKX A;  4D5C A;  1JKR C;  5FJ8 J;  4C3H J;  2K9S A;  3MKL A;  4FE7 A;  4X6A J;  3JRA A;  1AKH B;  1TWG J;  1K61 A;  2M2E A;  3BT9 A;  2HOA A;  4D5F A;  2EZL A;  3K7A J;  2JA8 J;  3GTM J;  3S2D J;  2DJN A;  1MH3 A;  2IBD A;  4XRS G;  1AHD P;  1HDD C;  4JP0 A;  2Y2Z A;  1H88 C;  3HDD A;  4A3L J;  1JT0 A;  2QF7 A;  2MSY A;  4IHV A;  4FCY A;  1GV2 A;  4NDL A;  4QSH A;  2E2J J;  2HDD A;  1K83 J;  3GTQ J;  3Q0W A;  1QRY A;  1NK3 P;  3B6C A;  1ZGW A;  2PMZ N;  5J3L A;  4J19 A;  5F04 A;  1IG7 A;  3A01 B;  2DMT A;  4IEJ A;  3BQZ A;  4QTR A;  5FKK A;  3BTJ A;  5IP7 J;  1HF0 A;  2FJ1 A;  3JRB A;  1JUP A;  2DMP A;  4M3D A;  5IPA A;  3B6A A;  1WGX A;  3WHC A;  4RBO A;  1ITY A;  1ETK A;  3S1R J;  1JUS A;  3A01 A;  1TWC J;  2KDZ A;  3BTI A;  5C44 J;  2E2I J;  2O9L A;  2YUS A;  1W0U A;  1GUU A;  3BG9 A;  4B4C A;  1Y1W J;  1WPK A;  2LLK A;  3S1N J;  2R5Y A;  3BR6 A;  4QIW N;  3FKI J;  1FIA A;  4B1R A;  2G0E A;  4JX5 A;  4L5E A;  1U9N A;  3BR0 A;  2XPU A;  2WV1 A;  1TWH J;  2OF7 A;  2X6O A;  1X2M A;  2WAQ N;  1AU7 A;  4C3I J;  3HOY J;  4M3E A;  1Y1V J;  2EQR A;  1RET A;  2P81 A;  5E3O A;  1QVT A;  5GP9 A;  3QPS A;  3OOU A;  3S2H J;  4DYR A;  4A3K J;  4UUS B;  1FTZ A;  4W1U A;  4I76 A;  4IHY A;  3PO3 J;  2KT0 A;  3GTO J;  2ELK A;  3JRH A;  3O8G A;  1GT0 C;  2H8R A;  2LP0 A;  1ETX A;  5IYC J;  1ENH A;  1ETW A;  1ETQ A;  2ID6 A;  2M34 A;  3BR3 A;  1LFU P;  1TWF J;  3JR9 A;  2Y9Z A;  4ABZ A;  3CDL A;  2JA7 J;  3Q0U A;  5J1R A;  5EEA A;  2HYJ A;  2R5Z A;  1OCT C;  3S15 J;  1OCP A;  4B3A A;  1JKQ C;  4D7N A;  1Z77 A;  2NVT J;  2DN0 A;  3M4O J;  4A3B J; 
#chains in the Genus database with same CATH topology
 1KZH A;  5C4X J;  1U3E M;  3BC8 A;  1W4M A;  1SD7 A;  3E5U A;  3KFW X;  3NRV A;  2IGO A;  4BHB A;  2B63 J;  2Y0S N;  1MMN A;  3KPH A;  3LSI A;  1F5T A;  2H6C A;  4RS8 A;  3TW7 A;  1P4X A;  1XDS A;  5E20 A;  2LH9 A;  4A3J J;  2L5Q A;  1P2F A;  2LTP A;  4X1E A;  3BP8 A;  2HYG D;  4A2U A;  2OTJ I;  3QYE A;  2BW3 B;  4BE2 A;  4JX4 A;  4B8X A;  4HX7 A;  4FX0 A;  4ENJ A;  3K9T A;  1YI2 I;  3EUA A;  1VQP I;  2I5U A;  4BAY A;  5F6F A;  1RR7 A;  2IJL A;  2KKO A;  3OYI A;  3TBI A;  4UVC A;  1I6H J;  5LHH A;  1SD4 A;  2BY2 A;  3AKZ A;  4EM1 A;  1HCR A;  5GAH J;  4XLC A;  4FAS D;  1ETY A;  2BW3 A;  3ZOB A;  1AKH A;  3LQQ A;  4IRG A;  3ECH A;  4B3X A;  1A5J A;  1XG1 A;  3RDI A;  3DFG A;  3S3O A;  2K9L A;  3LA3 A;  3D1N I;  1OCC H;  3SQN A;  2XPW A;  1A6I A;  4CCO A;  5EEH A;  5KAI C;  4L18 B;  1KQ9 A;  3WTY C;  1RPW A;  3E6M A;  3S14 J;  2E1M B;  2CW7 A;  4LD5 A;  2OPT A;  3PFI A;  2Q8K A;  3CME I;  4CIC A;  1SD6 A;  2UXN A;  1K4T A;  2Y31 A;  1ETV A;  1A36 A;  3AL0 B;  2KQR A;  3VEP A;  4DBR A;  1GHC A;  4KJZ A;  1MW7 A;  1MJB A;  3ISP A;  4XRS A;  2XSD C;  1ZYR F;  4XLN F;  1IN6 A;  4OAZ A;  4XN0 A;  4DJA A;  4ZYE A;  5DCF A;  2DBB A;  2CMP A;  3H0D A;  3K70 C;  4EJO A;  5CQG A;  5M5W J;  1WJ5 A;  1R58 A;  2CUJ A;  2JUG A;  3L09 A;  2E5N A;  3OS0 A;  5BOX A;  3CUQ C;  1FTT A;  2X1D A;  5EGO B;  3HOS A;  1T6S A;  2KRF A;  2GLO A;  2Y48 A;  1H89 C;  1I27 A;  1E3O C;  1VQ7 I;  2OBP A;  2L02 A;  2LNB A;  2MAB A;  2DMN A;  5A2Q Z;  1A35 A;  4JX6 A;  1XSX A;  2LKS A;  1Z0X A;  2ZC2 A;  3LMM A;  1ZQ3 P;  3VWB A;  2FML A;  4HBL A;  2Y0M A;  2WAQ A;  2KP6 A;  3GEZ A;  1JJ6 C;  2P8T A;  5EGO A;  1R4M B;  2VB6 A;  1Z7U A;  4E4H A;  2CYY A;  3GZ6 A;  2OZU A;  2DYR H;  2Q2E A;  2K86 A;  2KJB A;  2KRH A;  2XAG A;  1DGR M;  1QHH D;  5F0F A;  1RUO A;  1IZ1 A;  2VKV A;  3FMQ A;  3E3V A;  4Q4Z F;  4S0H B;  3BTL A;  3QYB A;  1P4A A;  1OCZ H;  2GXB A;  3L7W A;  5K7F A;  5E1Z B;  1FBQ A;  2VBY A;  1W7P D;  2EBI A;  2ELH A;  2ZXJ A;  4RM2 A;  5ICF A;  2V9V A;  2P5V A;  1XX5 A;  3D5L A;  1QVU A;  1T95 A;  2D5V A;  3CTA A;  3H9G A;  2VUM J;  4YRV A;  1U8B A;  4RGU A;  5DDG A;  4BBR J;  3W2W A;  1YJN I;  1JI8 A;  2EFQ A;  4MO7 A;  4BH9 A;  2P6S A;  3C3W A;  3CJT B;  1RIO H;  1IV8 A;  5BPI A;  1R6R A;  1V3F A;  4O5V A;  4A93 J;  2GWR A;  4NB5 A;  3CMY A;  2OD5 A;  1GXQ A;  4OIN F;  1TW3 A;  2L9R A;  1LDJ A;  1N78 A;  3A02 A;  5AIQ A;  5K7Z A;  1QQI A;  3I55 I;  1ZRC A;  3HL2 A;  4DZP A;  5ILU A;  3BPV A;  3CCQ I;  4E7Z A;  3W2A A;  2JK3 A;  1QZE A;  1XTA A;  3DBH B;  3OYJ A;  1J09 A;  3KP5 A;  4BKX A;  4MTE A;  3HPH A;  2E2H J;  4D7M A;  1UAA A;  4XLE A;  3HM5 A;  3ZPL A;  2DOA A;  4RB3 C;  1YHQ I;  1MBE A;  2XGC A;  2DFH A;  2YX4 A;  3G1L A;  4U88 A;  4WK8 F;  2ZME B;  2VN2 A;  2GXA A;  2XB0 X;  3ZMS A;  4WCG