2JA9A

Structure of the n-terminal deletion of yeast exosome component rrp40
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
175
structure length
175
Chain Sequence
KRYIPSVNDFVIGVIIGTFSDSYKVSLQNFSSSVSLSYMAFPNASKKNRPTLQVGDLVYARVCTAEKELEAEIECFDSTTGRDAGFGILEDGMIIDVNLNFARQLLFNNDFPLLKVLAAHTKFEVAIGLNGKIWVKCEELSNTLACYRTIMECCQKNDTAAFKDIAKRQFKEILT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Biochemical Characterization of the Yeast Exosome Component Rrp40
pubmed doi rcsb
molecule keywords EXOSOME COMPLEX EXONUCLEASE RRP40
molecule tags Rna binding protein
source organism Saccharomyces cerevisiae
total genus 43
structure length 175
sequence length 175
ec nomenclature ec 3.1.13.-:
pdb deposition date 2006-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF15985 KH_6 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2ja9A01
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 2ja9A02
4UP9A 5IYBH 3S1QH 2A1AA 5LMNQ 1Q86C 3HOYG 1HR0L 1VQKA 5C4JH 2UXDL 1FJGL 2ANNA 2Y0SG 2CCZA 1EUJA 2N8NA 3CP0A 5IP9G 1X54A 1A0IA 2CTMA 1WFQA 2R7DA 2ZTCA 3E0EA 4DR5L 3RN5A 2K5NA 2CPQA 2HH2A 3CPFA 1E1OA 3ERSX 3HOYH 4OX9L 1E7ZA 2F3IA 4R1JA 2OTJA 2A19A 2IY5B 1DTJA 1PYSB 2PQAA 1EFWA 5IP9H 3F2DA 1HZAA 5GAEC 1HNWQ 2VY3A 1WCMG 4EX5A 5JJIA 1X6OA 4LF5Q 4LF8Q 4OO1I 3K80C 1M90C 3HOUG 2L15A 3PO3G 1KAWA 3E9HA 3CCVA 1BBUA 4IOAA 4DR2L 2E2HH 4QY7A 1T9HA 2ATWA 5ELNA 2PQUA 2JK8A 4A3MG 3H3VH 1BVSA 1TWHH 2VQEL 3CW2C 3RLNA 1XNRL 1J6QA 3HOUH 5C3EG 2ZJRA 4JI6Q 1MJEA 3PO3H 1HNXQ 4K0KQ 3CPWA 2UXBL 3EBEA 2KENA 3IRBA 1GD7A 2F4VQ 4A3MH 1X3GA 3CC2A 3KYHC 3GTKH 3GTMH 4KHPQ 2CTKA 1YEZA 1N33Q 4GLAC 1J5KA 5C3EH 1IBKL 5M5YH 2PI2E 1VQ6A 4X66L 3S1MH 1Y1WH 2PQAB 4IOCA 4LF7Q 1K9MC 3GTJH 4YCVA 3S15H 1FGUA 4BA1I 2Q2HA 2QEXA 2NN6G 1YHQA 2Q2UA 4LW1A 4DV3Q 4B3TQ 1PV4A 4L5RC 4A3IG 3M3YH 1E24A 3CF5A 4R4TA 4YHHQ 4IFDI 1JJ2A 2JZXA 2KCMA 3PUZA 4GOPA 1HNZQ 1IBLQ 1PH2A 2YV5A 1K83H 2UUCQ 2WAQG 4A3LG 2FXQA 2KHJA 4J15A 2E2JH 3KLWA 4A3IH 1EQQA 3A74A 2WAQE 4L5QA 2GVAA 4GNXA 1CKNA 3S14H 3I7FA 1B70B 3F8TA 3G48A 1IZ6A 1CSQA 4MNOA 3TQYA 1J5EQ 2UUBQ 4LF9L 4A3LH 2P2RA 1WJJA 2K50A 2KHIA 3M9BA 4YWMA 3CCUA 3RNUA 5LMNL 4DR7Q 1Z47A 5FLMG 4A3JG 1YJ9A 1XMQQ 1Q1EA 3GTGH 3Q8DA 3S17H 4A3DG 2QA4A 3OYYA 1CKMA 3F2CA 4RMFA 2UUAQ 1TUAA 4A3CG 3GTPH 1OTCA 