2JA9A

Structure of the n-terminal deletion of yeast exosome component rrp40
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
175
structure length
175
Chain Sequence
KRYIPSVNDFVIGVIIGTFSDSYKVSLQNFSSSVSLSYMAFPNASKKNRPTLQVGDLVYARVCTAEKELEAEIECFDSTTGRDAGFGILEDGMIIDVNLNFARQLLFNNDFPLLKVLAAHTKFEVAIGLNGKIWVKCEELSNTLACYRTIMECCQKNDTAAFKDIAKRQFKEILT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EXOSOME COMPLEX EXONUCLEASE RRP40
publication title Structural and Biochemical Characterization of the Yeast Exosome Component Rrp40
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
total genus 43
structure length 175
sequence length 175
ec nomenclature ec 3.1.13.-:
pdb deposition date 2006-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF15985 KH_6 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2ja9A01
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 2ja9A02
2NVTH 4AIMA 2WFWA 2JJQA 4DV2L 1I94L 2L15A 1G51A 4A3EG 2KBNA 2Y0SG 2NVYH 5GROA 1VQEA 3I7FA 4BBRG 3GTKH 4UP7A 2KCTA 2UXCL 4A3MH 3CPWA 4JI2L 2JA7H 3I4OA 3CMAA 2QNDA 4DKAC 2WB1G 4UY8C 1VQ5A 2OPVA 1VQDA 2ZTCA 4QY7A 2DGRA 3T1HL 2RHQB 4O0AA 4A3LG 4OXPA 1VQMA 1X3EA 1ZZKA 1HNZL 2WB1E 3K7AH 1OXTA 3A5UA 2P2RA 1P16A 3BJUA 1KC8C 4GLXA 1IBLL 1OTCA 2UXDL 3D0FA 3I4MG 4X65Q 4A3IH 4A3KG 1FJGQ 4QQBX 1PFSA 1DTJA 1KIXA 3RLOA 3I4NG 1WFQA 2JEBI 1OXXK 2NN6I 1X56A 3GTJH 3S1MH 5M5YH 4QMFB 1WVNA 3NBHB 5C4XH 4YWLA 2I5HA 1D8LA 1MKHA 1O7IA 3E0EA 4IFDJ 1NY4A 1P8LA 1M1KC 1TWCH 3NEMA 3AYHB 1IBML 1XMQL 4LF5Q 4DPGA 1XNRL 4X62L 1KL9A 3S1QH 4R4TA 4NXNL 3RZDH 1UE6A 1UE1A 2KHJA 4QJFA 3CC2A 1IL2A 1NJIC 2HIVA 1HNWQ 4B8TA 1HZCA 4YCUA 4B3MQ 1TWGH 1FL0A 2MNAA 1KXLA 2CTKA 4IO9A 3CP0A 2UUCL 1LUZA 2JA5H 3T1YL 1GKHA 2OQ0A 1PH3A 3H3VH 1N9WA 4WALA 5EAYA 4YWMA 4DV3L 1A0IA 3PO2G 2HIXA 4BBRH 2CFMA 1XTDA 1IYJB 3K7UC 4YY3Q 1Q8KA 3PIOA 4DK6C 2GVAA 3G6EA 1XPRA 3GTQH 4DNIA 4YCWA 1Q12A 3PUYA 2XGTA 5IP7G 5GADC 3OW2A 2A8VA 3KDFB 3CCEA 3KDFA 4TVAB 1PH2A 1Q1BA 2JE6I 2NVQH 1FGUA 4PZ6A 4BA2I 4KHZA 3J80c 4JI1Q 5IYBH 4DV0Q 2WAQG 4LF8Q 3KLWA 4LF6Q 1A8VA 2F52A 2QGQA 1AE2A 3CCSA 3CCMA 3PUXA 2R7ZG 1VIGA 4ME3A 2E2IH 2OTLA 4C2MH 1N33Q 1RL2A 3L0OA 1VQHA 2WAQE 2K75A 1YI2A 1PH5A 4DR6Q 3A0JA 5C0XI 3E9IA 4A3KH 4JI4Q 1VQCA 3RNUA 1VCIA 1TWAH 1G6PA 4JV5Q 2VY3A 4NXMQ 5IYDG 4X6AH 1YJWA 4NBQA 2IT1A 4X65L 2VW9A 1K0RA 1FJGL 2CTLA 2ZTDA 2ZM6Q 5FLMG 3STBD 4A3BG 4WANA 2PY9A 1VQIA 4A3MG 1YHAA 4DV6Q 1YVCA 4IOCA 1H95A 2Q2HA 1HZBA 1XMOQ 2F4VQ 4IFDG 5LMNQ 4PZ7A 2CPQA 1BVSA 3CCUA 1I5FA 5E7NA 3CCVA 5HGQA 4LF5L 3CAMA 1VQAA 4JOIC 3GTMH 3MEFA 2WP8J 5HY6A 4DR2Q 2N8NA 1E22A 1T9HA 1EIYB 2AMCB 1HNWL 1DT4A 3PV0A 4B3ML 4L5SA 3PO2H 4A3JH 1MJEA 4EQ5A 3FHWA 1OXVA 1I3QH 2B29A 4P72A 4OX9Q 3HOWG 2BH2A 2YTVA 4R4QA 2ES2A 2MO1A 2MQHA 2DGYA 1VQLA 1YHQA 4YY3L 3A5ZB 1VQ7A 4DV5Q 4LUZA 5C4JH 2OCEA 2AWOA 4P71A 3RN2A 1NE3A 3F8TA 4L5QA 3M9BA 3CCJA 3CCQA 1YIJA 1GD7A 2EIFA 4X66Q 4DUYQ 1TWHH 4HIMA 1KHMA 4DV0L 4JI1L 4AH6A 4LF6L 3HOXG 2VZAA 1YHBA 3GD7A 2R7FA 3G4SA 1SFOH 3TS0A 1PYSB 2YQRA 4OO1I 1N33L 4BY7H 4JI8Q 1A62A 4ALPA 5IYDH 1PH6A 4DR6L 2FMRA 4TQUS 3RLNA 4APVA 1QZGA 4KLKA 1PVOA 1AH9A 4JI4L 4YHHQ 2AKWB 3J7ZC 1UWVA 4JI6Q 1HZ9A 3VDYA 5FLMH 1E3PA 3I2ZA 2QA4A 4NXML 4A3BH 4JV5L 4C3IH 3H15A 1YJ9A 2JZXA 1ASZA 2CTMA 2PQUA 2ZM6L 1ZTGA 1B70B 4LF4Q 2PMZE 2JK8A 3BU2A 3UE1A 5IYBG 4JI0Q 4A93H 4DV6L 2E8GA 3KF8B 4GLAC 4NPSA 1SROA 1B8AA 3E9HA 4XIGS 3TQYA 3W1GA 1XMOL 2F4VL 3KJPA 2CTJA 4YCVA 5LMNL 1KRSA 4WJ4A 3AEVB 4JI7Q 4OWXB 4DR1Q 2N49A 2JA9A 1X3GA 2VQFQ 1PH8A 2JA6G 4DR2L 3L7ZC 4DV1Q 1VQ6A 2K4KA 3RR5A 1Q7YC 3S24A 3S14H 4JI5Q 2KCMA 1V43A 2UUBQ 1EWIA 3HOWH 3BZCA 1ASYA 3U1KA 3OTOQ 4OWWB 5GAGC 4B3SQ 4KHPQ 5LMNW 4DAYB 1I6HH 2HHHQ 1GO3E 2CKZB 1WI5A 2R6GA 1K8AC 2ZJRA 4OX9L 3H0GG 4OONA 1IBKQ 3J81i 3CMEA 3ZJYC 3M85A 3RZOH 4DV5L 3ER0A 3K81C 4NB3A 3ULJA 5IE8A 5H1SE 4POGA 5IYCH 2ALYB 2RF4A 3HOXH 1XJVA 2VUMG 3J7A5 1VQJA 2Q2UA 5IT9c 2PQAB 2BA0A 3PCOB 4DV7Q 4UP8A 4GNXC 4X66L 4DUYL 1PA6A 3HOUH 4DR5Q 3KJOA 1JMCA 1R9TH 1LTLA 2VNUD 3CCLA 4A3JG 1SE8A 3AQQA 1EIFA 4JOIA 4DR4L 4BBSG 3TREA 3EIVA 4HJ7A 4JI8L 2IHEA 4X64Q 4YWKA 2UXBQ 2D0PA 3HKZE 3F2CA 2Q2TA 2OTJA 2AXYA 1RIPA 4YHHL 1QVGA 4IOAA 4JI6L 4LWCA 4BY1G 3UDXA 3HOVG 1E24A 3DLLA 4A3GG 4GN4B 3G48A 3TRZA 1X55A 3G71A 1KQSA 1EQQA 4DV4Q 3M7NA 1WJJA 3PUVA 1W2BA 2ANNA 1PYBA 1U5KA 3LGJA 4LF4L 1VQKA 2YYZA 2E2JH 4LUOA 2LSSA 3I55A 3KOJA 4PZ8A 2UUAL 2A19A 4JI0L 2A1AA 4BXXG 2K5VA 2JA6H 1EC6A 4IPHA 3M4OH 2PNHA 5M5WH 1VQNA 4BY7G 2R93G 4EX5A 5AJ3Q 4JI7L 4LF7Q 4DR1L 1XPUA 4LUVA 5DLQE 4RMFA 2VQFL 2JA8G 3S1RH 3S16H 1CKOA 1NBWA 3PSIA 2E3UA 4DV1L 1Y1VH 1S3OA 1VQ4A 4JI5L 1AE3A 1KHIA 5M3MH 2UUBL 2B3GA 3S1NH 3H0GH 1Q46A 5FLXc 4DR7Q 1SN8A 4LFAQ 1C9OA 1L1OC 3OTOL 1VQOA 1E7ZA 3CCRA 1PH4A 2H5XA 2N3SA 1Q1EA 4B3SL 2ASBA 4KHPL 1X4MA 2HHHL 2YTXA 1HR0W 2D62A 1CUKA 3DM3A 2VUMH 1DGSA 1WE8A 4GLVB 2B63G 4A75A 2HH2A 1IBKL 1J6QA 3HOYG 1A63A 2NN6G 4JC0A 2MO0A 2RHSB 1SMXA 3K80C 2KENA 2N78A 2JVZA 3FP9A 3CD6A 2CTEA 1WCMH 2UU9Q 3ERSX 2CQOA 3M3YH 4IPCA 3GTOH 4DV7L 4BBSH 2HH3A 1V9PA 1B7YB 3J80i 2ZJPA 4DR5L 2CCZA 5K36G 2XTIA 1UE5A 4LNQA 1K9MC 4JG2A 2Z0SA 4HJAA 3U58A 1PV4A 4BY1H 1G291 1YEZA 5ELOA 5IP9G 2HT1A 1OXSC 3HOVH 4X64L 4A3GH 1FVIA 4H02A 2UXBL 1JJGA 4GN5A 1U0LA 2R7DA 3HFZB 1Y1WG 2K50A 2Z6KC 2VQEQ 4O2DA 4P74A 4UPAA 3GTGH 1NMFA 2YTYA 4IJHA 4RG1A 1Q82C 3CQZH 4GKJQ 4R4OA 4JVHA 2OPUA 4LF8L 3KYHC 4QGUA 5IYCG 1PH7A 4JI3Q 1IZ6A 4DV4L 1S40A 4BXXH 1OXUA 2MJHA 4LF9Q 1KD1C 1J4WA 4A93G 4HIDA 3GTPH 3HOUG 5FJ8G 5LMUQ 4DR3Q 2PI2E 4UP9A 4PMWA 4GOPC 4DUZQ 2R93H 1YNXA 4P75A 1YJNA 1EQRA 4A3DG 4Y7NH 2JA8H 1EYGA 4GNXB 4GNXA 1N34Q 3ICEA 3PO3G 1PHJA 5AJ3L 4LF7L 4HIKA 3EBEA 3M4QA 3HKSA 4AQYQ 1C7YA 1Z9FA 3TS2A 3PIPA 3OYYA 5JJKA 5C44H 1K83H 1VQ8A 3D31A 4AM3A 5GAEC 1XPOA 5C0XG 1W3SA 4DAMA 3CC7A 1V1QA 4B3TQ 4DR7L 4IPDA 4R4CA 1NTGA 3U50C 1JJ2A 4LFAL 1TWFH 3GDEA 2B63H 2V1CC 3SGIA 3PUZA 3HOYH 1VQPA 4HIOA 2AHOB 1JT8A 3NENA 2I0QA 1HR0Q 3AEVA 2K14A 2E5LQ 4IPGA 4JBKA 3B6YA 1X6OA 3I56A 3PF4A 1N32Q 3PF5A 4GKKQ 1K3RA 2GN5A 2CTFA 1TUAA 1WOCA 4MTNA 4LFCQ 2ZJQA 3WWVA 3AFQA 3KF6B 3PUWA 3KF6A 2LXKA 2F3IA 2FXQA 4MZ9A 2GVBA 5JJIA 1HJPA 3K0XA 4A4IA 2Y0SE 2DUDA 2UU9L 4JYAQ 3Q8DA 1L0WA 4L5RC 1CSPA 2AWNA 5IP9H 3HOZG 1Y1VG 3V69A 4QIWE 2JA7G 4K0KQ 1BKBA 2ANRA 5M3MG 1Y1WH 1EUJA 3W5OA 1E1TA 2I5MX 3S17H 2PI2A 1J5KA 1D7QA 1S72A 4A3CH 3S2DH 1KAWA 2VQEL 4IFDI 4MNOA 1L1OB 1Y14B 1L1OA 5JEAG 4R4IA 1K1GA 2ID0A 3U4ZA 4P73A 2PQAA 3F2DA 4GKJL 1Q81C 4XTCS 5FJ8H 1QUQB 1QUQA 3MXNB 1Z47A 4JI3L 5BR8Q 1Q86C 1M90C 2ATWA 2IX1A 4A3DH 3HKZG 2CWPA 4LF9L 3UDFA 1WCMG 1X54A 2QEXA 1KRTA 1E1OA 1QZHA 4PG3A 3PO3H 4DR3L 5LMUL 1HH2P 5IWAQ 1N8RC 1YZ6A 4DUZL 3CXCA 1J5EQ 4LFBQ 4JBJA 2NZHA 3FKIH 3W1BA 1ZZIA 4WJ3M 3A74A 1N34L 4GN3B 3IRBA 3CF5A 1LYLA 4OWTB 4A76A 1I50H 4OO1G 4AQYL 4JBMA 4LIJA 3M4PA 1HNXQ 2R92G 4R1JA 1EOVA 2Q2IA 4HJ9A 1SRUA 5C3EH 3L2PA 4B3TL 1QVFA 3EN2A 5M3FG 4JVYA 2K5HA 4A3EH 5GQOA 2Z6KA 3RLFA 1IXRA 2K5NA 3K8AA 4QL5A 4A3FG 2UUAQ 3JAMc 2BA1A 1HR0L 1HZAA 2K52A 4HJ8A 2E5LL 1N32L 2IY5B 3S2HH 1SLJA 4GKKL 2MFIA 3H3VI 2C35B 4KI0A 4LFCL 3HOZH 4GS3A 1X65A 4L5TA 3J81j 4FDBA 5C0XJ 1YBYA 4JBWA 1UEBA 4GOPA 4GOPB 1EFWA 3TEHB 3CC4A 4A3LH 4JYAL 2E2HH 4B3RQ 4BA1I 1XNQQ 1N36Q 3PGZA 5C44G 1WYDA 4K0KL 1LM0A 1C0AA 4LW1A 1MIUA 4POFA 3I4MH 1CKMA 1BBWA 4DV2Q 1I94Q 1VS0A 1JJCB 3I4NH 3ULLA 3KFUA 2D0OA 2UXCQ 3UDIA 4J15A 3BZKA 1TXYA 4JI2Q 3S15H 3VKEA 3JC66 1X3FA 1VQFA 4IJLA 5BR8L 4Y52H 3T1HQ 3UE0A 3UDGA 1HNZQ 2JEAI 2YU9H 1JE5A 3NELA 1MJCA 1PH1A 1VQBA 5IWAL 3GTLH 1VQGA 1K73C 1IBLQ 5ELNA 1J5EL 4LFBL 2NZOA 2UXDQ 2BL5A 1CSQA 2BH8A 2R92H 5JEAJ 2HQLA 3JAMi 1CKNB 1CKNA 1QVCA 1X4NA 2OQKA 2VS1A 1GVPA 2LXJA 3STBC 5M3FH 3ULPA 1SR3A 4C3JH 5GAHC 2NVXH 2OWOA 1HNXL 3AFPA 3RN5A 1JB7A 4A3CG 3CPFA 4A3IG 1K8GA 4A3FH 4JCVE 1L2FA 1PH9A 4HJ5A 2I5LX 3GO5A 5IP7H 4AYBG 1XMQQ 1GM5A 1IBMQ 1XNRQ 2EQSA 5C4XG 4X62Q 1VIHA 1X9NA 4NXNQ 5M5XH 3F2BA 3CW2C 2EXDA 1BBUA 5J3BA 1YITA 4AYBE 2KHIA 3FKIG 4C3HH 3F1ZA 2R7ZH 3U4VA 2CWAA 1ZZJA 2UUCQ 2YV5A 5JJLA 2IHFA 3T1YQ 2RCNA 2JQOA 1NMGA 2IX0A 2VL6A 4B3RL 1XNQL 4DV3Q 4DK3C 1N36L 2ZTEA 4DR4Q 5IY0A 1VQ9A 2JA5G 3J81c 5C3EG 1UE7A
chains in the Genus database with same CATH superfamily
4DV2L 2WFWA 1RHPA 2EPBA 4FXDA 1I94L 1G51A 4TRDA 2KBNA 2Y0SG 5GROA 1S03G 3I7FA 1N33H 4E6IA 2C9OA 3K5LA 4JI2L 4UY8C 2F3VA 4IFDH 1VQDA 4QY7A 4Z9CB 2OPVA 2RHQB 3K7AB 4CDFC 4A3LG 1HUNA 1ZZKA 3K7AH 4ILWA 3NSWA 3IL8A 4GLXA 1OTCA 2UXDL 3IFTA 3D0FA 2CHBD 4TSSA 4X65Q 4LFAH 4OEMB 3UI2A 1PFSA 1KIXA 3RLOA 2JEBI 1PRTC 4H13C 5LMNH 2NN6I 4DFAA 2P5ZX 1HQMC 3KK7A 4ZKBB 3KDKA 3NEMA 2G5DA 3PMFA 3S1QB 1IBML 4DPGA 3RZDB 4QUCA 2UU9H 4X62L 3S1QH 3RZDH 1UE6A 1UE1A 4QJFA 4IZ8A 1NJIC 1HNWQ 1HZCA 1EU4A 5LL6b 4I7ZC 2OQ0A 4F87A 1F9SA 5EAYA 4DV3L 1RKNA 1XTDA 2BE5C 1NUCA 3BDLA 3PUYA 3OW2A 4JK1C 4F7XA 3CCEA 4OIJA 5IT9E 2ZQEA 2FFKB 1FGUA 4PZ6A 2AUJD 1SJHD 4KHZA 4JI1Q 5I4DA 4LF6Q 1GUTA 1BCPB 2BDOA 2F52A 2AQ2B 3TMEA 4C2MB 5LHY1 4JI6H 2E2IH 5D14A 4C2MH 2OTLA 1RL2A 1VQHA 1YI2A 1PH5A 1EQVA 1TWAB 1SYDA 3RNUA 1ZYRC 1TWAH 4JV5Q 5IYDG 4X6AH 1YJWA 4X65L 3ERQA 1F77A 1YNNC 2EYHA 2LTMA 2ZM6Q 3BYYB 3S2HB 4A3BG 1HA6A 2WINB 1PMRA 4KHVA 2VQFH 2Q2HA 3NTIA 1XMOQ 4HMIA 5JOBA 2D2CC 2CPQA 3GTMB 2CWHA 3RD4A 1STBA 3GTMH 1LTBD 3MA2B 2QEJC 1EIYB 1E22A 3PO2B 1HNWL 2HHHH 2F0QA 3PO2H 1MJEA 2E76C 1OXVA 1X3QA 3URYA 2O4XA 3M7GA 1I3QH 4KK7A 1SEIA 1HTPA 2RDHA 3D6WA 2F0WA 2DGYA 4B9XA 3A5ZB 3BG3A 1E2ZA 3CRKC 3LNNA 2OCEA 1PRTB 3GTGB 5LL6X 2A1SA 2B2YA 1PTOC 4FJUA 2NUCA 2Q8IB 3M9BA 1LTAD 2EIFA 4JI1L 4IUQA 4LF6L 3GD7A 1PYSB 2YQRA 3I91A 1A62A 4WJWA 1QZGA 1PTOF 2Z6BA 4KLKA 2XWJB 4YHHQ 3K5NA 4JV5L 2QA4A 4NMZA 1YJ9A 2RSNA 3VYUA 2ZM6L 4LF4Q 2JK8A 3BU2A 1Y69U 5IYBG 4A93H 3KBGA 3KF8A 1SROA 1B8AA 3E9HA 3HRZC 5F2DA 1XMOL 4YCVA 1PLFA 3NE5B 4WJ4A 3HP3A 3AEVB 1X3GA 1PH8A 2JA6G 3L7ZC 1S4ZA 3S14H 4KJNA 3RR5A 1K0SA 3RF2A 2QF7A 4JI5Q 3VYRA 2NTSA 2UUBQ 5EBCA 4FXGC 5HURA 1WI5A 4ME5A 2Q8TA 3ER0A 5IE8A 4DNTB 1LTSD 2VUMG 1XJVA 2F0DA 4G4KA 1FD7D 1K3BC 1TQOA 3A8KE 5COYA 3KJOA 4NZTM 5CBAE 2B2VC 4KY5A 2VQEH 1SE8A 2A69D 1EIFA 4K6LA 2UXBQ 1MD2D 