A;  4GYI A;  2XAU A;  2GQQ A;  1T56 A;  3K4B A;  2ZXH A;  1IRZ A;  2DT6 A;  2WV0 A;  2W7N A;  1OCO H;  1SVM A;  3PUF A;  2ZME A;  2ZSI B;  4HF1 A;  4GFB A;  3H35 A;  1FLI A;  3DU5 A;  3FBN B;  4XR6 A;  3CCS I;  2DOD A;  3A0H C;  4XLP F;  4E7J A;  2E1N A;  4CYC B;  2C6Y A;  4U0W A;  3M07 A;  4D9J A;  3LA7 A;  4M9Z A;  4A5M A;  1E17 A;  2CQX A;  2PG4 A;  4IX7 A;  5H20 A;  3TP0 A;  2HVS A;  5FD5 A;  2K7L A;  1J5Y A;  4N9H A;  1FNN A;  3SFI A;  3OSG A;  4ITV A;  1WQ2 A;  2BY0 A;  2EIJ H;  4AC0 A;  4CYC A;  1GVD A;  4IHX A;  3SEQ A;  3DCF A;  4HPQ A;  1S72 I;  1ZLJ A;  3TMO A;  1HLV A;  1RES A;  2VXZ A;  2X6W A;  3H0G J;  5E8I A;  3GX4 X;  1R71 A;  2F4O B;  5D5W B;  3WTW C;  3HOV J;  3FM5 A;  1B9N A;  3FK7 A;  5IT9 Z;  2GXG A;  4HA8 A;  4HST A;  2EZH A;  2HS5 A;  5CJ9 A;  3GUD A;  1APL C;  2ZJQ F;  4RDU A;  2VIX A;  3E6C C;  3VB2 A;  2VI6 A;  4PJ0 C;  2E7W A;  2QSH X;  3BCB A;  3ZQQ A;  3L00 A;  1ZLK A;  2P5L C;  4IQJ A;  1JGG A;  2V6E A;  3RIR A;  4MFE A;  3FX3 A;  1T39 A;  4EM0 B;  1XGS A;  3CQZ J;  2VLA A;  2XKO A;  1WJC A;  2NS8 A;  1QHG A;  2P0W A;  2W24 A;  2VOP A;  5CLS A;  2VJ5 A;  3LNQ A;  1FOK A;  1ZAO A;  5F1J A;  4P9U A;  1DP3 A;  5J8C A;  1FBU A;  4KNY A;  1X1B A;  1R9T J;  2WAF A;  2H09 A;  1ZK8 A;  1Y0N A;  5FRO A;  5HLH A;  3IWZ A;  1D5V A;  2Q1Z B;  2G7H A;  1FOY A;  5JVG F;  1BC8 C;  3B73 A;  1KQ8 A;  2O6G E;  1Z3X A;  4MQV A;  5IT3 A;  1YRN B;  1G6N A;  5GTH C;  4CDG A;  3WHB A;  2EA2 A;  3TW6 A;  3JRI A;  2X85 A;  2P7V B;  2MG4 A;  1HQC A;  4NQW B;  3G3Z A;  4H0E A;  4CA0 A;  5ILS A;  4PUS A;  1U78 A;  2QGU A;  4E6K G;  5B5E C;  2RDP A;  3AAF A;  3UKG A;  2IVM A;  2M0C A;  3VOD A;  3HBL A;  1YRN A;  1CQT A;  2X0L A;  3G1O A;  3LST A;  4FIS A;  2R7V A;  3F0C A;  4KMU X;  4NQW A;  5EYR A;  1LDK B;  2FA5 A;  3HKZ N;  1S8N A;  1Z91 A;  3OYN A;  1IN5 A;  5GPC A;  2HOS A;  2FOK A;  2K3P A;  2K4J A;  3HHG A;  3T8T A;  1FSH A;  1USS A;  2M7A A;  1FX7 A;  3H92 A;  1R5I D;  2XHK A;  2E71 A;  2CUF A;  1IN7 A;  2DAO A;  5K5R A;  3HTU A;  2QUF A;  1JKR C;  3L2R A;  1MGT A;  2NAZ A;  4XLF A;  3IKV A;  4PZJ A;  2XRN A;  1TWG J;  2VQG A;  4F55 A;  1E2X A;  1TQI A;  4PGG A;  3DP7 A;  2HOA A;  4ASN A;  1VQ5 I;  4M72 A;  4D5F A;  2EZL A;  3OS1 A;  2WB1 A;  5H6R A;  3JAM K;  3GFL A;  1D3Y A;  2DJN A;  3LSK A;  2EV0 A;  2MLG A;  1FOX A;  5L3F A;  1D0Z A;  3P9C A;  2Y2Z A;  3QAH A;  3FDY A;  1JT0 A;  4UY8 I;  1UFM A;  3AG3 H;  4NDL A;  2FBK A;  3P9K A;  1HW1 A;  3WGG A;  4DGW B;  4PFO A;  4HF0 A;  1K83 J;  4EV0 A;  1XMX A;  2A05 A;  1OPC A;  5J40 A;  5J3L A;  2OQG A;  1W5S A;  5F04 A;  3ZR8 X;  2QM3 A;  3S32 A;  4E7S A;  2Z16 A;  1HC8 A;  1ZRD A;  2KIQ A;  3J81 K;  2DK8 A;  4P96 A;  3H3Z A;  2JRT A;  4HSR A;  4LJZ F;  1EV7 A;  3PQJ A;  4FET A;  4BXU A;  3JRB A;  3MZH A;  4PJJ A;  1JUP A;  2DMP A;  2F6C A;  2HR3 A;  1X1C A;  5IPA A;  3I56 I;  3B6A A;  4LLL A;  2JZY A;  4G7H F;  2HEO A;  1WGX A;  2UZK A;  2Q0O A;  2QWW A;  3A0B C;  4M9X A;  2RN7 A;  4L9J A;  3J7A O;  2KDZ A;  3FXO A;  2KZV A;  4BNC A;  4CCN A;  4EJT A;  2O9L A;  2VL8 A;  4IL6 C;  3CES A;  2LLK A;  4HDV A;  2A5W A;  2R5Y A;  3K1N A;  2MYS A;  3P5J A;  1OKR A;  5K5Q A;  1Y8Q B;  4N0B A;  3HOT A;  1FIA A;  3Q9V A;  4WX9 A;  4OWR B;  4B1R A;  1X1P A;  4L5E A;  1UCR A;  2DYS H;  2H6B A;  4ENM A;  2QSG X;  4PK4 A;  3Q9S A;  2WV1 A;  5HS8 A;  3DU6 A;  5L3E A;  1YJ9 I;  2J5O A;  2FQ3 A;  2WWY A;  4M3E A;  2EQR A;  4IQ4 A;  1RET A;  1SMY F;  2VC0 A;  1QVT A;  5GP9 A;  3GZN B;  4IZZ A;  3S93 A;  1FTZ A;  3CLQ A;  1QA6 A;  1WJD A;  1Z21 A;  2B0L A;  3TO7 A;  4HQE A;  3V4G A;  2FSW A;  4U7D A;  4N4O B;  3KP3 A;  2H8R A;  2LP0 A;  1ETX A;  3NEU A;  3ERE D;  4NHJ A;  2WY8 Q;  4BQN A;  1IUY A;  2AXT C;  3F21 A;  3HRT A;  3JTH A;  4ABZ A;  1PP7 U;  3Q0U A;  5B3S H;  2L4A A;  1R7J A;  5GTI C;  3EDP A;  3A1Y A;  2DU9 A;  2F4I A;  2X6Y A;  4B3A A;  3VDX A;  2NVT J;  3UNG C;  2Z9O A;  3PJR A;  4A3B J;  1P7J A;  2Z99 A;  3LA2 A;  2LF7 A;  3H9J A;  4V2G A;  2V1U A;  2K40 A;  4PJN A;  3BZK A;  2BVM A;  3TL4 X;  2DQR A;  1KYZ A;  3KZI C;  3RTR A;  4AD9 A;  3J7A Y;  3OL4 A;  1WH7 A;  2E1M C;  4A3I J;  4PFP A;  3CO6 C;  1MMG A;  4XOT A;  1P4W A;  2PEX A;  3KP2 A;  4IOA F;  1FYL A;  1XDU A;  4UUT A;  5K7H A;  2Y30 A;  3ZQH A;  4PDK A;  5E18 F;  5HLI A;  1ZRF A;  1ULY A;  1G3S A;  5CVU A;  4MLO A;  1JE8 A;  5FFX A;  3AL0 C;  3JRF A;  1XC5 A;  2W00 A;  1MBF A;  4HYE A;  4KMF A;  1MIJ A;  2VQL A;  2FF4 A;  2VAS A;  1IXR C;  1RZ4 