3FDTA 4IUVA 3F2CA 4YHHL 3HG9A 1MBYA 1QVGA 4LWCA 4IALA 4BY1G 1S5DD 1E24A 3DLLA 1MHWC 4GN4B 5CR3A 2HDLA 1F2YA 1KQSA 4DUZH 4DV4Q 4V190 1PYBA 2DN8A 4LF4L 1N34H 4CGYB 2F0NA 5ELCA 4PZ8A 3SR1A 2K5VA 4K5WA 2TMPA 3BDOA 3S16B 4LUVA 3S16H 4I7AA 5CMDA 2EYFA 2HUGA 1VQ4A 4JI5L 4FF1A 2E2HB 2UUBL 4RKBA 1SN8A 4LFAQ 1N32H 3Q6SA 2N3SA 1Q1EA 1BDOA 1IW7D 5DAUA 2D62A 1WE8A 1DGSA 1LLRD 3VR3A 2B63G 4IN3A 2HH2A 1LT5D 3I90A 2E75C 5IT9L 4O1NA 2NN6G 3KUPA 3HKZB 3MHBA 4RGTA 3K80C 3RMHA 2UU9Q 1NSNS 3WDNA 2A73B 3QOLA 3J80i 2ZJPA 2CCZA 5K36G 2XTIA 1UE5A 3EROA 3AB9A 2Z0SA 3U58A 1K28A 1G291 1SNPA 4C56C 4ZK9B 5KIXA 1OXSC 1JJGA 2UXBL 1Y1WG 3IAYA 2DY7A 4C1NK 4GKJQ 1FR3A 4F8MA 5KNDA 4R4OA 2NWGA 4F88A 3PQIA 4JI3Q 5IYCG 1PH7A 4DV4L 3GTPB 3SXHA 1KD1C 1X0AA 4LF5H 4A93G 5IOCA 3GTPH 4DR3Q 4Y7NB 2JA8B 4UP9A 4PMWA 1YJNA 5FKAC 4Y7NH 1CHPD 2JA8H 3FPUB 2CW0C 2LKVA 4PNYA 4GNXA 3SK5A 1I6UA 2HD3A 2MPMA 1TS4A 3EBEA 4HIKA 1T5XD 3M4QA 1K83B 1Z6HA 3PIPA 1K83H 2KA7A 1VQ8A 1B50A 4AM3A 4DAMA 3CC7A 3HOYB 4LFAL 1U4MA 1HQRD 1JJ2A 4QUFA 2V1CC 5DM73 2F0PA 3PUZA 3HOYH 1VQPA 2WV6D 5G3LF 2OF1A 2ICEC 4U673 4RGMA 3EJIA 4IPGA 4JBKA 3B6YA 3I56A 2PQUA 3KBXA 4GKKQ 1GHJA 2CTFA 4KD4A 4LFCQ 4MTNA 3WWVA 3KF6B 2FXQA 2GVBA 4A4IA 3K0XA 2UU9L 2Y0SE 4DV2H 1I94H 1L0WA 5IP9H 2AWNA 3HOZG 1WHRA 1YNJC 1QNKA 5BN5A 2ANRA 1STNA 3EA6A 2I5MX 2AUKA 1WD0A 1LV9A 2PI2A 1D7QA 3I0PA 1DJRD 2EY2A 1S72A 4A3CH 2F0LA 2JXMB 1L1OA 5JEAG 1SE2A 4C1NI 4GKJL 3DMUA 3GTJB 4A3DB 1QUQA 2PO4A 4JI3L 5BR8Q 2IX1A 4A3DH 3QR8A 2UXDH 1D2BA 3PO3B 1ET9A 1EYAA 1WCMG 3UDFA 2QEXA 4PG3A 1STYA 3PO3H 4DR3L 4DR2H 4DNRB 4JBJA 3W1BA 3A74A 2N88A 1I50B 3OIPA 1JOKA 1I50H 4J1MA 5ELBA 1LTTD 4HSPA 4ABNA 1IBMH 2KUMA 1EOVA 4TKOB 1SRUA 2K5HA 4PQXA 3RLFA 2K5NA 4RH6A 3OMCA 4A3FG 5KNCA 3JAMc 4QB4A 2BA1A 3GV6A 1HZAA 4HJ8A 4GKKL 4ODGA 4DV3H 4LFCL 3J81j 1SNMA 4L5TA 3GP7A 3DXJC 5FK9C 4C3HG 5CBEE 2K5QA 1WTQA 1N36Q 2KEDA 1WYDA 4IURA 2J4XA 1LM0A 1A3UA 1BBWA 4KMUC 2G8YA 4OL7A 4NDXA 3VR6A 1Y8PB 2A68C 5T1IA 3KFUA 1TXYA 3A7LA 3VKEA 4KTAA 2RSOA 1DOLA 4RA8A 4MN3A 5BR8L 1XYIA 1WTJA 2RDFA 3UDGA 3H3VC 1MJCA 1FKAH 2DNCA 2EJMA 1IBLQ 4OO1H 2NZOA 1B3QA 3M4YA 1ESFA 1CSQA 2BH8A 3MXUA 2HQLA 4C3JB 1DZ1A 3I72A 3STBC 5M3FH 4C3JH 1CQVA 2MHVA 4XDXA 4DXFA 1IBKH 2IX3A 1PH9A 4OGQC 1HNWH 3P75A 3TSSA 3DEOA 4KKSA 5ELFA 4OIKA 5M5XB 1EEID 1E2VA 1EZ8A 2J7ZA 1X9NA 5M5XH 4E9JA 3CW2C 2EXDA 1BBUA 3SB1A 1YITA 4AYBE 2O2LD 2KHIA 1HXYD 3F1ZA 1ZZJA 5JJLA 4R8NA 1NMGA 2VL6A 1N36L 4J6HA 2PW5A 4LMQD 4DF7A 4KN4C 1T5EA 1V1PA 2HCIA 1JE5A 3GTKB 2L15A 2Z1CA 4JI1H 4LF6H 4ZQ3A 3GTKH 4UP7A 2KCTA 5I2XA 2CWFA 1TS5A 3NQIA 3I4OA 1IYVA 1DOKA 4CKBA 3KLSA 1VQMA 4LF7H 2WB1E 1O7ZA 1KC8C 2ZM6H 4HEDA 1IBLL 3GQBA 2L1BA 3OSOA 4DAVA 1D5MC 1RJTA 3DHQA 1I6VC 2ZXRA 1DXMA 1F2ZA 1DTJA 4NZRM 5M5YB 2ICIA 1OXXK 1I4XA 3A8JE 1X56A 1C8CA 5M5YH 1SE3A 3I4LA 1PQXA 3NBHB 4YWLA 2I5HA 1MKHA 1O7IA 1TWCB 5JPNC 5KGUA 2CH4A 1TWCH 4LF5Q 1KTKA 3I8ZA 1KL9A 3FVQA 1JR0D 2EYOA 4B8TA 1IL2A 1TWGB 4ZRZA 4Q0FA 1TWGH 1FL0A 2F0SA 3G6JB 3H3VH 1N9WA 2F0KA 4YWMA 4CJ0B 3PO2G 3Q24A 1IYJB 3K7UC 4YY3Q 1WTVA 1Q8IA 2X06A 4H7BA 4DK6C 2WKCA 5J1ZA 4DNIA 1WD1A 2XGTA 2A8VA 2EDGA 1XXGA 4ZYSA 3KDFA 2CTEA 4DV0Q 2QDLA 4LF8Q 3MC0B 2WACA 1H9SA 4YHHH 3CCSA 1VIGA 4ME3A 3HS0C 1STGA 4A3KB 2WAQE 4DR6Q 3A0JA 4AQYH 1EU3A 2M8WA 4A3KH 4JI4Q 4LF4H 1A3TA 3MVVA 3RUZA 2VW9A 1SMYC 1PXUA 2B2TA 1A2TA 4WANA 4A3MG 2E5LH 2KECA 1R4QB 4HSVA 4PZ7A 4JI5H 2UUBH 1EIGA 4LF5L 4KY7A 3BS1A 3MEFA 2WP8J 5HY6A 4DR2Q 4K6DA 2K05A 1UG8A 1DT4A 2RVLA 1K8OA 1FYCA 2F0JA 3ND8A 2B2UA 2B29A 3OSSD 3TP7A 1KNEA 2BH2A 5CV8A 2YTVA 4R4QA 1BCPC 2RKSA 2ES2A 2MO1A 1O7LA 1SSOA 2MQHA 1YHQA 3QJYA 4YY3L 1VQ7A 3DWAA 4XT1B 2LTLA 4HCSA 2AWOA 1B9NA 2EY1A 1TWHB 4L5QA 3FRPB 2F0VA 1GD7A 4X66Q 4DUYQ 1TWHH 4DV0L 2UXBH 1BCPF 1J5EH 4LFBH 2R7FA 3G4SA 4OO1I 2VXWA 4DK1A 4JI8Q 4DR6L 4TQUS 4JI4L 4DV4H 5HGTA 3J7ZC 4C3IB 3T51B 5JPMC 3D4DA 3D3RA 4C3IH 1ONLA 3ZYYX 2MGSA 1EY4A 1BOSA 2CTMA 1B70B 4O42A 1KLGD 4L8JA 2UUAQ 4XIGS 3W1GA 1NXUA 3FEWX 2K33A 2DNEA 4DR1Q 3D6CA 3HGBA 3C2PA 5ELEA 4DA2A 4DR2L 4DV1Q 1VQ6A 2K4KA 1TS2A 1S5ED 3EZJA 3T13A 3OTOQ 3E5SA 4B3SQ 4KHPQ 2QILA 4DAYA 2NZ1D 2R6GA 1K8AC 4OONA 3RZOB 2F0UA 1IBKQ 3J81i 3M85A 3RZOH 1XTCD 3HOXB 3K81C 2MUYA 1PRTF 4POGA 1B1ZA 2ALYB 2CH4W 3HOXH 3J7A5 3T1HH 3EQLC 4IUUA 3HOUB 1VQJA 3ITPA 5IT9c 3WOFA 4X66L 4DUYL 1EZ6A 3HOUH 4DR5Q 1JMCA 4CDEC 1SNCA 3CCLA 4X3SA 5L37A 4A3JG 3DM1A 4JOIA 3TREA 3EIVA 4JI8L 4GKJH 2IHEA 1AN8A 2OTJA 1KAAA 4JI3H 2EYLA 1OO9B 4GZYC 2AXYA 1ZYRD 4DR3H 1GXDC 1X55A 1YNND 1WJJA 3PUVA 2PQEA 2E2JB 1XMQH 2ANNA 3K59A 3LGJA 2M6QA 1KLUD 2E2JH 4NXNH 2N55A 2UUAL 2A1AA 1F2MA 4IPHA 5EKLA 2PNHA 1VQNA 2UUCH 4BY7G 4LF7Q 4FJSA 4DR1L 1M4VA 1Y1VB 1F2LA 5DLQE 2JA8G 4QMGA 3PSIA 2E3UA 4DV1L 1Y1VH 1S3OA 3QG1A 4EQOA 4RCOA 1W6JA 4DR7Q 5ISRA 3S2HH 3OTOL 1VQOA 1E7ZA 2H5XA 2ASBA 4GKKH 4B3SL 4KHPL 3LWEA 3DWPA 5I6YA 3AMUA 4LFCH 2YTXA 3OPOA 2FJ2A 1HR0W 4IUNA 2JSOA 3FAUA 1IBKL 3HOYG 4JC0A 1NR4A 2MO0A 2RHSB 1SMXA 2KENA 1AZQA 4N8FA 2CQAA 1GOZA 5CORA 1PTOD 3ERSX 2CQOA 4EVOA 1HHVA 1STEA 3BYTB 4DR5L 3KLRA 4LNQA 1II3A 3HOVB 4A3GB 1QCBD 3HZXA 5EGTA 1B3AA 1PV4A 5JVH3 1YEZA 2HT1A 5IP9G 3HOVH 4A3GH 4K8IA 1FVIA 4H02A 2F0IA 1SYGA 3R3OA 1UEAB 5BR8H 2Z6KC 3CQZB 4O2DA 4UPAA 5FO9B 3GTGH 2PNRC 2E2DC 4RG1A 3CQZH 2O4CA 3KYHC 1PZJD 4G7ZC 1IZ6A 1S40A 4BXXH 1G2TA 2MJHA 2R93B 1EY0A 2D9IA 4HIDA 2R93H 2PI2E 3J80W 1YNXA 1IKMA 4R9WA 1EQRA 4A3DG 1FNWA 2HCCA 3OW7A 2QW7A 3PO3G 1LT4D 4RCNA 4LF7L 4G08A 1SXTA 4AQYQ 1Z9FA 2XN9C 4G7OC 3D31A 5IGGA 1W3SA 1TWFB 1V1QA 2L5TA 4HR7B 4B3TQ 4DR7L 1NTGA 1RF2D 3U50C 1TWFH 2A6EC 3GDEA 1EY6A 3SGIA 2EVBA 4CKCA 4HIOA 1V1PB 2LF0A 2NVYB 2XWBB 5FLXW 2E5LQ 2A6HD 3PF5A 1TUAA 1WOCA 1N36H 3PUWA 3Q23A 2E74C 2KCCA 2F3IA 2RBMA 1CK1A 1HJPA 1BUVT 3V69A 2BOSA 3MWYW 4EQNA 1D5ZC 5M3MG 3J81E 4IQZA 2NB0A 1SYCA 1RD9D 3A56A 1KAWA 4IFDI 2RA4A 4PMCA 2KJXA 1K1GA 4DV6H 2ID0A 4P73A 2PQAA 3F2DA 3S1MB 2F4VH 4KN7C 3MXNB 1Z47A 3SE0A 2ATWA 1HFGA 5CV4A 4K5XA 1M90C 1B2TA 1IBLH 1KRTA 1NNXA 2R3ZA 2L0CA 3FKIB 4ZUJA 1J5EQ 4LFBQ 1CT1D 3FKIH 4WJ3M 3NCVA 4GN3B 5C0XH 3CF5A 3NTKA 4UHVA 4OO1G 4AQYL 4FF4A 4JBMA 3M4PA 1HNXQ 4K2KA 4MHEA 3V05A 4B3TL 3C1FA 2Y0SB 5FO7B 3EN2A 2B2WA 5M3FG 4C3JG 5GQOA 1ML0D 1IXRA 3K8AA 1WTPA 3FPPA 1SNDA 2E5LL 2MFIA 2SDFA 4KI0A 1HUMA 5KEEA 5EBDA 4GOPA 1UEBA 4A3LH 5C5LA 2E2HH 4BA1I 1XNQQ 2A69C 3I73A 2M9VA 5C44G 3R2IA 5EKKA 3VA7A 1MIUA 3SK8A 1VS0A 3TZUA 4KJOA 3ULLA 1EFID 1AP0A 1ICFB 3S15B 5E4WC 4RKLA 2D0OA 1U4RA 3S15H 4JI0H 4K2LA 2XRSD 2EE1A 1X3FA 4IJLA 4Y52H 4IUTA 1PZID 3T1HQ 1KDAA 1HNZQ 1SEBD 3GTLB 2JEAI 5M9OA 3PIP3 3GTLH 1K73C 2R92B 1RODA 1J5EL 4LFBL 3OHXC 2IJ0A 2R92H 5JEAJ 1BF4A 3U9SA 3JAMi 1CKNA 1QVCA 5G3LD 2OQKA 1GVPA 2LXJA 5J22A 1VDZA 1GHKA 1HNXL 3SEBA 3RN5A 5C4ZA 4JCVE 1L2FA 1EQTA 3NP8A 2I5LX 1XMQQ 3T16A 1XNRQ 4YIJA 4NXNQ 4IUPA 1XRHA 3U4VA 2UUCQ 3F2UA 3SDZA 3K5MA 2IHFA 3T1YQ 1TIID 4YY3H 2JQOA 5IGDA 1QB5D 1XNQL 4N8X1 2ZTEA 4DR4Q 5IY0A 2SOBA 5C3EG 1UE7A 4AIMA 4DV0H 4LF8H 2EY6A 4XXEA 4JVZA 2L9HA 3T53B 4A3EG 4PV1C 2M2LA 1MGSA 4DR6H 3CMAA 2QNDA 3GR5A 4DKAC 4Q5VA 1ENFA 4JI4H 1VQ5A 1MSZA 4M1UB 3T56B 1MI2A 2EY5A 3T1HL 4O0AA 1RDPD 2D9UA 1X3EA 1HNZL 1EIHA 1SE4A 1DCZA 3A5UA 1OXTA 2P2RA 2XIWA 2O5IC 1B9MA 3I4MG 4A3KG 2F4IA 2FMCA 1SDFA 3I4NG 2LRRA 4AYBB 3BZDB 4UDUC 5C4XB 2ENBA 3GTJH 5KYLA 1STHA 2B2YC 3MXGA 5CC4A 1WVNA 3L9AX 5C4XH 4CBVA 1D8LA 1G91A 4IFDJ 1NY4A 1P8LA 5A2QW 1M1KC 3AYHB 1XMQL 1XNRL 3MFYA 1SAPA 4NXNL 1QJOA 2KHJA 1RCVD 4B3MQ 2MNAA 1KXLA 2CTKA 4HMJA 4IO9A 3CP0A 2UUCL 1LUZA 2AQ1B 2M00A 2MJ8A 3T1YL 1GKHA 1PH3A 3LWUA 4BBRB 2EXZA 5EKIA 1ODHA 2PMZB 2HIXA 2OXPA 4BBRH 2ZXOA 3GTQB 3PIOA 1TVXA 4X66H 4DUYH 1I4RA 2WB1B 1XPRA 3GTQH 1Q12A 5GADC 5IP7G 4LF9H 3NHHA 4X3KA 2SNSA 1WTRA 3NWSA 4TVAB 1PH2A 1Q1BA 1V1OA 3BVZA 4JI8H 3J80c 3MTSA 5IYBH 5E1FA 3KLWA 3K57A 2QGQA 2R7ZG 3PUXA 3L0OA 2JA6B 4BS9A 1SYFA 2BCOA 5C0XI 4XQQA 3E9IA 1H9MA 1VQCA 2F1MA 1VCIA 1G6PA 2VY3A 4NXMQ 4NBQA 2IT1A 3J80E 1K0RA 1VF7A 2UUAH 2QCPX 3LX0A 3STBD 2PY9A 1VQIA 4DR1H 4DV6Q 1YVCA 3Q0AA 4IOCA 1HZBA 2VUMB 2F4VQ 5IGBA 4IFDG 4DV1H 5JVG3 4DK0A 3TP5A 1HCZA 1BVSA 1GUSA 4V0BA 3CCUA 5E7NA 5I2YA 3CCVA 1GUOA 3CAMA 1DONA 2QDBA 3OTOH 4B3SH 4KHPH 2AMCB 1DYQA 2Y3MA 2VB3X 3C1EA 3A8IE 4B3ML 5FLXE 4EQ5A 4OX9Q 4I65A 1VF5C 2KQ3A 1UUPA 5C4JB 1VQLA 2WAQB 1M8AA 4DV5Q 5C4JH 4DR5H 2X6GA 3RN2A 3F8TA 2LFNA 3VYTA 1SFOB 1J8IA 2G9DA 3HOXG 2VZAA 1YHBA 2XSCA 1JCKB 4XQNA 1SFOH 3TS0A 1H9JA 5DNFA 2J0TD 5JJZA 4FNFA 2FMRA 1I4PA 3NPPA 5IGEA 1PVOA 1DOMA 2AKWB 1JOOA 1HZ9A 3VDYA 5FLMH 1E3PA 3NWTA 4NXML 1E0BA 3H15A 1I4QA 2JZXA 3OWFA 1ASZA 3CRLC 1SYEA 2HDMA 2PMZE 3ONAB 3KF8B 4DV6L 3CC2A 4JI0Q 3TQYA 2F4VL 1TU2B 3KJPA 1ESRA 4OWXB 2PZWA 5KNBA 1HA5A 4DR7H 4B3RH 5C6AA 3HOWB 2RDGA 1SJED 2K1BA 2DJFC 2KCMA 4B8CD 3HOWH 1EWIA 3D4WA 1ASYA 3U1KA 1A2UA 2F0EA 5GAGC 5LMNW 1GO3E 3BVMA 4OX9L 4BWGB 4HAEA 3H09A 3VR5A 1BNZA 3CMEA 2F0OA 3ZJYC 4DV5L 3ULJA 5H1SE 5IYCH 2RF4A 4A93B 1C48A 3P20A 3DEPA 1F0XA 1EYCA 3E0JA 2PQAB 3MZ5A 4N9TA 2G9HD 4UP8A 3U9OA 4GNXC 1PA6A 1R9TB 4HCEA 1QWYA 1R9TH 1BXTA 1LTLA 2VNUD 1PFBA 2K5WA 1JWMD 3AQQA 4CDCC 1ENAA 4ZLTF 4YWKA 1PFMA 2H1EA 3K58A 5C3XA 2Q2TA 1G2SA 1SNOA 4CJ1B 3HOVG 4A3GG 3J81W 3G48A 4RFBA 1SYBA 1LABA 3SVMA 1SMYD 1U5KA 1VQKA 4OD6A 2LSSA 3M4OB 5ELDA 4JI0L 1UAPA 4BXXG 3D8GA 3VA5A 1EC6A 3M4OH 2R93G 3S1RB 4B3TH 4JPBW 4RMFA 3S1RH 4NP5A 1CKOA 1G8ZD 1ZKOA 1NBWA 3S1NB 4MTKA 1E2WA 3H0GB 4FF3A 1AE3A 2VB2X 3S1NH 3H0GH 1Q46A 4S3SA 1L1OC 1PH4A 1CI3M 1EY8A 1CUKA 4A75A 1BCPD 4G57A 1A63A 1WCMB 3FP9A 4BBSB 3GTOB 2JYOA 1WCMH 4BBSH 3GTOH 2OT2A 1V9PA 1B7YB 3MEHA 1K9MC 2KOLA 1F9RA 1S5CD 4JG2A 2KVMA 2PT7G 4HJAA 1FJGH 4CKEA 2PW7A 5E3FA 1U0LA 2R7DA 3HFZB 3J80L 2K50A 2KCNA 4P74A 1NMFA 4IJHA 4JVHA 4LF8L 4QGUA 4A3FB 1JQYD 4LF9Q 2K6AA 5EPJA 4P75A 2I46A 2PYKA 1G6ZA 1HNXH 3OETA 3HEJA 4RHRA 4GNXB 3ICEA 3R8BA 1PHJA 2B2VA 3HKSA 5FLXL 4QF4A 5A2QE 1CM9A 1XPOA 4FP5D 4DN4M 5C0XG 1BO0A 1PRTD 2PZTA 3CHBD 4EQPA 4KKUA 1V8QA 5AFWA 2FINB 3PF4A 1K3RA 1XNQH 3AFQA 3KF6A 4MZ9A 4P2CB 4L5RC 2KEEA 3K6OA 1KDBA 4CDDC 1UNSA 1O7YA 1EUJA 3S17B 1E1TA 3S17H 1FGBD 1H9RA 3GV3A 3S2DB 1F9PA 2BE5D 2JP1A 3IKJA 3S2DH 1L1OB 1GUNA 1Y14B 3C3LA 4R4IA 1HNZH 2L4NA 3U4ZA 1Q81C 4XTCS 5FJ8H 1QUQB 2K04A 2X69A 3TN2A 3HKZG 2CWPA 4LF9L 1QZHA 3NK9A 4RGNA 1BBXC 5EPLA 1MSGA 1N8RC 1YZ6A 3CXCA 1HTLD 3EFXD 1ZZIA 5FOBB 5CGKA 1EWCA 4RAUC 3IRBA 1LYLA 2VKCA 1EOTA 2R92G 3H94A 1J9OA 1XNRH 1CTMA 3L2PA 1QVFA 2V4DA 1WTHA 1BR9A 2EOTA 5IIFA 4CJ2C 4ZCKA 3T1YH 3K0YA 1IL8A 1SLJA 2JA7B 3H3VI 4DR4H 4GS3A 3VYSA 2JA7H 2PCFB 4FDBA 3CC4A 3D4RA 2FMMA 4B3RQ 2E2IB 1PYWD 3PGZA 3VR2A 1C0AA 2EJFC 4QCLA 1S5FD 2TSSA 1NCVA 1JJCB 1QNUA 4L63B 4X3UA 1K8MA 2UXCQ 5CV6A 3UDIA 4J15A 4H8AA 1X3PA 4ID6A 1XX8A 1A15A 3JC66 2EYMA 1HPCA 3UE0A 4JI7H 3NELA 1VQGA 4NW2A 1RTNA 5ELNA 2BL5A 1AN7A 3DUZA 2D5DA 2NVXB 5A35A 5DT9A 2VS1A 2F0GA 1SR3A 2NVXH 2OWOA 1NR2A 4L6TB 4A3CG 3AFPA 2EYPA 3EVQA 2L12A 1B53A 1I3QB 3CPFA 1K8GA 1ZXTA 5D3IB 3KDGA 2XNAC 2A6ED 4AYBG 1WTWA 1GM5A 4B3MH 2EQSA 4X3TA 5C4XG 1VIHA 4DV7H 4LK1C 4XT3B 3F2BA 5J3BA 1D6EC 4B9WA 5K5PA 4R8IA 4NKLA 2LY7A 2CWAA 4KY6A 3JAMW 4X64H 4KV6A 1O80A 2IX0A 2F03A 4B3RL 2R61A 1JORA 4DXGA 2NVTB 1VQ9A 3TP6A 3KLSX 2B2TC 3J81c 2NVTH 3H91A 2JJQA 1QG7A 3FMCA 2NVYH 1VQEA 4BBRG 4A3MB 1CA6A 1EEFD 2UXCL 4A3MH 3CPWA 2WB1G 4K14A 2ZTCA 2DGRA 2WKDA 4NXMH 4OXPA 2K5DA 2A74C 2LMCB 1PDQA 2B2UC 1P16A 3BJUA 1GUWA 2F0TA 4A3IB 4WORA 4G7HC 5A2QL 4ULLA 3S14B 4A3IH 1O78A 2H4OA 2IPKD 1FJGQ 1RTOA 1ET6A 4QQBX 5CV7A 1WFQA 1SNQA 4QMFB 3S1MH 5IGFA 3NBHA 3E0EA 1GJXA 1TY0A 2A6HC 2LS01 3TDQA 4R4TA 3J7AF 5BN3A 2HIVA 1JICA 4OX9H 4YCUA 2JA5B 1H9KA 2MP1A 2JA5H 4WALA 1C4QA 1I4GA 4DV5H 1A0IA 2CFMA 1Q8KA 1DD2A 2GVAA 3G6EA 5T1GA 4CHTB 4YCWA 1JB3A 2NVQB 4FF2A 3KDFB 2JE6I 3OOCA 2NVQH 4BA2I 5LMUH 1ILPA 2WAQG 1A8VA 1H9SB 1AE2A 3CCMA 3DWQA 1N33Q 1TR5A 2K75A 5J39A 1CZGA 1PTOB 2Q8RE 4PMBA 4FYDA 1JWUD 1PTOH 3K5OA 3I70A 1FJGL 1CZWA 2C5CA 2CTLA 2ZTDA 1AFPA 5FLMG 1WTOA 1QOHA 4M8AA 1HFNA 1HR0H 1YHAA 1H95A 2OEOA 3QB3A 1AEXA 5LMNQ 1I5FA 5HGQA 5KRUA 1VQAA 4K5VA 3NXWA 4JOIC 4KKTA 4JYAH 2CW0D 2N8NA 1T9HA 4A3JB 4K0KH 1F9QA 1STAA 3PV0A 4L5SA 5C4HA 4A3JH 3FHWA 1IW7C 4P72A 1CA5A 2AQ3B 3HOWG 2XVSA 3MFGA 3CKIB 3I3CA 1Y8OB 3E6ZX 2NYZD 4LUZA 1TS3A 1EY5A 4P71A 1NE3A 5DM63 3H6MA 2F0HA 3CCJA 4OELB 3CCQA 2K32A 4MIUA 1YIJA 4HIMA 1KHMA 5IWAH 4AH6A 4BY7B 5CV9A 1N33L 4BY7H 1YNJD 1JOQA 4ALPA 5IYDH 1PH6A 3SK4A 1L0XB 4LJZC 3RLNA 4APVA 5IODA 1AH9A 4A3BB 2B39A 1UWVA 2HQEA 4JI6Q 4XYOA 3I2ZA 3R2TA 4A3BH 1W6KA 1KDCA 4N9PA 1ZTGA 4XYQA 5I9PA 3UE1A 2E8GA 4GLAC 3A55A 4NPSA 3OWEB 4DAPA 3AU7A 2CTJA 3J7YW 2FPHX 5LMNL 1KRSA 2Z8LA 1VMCA 4JI7Q 3GKUA 1LTGD 2N49A 2JA9A 2VQFQ 5EPKA 1S20A 1Q7YC 3S24A 4U68A 1IKLA 1V43A 3BZCA 3PIO3 3NQTA 1I6HB 2Z9HA 1I6HH 4DAYB 5IGCA 2B8FA 2CKZB 2HHHQ 2ZJRA 3H0GG 1X9ZA 1ILQA 1QE6A 2K28A 4JI2H 4DU9A 3TP8A 4NB3A 2L55A 4OCHA 1IYUA 2Q2UA 4HN7A 3PCOB 2BA0A 4DV7Q 3P7JA 2L11A 3J81L 1S5BD 1WVLA 2SEBD 2Z4HA 4DR4L 4BBSG 4HJ7A 1QILA 3A54A 2IWHA 4WFN3 2XRQD 4X64Q 2D0PA 3OMGA 3HKZE 1TKWB 4RWSC 5EJWA 1RIPA 4J8QA 4IOAA 4JI6L 3UDXA 1LACA 3TRZA 2A68D 4K8JA 3G71A 2F0MA 1ICWA 1ENCA 2K01A 1EQQA 5C3WA 3M7NA 1W2BA 4X62H 3J7AV 2YYZA 3GABA 4EC5A 4LUOA 5C5MA 3I55A 3KOJA 2A19A 5M5WB 4QIWB 2JA6H 1ZEQX 1I4HA 5M5WH 1LT3D 3UOEA 4EX5A 5AJ3Q 5I9OA 4JI7L 1XPUA 3T4AC 2VQFL 3MAQA 1KNAA 5M3MB 1PFNA 1BQQT 3QD7X 1D1KA 2FHTA 1KHIA 1Z7TA 2NBFA 5M3MH 2B3GA 4C3IG 2SNMA 5FLXc 2IL8A 1B44D 1C9OA 3CCRA 2A5HA 1X4MA 2HHHL 4LAAA 2KHSA 3DM3A 3J7AK 2VUMH 3QWNA 3JAME 1Q90A 2NTTA 4GLVB 4FO2A 4FVMA 1CQFA 1J6QA 1JWSD 1WTXA 2JVZA 4EGVA 2N78A 3CD6A 1KABA 3M3YB 2JN4A 4JW0A 4ZKCB 3OIQA 3M3YH 4IPCA 4ZAIA 4DV7L 2HH3A 2DJGC 2B8GA 1EY9A 1PZKD 4BY1B 4X65H 5IT9W 4BY1H 5ELOA 3WOEA 2GA4B 4X64L 4GN5A 5D65A 2B2WC 1EL0A 3R93A 2VQEQ 3QO2A 3IFDA 1EYDA 5M3FB 2YTYA 1Q82C 4ZUIA 1CFMA 3W3AA 1D5XC 2OPUA 1HRJA 1OXUA 4XQJA 1J4WA 3V96A 2K1HA 2EZVA 1V8CA 3HOUG 5FJ8G 5LMUQ 4GOPC 4DUZQ 2K03A 1R4PB 1EYGA 1VMPA 1N34Q 3SHLA 5AJ3L 4WRDA 3CU7A 5C44B 1U4LA 1C7YA 3TS2A 3OYYA 5JJKA 5C44H 5GAEC 2B63B 4H0LC 1CHQD 3BVGA 4IPDA 4R4CA 2B63H 2NN6H 3Q22A 3QOJA 3P1HA 2AHOB 4UAIA 1JT8A 3NENA 2I0QA 1HR0Q 3AEVA 2K14A 1N32Q 3W2DA 1X6OA 2GN5A 2BDNA 2ZJQA 5K36H 1VBIA 1AZPA 5LL6S 2LXKA 1GUGA 5JJIA 4JYAQ 2DUDA 1Y8NB 3Q8DA 1SBBB 4OHJA 1CSPA 4B08A 1Y1WB 1Y1VG 4QIWE 2JA7G 4K0KQ 1BKBA 4JV5H 1Y1WH 1DM0B 3W5OA 2UXCH 2RCFA 3QIAA 1J5KA 2CPMA 2IW3A 3L3OC 2VQEL 4MNOA 4FXKC 2ZT9C 2CVRA 5D3DA 3C46A 1XMOH 4DGZA 1U4PA 3MXNA 1Q86C 3V2TA 1X54A 1E1OA 1NAPA 1LT6D 5CYUA 1HH2P 5IWAQ 5LMUL 4DUZL 5E4XA 1V9NA 2NZHA 1A3VA 1N34L 4HTHA 1Z2IA 4OWTB 4A76A 1Q3LA 4LIJA 2FFMA 2DY8A 4R1JA 5C3EB 4H44C 2Q2IA 5I6WA 4HJ9A 1TY2A 5C3EH 4A3EB 4JVYA 1D1IA 4A3EH 2Z6KA 4QL5A 5NUCA 1IHZA 1HR0L 2Z4IA 2IY5B 2K52A 3HOZB 1N32L 2C35B 3HOZH 2I07B 1X65A 1EFWA 2RQXA 5C0XJ 1YBYA 4JBWA 4GOPB 3TEHB 4JYAL 1U9RA 2EYJA 4KD3A 1MSHA 3I4MB 1EY7A 4K0KL 2PPBC 4LW1A 4POFA 3I4MH 1CKMA 4DV2Q 3I4NB 1I94Q 5JEAH 1LO5D 5DEHA 2F0FA 1X32A 1LTID 3ND9A 3I4NH 2X6LA 3MXPA 1TT2A 4RHSA 3BZKA 4JI2Q 5BN4A 3X3NA 1FNUA 5FO8B 1VQFA 2YU9B 3S9WA 2YU9H 3O13A 1PH1A 2ZXPA 1VQBA 5IWAL 1FNVA 4PDBA 2UXDQ 2PZUA 1A6XA 1CKNB 3BDCA 1X4NA 3G7LA 3N52A 3SK6A 3ULPA 4OWWB 5GAHC 1B4OA 1JB7A 2F3WA 3TZDA 4A3IG 4A3FH 5TSSA 3A7AB 5KYIA 4RGOS 3JAML 2O5JC 4HJ5A 2WIIB 2QKIC 3GO5A 5IP7H 5JAVA 1IBMQ 4X62Q 4C3HB 5EQ0A 3VR4A 2R7ZB 2K7VA 4C3HH 3FKIG 3N6RA 2R7ZH 1LTRD 1JC7A 3NBIA 1AW7A 2YV5A 3E3XA 1XWEA 2RCNA 3X3MA 3NTHA 3TBIB 5CV5A 3NUCA 4DK3C 4DV3Q 2EJGC 2JA5G 1L0YB 1JE4A 1EWHA
chains in the Genus database with same CATH topology
2NVTH 4AIMA 2WFWA 2JJQA 4DV2L 1I94L 2L15A 1G51A 4A3EG 2KBNA 2Y0SG 2NVYH 5GROA 1VQEA 3I7FA 4BBRG 3GTKH 4UP7A 2KCTA 2UXCL 4A3MH 3CPWA 4JI2L 2JA7H 3I4OA 3CMAA 2QNDA 4DKAC 2WB1G 4UY8C 1VQ5A 2OPVA 1VQDA 2ZTCA 4QY7A 2DGRA 3T1HL 2RHQB 4O0AA 4A3LG 4OXPA 1VQMA 1X3EA 1ZZKA 1HNZL 2WB1E 3K7AH 1OXTA 3A5UA 2P2RA 1P16A 3BJUA 1KC8C 4GLXA 1IBLL 1OTCA 2UXDL 3D0FA 3I4MG 4X65Q 4A3IH 4A3KG 1FJGQ 4QQBX 1PFSA 1DTJA 1KIXA 3RLOA 3I4NG 1WFQA 2JEBI 1OXXK 2NN6I 1X56A 3GTJH 3S1MH 5M5YH 4QMFB 1WVNA 3NBHB 5C4XH 4YWLA 2I5HA 1D8LA 1MKHA 1O7IA 3E0EA 4IFDJ 1NY4A 1P8LA 1M1KC 1TWCH 3NEMA 3AYHB 1IBML 1XMQL 4LF5Q 4DPGA 1XNRL 4X62L 1KL9A 3S1QH 4R4TA 4NXNL 3RZDH 1UE6A 1UE1A 2KHJA 4QJFA 3CC2A 1IL2A 1NJIC 2HIVA 1HNWQ 4B8TA 1HZCA 4YCUA 4B3MQ 1TWGH 1FL0A 2MNAA 1KXLA 2CTKA 4IO9A 3CP0A 2UUCL 1LUZA 2JA5H 3T1YL 1GKHA 2OQ0A 1PH3A 3H3VH 1N9WA 4WALA 5EAYA 4YWMA 4DV3L 1A0IA 3PO2G 2HIXA 4BBRH 2CFMA 1XTDA 1IYJB 3K7UC 4YY3Q 1Q8KA 3PIOA 4DK6C 2GVAA 3G6EA 1XPRA 3GTQH 4DNIA 4YCWA 1Q12A 3PUYA 2XGTA 5IP7G 5GADC 3OW2A 2A8VA 3KDFB 3CCEA 3KDFA 4TVAB 1PH2A 1Q1BA 2JE6I 2NVQH 1FGUA 4PZ6A 4BA2I 4KHZA 3J80c 4JI1Q 5IYBH 4DV0Q 2WAQG 4LF8Q 3KLWA 4LF6Q 1A8VA 2F52A 2QGQA 1AE2A 3CCSA 3CCMA 3PUXA 2R7ZG 1VIGA 4ME3A 2E2IH 2OTLA 4C2MH 1N33Q 1RL2A 3L0OA 1VQHA 2WAQE 2K75A 1YI2A 1PH5A 4DR6Q 3A0JA 5C0XI 3E9IA 4A3KH 4JI4Q 1VQCA 3RNUA 1VCIA 1TWAH 1G6PA 4JV5Q 2VY3A 4NXMQ 5IYDG 4X6AH 1YJWA 4NBQA 2IT1A 4X65L 2VW9A 1K0RA 1FJGL 2CTLA 2ZTDA 2ZM6Q 5FLMG 3STBD 4A3BG 4WANA 2PY9A 1VQIA 4A3MG 1YHAA 4DV6Q 1YVCA 4IOCA 1H95A 2Q2HA 1HZBA 1XMOQ 2F4VQ 4IFDG 5LMNQ 4PZ7A 2CPQA 1BVSA 3CCUA 1I5FA 5E7NA 3CCVA 5HGQA 4LF5L 3CAMA 1VQAA 4JOIC 3GTMH 3MEFA 2WP8J 5HY6A 4DR2Q 2N8NA 1E22A 1T9HA 1EIYB 2AMCB 1HNWL 1DT4A 3PV0A 4B3ML 4L5SA 3PO2H 4A3JH 1MJEA 4EQ5A 3FHWA 1OXVA 1I3QH 2B29A 4P72A 4OX9Q 3HOWG 2BH2A 2YTVA 4R4QA 2ES2A 2MO1A 2MQHA 2DGYA 1VQLA 1YHQA 4YY3L 3A5ZB 1VQ7A 4DV5Q 4LUZA 5C4JH 2OCEA 2AWOA 4P71A 3RN2A 1NE3A 3F8TA 4L5QA 3M9BA 3CCJA 3CCQA 1YIJA 1GD7A 2EIFA 4X66Q 4DUYQ 1TWHH 4HIMA 1KHMA 4DV0L 4JI1L 4AH6A 4LF6L 3HOXG 2VZAA 1YHBA 3GD7A 2R7FA 3G4SA 1SFOH 3TS0A 1PYSB 2YQRA 4OO1I 1N33L 4BY7H 4JI8Q 1A62A 4ALPA 5IYDH 1PH6A 4DR6L 2FMRA 4TQUS 3RLNA 4APVA 1QZGA 4KLKA 1PVOA 1AH9A 4JI4L 4YHHQ 2AKWB 3J7ZC 1UWVA 4JI6Q 1HZ9A 3VDYA 5FLMH 1E3PA 3I2ZA 2QA4A 4NXML 4A3BH 4JV5L 4C3IH 3H15A 1YJ9A 2JZXA 1ASZA 2CTMA 2PQUA 2ZM6L 1ZTGA 1B70B 4LF4Q 2PMZE 2JK8A 3BU2A 3UE1A 5IYBG 4JI0Q 4A93H 4DV6L 2E8GA 3KF8B 4GLAC 4NPSA 1SROA 1B8AA 3E9HA 4XIGS 3TQYA 3W1GA 1XMOL 2F4VL 3KJPA 2CTJA 4YCVA 5LMNL 1KRSA 4WJ4A 3AEVB 4JI7Q 4OWXB 4DR1Q 2N49A 2JA9A 1X3GA 2VQFQ 1PH8A 2JA6G 4DR2L 3L7ZC 4DV1Q 1VQ6A 2K4KA 3RR5A 1Q7YC 3S24A 3S14H 4JI5Q 2KCMA 1V43A 2UUBQ 1EWIA 3HOWH 3BZCA 1ASYA 3U1KA 3OTOQ 4OWWB 5GAGC 4B3SQ 4KHPQ 5LMNW 4DAYB 1I6HH 2HHHQ 1GO3E 2CKZB 1WI5A 2R6GA 1K8AC 2ZJRA 4OX9L 3H0GG 4OONA 1IBKQ 3J81i 3CMEA 3ZJYC 3M85A 3RZOH 4DV5L 3ER0A 3K81C 4NB3A 3ULJA 5IE8A 5H1SE 4POGA 5IYCH 2ALYB 2RF4A 3HOXH 1XJVA 2VUMG 3J7A5 1VQJA 2Q2UA 5IT9c 2PQAB 2BA0A 3PCOB 4DV7Q 4UP8A 4GNXC 4X66L 4DUYL 1PA6A 3HOUH 4DR5Q 3KJOA 1JMCA 1R9TH 1LTLA 2VNUD 3CCLA 4A3JG 1SE8A 3AQQA 1EIFA 4JOIA 4DR4L 4BBSG 3TREA 3EIVA 4HJ7A 4JI8L 2IHEA 4X64Q 4YWKA 2UXBQ 2D0PA 3HKZE 3F2CA 2Q2TA 2OTJA 2AXYA 1RIPA 4YHHL 1QVGA 4IOAA 4JI6L 4LWCA 4BY1G 3UDXA 3HOVG 1E24A 3DLLA 4A3GG 4GN4B 3G48A 3TRZA 1X55A 3G71A 1KQSA 1EQQA 4DV4Q 3M7NA 1WJJA 3PUVA 1W2BA 2ANNA 1PYBA 1U5KA 3LGJA 4LF4L 1VQKA 2YYZA 2E2JH 4LUOA 2LSSA 3I55A 3KOJA 4PZ8A 2UUAL 2A19A 4JI0L 2A1AA 4BXXG 2K5VA 2JA6H 1EC6A 4IPHA 3M4OH 2PNHA 5M5WH 1VQNA 4BY7G 2R93G 4EX5A 5AJ3Q 4JI7L 4LF7Q 4DR1L 1XPUA 4LUVA 5DLQE 4RMFA 2VQFL 2JA8G 3S1RH 3S16H 1CKOA 1NBWA 3PSIA 2E3UA 4DV1L 1Y1VH 1S3OA 1VQ4A 4JI5L 1AE3A 1KHIA 5M3MH 2UUBL 2B3GA 3S1NH 3H0GH 1Q46A 5FLXc 4DR7Q 1SN8A 4LFAQ 1C9OA 1L1OC 3OTOL 1VQOA 1E7ZA 3CCRA 1PH4A 2H5XA 2N3SA 1Q1EA 4B3SL 2ASBA 4KHPL 1X4MA 2HHHL 2YTXA 1HR0W 2D62A 1CUKA 3DM3A 2VUMH 1DGSA 1WE8A 4GLVB 2B63G 4A75A 2HH2A 1IBKL 1J6QA 3HOYG 1A63A 2NN6G 4JC0A 2MO0A 2RHSB 1SMXA 3K80C 2KENA 2N78A 2JVZA 3FP9A 3CD6A 2CTEA 1WCMH 2UU9Q 3ERSX 2CQOA 3M3YH 4IPCA 3GTOH 4DV7L 4BBSH 2HH3A 1V9PA 1B7YB 3J80i 2ZJPA 4DR5L 2CCZA 5K36G 2XTIA 1UE5A 4LNQA 1K9MC 4JG2A 2Z0SA 4HJAA 3U58A 1PV4A 4BY1H 1G291 1YEZA 5ELOA 5IP9G 2HT1A 1OXSC 3HOVH 4X64L 4A3GH 1FVIA 4H02A 2UXBL 1JJGA 4GN5A 1U0LA 2R7DA 3HFZB 1Y1WG 2K50A 2Z6KC 2VQEQ 4O2DA 4P74A 4UPAA 3GTGH 1NMFA 2YTYA 4IJHA 4RG1A 1Q82C 3CQZH 4GKJQ 4R4OA 4JVHA 2OPUA 4LF8L 3KYHC 4QGUA 5IYCG 1PH7A 4JI3Q 1IZ6A 4DV4L 1S40A 4BXXH 1OXUA 2MJHA 4LF9Q 1KD1C 1J4WA 4A93G 4HIDA 3GTPH 3HOUG 5FJ8G 5LMUQ 4DR3Q 2PI2E 4UP9A 4PMWA 4GOPC 4DUZQ 2R93H 1YNXA 4P75A 1YJNA 