A;  4ENK A;  1JKO C;  1LE8 A;  1IGN A;  3HPG A;  5FKM A;  2XDV A;  4KN7 X;  4BJ6 C;  1IXC A;  3HOW J;  4LB6 B;  2IT0 A;  2VPL A;  3ESW B;  2KMU A;  2XAQ A;  4CHU A;  3KYL A;  3WE3 A;  3VYR B;  3GTL J;  2ELJ A;  2EFP A;  5FGM A;  3BG5 A;  2IP2 A;  4AID A;  1IF1 A;  4ZYA A;  2VE8 A;  2HVR A;  2W85 A;  3KYC B;  1Q1H A;  3H1C A;  2EV6 A;  4AVZ A;  3HHH A;  5ERI A;  1NG7 A;  5HLG A;  3PO2 J;  4JYK A;  5K5O A;  2DDB A;  1PJR A;  1TT0 A;  1U2W A;  2K85 A;  3DTI A;  3EET A;  2BV6 A;  1RR8 C;  1B8I B;  4M74 A;  2O8K A;  4LG0 A;  5JLW A;  3RZD J;  4I09 A;  4XRM A;  5E3L A;  1Q1V A;  4BEH B;  4OMY A;  3DXJ F;  2LVS A;  2KRC A;  4I6Z A;  1VTN C;  2AS5 F;  4LFU A;  3F3X A;  2WTE A;  1BW5 A;  3KE2 A;  1MNE A;  1JT6 A;  5IY5 H;  1FBS A;  5B1B H;  1EKE A;  2IEK A;  3FXU A;  4E7K A;  2JJ7 A;  1MJ9 A;  4C2M J;  1G3Y A;  1J75 A;  1LNW A;  5FKO A;  1X1D A;  3IKT A;  1BW6 A;  3M9A A;  1N25 A;  2FEZ A;  4XIC A;  3S1M J;  1D1A A;  3E0J B;  3EUK L;  4FQG A;  4EJW A;  1X19 A;  3SDG A;  1FMV A;  3MMY B;  2IS4 A;  4UHT A;  5L3C A;  5D5V B;  5CPR B;  1X2N A;  2JT1 A;  4NC7 A;  4RAG A;  4Y33 A;  2PI0 A;  2A6E F;  4BQQ A;  2HFH A;  2VBW A;  1J59 A;  2ID3 A;  1UHS A;  3CCE I;  5E1W A;  3N4M A;  4KIB A;  4C30 A;  1S3J A;  2M1B A;  5JFR A;  1ORK A;  2CFO A;  1DGW Y;  2FX0 A;  2EH3 A;  2X48 A;  3IH3 A;  2QQ9 A;  4HZF A;  5KAF C;  4CSW A;  3U1K A;  4BY7 J;  2QBY A;  1ZEL A;  3SJM A;  4YFX F;  5LHG A;  1UEL B;  3ZMT A;  2HI3 A;  2DXI A;  4U7B A;  3IP4 B;  2RVC A;  4MQ9 F;  1IJW C;  1G2H A;  3GXO A;  3TP3 A;  1UMQ A;  2HQR A;  1MBJ A;  5D8K B;  4A3C J;  5A2Q K;  4I99 C;  2EFW A;  4J00 A;  1RKT A;  1TW2 A;  5JHF A;  4L5I A;  1IAW A;  5EZH A;  1UB9 A;  2V1X A;  4F7Z A;  4Y4R A;  2I10 A;  1ZHF A;  4M6X A;  5HDN A;  4HOB A;  2DDA A;  2RQP A;  2LDU A;  3FXJ A;  5LD2 C;  3HRS A;  3PNY A;  3G71 I;  2CGP A;  3PSF A;  1DP7 P;  1BR2 A;  1J2X A;  2K3F A;  4PSW A;  4BE0 A;  2NS7 A;  4JK1 X;  4C9Y A;  4O3M A;  2O7O A;  2KLO A;  5E3N A;  2OJE D;  2CW8 A;  2H27 A;  5LFA A;  4CXF A;  5EDN A;  1LB2 A;  3IL2 A;  2BEO A;  1BL0 A;  2EFN A;  3FF5 A;  2PQ8 A;  2PMH A;  4GDF A;  3WTS C;  4XK4 A;  2RQQ A;  2RKH A;  4YEJ A;  3WU1 B;  1MDM B;  4KT5 C;  1JGS A;  1JKP C;  4XOP A;  3WOD F;  5DD4 A;  5HOD A;  1MBH A;  3BR1 A;  2CQQ A;  3I4M J;  2JWT A;  3T5X A;  1XB4 A;  4DZJ A;  1YO5 C;  2LRE A;  4EQQ A;  2KIU A;  5LHI A;  1LQ1 A;  2VC1 A;  2K9N A;  2E36 A;  2YX7 A;  2D2W A;  5GAD J;  2UUZ A;  2EV5 A;  1MDM A;  1K78 B;  2GIV A;  2JMW A;  1KA8 A;  3D5S C;  3RYR A;  3J7Y J;  5FKN A;  4FX4 A;  1GDT A;  1ONV A;  3FXL A;  1DQU A;  2VPR A;  1PYV A;  2IW5 A;  3GLX A;  1D1B A;  5L3G A;  1NTC A;  1I1S A;  3WU2 C;  4U0V A;  1BA5 A;  2HOT A;  2ZXI A;  3QOD A;  3J80 K;  4M3F A;  2XF5 A;  3BWG A;  1S7E A;  2NRA C;  3K4J A;  1NG6 A;  3KX2 A;  4KIF A;  1IUF A;  5JVT A;  2XF7 A;  4NUB A;  4BGD A;  1ZKG A;  3PUB A;  3ZQI A;  5ICG A;  2NNY A;  2EZK A;  3F8F A;  2R7O A;  4BE1 A;  1EH7 A;  3QU6 A;  2TRT A;  2LY2 A;  1XSD A;  2M8G X;  4D1Q A;  4MGR A;  3ZQC A;  2OTL I;  1FMW A;  2QYO A;  4W97 A;  1LEA A;  2RNG A;  3DEW A;  1VQL I;  2NVX J;  1F4K A;  2LD5 A;  4XLA A;  5EG0 B;  1VND A;  2LY9 A;  1VZ0 A;  3KLN A;  2QA4 I;  2BXY A;  3EYY A;  2ESN A;  2STW A;  3KIO A;  4AYB N;  2VOO A;  3DV8 A;  5KK1 A;  1EJ9 A;  3I0T A;  5EZG A;  4CCJ A;  1X1A A;  1TP4 A;  4CCM A;  3HOX J;  1JJ8 C;  3MQ0 A;  4DW6 A;  4A3F J;  3N97 A;  1PUF B;  1JHH A;  4XKB A;  5EG0 A;  1NHA A;  2FOW A;  1V5G A;  2L4M A;  1AWC A;  2ETH A;  2O8X A;  3IWF A;  2HQN A;  4BXX J;  1T38 A;  2R93 J;  2YR2 A;  2CRG A;  3DF8 A;  2FE3 A;  3FKJ A;  3ZRG A;  2BE5 F;  1G4D A;  3H5R A;  3BOQ A;  5JR3 A;  2OCC H;  1PUF A;  3E5Q A;  4RM3 A;  2IAI A;  3Q0V A;  4IF4 A;  2N8G A;  2QEN A;  4NBQ A;  4KYW A;  3CD6 I;  4A3E J;  1LDD A;  1QZY A;  1D0Y A;  3MCZ A;  3F6O A;  4PGH A;  3S1Q J;  3F8N A;  1L3L A;  5D4S A;  3JTG A;  1H8A C;  2HXO A;  5IT9 K;  1IV6 A;  2O0Y A;  3D0S A;  4XL9 A;  4EGY A;  3FXM A;  2ICW G;  1AA7 A;  1DU0 A;  4MTD A;  4OOI A;  3IUO A;  2WA0 A;  5J6X A;  5JI6 A;  2MFZ A;  1FC3 A;  3OMY A;  2P6T A;  2LYC A;  2Y9Y A;  4OU0 A;  3QU3 A;  1BIB A;  1Z6R A;  5D5U B;  1XPX A;  3VSL A;  1WCM J;  4G6T B;  3PQK A;  3RPQ A;  4MIM A;  3TOA A;  1YX5 A;  4LLN A;  1ZH5 A;  1LVA A;  4PJL A;  1QPI A;  4LGW A;  5K1Y A;  2HXI A;  3CCR I;  3L2W A;  2W84 A;  2XAF A;  3ABL H;  3HGY A;  2M5W A;  2W1O A;  2HQA A;  2ZB9 A;  1JUM A;  2DQL A;  4II2 A;  1PDN C;  5D8L B;  1BI1 A;  3G1M A;  3RQ4 A;  3UR3 C;  4BL0 B;  2XF6 A;  2HVQ A;  5ICE A;  2CFX A;  4OMZ A;  3HXL A;  2CW0 F;  3J80 Z;  2DA1 A;  5FFZ A;  1Z05 A;  1S5L C;  3LQR A;  5LEK A;  1IN8 A;  2R7U A;  3K4M A;  3DLA A;  3RI4 A;  3WGH A;  1T98 A;  1VQ6 I;  3E6D A;  3S17 J;  3F8B A;  4CCK A;  2A6H F;  2K9S A;  3DBL B;  3GFJ A;  3GLL A;  3PIO F;  4X6A J;  3JRA A;  3L2C A;  2Z5U A;  1MMA A;  4UVA A;  1AOY A;  2JPC A;  2L01 A;  2A68 F;  4IRI A;  4ZDL A;  2NXN B;  3LSM A;  2XV4 S;  3KP7 A;  1TNT A;  2R7T A;  2IBD A;  3V7C A;  1YIJ I;  1R1T A;  1KU3 A;  2R7W A;  3G4S I;  2K9M A;  1YIO A;  2CSO A;  3HDD A;  4A3L J;  3HTS B;  4WXC A;  1UHW A;  4IHV A;  2CUZ A;  5J8F A;  3SZP A;  2VE9 A;  4HLY A;  1BI2 A;  3AG2 H;  4HQM A;  2PBI A;  4CO8 A;  2MC4 A;  1TQP A;  4XN3 A;  1WZ2 A;  1W5C C;  2I8D A;  5FLX K;  2KIF A;  3C7J A;  3OS2 A;  1G59 A;  2PJR B;  3ZMV A;  2E60 A;  4HNU A;  1HKT A;  2DMT A;  3G6E I;  2M3A A;  1A31 A;  2KL4 A;  1E3H A;  3BQZ A;  2V7F A;  3E6B A;  2O03 A;  2PMU A;  1SVL A;  5E8G A;  2Z33 A;  2BBY A;  2F5E A;  2X1E A;  4ON0 A;  3J7Z I;  1Y39 A;  2PJR A;  4L9V A;  1QGP A;  1IO2 A;  4DIQ A;  2VKH A;  5LGU A;  1TTY A;  1IRX A;  2AQF A;  1LUJ B;  1J9I A;  1GUU A;  3BG9 A;  3PIP F;  3I9V 2;  3C2H A;  4KFC A;  4G9Y A;  2QSF X;  3KYD B;  2H1L A;  4N9I A;  3U21 A;  1S6L A;  5DCM B;  1QZZ A;  4HX8 A;  5HDK A;  4Y15 A;  1O57 A;  2QVO A;  2G0E A;  4JX5 A;  4ESB A;  3WTX C;  4UUV A;  4RB1 A;  1R49 A;  3IAS 2;  2LKP A;  3PFY A;  1VQ9 I;  5LBQ A;  3BJO A;  1G3W A;  3WGI A;  4IRH A;  3HOY J;  1Y1V J;  2P81 A;  4N4N B;  3K70 D;  3QPS A;  5CVR A;  2VJI A;  3SYT A;  3HSF A;  2VOD A;  4KUM A;  1O7L A;  4UUS B;  1S9H A;  3L9F A;  4I76 A;  2F5F A;  2L9N A;  4XSX F;  4G8X A;  2GOM A;  5L3D A;  4AVP A;  3DWL E;  2EK5 A;  5IYC J;  5HOO A;  1ETW A;  3EUH A;  2R7X A;  3HSR A;  4XRF A;  5CVV A;  4ZZD A;  3JR9 A;  3LAP A;  3I71 A;  5J1R A;  1ACI A;  4B48 A;  2A07 F;  3OYF A;  3K0L A;  3RKX A;  2BHZ A;  3QP6 A;  5DUK A;  1Y8R B;  1OCP A;  1UST A;  3PNV A;  3OOP A;  4BQA A;  1TLH B;  2Z1D A;  3BY6 A;  3K10 A;  2KFD A;  3ZMU A;  3AG4 H;  3BZC A;  1FJL A;  3GTK J;  3ZQL A;  4HNV A;  3HKZ A;  4Z6Y A;  2HTJ A;  4AUX A;  4ZJZ A;  1OFC X;  4NC8 A;  3F23 A;  1S29 A;  3A03 A;  5DS9 A;  3NQO A;  1X3U A;  2YS9 A;  1HST A;  1PVE A;  1WI3 A;  3H9Q A;  4KA4 A;  1SAN A;  1Y6I A;  1BJZ A;  3M8E A;  2TCT A;  4KIS A;  3FZV A;  5FLX Z;  3S16 J;  4XBF A;  2R92 J;  3OYM A;  1V54 H;  2IXS A;  4S04 A;  3VYS B;  2CV2 A;  2BGC A;  1F9N A;  4KIG A;  4E7H A;  1I5Z A;  3KP4 A;  4O6J A;  3LSR A;  1QNT A;  2UWM A;  2L7F P;  4R79 A;  2OV7 A;  3EQL F;  3CF5 F;  1X4O A;  1U5T B;  1JHF A;  3Q5F A;  1T08 B;  3OL3 A;  2HZT A;  3L2Q A;  2VON A;  1POG A;  2HWV A;  1LFB A;  1KU2 A;  5F64 A;  1Z67 A;  3DTK A;  3SHF A;  3E97 A;  3WG9 A;  4BHC A;  3CC2 I;  3LOC A;  2ISZ A;  1RC9 A;  4BAC A;  3BQY A;  4D0P A;  1U5T A;  2K02 A;  2RV8 A;  2Y69 H;  4XMY A;  4EM2 A;  3PM1 A;  2WB1 N;  5J1U A;  4ESF A;  1QBJ A;  2JA5 J;  1EH6 A;  5JLX A;  3OSF A;  4MFD A;  1TNS A;  5E3M A;  3M3Y J;  3QQA A;  4QPQ A;  1LVK A;  2FNP A;  2ZJ2 A;  4XID A;  4Q48 A;  3JRD A;  3P7N A;  3A4C A;  4RGS A;  3BTC A;  1X58 A;  3TKY A;  3CDH A;  2VBZ A;  1OMI A;  3M8J A;  4R1H A;  2YU3 A;  1A6Q A;  5IYD J;  4RA2 A;  4A3M J;  2V1N A;  1I1G A;  5TRD A;  1S7A A;  3SEZ A;  1SFU A;  2E1O A;  1LFP A;  3JW4 A;  3ABK H;  3VPR A;  1I3A A;  4H4K C;  5FLM J;  2GBY A;  2MD5 A;  3QWL A;  5LEJ A;  2F2E A;  4FE4 A;  4G6D A;  2E19 A;  1FYK A;  1X3Z B;  3WTV C;  3ELK A;  1BJA A;  2DTZ A;  4XOR A;  4XQF A;  3GZ5 A;  5CVJ A;  5DTD A;  5CYV A;  1E0E A;  4CZZ A;  2L0K A;  2XGE A;  3W6J B;  4DNC A;  3RZO J;  3ULQ B;  5BQT A;  4II3 A;  3TOB A;  2ME0 A;  3HIF A;  2XAH A;  1XGO A;  1GLN A;  4J01 A;  2L54 A;  4A12 A;  2GA1 A;  4ZTF A;  3OYB A;  1I3Q J;  2XVC A;  3W6V A;  2X9D A;  4EGZ A;  2NNN A;  1KU7 A;  4A0Y A;  4EJV A;  4OAY A;  2XUB A;  5KHD A;  1IDY A;  2F48 A;  4I0A A;  1D5Y A;  1ZR2 A;  1TZL A;  3TGN A;  3IH2 A;  1F36 A;  1I50 J;  1RNL A;  1E3P A;  4NNJ A;  4M3B A;  3AG1 H;  3KET A;  1B9M A;  3ZXS A;  1XSV A;  5ICC A;  1P6R A;  4BDZ A;  4RAY A;  3DPL C;  1TT5 B;  4I98 B;  1T33 A;  3HGG A;  4FTH A;  5F0H A;  3R61 A;  3RKY A;  4M71 A;  2FU4 A;  3CJR B;  2MH2 A;  2LR8 A;  3O8H A;  1U8R A;  2CV0 A;  2K5C A;  2LOO A;  3GVA A;  3H3U A;  3W6K B;  3FIS A;  1Z9C A;  1VF9 A;  4EVI A;  1OJL A;  1S7O A;  3IC7 A;  3BPX A;  1HKS A;  4V2F A;  4ETS A;  3KZY A;  4OIP F;  2HTS A;  3TQN A;  2F5C A;  2WY7 Q;  4PJM A;  1ZG5 A;  1IC8 A;  2NYX