1EQRA 4A3DG 4Y7NH 2JA8H 1EYGA 4GNXB 4GNXA 1N34Q 3ICEA 3PO3G 1PHJA 5AJ3L 4LF7L 4HIKA 3EBEA 3M4QA 3HKSA 4AQYQ 1C7YA 1Z9FA 3TS2A 3PIPA 3OYYA 5JJKA 5C44H 1K83H 1VQ8A 3D31A 4AM3A 5GAEC 1XPOA 5C0XG 1W3SA 4DAMA 3CC7A 1V1QA 4B3TQ 4DR7L 4IPDA 4R4CA 1NTGA 3U50C 1JJ2A 4LFAL 1TWFH 3GDEA 2B63H 2V1CC 3SGIA 3PUZA 3HOYH 1VQPA 4HIOA 2AHOB 1JT8A 3NENA 2I0QA 1HR0Q 3AEVA 2K14A 2E5LQ 4IPGA 4JBKA 3B6YA 1X6OA 3I56A 3PF4A 1N32Q 3PF5A 4GKKQ 1K3RA 2GN5A 2CTFA 1TUAA 1WOCA 4MTNA 4LFCQ 2ZJQA 3WWVA 3AFQA 3KF6B 3PUWA 3KF6A 2LXKA 2F3IA 2FXQA 4MZ9A 2GVBA 5JJIA 1HJPA 3K0XA 4A4IA 2Y0SE 2DUDA 2UU9L 4JYAQ 3Q8DA 1L0WA 4L5RC 1CSPA 2AWNA 5IP9H 3HOZG 1Y1VG 3V69A 4QIWE 2JA7G 4K0KQ 1BKBA 2ANRA 5M3MG 1Y1WH 1EUJA 3W5OA 1E1TA 2I5MX 3S17H 2PI2A 1J5KA 1D7QA 1S72A 4A3CH 3S2DH 1KAWA 2VQEL 4IFDI 4MNOA 1L1OB 1Y14B 1L1OA 5JEAG 4R4IA 1K1GA 2ID0A 3U4ZA 4P73A 2PQAA 3F2DA 4GKJL 1Q81C 4XTCS 5FJ8H 1QUQB 1QUQA 3MXNB 1Z47A 4JI3L 5BR8Q 1Q86C 1M90C 2ATWA 2IX1A 4A3DH 3HKZG 2CWPA 4LF9L 3UDFA 1WCMG 1X54A 2QEXA 1KRTA 1E1OA 1QZHA 4PG3A 3PO3H 4DR3L 5LMUL 1HH2P 5IWAQ 1N8RC 1YZ6A 4DUZL 3CXCA 1J5EQ 4LFBQ 4JBJA 2NZHA 3FKIH 3W1BA 1ZZIA 4WJ3M 3A74A 1N34L 4GN3B 3IRBA 3CF5A 1LYLA 4OWTB 4A76A 1I50H 4OO1G 4AQYL 4JBMA 4LIJA 3M4PA 1HNXQ 2R92G 4R1JA 1EOVA 2Q2IA 4HJ9A 1SRUA 5C3EH 3L2PA 4B3TL 1QVFA 3EN2A 5M3FG 4JVYA 2K5HA 4A3EH 5GQOA 2Z6KA 3RLFA 1IXRA 2K5NA 3K8AA 4QL5A 4A3FG 2UUAQ 3JAMc 2BA1A 1HR0L 1HZAA 2K52A 4HJ8A 2E5LL 1N32L 2IY5B 3S2HH 1SLJA 4GKKL 2MFIA 3H3VI 2C35B 4KI0A 4LFCL 3HOZH 4GS3A 1X65A 4L5TA 3J81j 4FDBA 5C0XJ 1YBYA 4JBWA 1UEBA 4GOPA 4GOPB 1EFWA 3TEHB 3CC4A 4A3LH 4JYAL 2E2HH 4B3RQ 4BA1I 1XNQQ 1N36Q 3PGZA 5C44G 1WYDA 4K0KL 1LM0A 1C0AA 4LW1A 1MIUA 4POFA 3I4MH 1CKMA 1BBWA 4DV2Q 1I94Q 1VS0A 1JJCB 3I4NH 3ULLA 3KFUA 2D0OA 2UXCQ 3UDIA 4J15A 3BZKA 1TXYA 4JI2Q 3S15H 3VKEA 3JC66 1X3FA 1VQFA 4IJLA 5BR8L 4Y52H 3T1HQ 3UE0A 3UDGA 1HNZQ 2JEAI 2YU9H 1JE5A 3NELA 1MJCA 1PH1A 1VQBA 5IWAL 3GTLH 1VQGA 1K73C 1IBLQ 5ELNA 1J5EL 4LFBL 2NZOA 2UXDQ 2BL5A 1CSQA 2BH8A 2R92H 5JEAJ 2HQLA 3JAMi 1CKNB 1CKNA 1QVCA 1X4NA 2OQKA 2VS1A 1GVPA 2LXJA 3STBC 5M3FH 3ULPA 1SR3A 4C3JH 5GAHC 2NVXH 2OWOA 1HNXL 3AFPA 3RN5A 1JB7A 4A3CG 3CPFA 4A3IG 1K8GA 4A3FH 4JCVE 1L2FA 1PH9A 4HJ5A 2I5LX 3GO5A 5IP7H 4AYBG 1XMQQ 1GM5A 1IBMQ 1XNRQ 2EQSA 5C4XG 4X62Q 1VIHA 1X9NA 4NXNQ 5M5XH 3F2BA 3CW2C 2EXDA 1BBUA 5J3BA 1YITA 4AYBE 2KHIA 3FKIG 4C3HH 3F1ZA 2R7ZH 3U4VA 2CWAA 1ZZJA 2UUCQ 2YV5A 5JJLA 2IHFA 3T1YQ 2RCNA 2JQOA 1NMGA 2IX0A 2VL6A 4B3RL 1XNQL 4DV3Q 4DK3C 1N36L 2ZTEA 4DR4Q 5IY0A 1VQ9A 2JA5G 3J81c 5C3EG 1UE7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NVT H;  4AIM A;  2WFW A;  2JJQ A;  4DV2 L;  1I94 L;  2L15 A;  1G51 A;  4A3E G;  2KBN A;  2Y0S G;  2NVY H;  5GRO A;  1VQE A;  3I7F A;  4BBR G;  3GTK H;  4UP7 A;  2KCT A;  2UXC L;  4A3M H;  3CPW A;  4JI2 L;  2JA7 H;  3I4O A;  3CMA A;  2QND A;  4DKA C;  2WB1 G;  4UY8 C;  1VQ5 A;  2OPV A;  1VQD A;  2ZTC A;  4QY7 A;  2DGR A;  3T1H L;  2RHQ B;  4O0A A;  4A3L G;  4OXP A;  1VQM A;  1X3E A;  1ZZK A;  1HNZ L;  2WB1 E;  3K7A H;  1OXT A;  3A5U A;  2P2R A;  1P16 A;  3BJU A;  1KC8 C;  4GLX A;  1IBL L;  1OTC A;  2UXD L;  3D0F A;  3I4M G;  4X65 Q;  4A3I H;  4A3K G;  1FJG Q;  4QQB X;  1PFS A;  1DTJ A;  1KIX A;  3RLO A;  3I4N G;  1WFQ A;  2JEB I;  1OXX K;  2NN6 I;  1X56 A;  3GTJ H;  3S1M H;  5M5Y H;  4QMF B;  1WVN A;  3NBH B;  5C4X H;  4YWL A;  2I5H A;  1D8L A;  1MKH A;  1O7I A;  3E0E A;  4IFD J;  1NY4 A;  1P8L A;  1M1K C;  1TWC H;  3NEM A;  3AYH B;  1IBM L;  1XMQ L;  4LF5 Q;  4DPG A;  1XNR L;  4X62 L;  1KL9 A;  3S1Q H;  4R4T A;  4NXN L;  3RZD H;  1UE6 A;  1UE1 A;  2KHJ A;  4QJF A;  3CC2 A;  1IL2 A;  1NJI C;  2HIV A;  1HNW Q;  4B8T A;  1HZC A;  4YCU A;  4B3M Q;  1TWG H;  1FL0 A;  2MNA A;  1KXL A;  2CTK A;  4IO9 A;  3CP0 A;  2UUC L;  1LUZ A;  2JA5 H;  3T1Y L;  1GKH A;  2OQ0 A;  1PH3 A;  3H3V H;  1N9W A;  4WAL A;  5EAY A;  4YWM A;  4DV3 L;  1A0I A;  3PO2 G;  2HIX A;  4BBR H;  2CFM A;  1XTD A;  1IYJ B;  3K7U C;  4YY3 Q;  1Q8K A;  3PIO A;  4DK6 C;  2GVA A;  3G6E A;  1XPR A;  3GTQ H;  4DNI A;  4YCW A;  1Q12 A;  3PUY A;  2XGT A;  5IP7 G;  5GAD C;  3OW2 A;  2A8V A;  3KDF B;  3CCE A;  3KDF A;  4TVA B;  1PH2 A;  1Q1B A;  2JE6 I;  2NVQ H;  1FGU A;  4PZ6 A;  4BA2 I;  4KHZ A;  3J80 c;  4JI1 Q;  5IYB H;  4DV0 Q;  2WAQ G;  4LF8 Q;  3KLW A;  4LF6 Q;  1A8V A;  2F52 A;  2QGQ A;  1AE2 A;  3CCS A;  3CCM A;  3PUX A;  2R7Z G;  1VIG A;  4ME3 A;  2E2I H;  2OTL A;  4C2M H;  1N33 Q;  1RL2 A;  3L0O A;  1VQH A;  2WAQ E;  2K75 A;  1YI2 A;  1PH5 A;  4DR6 Q;  3A0J A;  5C0X I;  3E9I A;  4A3K H;  4JI4 Q;  1VQC A;  3RNU A;  1VCI A;  1TWA H;  1G6P A;  4JV5 Q;  2VY3 A;  4NXM Q;  5IYD G;  4X6A H;  1YJW A;  4NBQ A;  2IT1 A;  4X65 L;  2VW9 A;  1K0R A;  1FJG L;  2CTL A;  2ZTD A;  2ZM6 Q;  5FLM G;  3STB D;  4A3B G;  4WAN A;  2PY9 A;  1VQI A;  4A3M G;  1YHA A;  4DV6 Q;  1YVC A;  4IOC A;  1H95 A;  2Q2H A;  1HZB A;  1XMO Q;  2F4V Q;  4IFD G;  5LMN Q;  4PZ7 A;  2CPQ A;  1BVS A;  3CCU A;  1I5F A;  5E7N A;  3CCV A;  5HGQ A;  4LF5 L;  3CAM A;  1VQA A;  4JOI C;  3GTM H;  3MEF A;  2WP8 J;  5HY6 A;  4DR2 Q;  2N8N A;  1E22 A;  1T9H A;  1EIY B;  2AMC B;  1HNW L;  1DT4 A;  3PV0 A;  4B3M L;  4L5S A;  3PO2 H;  4A3J H;  1MJE A;  4EQ5 A;  3FHW A;  1OXV A;  1I3Q H;  2B29 A;  4P72 A;  4OX9 Q;  3HOW G;  2BH2 A;  2YTV A;  4R4Q A;  2ES2 A;  2MO1 A;  2MQH A;  2DGY A;  1VQL A;  1YHQ A;  4YY3 L;  3A5Z B;  1VQ7 A;  4DV5 Q;  4LUZ A;  5C4J H;  2OCE A;  2AWO A;  4P71 A;  3RN2 A;  1NE3 A;  3F8T A;  4L5Q A;  3M9B A;  3CCJ A;  3CCQ A;  1YIJ A;  1GD7 A;  2EIF A;  4X66 Q;  4DUY Q;  1TWH H;  4HIM A;  1KHM A;  4DV0 L;  4JI1 L;  4AH6 A;  4LF6 L;  3HOX G;  2VZA A;  1YHB A;  3GD7 A;  2R7F A;  3G4S A;  1SFO H;  3TS0 A;  1PYS B;  2YQR A;  4OO1 I;  1N33 L;  4BY7 H;  4JI8 Q;  1A62 A;  4ALP A;  5IYD H;  1PH6 A;  4DR6 L;  2FMR A;  4TQU S;  3RLN A;  4APV A;  1QZG A;  4KLK A;  1PVO A;  1AH9 A;  4JI4 L;  4YHH Q;  2AKW B;  3J7Z C;  1UWV A;  4JI6 Q;  1HZ9 A;  3VDY A;  5FLM H;  1E3P A;  3I2Z A;  2QA4 A;  4NXM L;  4A3B H;  4JV5 L;  4C3I H;  3H15 A;  1YJ9 A;  2JZX A;  1ASZ A;  2CTM A;  2PQU A;  2ZM6 L;  1ZTG A;  1B70 B;  4LF4 Q;  2PMZ E;  2JK8 A;  3BU2 A;  3UE1 A;  5IYB G;  4JI0 Q;  4A93 H;  4DV6 L;  2E8G A;  3KF8 B;  4GLA C;  4NPS A;  1SRO A;  1B8A A;  3E9H A;  4XIG S;  3TQY A;  3W1G A;  1XMO L;  2F4V L;  3KJP A;  2CTJ A;  4YCV A;  5LMN L;  1KRS A;  4WJ4 A;  3AEV B;  4JI7 Q;  4OWX B;  4DR1 Q;  2N49 A;  2JA9 A;  1X3G A;  2VQF Q;  1PH8 A;  2JA6 G;  4DR2 L;  3L7Z C;  4DV1 Q;  1VQ6 A;  2K4K A;  3RR5 A;  1Q7Y C;  3S24 A;  3S14 H;  4JI5 Q;  2KCM A;  1V43 A;  2UUB Q;  1EWI A;  3HOW H;  3BZC A;  1ASY A;  3U1K A;  3OTO Q;  4OWW B;  5GAG C;  4B3S Q;  4KHP Q;  5LMN W;  4DAY B;  1I6H H;  2HHH Q;  1GO3 E;  2CKZ B;  1WI5 A;  2R6G A;  1K8A C;  2ZJR A;  4OX9 L;  3H0G G;  4OON A;  1IBK Q;  3J81 i;  3CME A;  3ZJY C;  3M85 A;  3RZO H;  4DV5 L;  3ER0 A;  3K81 C;  4NB3 A;  3ULJ A;  5IE8 A;  5H1S E;  4POG A;  5IYC H;  2ALY B;  2RF4 A;  3HOX H;  1XJV A;  2VUM G;  3J7A 5;  1VQJ A;  2Q2U A;  5IT9 c;  2PQA B;  2BA0 A;  3PCO B;  4DV7 Q;  4UP8 A;  4GNX C;  4X66 L;  4DUY L;  1PA6 A;  3HOU H;  4DR5 Q;  3KJO A;  1JMC A;  1R9T H;  1LTL A;  2VNU D;  3CCL A;  4A3J G;  1SE8 A;  3AQQ A;  1EIF A;  4JOI A;  4DR4 L;  4BBS G;  3TRE A;  3EIV A;  4HJ7 A;  4JI8 L;  2IHE A;  4X64 Q;  4YWK A;  2UXB Q;  2D0P A;  3HKZ E;  3F2C A;  2Q2T A;  2OTJ A;  2AXY A;  1RIP A;  4YHH L;  1QVG A;  4IOA A;  4JI6 L;  4LWC A;  4BY1 G;  3UDX A;  3HOV G;  1E24 A;  3DLL A;  4A3G G;  4GN4 B;  3G48 A;  3TRZ A;  1X55 A;  3G71 A;  1KQS A;  1EQQ A;  4DV4 Q;  3M7N A;  1WJJ A;  3PUV A;  1W2B A;  2ANN A;  1PYB A;  1U5K A;  3LGJ A;  4LF4 L;  1VQK A;  2YYZ A;  2E2J H;  4LUO A;  2LSS A;  3I55 A;  3KOJ A;  4PZ8 A;  2UUA L;  2A19 A;  4JI0 L;  2A1A A;  4BXX G;  2K5V A;  2JA6 H;  1EC6 A;  4IPH A;  3M4O H;  2PNH A;  5M5W H;  1VQN A;  4BY7 G;  2R93 G;  4EX5 A;  5AJ3 Q;  4JI7 L;  4LF7 Q;  4DR1 L;  1XPU A;  4LUV A;  5DLQ E;  4RMF A;  2VQF L;  2JA8 G;  3S1R H;  3S16 H;  1CKO A;  1NBW A;  3PSI A;  2E3U A;  4DV1 L;  1Y1V H;  1S3O A;  1VQ4 A;  4JI5 L;  1AE3 A;  1KHI A;  5M3M H;  2UUB L;  2B3G A;  3S1N H;  3H0G H;  1Q46 A;  5FLX c;  4DR7 Q;  1SN8 A;  4LFA Q;  1C9O A;  1L1O C;  3OTO L;  1VQO A;  1E7Z A;  3CCR A;  1PH4 A;  2H5X A;  2N3S A;  1Q1E A;  4B3S L;  2ASB A;  4KHP L;  1X4M A;  2HHH L;  2YTX A;  1HR0 W;  2D62 A;  1CUK A;  3DM3 A;  2VUM H;  1DGS A;  1WE8 A;  4GLV B;  2B63 G;  4A75 A;  2HH2 A;  1IBK L;  1J6Q A;  3HOY G;  1A63 A;  2NN6 G;  4JC0 A;  2MO0 A;  2RHS B;  1SMX A;  3K80 C;  2KEN A;  2N78 A;  2JVZ A;  3FP9 A;  3CD6 A;  2CTE A;  1WCM H;  2UU9 Q;  3ERS X;  2CQO A;  3M3Y H;  4IPC A;  3GTO H;  4DV7 L;  4BBS H;  2HH3 A;  1V9P A;  1B7Y B;  3J80 i;  2ZJP A;  4DR5 L;  2CCZ A;  5K36 G;  2XTI A;  1UE5 A;  4LNQ A;  1K9M C;  4JG2 A;  2Z0S A;  4HJA A;  3U58 A;  1PV4 A;  4BY1 H;  1G29 1;  1YEZ A;  5ELO A;  5IP9 G;  2HT1 A;  1OXS C;  3HOV H;  4X64 L;  4A3G H;  1FVI A;  4H02 A;  2UXB L;  1JJG A;  4GN5 A;  1U0L A;  2R7D A;  3HFZ B;  1Y1W G;  2K50 A;  2Z6K C;  2VQE Q;  4O2D A;  4P74 A;  4UPA A;  3GTG H;  1NMF A;  2YTY A;  4IJH A;  4RG1 A;  1Q82 C;  3CQZ H;  4GKJ Q;  4R4O A;  4JVH A;  2OPU A;  4LF8 L;  3KYH C;  4QGU A;  5IYC G;  1PH7 A;  4JI3 Q;  1IZ6 A;  4DV4 L;  1S40 A;  4BXX H;  1OXU A;  2MJH A;  4LF9 Q;  1KD1 C;  1J4W A;  4A93 G;  4HID A;  3GTP H;  3HOU G;  5FJ8 G;  5LMU Q;  4DR3 Q;  2PI2 E;  4UP9 A;  4PMW A;  4GOP C;  4DUZ Q;  2R93 H;  1YNX A;  4P75 A;  1YJN A;  1EQR A;  4A3D G;  4Y7N H;  2JA8 H;  1EYG A;  4GNX B;  4GNX A;  1N34 Q;  3ICE A;  3PO3 G;  1PHJ A;  5AJ3 L;  4LF7 L;  4HIK A;  3EBE A;  3M4Q A;  3HKS A;  4AQY Q;  1C7Y A;  1Z9F A;  3TS2 A;  3PIP A;  3OYY A;  5JJK A;  5C44 H;  1K83 H;  1VQ8 A;  3D31 A;  4AM3 A;  5GAE C;  1XPO A;  5C0X G;  1W3S A;  4DAM A;  3CC7 A;  1V1Q A;  4B3T Q;  4DR7 L;  4IPD A;  4R4C A;  1NTG A;  3U50 C;  1JJ2 A;  4LFA L;  1TWF H;  3GDE A;  2B63 H;  2V1C C;  3SGI A;  3PUZ A;  3HOY H;  1VQP A;  