A;  3T0Y A;  3GYH X;  3CP2 A;  4UNO A;  4A3D J;  5M5X J;  3ZMD A;  4M6V A;  5AIP A;  4WXD A;  2RGV A;  1IXS B;  3FHZ A;  2F5V A;  2TDX A;  2ECB A;  2J5P A;  2JTV A;  5BNG A;  1LEB A;  2QKM B;  1EF4 A;  3HUG B;  1UZC A;  3A2K A;  3LSG A;  2JVH A;  5DEQ A;  2KDO A;  1SEU A;  4IHW A;  2FRH A;  1U6G A;  4X0G A;  4A5N A;  1IDZ A;  3OIQ A;  3QP5 A;  1YQA A;  4LMY A;  4A6E A;  2FMY A;  1KGS A;  3NAU A;  4HAM A;  3KP6 A;  4L5J A;  1LKX A;  2XB5 A;  2DFE A;  4I7H A;  3I54 A;  5IOY A;  5C4J J;  4GCV A;  4JOM A;  4HW0 A;  3IHU A;  1KQ0 A;  3PSI A;  5EEG A;  3E7L A;  3T1B A;  4ZC3 A;  3VFZ A;  2GIZ A;  3BLY A;  3DBR B;  2A5Y B;  2IA0 A;  4XKW A;  2PMZ A;  2DJI A;  1ON2 A;  1V4R A;  1G3T A;  2M9H A;  3V8K A;  4JBA A;  4F91 B;  3L1P A;  2ZNY A;  4IKF A;  3ABT A;  2W57 A;  3X2Q H;  5CVI A;  1LJ9 A;  1YG2 A;  4ZYH A;  3JRC A;  5M3F J;  1R36 A;  1OLT A;  2WAD A;  3HRU A;  3ZQF A;  2HGC A;  3PL8 A;  3LL7 A;  4BS9 A;  2ISY A;  2ZBK A;  1RI7 A;  2DA7 A;  1MNM C;  1B8I A;  1F43 A;  2MGQ A;  3SFZ A;  1BN5 A;  4A69 C;  5FRN A;  2DT7 B;  3HEF A;  4DOZ A;  4BEH A;  2ZJR F;  1SFX A;  3OIO A;  2BOL A;  3HOU J;  1ZG1 A;  3QPT A;  4A0Z A;  3LFU A;  1B6A A;  1WH5 A;  1BM9 A;  2XAJ A;  4HEA 2;  2G9W A;  5BPD A;  1SMT A;  2L2O A;  3KEO A;  3CLO A;  4GYG A;  1XCV A;  4HRI A;  1FOW A;  3F22 A;  2DA2 A;  4B47 A;  4CYD A;  2AXL A;  3OR1 C;  2QQA A;  3OR2 C;  2HYF A;  3OYD A;  2JA6 J;  2FNA A;  3S3N A;  3F6V A;  2RRE A;  4YFK F;  4P1W A;  4ANJ A;  1IRF A;  1TWA J;  2QQB A;  3FK6 A;  5HNH A;  2AHQ A;  4Z2Y A;  3W3C A;  3LSP A;  2OC6 A;  3CCU I;  4YIF A;  4Y17 A;  1YIT I;  3RPU A;  5FB2 A;  2X1C A;  4YIR X;  1R00 A;  3QPL A;  2JN6 A;  3MEX A;  1WJB A;  2JUC A;  5TIS C;  1VQM I;  2NOG A;  1HW2 A;  2HOE A;  2ZNZ A;  2L9V A;  1V5E A;  3DEU A;  1FEX A;  1HBX G;  3SXY A;  2R5Z B;  2MH9 A;  2A61 A;  2QKL B;  1CF7 B;  5KVR A;  4A0X A;  1B4A A;  4B09 A;  5HNF A;  2EZI A;  2IA1 A;  3KEY A;  3AFH A;  3K1M A;  2M87 A;  3DPU A;  3MAJ A;  5EJC A;  2VT2 A;  5LLQ A;  2O5R A;  2ME6 A;  3NWT A;  2DPU A;  5J1Y A;  4ZDO A;  1UJ8 A;  2Y0S A;  2CJJ A;  1XGM A;  3F8C A;  5GAE J;  2XGD A;  3MVP A;  2ZJP F;  2R7Z J;  3COA C;  1R5G A;  4G94 A;  1ZN2 A;  2CO5 A;  2QZ8 A;  1H9T A;  4LB5 A;  1ON1 A;  3V8J A;  1O3R A;  3SDB A;  5LRS A;  2DMU A;  4M9S A;  3K1P A;  4LLG F;  2CH0 A;  1W36 C;  1XGN A;  2LRD A;  4G7O F;  4QLC U;  1VQO I;  5EF6 A;  1M1E B;  1U0J A;  3GFM A;  3G2B A;  5IP6 A;  4ZYD A;  3G73 A;  4BBS J;  2DT5 A;  2K27 A;  2GAU A;  3I53 A;  4ZH4 F;  2HPM A;  1YOV B;  3FXK A;  4D5C A;  3DKY A;  2JQ7 A;  2V26 A;  3MKL A;  4FE7 A;  3K69 A;  4NC6 A;  1B1B A;  1AKH B;  1XD7 A;  1K61 A;  3BT9 A;  3GF2 A;  1YX3 A;  3K7A J;  4XON A;  5TJJ A;  3GTM J;  4B44 A;  1MH3 A;  4XRS G;  1AHD P;  2DW4 A;  1WJE A;  2M7B A;  4BQO A;  1QU3 A;  4JP0 A;  1BOB A;  4LK0 F;  1K78 A;  1K7A A;  3VOE A;  3BCA A;  4AWX B;  4RLF A;  3I3L A;  2DI3 A;  1BIA A;  3FM3 A;  2E2J J;  2H8W A;  2AQE A;  3MKW B;  1PUE E;  3HZJ A;  3F8M A;  1ZRE A;  3RSN A;  3WG7 H;  3Q0W A;  1NK3 P;  1HA8 A;  1ZGW A;  4YII A;  3CC7 I;  4CH7 A;  4MEX F;  4IHT A;  1IG7 A;  4F3Q A;  3A01 B;  5HS9 A;  2PFB A;  3EUH C;  3ECO A;  3GWZ A;  2H94 A;  5FKK A;  4YG2 F;  4WWC A;  1ZG3 A;  1KU9 A;  3QPH A;  5IP7 J;  2FJ1 A;  3JCU C;  2IGM A;  1JXS A;  2KIS A;  4AYB A;  4M3D A;  4L9N A;  4UB6 C;  2LG4 A;  3VYT B;  2F4M B;  2JRM A;  4RBO A;  1ITY A;  2JSP A;  3CJN A;  1JUS A;  2IS6 A;  1G8X A;  3A01 A;  1SAU A;  5C44 J;  1Y56 A;  3FMR A;  4HX4 A;  4I01 A;  3I64 A;  1VQN I;  3H5N A;  2HKX A;  4B4C A;  2HPI A;  1WPK A;  3K2Z A;  2WC2 A;  2E34 A;  4CGZ A;  4QIW N;  1Y0U A;  3QOE A;  1FPQ A;  4U87 A;  4HLX A;  2UV1 A;  3MD2 A;  3LFK A;  3GME A;  4IVN A;  3E1S A;  5LRR A;  5D5X B;  2RNJ A;  3BR0 A;  2Y75 A;  2G7U A;  2L9S A;  2EIN H;  2XPU A;  2Q2E B;  2ACJ A;  1SAX A;  2X6O A;  1EH8 A;  1X2M A;  2WAQ N;  1AU7 A;  3HJE A;  4IJA A;  1VQ8 I;  5E3O A;  3CMA I;  1O7F A;  4LIV A;  1I6X A;  1YYV A;  3OOU A;  4DYR A;  4A3K J;  1ERD A;  2XKP A;  2DFI A;  2Z2S B;  2R4G A;  4W1U A;  2DO7 A;  2EWN A;  2ELK A;  2HU9 A;  2KPM A;  3O8G A;  2CQ7 A;  3SZT A;  3JRH A;  4IHS A;  3B02 A;  1T8I A;  5KNL A;  1T0F A;  2DTR A;  4AIH A;  1TWF J;  1YS7 A;  4RGR A;  4MNU A;  1RUN A;  1BI3 A;  1U5T C;  5EEA A;  4XSZ F;  2HYJ A;  4ZYG A;  2EIL H;  3S15 J;  4UV9 A;  1OR7 A;  1JKQ C;  4D7N A;  2PN6 A;  2O3F A;  5TGT A;  1W7P B;  2X51 A;  2DN0 A;  4QWQ A;  2XC7 A;  4BXF A;  3R60 A;  1EA3 A;  4XNF A;  2CUE A;  1P7I A;  