4HIO A;  2AHO B;  1JT8 A;  3NEN A;  2I0Q A;  1HR0 Q;  3AEV A;  2K14 A;  2E5L Q;  4IPG A;  4JBK A;  3B6Y A;  1X6O A;  3I56 A;  3PF4 A;  1N32 Q;  3PF5 A;  4GKK Q;  1K3R A;  2GN5 A;  2CTF A;  1TUA A;  1WOC A;  4MTN A;  4LFC Q;  2ZJQ A;  3WWV A;  3AFQ A;  3KF6 B;  3PUW A;  3KF6 A;  2LXK A;  2F3I A;  2FXQ A;  4MZ9 A;  2GVB A;  5JJI A;  1HJP A;  3K0X A;  4A4I A;  2Y0S E;  2DUD A;  2UU9 L;  4JYA Q;  3Q8D A;  1L0W A;  4L5R C;  1CSP A;  2AWN A;  5IP9 H;  3HOZ G;  1Y1V G;  3V69 A;  4QIW E;  2JA7 G;  4K0K Q;  1BKB A;  2ANR A;  5M3M G;  1Y1W H;  1EUJ A;  3W5O A;  1E1T A;  2I5M X;  3S17 H;  2PI2 A;  1J5K A;  1D7Q A;  1S72 A;  4A3C H;  3S2D H;  1KAW A;  2VQE L;  4IFD I;  4MNO A;  1L1O B;  1Y14 B;  1L1O A;  5JEA G;  4R4I A;  1K1G A;  2ID0 A;  3U4Z A;  4P73 A;  2PQA A;  3F2D A;  4GKJ L;  1Q81 C;  4XTC S;  5FJ8 H;  1QUQ B;  1QUQ A;  3MXN B;  1Z47 A;  4JI3 L;  5BR8 Q;  1Q86 C;  1M90 C;  2ATW A;  2IX1 A;  4A3D H;  3HKZ G;  2CWP A;  4LF9 L;  3UDF A;  1WCM G;  1X54 A;  2QEX A;  1KRT A;  1E1O A;  1QZH A;  4PG3 A;  3PO3 H;  4DR3 L;  5LMU L;  1HH2 P;  5IWA Q;  1N8R C;  1YZ6 A;  4DUZ L;  3CXC A;  1J5E Q;  4LFB Q;  4JBJ A;  2NZH A;  3FKI H;  3W1B A;  1ZZI A;  4WJ3 M;  3A74 A;  1N34 L;  4GN3 B;  3IRB A;  3CF5 A;  1LYL A;  4OWT B;  4A76 A;  1I50 H;  4OO1 G;  4AQY L;  4JBM A;  4LIJ A;  3M4P A;  1HNX Q;  2R92 G;  4R1J A;  1EOV A;  2Q2I A;  4HJ9 A;  1SRU A;  5C3E H;  3L2P A;  4B3T L;  1QVF A;  3EN2 A;  5M3F G;  4JVY A;  2K5H A;  4A3E H;  5GQO A;  2Z6K A;  3RLF A;  1IXR A;  2K5N A;  3K8A A;  4QL5 A;  4A3F G;  2UUA Q;  3JAM c;  2BA1 A;  1HR0 L;  1HZA A;  2K52 A;  4HJ8 A;  2E5L L;  1N32 L;  2IY5 B;  3S2H H;  1SLJ A;  4GKK L;  2MFI A;  3H3V I;  2C35 B;  4KI0 A;  4LFC L;  3HOZ H;  4GS3 A;  1X65 A;  4L5T A;  3J81 j;  4FDB A;  5C0X J;  1YBY A;  4JBW A;  1UEB A;  4GOP A;  4GOP B;  1EFW A;  3TEH B;  3CC4 A;  4A3L H;  4JYA L;  2E2H H;  4B3R Q;  4BA1 I;  1XNQ Q;  1N36 Q;  3PGZ A;  5C44 G;  1WYD A;  4K0K L;  1LM0 A;  1C0A A;  4LW1 A;  1MIU A;  4POF A;  3I4M H;  1CKM A;  1BBW A;  4DV2 Q;  1I94 Q;  1VS0 A;  1JJC B;  3I4N H;  3ULL A;  3KFU A;  2D0O A;  2UXC Q;  3UDI A;  4J15 A;  3BZK A;  1TXY A;  4JI2 Q;  3S15 H;  3VKE A;  3JC6 6;  1X3F A;  1VQF A;  4IJL A;  5BR8 L;  4Y52 H;  3T1H Q;  3UE0 A;  3UDG A;  1HNZ Q;  2JEA I;  2YU9 H;  1JE5 A;  3NEL A;  1MJC A;  1PH1 A;  1VQB A;  5IWA L;  3GTL H;  1VQG A;  1K73 C;  1IBL Q;  5ELN A;  1J5E L;  4LFB L;  2NZO A;  2UXD Q;  2BL5 A;  1CSQ A;  2BH8 A;  2R92 H;  5JEA J;  2HQL A;  3JAM i;  1CKN B;  1CKN A;  1QVC A;  1X4N A;  2OQK A;  2VS1 A;  1GVP A;  2LXJ A;  3STB C;  5M3F H;  3ULP A;  1SR3 A;  4C3J H;  5GAH C;  2NVX H;  2OWO A;  1HNX L;  3AFP A;  3RN5 A;  1JB7 A;  4A3C G;  3CPF A;  4A3I G;  1K8G A;  4A3F H;  4JCV E;  1L2F A;  1PH9 A;  4HJ5 A;  2I5L X;  3GO5 A;  5IP7 H;  4AYB G;  1XMQ Q;  1GM5 A;  1IBM Q;  1XNR Q;  2EQS A;  5C4X G;  4X62 Q;  1VIH A;  1X9N A;  4NXN Q;  5M5X H;  3F2B A;  3CW2 C;  2EXD A;  1BBU A;  5J3B A;  1YIT A;  4AYB E;  2KHI A;  3FKI G;  4C3H H;  3F1Z A;  2R7Z H;  3U4V A;  2CWA A;  1ZZJ A;  2UUC Q;  2YV5 A;  5JJL A;  2IHF A;  3T1Y Q;  2RCN A;  2JQO A;  1NMG A;  2IX0 A;  2VL6 A;  4B3R L;  1XNQ L;  4DV3 Q;  4DK3 C;  1N36 L;  2ZTE A;  4DR4 Q;  5IY0 A;  1VQ9 A;  2JA5 G;  3J81 c;  5C3E G;  1UE7 A; 
#chains in the Genus database with same CATH topology
 4DV2 L;  2WFW A;  1RHP A;  2EPB A;  4FXD A;  1I94 L;  1G51 A;  4TRD A;  2KBN A;  2Y0S G;  5GRO A;  1S03 G;  3I7F A;  1N33 H;  4E6I A;  2C9O A;  3K5L A;  4JI2 L;  4UY8 C;  2F3V A;  4IFD H;  1VQD A;  4QY7 A;  4Z9C B;  2OPV A;  2RHQ B;  3K7A B;  4CDF C;  4A3L G;  1HUN A;  1ZZK A;  3K7A H;  4ILW A;  3NSW A;  3IL8 A;  4GLX A;  1OTC A;  2UXD L;  3IFT A;  3D0F A;  2CHB D;  4TSS A;  4X65 Q;  4LFA H;  4OEM B;  3UI2 A;  1PFS A;  1KIX A;  3RLO A;  2JEB I;  1PRT C;  4H13 C;  5LMN H;  2NN6 I;  4DFA A;  2P5Z X;  1HQM C;  3KK7 A;  4ZKB B;  3KDK A;  3NEM A;  2G5D A;  3PMF A;  3S1Q B;  1IBM L;  4DPG A;  3RZD B;  4QUC A;  2UU9 H;  4X62 L;  3S1Q H;  3RZD H;  1UE6 A;  1UE1 A;  4QJF A;  4IZ8 A;  1NJI C;  1HNW Q;  1HZC A;  1EU4 A;  5LL6 b;  4I7Z C;  2OQ0 A;  4F87 A;  1F9S A;  5EAY A;  4DV3 L;  1RKN A;  1XTD A;  2BE5 C;  1NUC A;  3BDL A;  3PUY A;  3OW2 A;  4JK1 C;  4F7X A;  3CCE A;  4OIJ A;  5IT9 E;  2ZQE A;  2FFK B;  1FGU A;  4PZ6 A;  2AUJ D;  1SJH D;  4KHZ A;  4JI1 Q;  5I4D A;  4LF6 Q;  1GUT A;  1BCP B;  2BDO A;  2F52 A;  2AQ2 B;  3TME A;  4C2M B;  5LHY 1;  4JI6 H;  2E2I H;  5D14 A;  4C2M H;  2OTL A;  1RL2 A;  1VQH A;  1YI2 A;  1PH5 A;  1EQV A;  1TWA B;  1SYD A;  3RNU A;  1ZYR C;  1TWA H;  4JV5 Q;  5IYD G;  4X6A H;  1YJW A;  4X65 L;  3ERQ A;  1F77 A;  1YNN C;  2EYH A;  2LTM A;  2ZM6 Q;  3BYY B;  3S2H B;  4A3B G;  1HA6 A;  2WIN B;  1PMR A;  4KHV A;  2VQF H;  2Q2H A;  3NTI A;  1XMO Q;  4HMI A;  5JOB A;  2D2C C;  2CPQ A;  3GTM B;  2CWH A;  3RD4 A;  1STB A;  3GTM H;  1LTB D;  3MA2 B;  2QEJ C;  1EIY B;  1E22 A;  3PO2 B;  1HNW L;  2HHH H;  2F0Q A;  3PO2 H;  1MJE A;  2E76 C;  1OXV A;  1X3Q A;  3URY A;  2O4X A;  3M7G A;  1I3Q H;  4KK7 A;  1SEI A;  1HTP A;  2RDH A;  3D6W A;  2F0W A;  2DGY A;  4B9X A;  3A5Z B;  3BG3 A;  1E2Z A;  3CRK C;  3LNN A;  2OCE A;  1PRT B;  3GTG B;  5LL6 X;  2A1S A;  2B2Y A;  1PTO C;  4FJU A;  2NUC A;  2Q8I B;  3M9B A;  1LTA D;  2EIF A;  4JI1 L;  4IUQ A;  4LF6 L;  3GD7 A;  1PYS B;  2YQR A;  3I91 A;  1A62 A;  4WJW A;  1QZG A;  1PTO F;  2Z6B A;  4KLK A;  2XWJ B;  4YHH Q;  3K5N A;  4JV5 L;  2QA4 A;  4NMZ A;  1YJ9 A;  2RSN A;  3VYU A;  2ZM6 L;  4LF4 Q;  2JK8 A;  3BU2 A;  1Y69 U;  5IYB G;  4A93 H;  3KBG A;  3KF8 A;  1SRO A;  1B8A A;  3E9H A;  3HRZ C;  5F2D A;  1XMO L;  4YCV A;  1PLF A;  3NE5 B;  4WJ4 A;  3HP3 A;  3AEV B;  1X3G A;  1PH8 A;  2JA6 G;  3L7Z C;  1S4Z A;  3S14 H;  4KJN A;  3RR5 A;  1K0S A;  3RF2 A;  2QF7 A;  4JI5 Q;  3VYR A;  2NTS A;  2UUB Q;  5EBC A;  4FXG C;  5HUR A;  1WI5 A;  4ME5 A;  2Q8T A;  3ER0 A;  5IE8 A;  4DNT B;  1LTS D;  2VUM G;  1XJV A;  2F0D A;  4G4K A;  1FD7 D;  1K3B C;  1TQO A;  3A8K E;  5COY A;  3KJO A;  4NZT M;  5CBA E;  2B2V C;  4KY5 A;  2VQE H;  1SE8 A;  2A69 D;  1EIF A;  4K6L A;  2UXB Q;  1MD2 D;  3FDT A;  4IUV A;  3F2C A;  4YHH L;  3HG9 A;  1MBY A;  1QVG A;  4LWC A;  4IAL A;  4BY1 G;  1S5D D;  1E24 A;  3DLL A;  1MHW C;  4GN4 B;  5CR3 A;  2HDL A;  1F2Y A;  1KQS A;  4DUZ H;  4DV4 Q;  4V19 0;  1PYB A;  2DN8 A;  4LF4 L;  1N34 H;  4CGY B;  2F0N A;  5ELC A;  4PZ8 A;  3SR1 A;  2K5V A;  4K5W A;  2TMP A;  3BDO A;  3S16 B;  4LUV A;  3S16 H;  4I7A A;  5CMD A;  2EYF A;  2HUG A;  1VQ4 A;  4JI5 L;  4FF1 A;  2E2H B;  2UUB L;  4RKB A;  1SN8 A;  4LFA Q;  1N32 H;  3Q6S A;  2N3S A;  1Q1E A;  1BDO A;  1IW7 D;  5DAU A;  2D62 A;  1WE8 A;  1DGS A;  1LLR D;  3VR3 A;  2B63 G;  4IN3 A;  2HH2 A;  1LT5 D;  3I90 A;  2E75 C;  5IT9 L;  4O1N A;  2NN6 G;  3KUP A;  3HKZ B;  3MHB A;  4RGT A;  3K80 C;  3RMH A;  2UU9 Q;  1NSN S;  3WDN A;  2A73 B;  3QOL A;  3J80 i;  2ZJP A;  2CCZ A;  5K36 G;  2XTI A;  1UE5 A;  3ERO A;  3AB9 A;  2Z0S A;  3U58 A;  1K28 A;  1G29 1;  1SNP A;  4C56 C;  4ZK9 B;  5KIX A;  1OXS C;  1JJG A;  2UXB L;  1Y1W G;  3IAY A;  2DY7 A;  4C1N K;  4GKJ Q;  1FR3 A;  4F8M A;  5KND A;  4R4O A;  2NWG A;  4F88 A;  3PQI A;  4JI3 Q;  5IYC G;  1PH7 A;  4DV4 L;  3GTP B;  3SXH A;  1KD1 C;  1X0A A;  4LF5 H;  4A93 G;  5IOC A;  3GTP H;  4DR3 Q;  4Y7N B;  2JA8 B;  4UP9 A;  4PMW A;  1YJN A;  5FKA C;  4Y7N H;  1CHP D;  2JA8 H;  3FPU B;  2CW0 C;  2LKV A;  4PNY A;  4GNX A;  3SK5 A;  1I6U A;  2HD3 A;  2MPM A;  1TS4 A;  3EBE A;  4HIK A;  1T5X D;  3M4Q A;  1K83 B;  1Z6H A;  3PIP A;  1K83 H;  2KA7 A;  1VQ8 A;  1B50 A;  4AM3 A;  4DAM A;  3CC7 A;  3HOY B;  4LFA L;  1U4M A;  1HQR D;  1JJ2 A;  4QUF A;  2V1C C;  5DM7 3;  2F0P A;  3PUZ A;  3HOY H;  1VQP A;  2WV6 D;  5G3L F;  2OF1 A;  2ICE C;  4U67 3;  4RGM A;  3EJI A;  4IPG A;  4JBK A;  3B6Y A;  3I56 A;  2PQU A;  3KBX A;  4GKK Q;  1GHJ A;  2CTF A;  4KD4 A;  4LFC Q;  4MTN A;  3WWV A;  3KF6 B;  2FXQ A;  2GVB A;  4A4I A;  3K0X A;  2UU9 L;  2Y0S E;  4DV2 H;  1I94 H;  1L0W A;  5IP9 H;  2AWN A;  3HOZ G;  1WHR A;  1YNJ C;  1QNK A;  5BN5 A;  2ANR A;  1STN A;  3EA6 A;  2I5M X;  2AUK A;  1WD0 A;  1LV9 A;  2PI2 A;  1D7Q A;  3I0P A;  1DJR D;  2EY2 A;  1S72 A;  4A3C H;  2F0L A;  2JXM B;  1L1O A;  5JEA G;  1SE2 A;  4C1N I;  4GKJ L;  3DMU A;  3GTJ B;  4A3D B;  1QUQ A;  2PO4 A;  4JI3 L;  5BR8 Q;  2IX1 A;  4A3D H;  3QR8 A;  2UXD H;  1D2B A;  3PO3 B;  1ET9 A;  1EYA A;  1WCM G;  3UDF A;  2QEX A;  4PG3 A;  1STY A;  3PO3 H;  4DR3 L;  4DR2 H;  4DNR B;  4JBJ A;  3W1B A;  3A74 A;  2N88 A;  1I50 B;  3OIP A;  1JOK A;  1I50 H;  4J1M A;  5ELB A;  1LTT D;  4HSP A;  4ABN A;  1IBM H;  2KUM A;  1EOV A;  4TKO B;  1SRU A;  2K5H A;  4PQX A;  3RLF A;  2K5N A;  4RH6 A;  3OMC A;  4A3F G;  5KNC A;  3JAM c;  4QB4 A;  2BA1 A;  3GV6 A;  1HZA A;  4HJ8 A;  4GKK L;  4ODG A;  4DV3 H;  4LFC L;  3J81 j;  1SNM A;  4L5T A;  3GP7 A;  3DXJ C;  5FK9 C;  4C3H G;  5CBE E;  2K5Q A;  1WTQ A;  1N36 Q;  2KED A;  1WYD A;  4IUR A;  2J4X A;  1LM0 A;  1A3U A;  1BBW A;  4KMU C;  2G8Y A;  4OL7 A;  4NDX A;  3VR6 A;  1Y8P B;  2A68 C;  5T1I A;  3KFU A;  1TXY A;  3A7L A;  3VKE A;  4KTA A;  2RSO A;  1DOL A;  4RA8 A;  4MN3 A;  5BR8 L;  1XYI A;  1WTJ A;  2RDF A;  3UDG A;  3H3V C;  1MJC A;  1FKA H;  2DNC A;  2EJM A;  1IBL Q;  4OO1 H;  2NZO A;  1B3Q A;  3M4Y A;  1ESF A;  1CSQ A;  2BH8 A;  3MXU A;  2HQL A;  4C3J B;  1DZ1 A;  3I72 A;  3STB C;  5M3F H;  4C3J H;  1CQV A;  2MHV A;  4XDX A;  4DXF A;  1IBK H;  2IX3 A;  1PH9 A;  4OGQ C;  1HNW H;  3P75 A;  3TSS A;  3DEO A;  4KKS A;  5ELF A;  4OIK A;  5M5X B;  1EEI D;  1E2V A;  1EZ8 A;  2J7Z A;  1X9N A;  5M5X H;  4E9J A;  3CW2 C;  2EXD A;  1BBU A;  3SB1 A;  1YIT A;  4AYB E;  2O2L D;  2KHI A;  1HXY D;  3F1Z A;  1ZZJ A;  5JJL A;  4R8N A;  1NMG A;  2VL6 A;  1N36 L;  4J6H A;  2PW5 A;  4LMQ D;  4DF7 A;  4KN4 C;  1T5E A;  1V1P A;  2HCI A;  1JE5 A;  3GTK B;  2L15 A;  2Z1C A;  4JI1 H;  4LF6 H;  4ZQ3 A;  3GTK H;  