2OA4 A;  2V9K A;  3IV5 A;  2JPB A;  3V8L A;  4GXO A;  6PAX A;  1YW7 A;  3CUO A;  3REO A;  5HLT A;  4ENN A;  1HDP A;  4IOC F;  1R1U A;  2X6X A;  4F93 B;  2R7F A;  1CGP A;  1W7P A;  3DEE A;  5FD6 A;  1F1Z A;  4I02 A;  2XRL A;  1BR4 A;  1W5T A;  3RJP A;  4EAT A;  5GAG J;  2CU7 A;  2ADU A;  2OUM A;  2FXA A;  2CS3 A;  2LY1 A;  2UXX A;  4HV5 A;  1A04 A;  5H6Q A;  1XS9 A;  1DDN A;  1H0M A;  3BR2 A;  4EEF G;  3DTE A;  1WJA A;  2DA4 A;  5JHU A;  5E17 F;  3K6G A;  2ZFW A;  3V7S A;  4UV8 A;  4R8H A;  2JSC A;  4BU2 A;  1Z3Y A;  3NWS A;  5FLV A;  2BY1 A;  1O3Q A;  4AM3 A;  5B66 C;  1XMK A;  5M5Y J;  2FBI A;  3CDI A;  1I39 A;  2VKE A;  2BZT A;  2JVG A;  3OYA A;  4BYY A;  2IS1 A;  1W36 D;  2W48 A;  1FSE A;  2L7Z A;  4M73 A;  4LK1 F;  3ASN H;  1K79 A;  2D1H A;  5D6F A;  3ABM H;  5BMZ A;  1O4X A;  4BY1 J;  3RYP A;  3C2B A;  2VKD A;  2DPD A;  1R4N B;  1PP8 F;  4KDP A;  1Z7L A;  1OYY A;  4ZDP A;  3CCY A;  1OCR H;  1LPQ A;  4C3J J;  5M3M J;  1O3T A;  4DYQ A;  2V6C A;  2KHM A;  5F27 A;  4FT8 A;  3QRF F;  4K2E A;  2NVY J;  4CCL A;  3SZG A;  2R7Q A;  3OYL A;  2DA5 A;  3K2A A;  3L2V A;  2DCE A;  3GCM A;  2YSR A;  2IGK A;  2VT3 A;  1H9G A;  2BHY A;  1TQM A;  1YLF A;  1QPM A;  3GTG J;  5CKT A;  2R7S A;  3DKX A;  3U9G A;  2OU2 A;  1UG0 A;  2QLZ A;  1YTY A;  3LSH A;  1NH3 A;  2MW8 A;  3BZ6 A;  3ZCO A;  1XCB A;  4MHG A;  1DU6 A;  4FHT A;  3K4C A;  3QOP A;  4Y7N J;  3Q3S A;  3ONQ A;  3S3M A;  1MSF C;  3ZQG A;  3ROU A;  5H2F C;  2EIM H;  3P9I A;  1RKW A;  4Y52 J;  2L3D A;  4XLH A;  2M45 A;  1MBG A;  3OV8 A;  1WHU A;  2HZD A;  2XIG A;  1BC7 C;  1WI9 A;  5DCM A;  3MZY A;  3N05 A;  2HQ5 A;  1SFE A;  3CMM A;  3FXQ A;  3CF2 A;  3EPZ A;  3K4K A;  5L3B A;  2CV1 A;  2B9S A;  3FWE A;  1WVR A;  1SVO A;  4RAF A;  1ZTR A;  1KYW A;  2XGX A;  2L7K A;  2ZCW A;  3FIW A;  3OYE A;  3GW2 A;  1Z1D A;  4UB8 C;  3IRQ A;  3H3V K;  3BDD A;  4KIC A;  4BDY A;  2VBX A;  3HB9 A;  4M3G A;  3V7R A;  2YU9 J;  2EB7 A;  4UUS A;  1ODD A;  4DQ2 A;  1MBK A;  4KIT B;  3HYI A;  4A3G J;  3MN2 A;  2GOX B;  4A6D A;  3CCV I;  4BUP A;  3WTZ A;  2V1D A;  2W4S A;  2GA2 A;  2DA6 A;  3CUQ B;  4M6Y A;  2WAE A;  2NVU B;  1W0T A;  1ZAR A;  2A6T A;  3GBG A;  3PNT A;  2RAE A;  3BRO A;  3KLO A;  3K4N A;  3CP8 A;  3CCJ I;  2XSJ C;  1D8J A;  2MA3 A;  3OYG A;  2BY3 A;  3RKW A;  3WTT C;  3I58 A;  3I4N J;  2DA3 A;  2IA2 A;  5FO5 A;  2V9P A;  4UXN A;  1C0W A;  4LOC A;  3LWF A;  3CUQ A;  3JRG A;  1HXD A;  3BR5 A;  2QEX I;  4Q5S F;  3LSJ A;  1HOM A;  4OIQ F;  1UG2 A;  2M0M A;  3BJA A;  5E79 C;  2DLL A;  2LBF B;  3MFK A;  1DUX C;  1MND A;  3IRR A;  1D1C A;  2HKO A;  1WJF A;  3JSO A;  2WBM A;  4G7Z F;  2DFF A;  2L7M P;  1YJW I;  3HG9 A;  1ZGJ A;  2FD5 A;  3R0J A;  1J0R A;  1GV5 A;  2LBF A;  4XKV A;  3U1D A;  1OYW A;  2AO9 A;  2H1K A;  2PJP A;  5F08 A;  3ZN0 A;  2ZXW H;  1V5F A;  2EA4 A;  1ETO A;  2BXZ A;  2QQ8 A;  3K4L A;  4AIK A;  1TBX A;  1DPU A;  3CC4 I;  1VI0 A;  2EPF A;  2LFB A;  3MKZ A;  4E7L A;  2A69 F;  2D45 A;  4RB2 C;  1WFX A;  5DYM A;  1MSE C;  3H36 A;  2ESH A;  4G6Q A;  4GRI A;  5J4Y A;  5DUI A;  1VFC A;  1QO0 D;  3O6B B;  2KZG A;  3DPT A;  2FUG 2;  4OIR F;  4AU7 A;  3O3K A;  2W82 A;  3BG3 A;  4BJT A;  2JA2 A;  3M1E A;  2O61 A;  3GTJ J;  2K9Q A;  4L9T A;  2R7R A;  3OYK A;  1HKQ A;  3F9K A;  2P5K A;  4IO9 F;  1L0O C;  4GO1 A;  3TDU C;  2VJJ A;  4U0Y A;  2STT A;  1FIP A;  2HDW A;  1U9O A;  3FHN A;  2OZ6 A;  3OYH A;  1MZB A;  3R0A A;  4HG2 A;  2Z3Y A;  3OYC A;  1BOA A;  2QCO A;  2COM A;  3M7G A;  1W1W E;  2NS0 A;  1SFK A;  1WWX A;  3GTP J;  5IYB J;  5LGN A;  3CCL I;  4G12 A;  3L2U A;  2LSO A;  3EYI A;  2R0Q C;  3E5X A;  4Y13 A;  3KEQ A;  5HDG A;  2KIM A;  4LIT A;  2ZKZ A;  3RQI A;  2R5Y B;  1N75 A;  4C2T A;  2LK2 A;  1JTY A;  5HVQ C;  1WKM A;  2DOF A;  1B59 A;  1B72 B;  1R23 A;  3ABU A;  1X4P A;  3CO7 C;  2PLY A;  1SFO J;  3S8P A;  2B7E A;  2FQ4 A;  1R5H A;  3ML6 A;  1IW7 F;  5J47 A;  2K4B A;  4BJ5 C;  1FYM A;  4KN4 X;  3ZQ7 A;  3IH4 A;  3T8R A;  2GM4 A;  1D8K A;  5D4R A;  3BJ6 A;  4E7I A;  3FXR A;  5FKL A;  2E5Z A;  2NOJ B;  3HRM A;  4DYC A;  2HDC A;  1B72 A;  1MH4 A;  3OIP A;  2RC4 A;  1N77 A;  4RGX A;  5C3E J;  4V19 K;  2A3S A;  3JSP A;  1SC7 A;  4AIJ A;  2BVL A;  1FZP B;  3GFI A;  1HW5 A;  2EIK H;  2OAZ A;  2XPV A;  3TED A;  5F0C A;  3NAR A;  3MZ8 A;  3TDZ C;  4I0B A;  1OIS A;  3CZ6 A;  2DOE A;  3TO6 A;  2P4W A;  3ZN1 A;  2IPQ X;  1MMD A;  2CWE A;  4HV6 A;  5GPA A;  1KON A;  2MLK A;  3VSK A;  1TC3 C;  1DPR A;  1XN7 A;  1YW8 A;  3H5A A;  3MWM A;  2ECC A;  2M4G A;  1JTX A;  2ZFU A;  1V55 H;  4DBQ A;  4RAZ A;  3DQV C;  3JRE A;  4PCQ A;  2M8E A;  3WE2 A;  1FP1 D;  2DMQ A;  1K6O A;  2NVQ J;  5KCM A;  3CCM I;  4P9F A;  1NK2 P;  3KCC A;  2R7D A;  3S2W A;  5J4V A;  3IAM 2;  5IP9 J;  3HOZ J;  2COB A;  3JAM Z;  4F92 B;  1VQK I;  3W2V A;  2LC2 A;  5IOZ A;  4IPA A;  4GGG A;  9ANT A;  3D5R C;  3C1D A;  2MD0 A;  2OCE A;  3DKW A;  2CQK A;  3RKQ A;  1ZR4 A;  2VQH A;  1O3S A;  4KT6 A;  5CQE A;  1MJA A;  2F5D A;  1R1V A;  1LE8 B;  2IRF G;  1BR1 A;  5FRM A;  2VQC A;  2LKX A;  1T2K A;  3HUG A;  3GO5 A;  4EMS A;  5FJ8 J;  4C3H J;  3M8F A;  2E35 A;  1TL8 A;  4EJU A;  3I5U A;  2P7C B;  2PX9 A;  1REP C;  1BI0 A;  3ASO H;  3TO9 A;  3FBI B;  3J81 Z;  2M2E A;  2KJC A;  2FBH A;  2ZO4 A;  1RRJ A;  3R6S A;  3V42 A;  2JA8 J;  3S2D J;  3HSE A;  2W25 A;  2LMD A;  1HDD C;  1WSU A;  1J7K A;  3DLL F;  1MMS A;  4MEY F;  1ZGA A;  3WTU C;  3OY9 A;  3U2R A;  1H88 C;  2QF7 A;  4YEL A;  4B43 A;  2MSY A;  5DM7 F;  1FWZ A;  5LGT A;  4FCY A;  1GV2 A;  3QYF A;  4QSH A;  1FY7 A;  3LAJ A;  4P5O A;  2HDD A;  4RMN A;  4LG0 B;  3GTQ J;  2EFO A;  1QRY A;  3B6C A;  1YFH A;  4HF2 A;  2PMZ N;  4J19 A;  5ILV A;  1T0F C;  5D6E A;  3BG6 A;  4IEJ A;  4LIU A;  4QTR A;  1D0X A;  4I2O A;  1WRJ A;  3BTJ A;  4PSX A;  4ZTJ A;  1FP2 A;  4WXH A;  1R22 A;  1X3W B;  3BG7 A;  2D1V A;  1HF0 A;  1UHM A;  2ZSH B;  1P92 A;  2VXD A;  1MD0 A;  2VJ4 A;  1STZ A;  4XM3 A;  1OR7 C;  3HC7 A;  3WHC A;  4L0Y B;  4HDU A;  3MKY B;  5DV5 A;  1VQ4 I;  4ESJ A;  1ETK A;  3S1R J;  4WF2 A;  1TWC J;  3BTI A;  4BHP A;  2EJR A;  3OWT A;  4QPO A;  5HS7 A;  3I59 B;  2LF8 A;  2E2I J;  1OYI A;  3CJQ B;  3VYU B;  1Z6T A;  2YUS A;  3RPU D;  2MC3 A;  1W0U A;  1K6Y A;  5DD8 A;  5BS6 A;  1Y1W J;  1SD5 A;  4XKC A;  3S1N J;  5B1A H;  4Y3O A;  3BR6 A;  4F52 A;  4S05 A;  3WU0 A;  4Q47 A;  3F72 A;  3M1C A;  3FKI J;  5E1X A;  4P55 A;  4OIO F;  4UVB A;  1YE9 A;  1OQY A;  1XMA A;  2BYV E;  4JQF A;  1K4S A;  3I59 A;  1U9N A;  1GXP A;  1BBY A;  2M4K A;  2E7X A;  4C2U A;  2XRO A;  2HNH A;  3FMS A;  3C18 A;  1TWH J;  4E70 A;  1YS6 A;  2CQN A;  2OF7 A;  2V4J C;  2IGN A;  4LG3 A;  3ZMZ A;  1IRG A;  4C3I J;  2V79 A;  3R4K A;  1GVJ A;  3S2H J;  1HSJ A;  5ED4 A;  3ERM A;  2QBY B;  3C2G A;  3O2P E;  4CZC A;  3ZP5 A;  1IN4 A;  4IHY A;  3PO3 J;  2KT0 A;  4ZZL A;  2X4H A;  2CG4 A;  3GTO J;  4RLQ A;  1GT0 C;  4TV7 A;  2E1C A;  1ENH A;  2YPR A;  1ETQ A;  2ID6 A;  2M34 A;  3BR3 A;  1P9Q C;  4HNT A;  1YW9 A;  1LFU P;  3ZGK A;  2Y9Z A;  4YFN F;  2M30 A;  3CDL A;  4L0Z B;  2JA7 J;  2GZW A;  4RB0 A;  2DK5 A;  2OQR A;  5F1R A;  2R5Z A;  1OCT C;  4IXA A;  5DM6 F;  5AON A;  3I4P A;  3RCO A;  4CUG A;  1CF7 A;  2IS2 A;  2MBF A;  3KZZ A;  1Z77 A;  2XAS A;  1FT9 A;  2ZME C;  3M4O J;  1MKM A;  2R3S A; 
#chains in the Genus database with same CATH homology
 5C4X J;  1P7J A;  2CUE A;  1P7I A;  1FJL A;  3GTK J;  3IV5 A;  4V2G A;  4HNV A;  3ZQL A;  4AUX A;  2K40 A;  1OFC X;  3A03 A;  1HDP A;  5DS9 A;  2B63 J;  2Y0S N;  2YS9 A;  1WI3 A;  3TW7 A;  1WH7 A;  1SAN A;  4A3I J;  2XRL A;  1BJZ A;  2TCT A;  4A3J J;  2CU7 A;  2LTP A;  4X1E A;  4UUT A;  5K7H A;  3S16 J;  2R92 J;  2Y30 A;  3ZQH A;  4JX4 A;  1XS9 A;  4MLO A;  3BR2 A;  4EEF G;  3JRF A;  1RR7 A;  1XC5 A;  3LSR A;  2L7F P;  1MBF A;  2DA4 A;  1LE8 A;  1I6H J;  1JKO C;  1IGN A;  5FKM A;  1HCR A;  1POG A;  1LFB A;  3HOW J;  1ETY A;  5FLV A;  3ZOB A;  1AKH A;  3LOC A;  5M5Y J;  3BQY A;  1A5J A;  1XG1 A;  2VKE A;  3GTL J;  3D1N I;  2W48 A;  3BG5 A;  2L7Z A;  3PM1 A;  2WB1 N;  5J1U A;  2XPW A;  2JA5 J;  1O4X A;  4BY1 J;  5JLX A;  1A6I A;  3OSF A;  4MFD A;  5E3M A;  3M3Y J;  3QQA A;  3C2B A;  1RPW A;  3S14 J;  4XID A;  2OPT A;  3JRD A;  4JYK A;  3PO2 J;  3BTC A;  3CCY A;  1X58 A;  4C3J J;  1B8I B;  5M3M J;  2O8K A;  4DYQ A;  5JLW A;  3RZD J;  5F27 A;  4XRM A;  2Y31 A;  5IYD J;  5E3L A;  1Q1V A;  2NVY J;  4A3M J;  1ETV A;  3K2A A;  2DA5 A;  2LVS A;  2E1O A;  4I6Z A;  3VPR A;  5FLM J;  2GBY A;  4XRS A;  2XSD C;  1BW5 A;  4FE4 A;  3GTG J;  2E19 A;  5M5W J;  1JT6 A;  2DTZ A;  2IEK A;  2JJ7 A;  5DTD A;  2MW8 A;  4C2M J;  2L0K A;  2XGE A;  5FKO A;  3RZO J;  1DU6 A;  1BW6 A;  1FTT A;  5EGO B;  2ME0 A;  4XIC A;  4Y7N J;  3S1M J;  2GLO A;  3Q3S A;  1H89 C;  1E3O C;  1MSF C;  3ZQG A;  3SDG A;  1RKW A;  4Y52 J;  2DMN A;  4JX6 A;  1MBG A;  1Z0X A;  1ZQ3 P;  1I3Q J;  1X2N A;  3W6V A;  2X9D A;  1JJ6 C;  2HQ5 A;  1IDY A;  5EGO A;  2ID3 A;  1UHS A;  1D5Y A;  1ZR2 A;  1ZTR A;  3IH2 A;  1F36 A;  