4UP7 A;  2KCT A;  5I2X A;  2CWF A;  1TS5 A;  3NQI A;  3I4O A;  1IYV A;  1DOK A;  4CKB A;  3KLS A;  1VQM A;  4LF7 H;  2WB1 E;  1O7Z A;  1KC8 C;  2ZM6 H;  4HED A;  1IBL L;  3GQB A;  2L1B A;  3OSO A;  4DAV A;  1D5M C;  1RJT A;  3DHQ A;  1I6V C;  2ZXR A;  1DXM A;  1F2Z A;  1DTJ A;  4NZR M;  5M5Y B;  2ICI A;  1OXX K;  1I4X A;  3A8J E;  1X56 A;  1C8C A;  5M5Y H;  1SE3 A;  3I4L A;  1PQX A;  3NBH B;  4YWL A;  2I5H A;  1MKH A;  1O7I A;  1TWC B;  5JPN C;  5KGU A;  2CH4 A;  1TWC H;  4LF5 Q;  1KTK A;  3I8Z A;  1KL9 A;  3FVQ A;  1JR0 D;  2EYO A;  4B8T A;  1IL2 A;  1TWG B;  4ZRZ A;  4Q0F A;  1TWG H;  1FL0 A;  2F0S A;  3G6J B;  3H3V H;  1N9W A;  2F0K A;  4YWM A;  4CJ0 B;  3PO2 G;  3Q24 A;  1IYJ B;  3K7U C;  4YY3 Q;  1WTV A;  1Q8I A;  2X06 A;  4H7B A;  4DK6 C;  2WKC A;  5J1Z A;  4DNI A;  1WD1 A;  2XGT A;  2A8V A;  2EDG A;  1XXG A;  4ZYS A;  3KDF A;  2CTE A;  4DV0 Q;  2QDL A;  4LF8 Q;  3MC0 B;  2WAC A;  1H9S A;  4YHH H;  3CCS A;  1VIG A;  4ME3 A;  3HS0 C;  1STG A;  4A3K B;  2WAQ E;  4DR6 Q;  3A0J A;  4AQY H;  1EU3 A;  2M8W A;  4A3K H;  4JI4 Q;  4LF4 H;  1A3T A;  3MVV A;  3RUZ A;  2VW9 A;  1SMY C;  1PXU A;  2B2T A;  1A2T A;  4WAN A;  4A3M G;  2E5L H;  2KEC A;  1R4Q B;  4HSV A;  4PZ7 A;  4JI5 H;  2UUB H;  1EIG A;  4LF5 L;  4KY7 A;  3BS1 A;  3MEF A;  2WP8 J;  5HY6 A;  4DR2 Q;  4K6D A;  2K05 A;  1UG8 A;  1DT4 A;  2RVL A;  1K8O A;  1FYC A;  2F0J A;  3ND8 A;  2B2U A;  2B29 A;  3OSS D;  3TP7 A;  1KNE A;  2BH2 A;  5CV8 A;  2YTV A;  4R4Q A;  1BCP C;  2RKS A;  2ES2 A;  2MO1 A;  1O7L A;  1SSO A;  2MQH A;  1YHQ A;  3QJY A;  4YY3 L;  1VQ7 A;  3DWA A;  4XT1 B;  2LTL A;  4HCS A;  2AWO A;  1B9N A;  2EY1 A;  1TWH B;  4L5Q A;  3FRP B;  2F0V A;  1GD7 A;  4X66 Q;  4DUY Q;  1TWH H;  4DV0 L;  2UXB H;  1BCP F;  1J5E H;  4LFB H;  2R7F A;  3G4S A;  4OO1 I;  2VXW A;  4DK1 A;  4JI8 Q;  4DR6 L;  4TQU S;  4JI4 L;  4DV4 H;  5HGT A;  3J7Z C;  4C3I B;  3T51 B;  5JPM C;  3D4D A;  3D3R A;  4C3I H;  1ONL A;  3ZYY X;  2MGS A;  1EY4 A;  1BOS A;  2CTM A;  1B70 B;  4O42 A;  1KLG D;  4L8J A;  2UUA Q;  4XIG S;  3W1G A;  1NXU A;  3FEW X;  2K33 A;  2DNE A;  4DR1 Q;  3D6C A;  3HGB A;  3C2P A;  5ELE A;  4DA2 A;  4DR2 L;  4DV1 Q;  1VQ6 A;  2K4K A;  1TS2 A;  1S5E D;  3EZJ A;  3T13 A;  3OTO Q;  3E5S A;  4B3S Q;  4KHP Q;  2QIL A;  4DAY A;  2NZ1 D;  2R6G A;  1K8A C;  4OON A;  3RZO B;  2F0U A;  1IBK Q;  3J81 i;  3M85 A;  3RZO H;  1XTC D;  3HOX B;  3K81 C;  2MUY A;  1PRT F;  4POG A;  1B1Z A;  2ALY B;  2CH4 W;  3HOX H;  3J7A 5;  3T1H H;  3EQL C;  4IUU A;  3HOU B;  1VQJ A;  3ITP A;  5IT9 c;  3WOF A;  4X66 L;  4DUY L;  1EZ6 A;  3HOU H;  4DR5 Q;  1JMC A;  4CDE C;  1SNC A;  3CCL A;  4X3S A;  5L37 A;  4A3J G;  3DM1 A;  4JOI A;  3TRE A;  3EIV A;  4JI8 L;  4GKJ H;  2IHE A;  1AN8 A;  2OTJ A;  1KAA A;  4JI3 H;  2EYL A;  1OO9 B;  4GZY C;  2AXY A;  1ZYR D;  4DR3 H;  1GXD C;  1X55 A;  1YNN D;  1WJJ A;  3PUV A;  2PQE A;  2E2J B;  1XMQ H;  2ANN A;  3K59 A;  3LGJ A;  2M6Q A;  1KLU D;  2E2J H;  4NXN H;  2N55 A;  2UUA L;  2A1A A;  1F2M A;  4IPH A;  5EKL A;  2PNH A;  1VQN A;  2UUC H;  4BY7 G;  4LF7 Q;  4FJS A;  4DR1 L;  1M4V A;  1Y1V B;  1F2L A;  5DLQ E;  2JA8 G;  4QMG A;  3PSI A;  2E3U A;  4DV1 L;  1Y1V H;  1S3O A;  3QG1 A;  4EQO A;  4RCO A;  1W6J A;  4DR7 Q;  5ISR A;  3S2H H;  3OTO L;  1VQO A;  1E7Z A;  2H5X A;  2ASB A;  4GKK H;  4B3S L;  4KHP L;  3LWE A;  3DWP A;  5I6Y A;  3AMU A;  4LFC H;  2YTX A;  3OPO A;  2FJ2 A;  1HR0 W;  4IUN A;  2JSO A;  3FAU A;  1IBK L;  3HOY G;  4JC0 A;  1NR4 A;  2MO0 A;  2RHS B;  1SMX A;  2KEN A;  1AZQ A;  4N8F A;  2CQA A;  1GOZ A;  5COR A;  1PTO D;  3ERS X;  2CQO A;  4EVO A;  1HHV A;  1STE A;  3BYT B;  4DR5 L;  3KLR A;  4LNQ A;  1II3 A;  3HOV B;  4A3G B;  1QCB D;  3HZX A;  5EGT A;  1B3A A;  1PV4 A;  5JVH 3;  1YEZ A;  2HT1 A;  5IP9 G;  3HOV H;  4A3G H;  4K8I A;  1FVI A;  4H02 A;  2F0I A;  1SYG A;  3R3O A;  1UEA B;  5BR8 H;  2Z6K C;  3CQZ B;  4O2D A;  4UPA A;  5FO9 B;  3GTG H;  2PNR C;  2E2D C;  4RG1 A;  3CQZ H;  2O4C A;  3KYH C;  1PZJ D;  4G7Z C;  1IZ6 A;  1S40 A;  4BXX H;  1G2T A;  2MJH A;  2R93 B;  1EY0 A;  2D9I A;  4HID A;  2R93 H;  2PI2 E;  3J80 W;  1YNX A;  1IKM A;  4R9W A;  1EQR A;  4A3D G;  1FNW A;  2HCC A;  3OW7 A;  2QW7 A;  3PO3 G;  1LT4 D;  4RCN A;  4LF7 L;  4G08 A;  1SXT A;  4AQY Q;  1Z9F A;  2XN9 C;  4G7O C;  3D31 A;  5IGG A;  1W3S A;  1TWF B;  1V1Q A;  2L5T A;  4HR7 B;  4B3T Q;  4DR7 L;  1NTG A;  1RF2 D;  3U50 C;  1TWF H;  2A6E C;  3GDE A;  1EY6 A;  3SGI A;  2EVB A;  4CKC A;  4HIO A;  1V1P B;  2LF0 A;  2NVY B;  2XWB B;  5FLX W;  2E5L Q;  2A6H D;  3PF5 A;  1TUA A;  1WOC A;  1N36 H;  3PUW A;  3Q23 A;  2E74 C;  2KCC A;  2F3I A;  2RBM A;  1CK1 A;  1HJP A;  1BUV T;  3V69 A;  2BOS A;  3MWY W;  4EQN A;  1D5Z C;  5M3M G;  3J81 E;  4IQZ A;  2NB0 A;  1SYC A;  1RD9 D;  3A56 A;  1KAW A;  4IFD I;  2RA4 A;  4PMC A;  2KJX A;  1K1G A;  4DV6 H;  2ID0 A;  4P73 A;  2PQA A;  3F2D A;  3S1M B;  2F4V H;  4KN7 C;  3MXN B;  1Z47 A;  3SE0 A;  2ATW A;  1HFG A;  5CV4 A;  4K5X A;  1M90 C;  1B2T A;  1IBL H;  1KRT A;  1NNX A;  2R3Z A;  2L0C A;  3FKI B;  4ZUJ A;  1J5E Q;  4LFB Q;  1CT1 D;  3FKI H;  4WJ3 M;  3NCV A;  4GN3 B;  5C0X H;  3CF5 A;  3NTK A;  4UHV A;  4OO1 G;  4AQY L;  4FF4 A;  4JBM A;  3M4P A;  1HNX Q;  4K2K A;  4MHE A;  3V05 A;  4B3T L;  3C1F A;  2Y0S B;  5FO7 B;  3EN2 A;  2B2W A;  5M3F G;  4C3J G;  5GQO A;  1ML0 D;  1IXR A;  3K8A A;  1WTP A;  3FPP A;  1SND A;  2E5L L;  2MFI A;  2SDF A;  4KI0 A;  1HUM A;  5KEE A;  5EBD A;  4GOP A;  1UEB A;  4A3L H;  5C5L A;  2E2H H;  4BA1 I;  1XNQ Q;  2A69 C;  3I73 A;  2M9V A;  5C44 G;  3R2I A;  5EKK A;  3VA7 A;  1MIU A;  3SK8 A;  1VS0 A;  3TZU A;  4KJO A;  3ULL A;  1EFI D;  1AP0 A;  1ICF B;  3S15 B;  5E4W C;  4RKL A;  2D0O A;  1U4R A;  3S15 H;  4JI0 H;  4K2L A;  2XRS D;  2EE1 A;  1X3F A;  4IJL A;  4Y52 H;  4IUT A;  1PZI D;  3T1H Q;  1KDA A;  1HNZ Q;  1SEB D;  3GTL B;  2JEA I;  5M9O A;  3PIP 3;  3GTL H;  1K73 C;  2R92 B;  1ROD A;  1J5E L;  4LFB L;  3OHX C;  2IJ0 A;  2R92 H;  5JEA J;  1BF4 A;  3U9S A;  3JAM i;  1CKN A;  1QVC A;  5G3L D;  2OQK A;  1GVP A;  2LXJ A;  5J22 A;  1VDZ A;  1GHK A;  1HNX L;  3SEB A;  3RN5 A;  5C4Z A;  4JCV E;  1L2F A;  1EQT A;  3NP8 A;  2I5L X;  1XMQ Q;  3T16 A;  1XNR Q;  4YIJ A;  4NXN Q;  4IUP A;  1XRH A;  3U4V A;  2UUC Q;  3F2U A;  3SDZ A;  3K5M A;  2IHF A;  3T1Y Q;  1TII D;  4YY3 H;  2JQO A;  5IGD A;  1QB5 D;  1XNQ L;  4N8X 1;  2ZTE A;  4DR4 Q;  5IY0 A;  2SOB A;  5C3E G;  1UE7 A;  4AIM A;  4DV0 H;  4LF8 H;  2EY6 A;  4XXE A;  4JVZ A;  2L9H A;  3T53 B;  4A3E G;  4PV1 C;  2M2L A;  1MGS A;  4DR6 H;  3CMA A;  2QND A;  3GR5 A;  4DKA C;  4Q5V A;  1ENF A;  4JI4 H;  1VQ5 A;  1MSZ A;  4M1U B;  3T56 B;  1MI2 A;  2EY5 A;  3T1H L;  4O0A A;  1RDP D;  2D9U A;  1X3E A;  1HNZ L;  1EIH A;  1SE4 A;  1DCZ A;  3A5U A;  1OXT A;  2P2R A;  2XIW A;  2O5I C;  1B9M A;  3I4M G;  4A3K G;  2F4I A;  2FMC A;  1SDF A;  3I4N G;  2LRR A;  4AYB B;  3BZD B;  4UDU C;  5C4X B;  2ENB A;  3GTJ H;  5KYL A;  1STH A;  2B2Y C;  3MXG A;  5CC4 A;  1WVN A;  3L9A X;  5C4X H;  4CBV A;  1D8L A;  1G91 A;  4IFD J;  1NY4 A;  1P8L A;  5A2Q W;  1M1K C;  3AYH B;  1XMQ L;  1XNR L;  3MFY A;  1SAP A;  4NXN L;  1QJO A;  2KHJ A;  1RCV D;  4B3M Q;  2MNA A;  1KXL A;  2CTK A;  4HMJ A;  4IO9 A;  3CP0 A;  2UUC L;  1LUZ A;  2AQ1 B;  2M00 A;  2MJ8 A;  3T1Y L;  1GKH A;  1PH3 A;  3LWU A;  4BBR B;  2EXZ A;  5EKI A;  1ODH A;  2PMZ B;  2HIX A;  2OXP A;  4BBR H;  2ZXO A;  3GTQ B;  3PIO A;  1TVX A;  4X66 H;  4DUY H;  1I4R A;  2WB1 B;  1XPR A;  3GTQ H;  1Q12 A;  5GAD C;  5IP7 G;  4LF9 H;  3NHH A;  4X3K A;  2SNS A;  1WTR A;  3NWS A;  4TVA B;  1PH2 A;  1Q1B A;  1V1O A;  3BVZ A;  4JI8 H;  3J80 c;  3MTS A;  5IYB H;  5E1F A;  3KLW A;  3K57 A;  2QGQ A;  2R7Z G;  3PUX A;  3L0O A;  2JA6 B;  4BS9 A;  1SYF A;  2BCO A;  5C0X I;  4XQQ A;  3E9I A;  1H9M A;  1VQC A;  2F1M A;  1VCI A;  1G6P A;  2VY3 A;  4NXM Q;  4NBQ A;  2IT1 A;  3J80 E;  1K0R A;  1VF7 A;  2UUA H;  2QCP X;  3LX0 A;  3STB D;  2PY9 A;  1VQI A;  4DR1 H;  4DV6 Q;  1YVC A;  3Q0A A;  4IOC A;  1HZB A;  2VUM B;  2F4V Q;  5IGB A;  4IFD G;  4DV1 H;  5JVG 3;  4DK0 A;  3TP5 A;  1HCZ A;  1BVS A;  1GUS A;  4V0B A;  3CCU A;  5E7N A;  5I2Y A;  3CCV A;  1GUO A;  3CAM A;  1DON A;  2QDB A;  3OTO H;  4B3S H;  4KHP H;  2AMC B;  1DYQ A;  2Y3M A;  2VB3 X;  3C1E A;  3A8I E;  4B3M L;  5FLX E;  4EQ5 A;  4OX9 Q;  4I65 A;  1VF5 C;  2KQ3 A;  1UUP A;  5C4J B;  1VQL A;  2WAQ B;  1M8A A;  4DV5 Q;  5C4J H;  4DR5 H;  2X6G A;  3RN2 A;  3F8T A;  2LFN A;  3VYT A;  1SFO B;  1J8I A;  2G9D A;  3HOX G;  2VZA A;  1YHB A;  2XSC A;  1JCK B;  4XQN A;  1SFO H;  3TS0 A;  1H9J A;  5DNF A;  2J0T D;  5JJZ A;  4FNF A;  2FMR A;  1I4P A;  3NPP A;  5IGE A;  1PVO A;  1DOM A;  2AKW B;  1JOO A;  1HZ9 A;  3VDY A;  5FLM H;  1E3P A;  3NWT A;  4NXM L;  1E0B A;  3H15 A;  1I4Q A;  2JZX A;  3OWF A;  1ASZ A;  3CRL C;  1SYE A;  2HDM A;  2PMZ E;  3ONA B;  3KF8 B;  4DV6 L;  3CC2 A;  4JI0 Q;  3TQY A;  2F4V L;  1TU2 B;  3KJP A;  1ESR A;  4OWX B;  2PZW A;  5KNB A;  1HA5 A;  4DR7 H;  4B3R H;  5C6A A;  3HOW B;  2RDG A;  1SJE D;  2K1B A;  2DJF C;  2KCM A;  4B8C D;  3HOW H;  1EWI A;  3D4W A;  1ASY A;  3U1K A;  1A2U A;  2F0E A;  5GAG C;  5LMN W;  1GO3 E;  3BVM A;  4OX9 L;  4BWG B;  4HAE A;  3H09 A;  3VR5 A;  1BNZ A;  3CME A;  2F0O A;  3ZJY C;  4DV5 L;  3ULJ A;  5H1S E;  5IYC H;  2RF4 A;  4A93 B;  1C48 A;  3P20 A;  3DEP A;  1F0X A;  1EYC A;  3E0J A;  2PQA B;  3MZ5 A;  4N9T A;  2G9H D;  4UP8 A;  3U9O A;  4GNX C;  1PA6 A;  1R9T B;  4HCE A;  1QWY A;  1R9T H;  1BXT A;  1LTL A;  2VNU D;  1PFB A;  2K5W A;  1JWM D;  3AQQ A;  4CDC C;  1ENA A;  4ZLT F;  4YWK A;  1PFM A;  2H1E A;  3K58 A;  5C3X A;  2Q2T A;  1G2S A;  1SNO A;  4CJ1 B;  3HOV G;  4A3G G;  3J81 W;  3G48 A;  4RFB A;  1SYB A;  1LAB A;  3SVM A;  1SMY D;  1U5K A;  1VQK A;  4OD6 A;  2LSS A;  3M4O B;  5ELD A;  4JI0 L;  1UAP A;  4BXX G;  3D8G A;  3VA5 A;  1EC6 A;  3M4O H;  2R93 G;  3S1R B;  4B3T H;  4JPB W;  4RMF A;  3S1R H;  4NP5 A;  1CKO A;  1G8Z D;  1ZKO A;  1NBW A;  3S1N B;  4MTK A;  1E2W A;  3H0G B;  4FF3 A;  1AE3 A;  2VB2 X;  3S1N H;  3H0G H;  1Q46 A;  4S3S A;  1L1O C;  1PH4 A;  1CI3 M;  1EY8 A;  1CUK A;  4A75 A;  1BCP D;  4G57 A;  1A63 A;  1WCM B;  3FP9 A;  4BBS B;  3GTO B;  2JYO A;  1WCM H;  4BBS H;  3GTO H;  2OT2 A;  1V9P A;  1B7Y B;  3MEH A;  1K9M C;  2KOL A;  1F9R A;  1S5C D;  4JG2 A;  2KVM A;  2PT7 G;  4HJA A;  1FJG H;  4CKE A;  2PW7 A;  5E3F A;  1U0L A;  2R7D A;  3HFZ B;  3J80 L;  2K50 A;  2KCN A;  4P74 A;  1NMF A;  4IJH A;  4JVH A;  4LF8 L;  4QGU A;  4A3F B;  1JQY D;  4LF9 Q;  2K6A A;  5EPJ A;  4P75 A;  2I46 A;  2PYK A;  1G6Z A;  1HNX H;  3OET A;  3HEJ A;  4RHR A;  4GNX B;  3ICE A;  3R8B A;  1PHJ A;  2B2V A;  3HKS A;  5FLX L;  4QF4 A;  5A2Q E;  1CM9 A;  1XPO A;  4FP5 D;  4DN4 M;  5C0X G;  1BO0 A;  1PRT D;  2PZT A;  3CHB D;  4EQP A;  4KKU A;  1V8Q A;  5AFW A;  2FIN B;  3PF4 A;  1K3R A;  1XNQ H;  3AFQ A;  3KF6 A;  4MZ9 A;  4P2C B;  4L5R C;  2KEE A;  3K6O A;  1KDB A;  4CDD C;  1UNS A;  1O7Y A;  1EUJ A;  3S17 B;  1E1T A;  3S17 H;  1FGB D;  1H9R A;  3GV3 A;  3S2D B;  1F9P A;  2BE5 D;  2JP1 A;  3IKJ A;  3S2D H;  1L1O B;  1GUN A;  1Y14 B;  3C3L A;  4R4I A;  1HNZ H;  2L4N A;  3U4Z A;  1Q81 C;  4XTC S;  5FJ8 H;  1QUQ B;  2K04 A;  2X69 A;  3TN2 A;  3HKZ G;  2CWP A;  4LF9 L;  1QZH A;  3NK9 A;  4RGN A;  1BBX C;  5EPL A;  1MSG A;  1N8R C;  1YZ6 A;  3CXC A;  1HTL D;  3EFX D;  1ZZI A;  5FOB B;  5CGK A;  1EWC A;  4RAU C;  3IRB A;  1LYL A;  2VKC A;  1EOT A;  2R92 G;  3H94 A;  1J9O A;  1XNR H;  1CTM A;  3L2P A;  1QVF A;  2V4D A;  1WTH A;  1BR9 A;  2EOT A;  5IIF A;  4CJ2 C;  4ZCK A;  3T1Y H;  3K0Y A;  1IL8 A;  1SLJ A;  2JA7 B;  3H3V I;  4DR4 H;  4GS3 A;  3VYS A;  2JA7 H;  2PCF B;  4FDB A;  3CC4 A;  3D4R A;  2FMM A;  4B3R Q;  2E2I B;  1PYW D;  3PGZ A;  3VR2 A;  1C0A A;  2EJF C;  4QCL A;  1S5F D;  2TSS A;  1NCV A;  1JJC B;  1QNU A;  4L63 B;  4X3U A;  1K8M A;  2UXC Q;  5CV6 A;  3UDI A;  4J15 A;  4H8A A;  1X3P A;  4ID6 A;  1XX8 A;  1A15 A;  3JC6 6;  2EYM A;  1HPC A;  3UE0 A;  4JI7 H;  3NEL A;  1VQG A;  4NW2 A;  1RTN A;  5ELN A;  2BL5 A;  1AN7 A;  3DUZ A;  2D5D A;  2NVX B;  5A35 A;  5DT9 A;  2VS1 A;  2F0G A;  1SR3 A;  2NVX H;  2OWO A;  1NR2 A;  4L6T B;  4A3C G;  3AFP A;  2EYP A;  3EVQ A;  2L12 A;  1B53 A;  1I3Q B;  3CPF A;  1K8G A;  1ZXT A;  5D3I B;  3KDG A;  2XNA C;  2A6E D;  4AYB G;  1WTW A;  1GM5 A;  4B3M H;  2EQS A;  4X3T A;  5C4X G;  1VIH A;  4DV7 H;  4LK1 C;  4XT3 B;  3F2B A;  5J3B A;  1D6E C;  4B9W A;  5K5P A;  4R8I A;  4NKL A;  2LY7 A;  2CWA A;  4KY6 A;  3JAM W;  4X64 H;  4KV6 A;  1O80 A;  2IX0 A;  2F03 A;  4B3R L;  2R61 A;  1JOR A;  4DXG A;  2NVT B;  1VQ9 A;  3TP6 A;  3KLS X;  2B2T C;  3J81 c;  2NVT H;  3H91 A;  2JJQ A;  1QG7 A;  3FMC A;  2NVY H;  1VQE A;  4BBR G;  4A3M B;  1CA6 A;  1EEF D;  2UXC L;  4A3M H;  3CPW A;  2WB1 G;  4K14 A;  2ZTC A;  2DGR A;  2WKD A;  4NXM H;  4OXP A;  2K5D A;  2A74 C;  2LMC B;  1PDQ A;  2B2U C;  1P16 A;  3BJU A;  1GUW A;  2F0T A;  4A3I B;  4WOR A;  4G7H C;  5A2Q L;  4ULL A;  3S14 B;  4A3I H;  1O78 A;  2H4O A;  2IPK D;  1FJG Q;  1RTO A;  1ET6 A;  4QQB X;  5CV7 A;  1WFQ A;  1SNQ A;  4QMF B;  3S1M H;  5IGF A;  3NBH A;  3E0E A;  1GJX A;  1TY0 A;  2A6H C;  2LS0 1;  3TDQ A;  4R4T A;  3J7A F;  5BN3 A;  2HIV A;  1JIC A;  4OX9 H;  4YCU A;  2JA5 B;  1H9K A;  2MP1 A;  2JA5 H;  4WAL A;  1C4Q A;  1I4G A;  4DV5 H;  1A0I A;  2CFM A;  1Q8K A;  1DD2 A;  2GVA A;  3G6E A;  5T1G A;  4CHT B;  4YCW A;  1JB3 A;  2NVQ B;  4FF2 A;  3KDF B;  2JE6 I;  3OOC A;  2NVQ H;  4BA2 I;  5LMU H;  1ILP A;  2WAQ G;  1A8V A;  1H9S B;  1AE2 A;  3CCM A;  3DWQ A;  1N33 Q;  1TR5 A;  2K75 A;  5J39 A;  1CZG A;  1PTO B;  2Q8R E;  4PMB A;  4FYD A;  1JWU D;  1PTO H;  3K5O A;  3I70 A;  1FJG L;  1CZW A;  2C5C A;  2CTL A;  2ZTD A;  1AFP A;  5FLM G;  1WTO A;  1QOH A;  4M8A A;  1HFN A;  1HR0 H;  1YHA A;  1H95 A;  2OEO A;  3QB3 A;  1AEX A;  5LMN Q;  1I5F A;  5HGQ A;  5KRU A;  1VQA A;  4K5V A;  3NXW A;  4JOI C;  4KKT A;  4JYA H;  2CW0 D;  2N8N A;  1T9H A;  4A3J B;  4K0K H;  1F9Q A;  1STA A;  3PV0 A;  4L5S A;  5C4H A;  4A3J H;  3FHW A;  1IW7 C;  4P72 A;  1CA5 A;  2AQ3 B;  3HOW G;  2XVS A;  3MFG A;  3CKI B;  3I3C A;  1Y8O B;  3E6Z X;  2NYZ D;  4LUZ A;  1TS3 A;  1EY5 A;  4P71 A;  1NE3 A;  5DM6 3;  3H6M A;  2F0H A;  3CCJ A;  4OEL B;  3CCQ A;  2K32 A;  4MIU A;  1YIJ A;  4HIM A;  1KHM A;  5IWA H;  4AH6 A;  4BY7 B;  5CV9 A;  1N33 L;  4BY7 H;  1YNJ D;  1JOQ A;  4ALP A;  5IYD H;  1PH6 A;  3SK4 A;  1L0X B;  4LJZ C;  3RLN A;  4APV A;  5IOD A;  1AH9 A;  4A3B B;  2B39 A;  1UWV A;  2HQE A;  4JI6 Q;  4XYO A;  3I2Z A;  3R2T A;  4A3B H;  1W6K A;  1KDC A;  4N9P A;  1ZTG A;  4XYQ A;  5I9P A;  3UE1 A;  2E8G A;  4GLA C;  3A55 A;  4NPS A;  3OWE B;  4DAP A;  3AU7 A;  2CTJ A;  3J7Y W;  2FPH X;  5LMN L;  1KRS A;  2Z8L A;  1VMC A;  4JI7 Q;  3GKU A;  1LTG D;  2N49 A;  2JA9 A;  2VQF Q;  5EPK A;  1S20 A;  1Q7Y C;  3S24 A;  4U68 A;  1IKL A;  1V43 A;  3BZC A;  3PIO 3;  3NQT A;  1I6H B;  2Z9H A;  1I6H H;  4DAY B;  5IGC A;  2B8F A;  2CKZ B;  2HHH Q;  2ZJR A;  3H0G G;  1X9Z A;  1ILQ A;  1QE6 A;  2K28 A;  4JI2 H;  4DU9 A;  3TP8 A;  4NB3 A;  2L55 A;  4OCH A;  1IYU A;  2Q2U A;  4HN7 A;  3PCO B;  2BA0 A;  4DV7 Q;  3P7J A;  2L11 A;  3J81 L;  1S5B D;  1WVL A;  2SEB D;  2Z4H A;  4DR4 L;  4BBS G;  4HJ7 A;  1QIL A;  3A54 A;  2IWH A;  4WFN 3;  2XRQ D;  4X64 Q;  2D0P A;  3OMG A;  3HKZ E;  1TKW B;  4RWS C;  5EJW A;  1RIP A;  4J8Q A;  4IOA A;  4JI6 L;  3UDX A;  1LAC A;  3TRZ A;  2A68 D;  4K8J A;  3G71 A;  2F0M A;  1ICW A;  1ENC A;  2K01 A;  1EQQ A;  5C3W A;  3M7N A;  1W2B A;  4X62 H;  3J7A V;  2YYZ A;  3GAB A;  4EC5 A;  4LUO A;  5C5M A;  3I55 A;  3KOJ A;  2A19 A;  5M5W B;  4QIW B;  2JA6 H;  1ZEQ X;  1I4H A;  5M5W H;  1LT3 D;  3UOE A;  4EX5 A;  5AJ3 Q;  5I9O A;  4JI7 L;  1XPU A;  3T4A C;  2VQF L;  3MAQ A;  1KNA A;  5M3M B;  1PFN A;  1BQQ T;  3QD7 X;  1D1K A;  2FHT A;  1KHI A;  1Z7T A;  2NBF A;  5M3M H;  2B3G A;  4C3I G;  2SNM A;  5FLX c;  2IL8 A;  1B44 D;  1C9O A;  3CCR A;  2A5H A;  1X4M A;  2HHH L;  4LAA A;  2KHS A;  3DM3 A;  3J7A K;  2VUM H;  3QWN A;  3JAM E;  1Q90 A;  2NTT A;  4GLV B;  4FO2 A;  4FVM A;  1CQF A;  1J6Q A;  1JWS D;  1WTX A;  2JVZ A;  4EGV A;  2N78 A;  3CD6 A;  1KAB A;  3M3Y B;  2JN4 A;  4JW0 A;  4ZKC B;  3OIQ A;  3M3Y H;  4IPC A;  4ZAI A;  4DV7 L;  2HH3 A;  2DJG C;  2B8G A;  1EY9 A;  1PZK D;  4BY1 B;  4X65 H;  5IT9 W;  4BY1 H;  5ELO A;  3WOE A;  2GA4 B;  4X64 L;  4GN5 A;  5D65 A;  2B2W C;  1EL0 A;  3R93 A;  2VQE Q;  3QO2 A;  3IFD A;  1EYD A;  5M3F B;  2YTY A;  1Q82 C;  4ZUI A;  1CFM A;  3W3A A;  1D5X C;  2OPU A;  1HRJ A;  1OXU A;  4XQJ A;  1J4W A;  3V96 A;  2K1H A;  2EZV A;  1V8C A;  3HOU G;  5FJ8 G;  5LMU Q;  4GOP C;  4DUZ Q;  2K03 A;  1R4P B;  1EYG A;  1VMP A;  1N34 Q;  3SHL A;  5AJ3 L;  4WRD A;  3CU7 A;  5C44 B;  1U4L A;  1C7Y A;  3TS2 A;  3OYY A;  5JJK A;  5C44 H;  5GAE C;  2B63 B;  4H0L C;  1CHQ D;  3BVG A;  4IPD A;  4R4C A;  2B63 H;  2NN6 H;  3Q22 A;  3QOJ A;  3P1H A;  2AHO B;  4UAI A;  1JT8 A;  3NEN A;  2I0Q A;  1HR0 Q;  3AEV A;  2K14 A;  1N32 Q;  3W2D A;  1X6O A;  2GN5 A;  2BDN A;  2ZJQ A;  5K36 H;  1VBI A;  1AZP A;  5LL6 S;  2LXK A;  1GUG A;  5JJI A;  4JYA Q;  2DUD A;  1Y8N B;  3Q8D A;  1SBB B;  4OHJ A;  1CSP A;  4B08 A;  1Y1W B;  1Y1V G;  4QIW E;  2JA7 G;  4K0K Q;  1BKB A;  4JV5 H;  1Y1W H;  1DM0 B;  3W5O A;  2UXC H;  2RCF A;  3QIA A;  1J5K A;  2CPM A;  2IW3 A;  3L3O C;  2VQE L;  4MNO A;  4FXK C;  2ZT9 C;  2CVR A;  5D3D A;  3C46 A;  1XMO H;  4DGZ A;  1U4P A;  3MXN A;  1Q86 C;  3V2T A;  1X54 A;  1E1O A;  1NAP A;  1LT6 D;  5CYU A;  1HH2 P;  5IWA Q;  5LMU L;  4DUZ L;  5E4X A;  1V9N A;  2NZH A;  1A3V A;  1N34 L;  4HTH A;  1Z2I A;  4OWT B;  4A76 A;  1Q3L A;  4LIJ A;  2FFM A;  2DY8 A;  4R1J A;  5C3E B;  4H44 C;  2Q2I A;  5I6W A;  4HJ9 A;  1TY2 A;  5C3E H;  4A3E B;  4JVY A;  1D1I A;  4A3E H;  2Z6K A;  4QL5 A;  5NUC A;  1IHZ A;  1HR0 L;  2Z4I A;  2IY5 B;  2K52 A;  3HOZ B;  1N32 L;  2C35 B;  3HOZ H;  2I07 B;  1X65 A;  1EFW A;  2RQX A;  5C0X J;  1YBY A;  4JBW A;  4GOP B;  3TEH B;  4JYA L;  1U9R A;  2EYJ A;  4KD3 A;  1MSH A;  3I4M B;  1EY7 A;  4K0K L;  2PPB C;  4LW1 A;  4POF A;  3I4M H;  1CKM A;  4DV2 Q;  3I4N B;  1I94 Q;  5JEA H;  1LO5 D;  5DEH A;  2F0F A;  1X32 A;  1LTI D;  3ND9 A;  3I4N H;  2X6L A;  3MXP A;  1TT2 A;  4RHS A;  3BZK A;  4JI2 Q;  5BN4 A;  3X3N A;  1FNU A;  5FO8 B;  1VQF A;  2YU9 B;  3S9W A;  2YU9 H;  3O13 A;  1PH1 A;  2ZXP A;  1VQB A;  5IWA L;  1FNV A;  4PDB A;  2UXD Q;  2PZU A;  1A6X A;  1CKN B;  3BDC A;  1X4N A;  3G7L A;  3N52 A;  3SK6 A;  3ULP A;  4OWW B;  5GAH C;  1B4O A;  1JB7 A;  2F3W A;  3TZD A;  4A3I G;  4A3F H;  5TSS A;  3A7A B;  5KYI A;  4RGO S;  3JAM L;  2O5J C;  4HJ5 A;  2WII B;  2QKI C;  3GO5 A;  5IP7 H;  5JAV A;  1IBM Q;  4X62 Q;  4C3H B;  5EQ0 A;  3VR4 A;  2R7Z B;  2K7V A;  4C3H H;  3FKI G;  3N6R A;  2R7Z H;  1LTR D;  1JC7 A;  3NBI A;  1AW7 A;  2YV5 A;  3E3X A;  1XWE A;  2RCN A;  3X3M A;  3NTH A;  3TBI B;  5CV5 A;  3NUC A;  4DK3 C;  4DV3 Q;  2EJG C;  2JA5 G;  1L0Y B;  1JE4 A;  1EWH A; 
#chains in the Genus database with same CATH homology