1I50 J;  1ORK A;  4M3B A;  3FIW A;  2FX0 A;  5F0F A;  3H3V K;  2EH3 A;  2X48 A;  3IH3 A;  1T33 A;  3HGG A;  4FTH A;  2VKV A;  3HB9 A;  5F0H A;  4BY7 J;  4M3G A;  3SJM A;  2YU9 J;  4UUS A;  1MBK A;  2HI3 A;  2LR8 A;  3O8H A;  4A3G J;  4S0H B;  3BTL A;  3MN2 A;  1IJW C;  1G2H A;  3TP3 A;  1UMQ A;  1MBJ A;  3FIS A;  5K7F A;  4A3C J;  1VF9 A;  2DA6 A;  1RKT A;  2EBI A;  1W0T A;  1OJL A;  3GBG A;  5EZH A;  2D5V A;  2VUM J;  2RAE A;  1QVU A;  1U8B A;  4V2F A;  4BBR J;  2I10 A;  4MO7 A;  1IC8 A;  2DA3 A;  3I4N J;  4A93 J;  4LOC A;  4A3D J;  5M5X J;  3CMY A;  4M6V A;  3JRG A;  3BR5 A;  2L9R A;  3LSJ A;  3A02 A;  1HOM A;  2NS7 A;  1UG2 A;  2ECB A;  5BNG A;  2O7O A;  5K7Z A;  5E3N A;  4DZP A;  5EDN A;  1EF4 A;  3LSG A;  2JK3 A;  1BL0 A;  2L7M P;  1JKP C;  4XK4 A;  4IHW A;  4BKX A;  2E2H J;  1IDZ A;  4D7M A;  5HOD A;  1MBH A;  3BR1 A;  3HM5 A;  2CQQ A;  3I4M J;  2FD5 A;  3NAU A;  1GV5 A;  2JWT A;  1MBE A;  2XGC A;  4DZJ A;  3G1L A;  2XB5 A;  2AO9 A;  2H1K A;  5IOY A;  5F08 A;  5C4J J;  2K9N A;  2XB0 X;  1ETO A;  1VI0 A;  2LFB A;  3E7L A;  1T56 A;  2JMW A;  1GDT A;  5FKN A;  1MSE C;  1IRZ A;  2VPR A;  1VFC A;  1NTC A;  1BA5 A;  2HOT A;  4GFB A;  2M9H A;  4M3F A;  3BG3 A;  1S7E A;  3L1P A;  4CYC B;  1IUF A;  3GTJ J;  2K9Q A;  1ZKG A;  3ZQI A;  2EZK A;  2CQX A;  3TP0 A;  3JRC A;  2TRT A;  5M3F J;  2M8G X;  1FIP A;  3SFI A;  3ZQC A;  3OSG A;  3ZQF A;  1U9O A;  4W97 A;  3DEW A;  2NVX J;  4AC0 A;  4CYC A;  2DA7 A;  2QCO A;  1GVD A;  1MNM C;  2LD5 A;  4IHX A;  1B8I A;  5EG0 B;  1F43 A;  3DCF A;  1VND A;  2LY9 A;  2MGQ A;  4A69 C;  3GTP J;  3HEF A;  5IYB J;  4G12 A;  1HLV A;  1RES A;  4AYB N;  3H0G J;  2R0Q C;  3OIO A;  5EZG A;  3HOU J;  3HOV J;  3FK7 A;  3HOX J;  2EZH A;  3RQI A;  2R5Y B;  1JJ8 C;  2LK2 A;  1APL C;  1WH5 A;  1JTY A;  4DW6 A;  4RDU A;  4A3F J;  1PUF B;  5EG0 A;  1B72 B;  2VI6 A;  1SFO J;  2DA2 A;  2FQ4 A;  4BXX J;  2R93 J;  3IH4 A;  2CRG A;  2JA6 J;  1JGG A;  2GM4 A;  4MFE A;  5FKL A;  3CQZ J;  1PUF A;  1TWA J;  3FK6 A;  2IAI A;  2AHQ A;  3Q0V A;  4DYC A;  3LSP A;  1B72 A;  2N8G A;  1MH4 A;  2NS8 A;  5C3E J;  4A3E J;  3LNQ A;  3S1Q J;  5F1J A;  1H8A C;  2HXO A;  3QPL A;  1IV6 A;  2XPV A;  3TED A;  5F0C A;  3NAR A;  2JN6 A;  1R9T J;  1ZK8 A;  1DU0 A;  2NOG A;  1FEX A;  5GPA A;  2Y9Y A;  2R5Z B;  1TC3 C;  1WCM J;  1YRN B;  4MIM A;  3WHB A;  2EZI A;  3TW6 A;  3JRI A;  2ECC A;  2MG4 A;  1JTX A;  1QPI A;  2HXI A;  2ME6 A;  1U78 A;  3JRE A;  3HGY A;  5J1Y A;  2CJJ A;  2ZB9 A;  3UKG A;  2DMQ A;  2XGD A;  2NVQ J;  3MVP A;  1JUM A;  2M0C A;  2R7Z J;  1NK2 P;  3HBL A;  1YRN A;  3G1M A;  1CQT A;  3G1O A;  4FIS A;  5IP9 J;  3F0C A;  3HOZ J;  2COB A;  5EYR A;  2DMU A;  3HKZ N;  2DA1 A;  5IOZ A;  9ANT A;  5GPC A;  2HOS A;  5EF6 A;  3RKQ A;  1ZR4 A;  5IP6 A;  4BBS J;  1LE8 B;  3S17 J;  2CUF A;  2LKX A;  4D5C A;  1JKR C;  5FJ8 J;  4C3H J;  2K9S A;  3MKL A;  4FE7 A;  4X6A J;  3JRA A;  1AKH B;  1TWG J;  1K61 A;  2M2E A;  3BT9 A;  2HOA A;  4D5F A;  2EZL A;  3K7A J;  2JA8 J;  3GTM J;  3S2D J;  2DJN A;  1MH3 A;  2IBD A;  4XRS G;  1AHD P;  1HDD C;  4JP0 A;  2Y2Z A;  1H88 C;  3HDD A;  4A3L J;  1JT0 A;  2QF7 A;  2MSY A;  4IHV A;  4FCY A;  1GV2 A;  4NDL A;  4QSH A;  2E2J J;  2HDD A;  1K83 J;  3GTQ J;  3Q0W A;  1QRY A;  1NK3 P;  3B6C A;  1ZGW A;  2PMZ N;  5J3L A;  4J19 A;  5F04 A;  1IG7 A;  3A01 B;  2DMT A;  4IEJ A;  3BQZ A;  4QTR A;  5FKK A;  3BTJ A;  5IP7 J;  1HF0 A;  2FJ1 A;  3JRB A;  1JUP A;  2DMP A;  4M3D A;  5IPA A;  3B6A A;  1WGX A;  3WHC A;  4RBO A;  1ITY A;  1ETK A;  3S1R J;  1JUS A;  3A01 A;  1TWC J;  2KDZ A;  3BTI A;  5C44 J;  2E2I J;  2O9L A;  2YUS A;  1W0U A;  1GUU A;  3BG9 A;  4B4C A;  1Y1W J;  1WPK A;  2LLK A;  3S1N J;  2R5Y A;  3BR6 A;  4QIW N;  3FKI J;  1FIA A;  4B1R A;  2G0E A;  4JX5 A;  4L5E A;  1U9N A;  3BR0 A;  2XPU A;  2WV1 A;  1TWH J;  2OF7 A;  2X6O A;  1X2M A;  2WAQ N;  1AU7 A;  4C3I J;  3HOY J;  4M3E A;  1Y1V J;  2EQR A;  1RET A;  2P81 A;  5E3O A;  1QVT A;  5GP9 A;  3QPS A;  3OOU A;  3S2H J;  4DYR A;  4A3K J;  4UUS B;  1FTZ A;  4W1U A;  4I76 A;  4IHY A;  3PO3 J;  2KT0 A;  3GTO J;  2ELK A;  3JRH A;  3O8G A;  1GT0 C;  2H8R A;  2LP0 A;  1ETX A;  5IYC J;  1ENH A;  1ETW A;  1ETQ A;  2ID6 A;  2M34 A;  3BR3 A;  1LFU P;  1TWF J;  3JR9 A;  2Y9Z A;  4ABZ A;  3CDL A;  2JA7 J;  3Q0U A;  5J1R A;  5EEA A;  2HYJ A;  2R5Z A;  1OCT C;  3S15 J;  1OCP A;  4B3A A;  1JKQ C;  4D7N A;  1Z77 A;  2NVT J;  2DN0 A;  3M4O J;  4A3B J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...