 2NVT H;  4AIM A;  2WFW A;  2JJQ A;  4DV2 L;  1I94 L;  2L15 A;  1G51 A;  4A3E G;  2KBN A;  2Y0S G;  2NVY H;  5GRO A;  1VQE A;  3I7F A;  4BBR G;  3GTK H;  4UP7 A;  2KCT A;  2UXC L;  4A3M H;  3CPW A;  4JI2 L;  2JA7 H;  3I4O A;  3CMA A;  2QND A;  4DKA C;  2WB1 G;  4UY8 C;  1VQ5 A;  2OPV A;  1VQD A;  2ZTC A;  4QY7 A;  2DGR A;  3T1H L;  2RHQ B;  4O0A A;  4A3L G;  4OXP A;  1VQM A;  1X3E A;  1ZZK A;  1HNZ L;  2WB1 E;  3K7A H;  1OXT A;  3A5U A;  2P2R A;  1P16 A;  3BJU A;  1KC8 C;  4GLX A;  1IBL L;  1OTC A;  2UXD L;  3D0F A;  3I4M G;  4X65 Q;  4A3I H;  4A3K G;  1FJG Q;  4QQB X;  1PFS A;  1DTJ A;  1KIX A;  3RLO A;  3I4N G;  1WFQ A;  2JEB I;  1OXX K;  2NN6 I;  1X56 A;  3GTJ H;  3S1M H;  5M5Y H;  4QMF B;  1WVN A;  3NBH B;  5C4X H;  4YWL A;  2I5H A;  1D8L A;  1MKH A;  1O7I A;  3E0E A;  4IFD J;  1NY4 A;  1P8L A;  1M1K C;  1TWC H;  3NEM A;  3AYH B;  1IBM L;  1XMQ L;  4LF5 Q;  4DPG A;  1XNR L;  4X62 L;  1KL9 A;  3S1Q H;  4R4T A;  4NXN L;  3RZD H;  1UE6 A;  1UE1 A;  2KHJ A;  4QJF A;  3CC2 A;  1IL2 A;  1NJI C;  2HIV A;  1HNW Q;  4B8T A;  1HZC A;  4YCU A;  4B3M Q;  1TWG H;  1FL0 A;  2MNA A;  1KXL A;  2CTK A;  4IO9 A;  3CP0 A;  2UUC L;  1LUZ A;  2JA5 H;  3T1Y L;  1GKH A;  2OQ0 A;  1PH3 A;  3H3V H;  1N9W A;  4WAL A;  5EAY A;  4YWM A;  4DV3 L;  1A0I A;  3PO2 G;  2HIX A;  4BBR H;  2CFM A;  1XTD A;  1IYJ B;  3K7U C;  4YY3 Q;  1Q8K A;  3PIO A;  4DK6 C;  2GVA A;  3G6E A;  1XPR A;  3GTQ H;  4DNI A;  4YCW A;  1Q12 A;  3PUY A;  2XGT A;  5IP7 G;  5GAD C;  3OW2 A;  2A8V A;  3KDF B;  3CCE A;  3KDF A;  4TVA B;  1PH2 A;  1Q1B A;  2JE6 I;  2NVQ H;  1FGU A;  4PZ6 A;  4BA2 I;  4KHZ A;  3J80 c;  4JI1 Q;  5IYB H;  4DV0 Q;  2WAQ G;  4LF8 Q;  3KLW A;  4LF6 Q;  1A8V A;  2F52 A;  2QGQ A;  1AE2 A;  3CCS A;  3CCM A;  3PUX A;  2R7Z G;  1VIG A;  4ME3 A;  2E2I H;  2OTL A;  4C2M H;  1N33 Q;  1RL2 A;  3L0O A;  1VQH A;  2WAQ E;  2K75 A;  1YI2 A;  1PH5 A;  4DR6 Q;  3A0J A;  5C0X I;  3E9I A;  4A3K H;  4JI4 Q;  1VQC A;  3RNU A;  1VCI A;  1TWA H;  1G6P A;  4JV5 Q;  2VY3 A;  4NXM Q;  5IYD G;  4X6A H;  1YJW A;  4NBQ A;  2IT1 A;  4X65 L;  2VW9 A;  1K0R A;  1FJG L;  2CTL A;  2ZTD A;  2ZM6 Q;  5FLM G;  3STB D;  4A3B G;  4WAN A;  2PY9 A;  1VQI A;  4A3M G;  1YHA A;  4DV6 Q;  1YVC A;  4IOC A;  1H95 A;  2Q2H A;  1HZB A;  1XMO Q;  2F4V Q;  4IFD G;  5LMN Q;  4PZ7 A;  2CPQ A;  1BVS A;  3CCU A;  1I5F A;  5E7N A;  3CCV A;  5HGQ A;  4LF5 L;  3CAM A;  1VQA A;  4JOI C;  3GTM H;  3MEF A;  2WP8 J;  5HY6 A;  4DR2 Q;  2N8N A;  1E22 A;  1T9H A;  1EIY B;  2AMC B;  1HNW L;  1DT4 A;  3PV0 A;  4B3M L;  4L5S A;  3PO2 H;  4A3J H;  1MJE A;  4EQ5 A;  3FHW A;  1OXV A;  1I3Q H;  2B29 A;  4P72 A;  4OX9 Q;  3HOW G;  2BH2 A;  2YTV A;  4R4Q A;  2ES2 A;  2MO1 A;  2MQH A;  2DGY A;  1VQL A;  1YHQ A;  4YY3 L;  3A5Z B;  1VQ7 A;  4DV5 Q;  4LUZ A;  5C4J H;  2OCE A;  2AWO A;  4P71 A;  3RN2 A;  1NE3 A;  3F8T A;  4L5Q A;  3M9B A;  3CCJ A;  3CCQ A;  1YIJ A;  1GD7 A;  2EIF A;  4X66 Q;  4DUY Q;  1TWH H;  4HIM A;  1KHM A;  4DV0 L;  4JI1 L;  4AH6 A;  4LF6 L;  3HOX G;  2VZA A;  1YHB A;  3GD7 A;  2R7F A;  3G4S A;  1SFO H;  3TS0 A;  1PYS B;  2YQR A;  4OO1 I;  1N33 L;  4BY7 H;  4JI8 Q;  1A62 A;  4ALP A;  5IYD H;  1PH6 A;  4DR6 L;  2FMR A;  4TQU S;  3RLN A;  4APV A;  1QZG A;  4KLK A;  1PVO A;  1AH9 A;  4JI4 L;  4YHH Q;  2AKW B;  3J7Z C;  1UWV A;  4JI6 Q;  1HZ9 A;  3VDY A;  5FLM H;  1E3P A;  3I2Z A;  2QA4 A;  4NXM L;  4A3B H;  4JV5 L;  4C3I H;  3H15 A;  1YJ9 A;  2JZX A;  1ASZ A;  2CTM A;  2PQU A;  2ZM6 L;  1ZTG A;  1B70 B;  4LF4 Q;  2PMZ E;  2JK8 A;  3BU2 A;  3UE1 A;  5IYB G;  4JI0 Q;  4A93 H;  4DV6 L;  2E8G A;  3KF8 B;  4GLA C;  4NPS A;  1SRO A;  1B8A A;  3E9H A;  4XIG S;  3TQY A;  3W1G A;  1XMO L;  2F4V L;  3KJP A;  2CTJ A;  4YCV A;  5LMN L;  1KRS A;  4WJ4 A;  3AEV B;  4JI7 Q;  4OWX B;  4DR1 Q;  2N49 A;  2JA9 A;  1X3G A;  2VQF Q;  1PH8 A;  2JA6 G;  4DR2 L;  3L7Z C;  4DV1 Q;  1VQ6 A;  2K4K A;  3RR5 A;  1Q7Y C;  3S24 A;  3S14 H;  4JI5 Q;  2KCM A;  1V43 A;  2UUB Q;  1EWI A;  3HOW H;  3BZC A;  1ASY A;  3U1K A;  3OTO Q;  4OWW B;  5GAG C;  4B3S Q;  4KHP Q;  5LMN W;  4DAY B;  1I6H H;  2HHH Q;  1GO3 E;  2CKZ B;  1WI5 A;  2R6G A;  1K8A C;  2ZJR A;  4OX9 L;  3H0G G;  4OON A;  1IBK Q;  3J81 i;  3CME A;  3ZJY C;  3M85 A;  3RZO H;  4DV5 L;  3ER0 A;  3K81 C;  4NB3 A;  3ULJ A;  5IE8 A;  5H1S E;  4POG A;  5IYC H;  2ALY B;  2RF4 A;  3HOX H;  1XJV A;  2VUM G;  3J7A 5;  1VQJ A;  2Q2U A;  5IT9 c;  2PQA B;  2BA0 A;  3PCO B;  4DV7 Q;  4UP8 A;  4GNX C;  4X66 L;  4DUY L;  1PA6 A;  3HOU H;  4DR5 Q;  3KJO A;  1JMC A;  1R9T H;  1LTL A;  2VNU D;  3CCL A;  4A3J G;  1SE8 A;  3AQQ A;  1EIF A;  4JOI A;  4DR4 L;  4BBS G;  3TRE A;  3EIV A;  4HJ7 A;  4JI8 L;  2IHE A;  4X64 Q;  4YWK A;  2UXB Q;  2D0P A;  3HKZ E;  3F2C A;  2Q2T A;  2OTJ A;  2AXY A;  1RIP A;  4YHH L;  1QVG A;  4IOA A;  4JI6 L;  4LWC A;  4BY1 G;  3UDX A;  3HOV G;  1E24 A;  3DLL A;  4A3G G;  4GN4 B;  3G48 A;  3TRZ A;  1X55 A;  3G71 A;  1KQS A;  1EQQ A;  4DV4 Q;  3M7N A;  1WJJ A;  3PUV A;  1W2B A;  2ANN A;  1PYB A;  1U5K A;  3LGJ A;  4LF4 L;  1VQK A;  2YYZ A;  2E2J H;  4LUO A;  2LSS A;  3I55 A;  3KOJ A;  4PZ8 A;  2UUA L;  2A19 A;  4JI0 L;  2A1A A;  4BXX G;  2K5V A;  2JA6 H;  1EC6 A;  4IPH A;  3M4O H;  2PNH A;  5M5W H;  1VQN A;  4BY7 G;  2R93 G;  4EX5 A;  5AJ3 Q;  4JI7 L;  4LF7 Q;  4DR1 L;  1XPU A;  4LUV A;  5DLQ E;  4RMF A;  2VQF L;  2JA8 G;  3S1R H;  3S16 H;  1CKO A;  1NBW A;  3PSI A;  2E3U A;  4DV1 L;  1Y1V H;  1S3O A;  1VQ4 A;  4JI5 L;  1AE3 A;  1KHI A;  5M3M H;  2UUB L;  2B3G A;  3S1N H;  3H0G H;  1Q46 A;  5FLX c;  4DR7 Q;  1SN8 A;  4LFA Q;  1C9O A;  1L1O C;  3OTO L;  1VQO A;  1E7Z A;  3CCR A;  1PH4 A;  2H5X A;  2N3S A;  1Q1E A;  4B3S L;  2ASB A;  4KHP L;  1X4M A;  2HHH L;  2YTX A;  1HR0 W;  2D62 A;  1CUK A;  3DM3 A;  2VUM H;  1DGS A;  1WE8 A;  4GLV B;  2B63 G;  4A75 A;  2HH2 A;  1IBK L;  1J6Q A;  3HOY G;  1A63 A;  2NN6 G;  4JC0 A;  2MO0 A;  2RHS B;  1SMX A;  3K80 C;  2KEN A;  2N78 A;  2JVZ A;  3FP9 A;  3CD6 A;  2CTE A;  1WCM H;  2UU9 Q;  3ERS X;  2CQO A;  3M3Y H;  4IPC A;  3GTO H;  4DV7 L;  4BBS H;  2HH3 A;  1V9P A;  1B7Y B;  3J80 i;  2ZJP A;  4DR5 L;  2CCZ A;  5K36 G;  2XTI A;  1UE5 A;  4LNQ A;  1K9M C;  4JG2 A;  2Z0S A;  4HJA A;  3U58 A;  1PV4 A;  4BY1 H;  1G29 1;  1YEZ A;  5ELO A;  5IP9 G;  2HT1 A;  1OXS C;  3HOV H;  4X64 L;  4A3G H;  1FVI A;  4H02 A;  2UXB L;  1JJG A;  4GN5 A;  1U0L A;  2R7D A;  3HFZ B;  1Y1W G;  2K50 A;  2Z6K C;  2VQE Q;  4O2D A;  4P74 A;  4UPA A;  3GTG H;  1NMF A;  2YTY A;  4IJH A;  4RG1 A;  1Q82 C;  3CQZ H;  4GKJ Q;  4R4O A;  4JVH A;  2OPU A;  4LF8 L;  3KYH C;  4QGU A;  5IYC G;  1PH7 A;  4JI3 Q;  1IZ6 A;  4DV4 L;  1S40 A;  4BXX H;  1OXU A;  2MJH A;  4LF9 Q;  1KD1 C;  1J4W A;  4A93 G;  4HID A;  3GTP H;  3HOU G;  5FJ8 G;  5LMU Q;  4DR3 Q;  2PI2 E;  4UP9 A;  4PMW A;  4GOP C;  4DUZ Q;  2R93 H;  1YNX A;  4P75 A;  1YJN A;  1EQR A;  4A3D G;  4Y7N H;  2JA8 H;  1EYG A;  4GNX B;  4GNX A;  1N34 Q;  3ICE A;  3PO3 G;  1PHJ A;  5AJ3 L;  4LF7 L;  4HIK A;  3EBE A;  3M4Q A;  3HKS A;  4AQY Q;  1C7Y A;  1Z9F A;  3TS2 A;  3PIP A;  3OYY A;  5JJK A;  5C44 H;  1K83 H;  1VQ8 A;  3D31 A;  4AM3 A;  5GAE C;  1XPO A;  5C0X G;  1W3S A;  4DAM A;  3CC7 A;  1V1Q A;  4B3T Q;  4DR7 L;  4IPD A;  4R4C A;  1NTG A;  3U50 C;  1JJ2 A;  4LFA L;  1TWF H;  3GDE A;  2B63 H;  2V1C C;  3SGI A;  3PUZ A;  3HOY H;  1VQP A;  4HIO A;  2AHO B;  1JT8 A;  3NEN A;  2I0Q A;  1HR0 Q;  3AEV A;  2K14 A;  2E5L Q;  4IPG A;  4JBK A;  3B6Y A;  1X6O A;  3I56 A;  3PF4 A;  1N32 Q;  3PF5 A;  4GKK Q;  1K3R A;  2GN5 A;  2CTF A;  1TUA A;  1WOC A;  4MTN A;  4LFC Q;  2ZJQ A;  3WWV A;  3AFQ A;  3KF6 B;  3PUW A;  3KF6 A;  2LXK A;  2F3I A;  2FXQ A;  4MZ9 A;  2GVB A;  5JJI A;  1HJP A;  3K0X A;  4A4I A;  2Y0S E;  2DUD A;  2UU9 L;  4JYA Q;  3Q8D A;  1L0W A;  4L5R C;  1CSP A;  2AWN A;  5IP9 H;  3HOZ G;  1Y1V G;  3V69 A;  4QIW E;  2JA7 G;  4K0K Q;  1BKB A;  2ANR A;  5M3M G;  1Y1W H;  1EUJ A;  3W5O A;  1E1T A;  2I5M X;  3S17 H;  2PI2 A;  1J5K A;  1D7Q A;  1S72 A;  4A3C H;  3S2D H;  1KAW A;  2VQE L;  4IFD I;  4MNO A;  1L1O B;  1Y14 B;  1L1O A;  5JEA G;  4R4I A;  1K1G A;  2ID0 A;  3U4Z A;  4P73 A;  2PQA A;  3F2D A;  4GKJ L;  1Q81 C;  4XTC S;  5FJ8 H;  1QUQ B;  1QUQ A;  3MXN B;  1Z47 A;  4JI3 L;  5BR8 Q;  1Q86 C;  1M90 C;  2ATW A;  2IX1 A;  4A3D H;  3HKZ G;  2CWP A;  4LF9 L;  3UDF A;  1WCM G;  1X54 A;  2QEX A;  1KRT A;  1E1O A;  1QZH A;  4PG3 A;  3PO3 H;  4DR3 L;  5LMU L;  1HH2 P;  5IWA Q;  1N8R C;  1YZ6 A;  4DUZ L;  3CXC A;  1J5E Q;  4LFB Q;  4JBJ A;  2NZH A;  3FKI H;  3W1B A;  1ZZI A;  4WJ3 M;  3A74 A;  1N34 L;  4GN3 B;  3IRB A;  3CF5 A;  1LYL A;  4OWT B;  4A76 A;  1I50 H;  4OO1 G;  4AQY L;  4JBM A;  4LIJ A;  3M4P A;  1HNX Q;  2R92 G;  4R1J A;  1EOV A;  2Q2I A;  4HJ9 A;  1SRU A;  5C3E H;  3L2P A;  4B3T L;  1QVF A;  3EN2 A;  5M3F G;  4JVY A;  2K5H A;  4A3E H;  5GQO A;  2Z6K A;  3RLF A;  1IXR A;  2K5N A;  3K8A A;  4QL5 A;  4A3F G;  2UUA Q;  3JAM c;  2BA1 A;  1HR0 L;  1HZA A;  2K52 A;  4HJ8 A;  2E5L L;  1N32 L;  2IY5 B;  3S2H H;  1SLJ A;  4GKK L;  2MFI A;  3H3V I;  2C35 B;  4KI0 A;  4LFC L;  3HOZ H;  4GS3 A;  1X65 A;  4L5T A;  3J81 j;  4FDB A;  5C0X J;  1YBY A;  4JBW A;  1UEB A;  4GOP A;  4GOP B;  1EFW A;  3TEH B;  3CC4 A;  4A3L H;  4JYA L;  2E2H H;  4B3R Q;  4BA1 I;  1XNQ Q;  1N36 Q;  3PGZ A;  5C44 G;  1WYD A;  4K0K L;  1LM0 A;  1C0A A;  4LW1 A;  1MIU A;  4POF A;  3I4M H;  1CKM A;  1BBW A;  4DV2 Q;  1I94 Q;  1VS0 A;  1JJC B;  3I4N H;  3ULL A;  3KFU A;  2D0O A;  2UXC Q;  3UDI A;  4J15 A;  3BZK A;  1TXY A;  4JI2 Q;  3S15 H;  3VKE A;  3JC6 6;  1X3F A;  1VQF A;  4IJL A;  5BR8 L;  4Y52 H;  3T1H Q;  3UE0 A;  3UDG A;  1HNZ Q;  2JEA I;  2YU9 H;  1JE5 A;  3NEL A;  1MJC A;  1PH1 A;  1VQB A;  5IWA L;  3GTL H;  1VQG A;  1K73 C;  1IBL Q;  5ELN A;  1J5E L;  4LFB L;  2NZO A;  2UXD Q;  2BL5 A;  1CSQ A;  2BH8 A;  2R92 H;  5JEA J;  2HQL A;  3JAM i;  1CKN B;  1CKN A;  1QVC A;  1X4N A;  2OQK A;  2VS1 A;  1GVP A;  2LXJ A;  3STB C;  5M3F H;  3ULP A;  1SR3 A;  4C3J H;  5GAH C;  2NVX H;  2OWO A;  1HNX L;  3AFP A;  3RN5 A;  1JB7 A;  4A3C G;  3CPF A;  4A3I G;  1K8G A;  4A3F H;  4JCV E;  1L2F A;  1PH9 A;  4HJ5 A;  2I5L X;  3GO5 A;  5IP7 H;  4AYB G;  1XMQ Q;  1GM5 A;  1IBM Q;  1XNR Q;  2EQS A;  5C4X G;  4X62 Q;  1VIH A;  1X9N A;  4NXN Q;  5M5X H;  3F2B A;  3CW2 C;  2EXD A;  1BBU A;  5J3B A;  1YIT A;  4AYB E;  2KHI A;  3FKI G;  4C3H H;  3F1Z A;  2R7Z H;  3U4V A;  2CWA A;  1ZZJ A;  2UUC Q;  2YV5 A;  5JJL A;  2IHF A;  3T1Y Q;  2RCN A;  2JQO A;  1NMG A;  2IX0 A;  2VL6 A;  4B3R L;  1XNQ L;  4DV3 Q;  4DK3 C;  1N36 L;  2ZTE A;  4DR4 Q;  5IY0 A;  1VQ9 A;  2JA5 G;  3J81 c;  5C3E G;  1UE7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...