2E2IH 2IHFA 2YU9H 1KHIA 3I4OA 4YCUA 5FLMH 4A3JH 2CTJA 1QUQA 4A3DH 1VIGA 1UE5A 3I2ZA 4KI0A 4DR4Q 4GOPB 1HNWL 2JA9A 3LGJA 1PH4A 4A3CH 1A63A 1D8LA 3FKIG 4L5TA 4A4IA 5GAHC 5C0XG 1YNXA 3TEHB 4LF5L 4LF8L 1L1OA 4NBQA 2C35B 3V69A 2D0PA 4QMFB 3JAMc 1LTLA 4GNXB 3T1HQ 4IFDJ 1VQBA 5IP7G 3GD7A 3FKIH 1V9PA 4XTCS 4LF6Q 1U5KA 2HQLA 3UDGA 4JI6L 4K0KL 2PMZE 4DUZQ 3PF4A 4DPGA 1X65A 5IP7H 2F4VL 3E9IA 2B3GA 4R4OA 4KHPL 3AFPA 3RZDH 2ANRA 1XPRA 4A3BG 4X65Q 1C0AA 5LMUQ 4MZ9A 2Z0SA 4ALPA 2CWAA 1WVNA 1O7IA 3ZJYC 3KF8B 4DR6Q 1GO3E 2RHSB 4LF7L 1HR0W 1ZZIA 1N32Q 2UXCQ 1XPOA 1NTGA 1UE7A 1VQGA 2EXDA 4DV2Q 1PH8A 5BR8Q 1Y14B 4B3TL 1RL2A 1YZ6A 3CCSA 4DV3L 4DV7Q 2ASBA 3M4PA 4DUYQ 2JVZA 1VQ9A 4JBWA 1L1OB 3HKZE 4OWXB 1GVPA 1SR3A 2QNDA 4POGA 1IBLL 2RHQB 3OTOQ 1SROA 1EIYB 4B3SQ 1VQFA 2UUCL 1Q12A 3U50C 5IYBG 1SMXA 2IX1A 4A3GG 2BH8A 4GLXA 3UDFA 1XJVA 3KFUA 2ID0A 3FHWA 3PUYA 3UDXA 1C7YA 1D7QA 4DV6Q 3S24A 5JEAG 2GVBA 2Q2TA 1IYJB 3U4VA 3CCEA 4RG1A 1I5FA 1VQMA 2K52A 1J5EL 2UUBL 4JV5Q 4DV4L 1X4MA 4A3GH 2OQ0A 4JVYA 1HZBA 3CCMA 2DGRA 3HOXG 4LFCQ 4DR7L 2K4KA 3J81c 1XMQL 1G291 1JE5A 4IPHA 1PH5A 1IBMQ 1KHMA 1A62A 4R4CA 1E22A 3T1YL 2UUAL 2JA7G 3S1NH 1AE3A 1YBYA 1OXXK 2BA0A 3DLLA 2B63G 1NMFA 3S2HH 4GN3B 3HOXH 4R4IA 2LXKA 3PUXA 4A93G 1HZ9A 1VQ4A 5GROA 3I4MG 2JA7H 4DR4L 1EQRA 2I5MX 3CQZH 4DV5Q 2B63H 1PHJA 3TS2A 5IWAQ 2BL5A 2RF4A 2WB1G 1EYGA 1XNQL 1VQ8A 3W1GA 3PV0A 2GN5A 4A93H 5EAYA 1VQIA 2WB1E 4JYAQ 3I4MH 2PY9A 3T1HL 1HH2P 1XMOQ 2HHHL 1W3SA 5J3BA 1W2BA 1PH7A 4LF6L 4GKJQ 4WANA 2NN6I 1N36Q 3CXCA 1VQ7A 2KBNA 4DUZL 1PH3A 2OWOA 1Q46A 5M3MG 4WJ3M 1ZZJA 4NXML 3TS0A 2CQOA 1OXTA 1NY4A 4HJAA 4X65L 4DV0L 4IJLA 1YHBA 2Z6KC 5LMUL 5IT9c 1IXRA 5DLQE 1L2FA 2E8GA 1SN8A 1PYBA 3K8AA 3NEMA 1CUKA 3UE1A 5M3MH 4JI2Q 3GTLH 4R4QA 1B7YB 3F2BA 1N32L 2UXCL 1Q8KA 2VW9A 3UE0A 3ICEA 3H15A 5BR8L 4JVHA 2JQOA 1HZCA 2XTIA 4JBKA 3FP9A 1U0LA 4HIOA 4EQ5A 4YY3Q 2FMRA 3CMEA 3S1RH 4B3RL 1NBWA 4HJ8A 4BXXG 1UWVA 3HKSA 4NPSA 4B3SL 5H1SE 3L2PA 1TXYA 1X9NA 2VNUD 1ZTGA 4HJ5A 3OW2A 4UPAA 4HIDA 3CCRA 3K7AH 4A3FG 1EIFA 1I94Q 2NZHA 4JI3Q 2BH2A 3CCJA 4BXXH 1YVCA 3BJUA 2ZJPA 4GS3A 4DK3C 4GLVB 4PG3A 4LFCL 4O2DA 1ASYA 4BY7G 4BY1G 4A3FH 2NVYH 2VL6A 2K14A 4L5SA 1IBML 3PO2G 4KHZA 4X64Q 2YTVA 3ULLA 3VKEA 4HIMA 1FVIA 5E7NA 2ZM6Q 1E3PA 1BKBA 4DV1Q 3PSIA 4UP8A 4BY7H 1X56A 1QVGA 1RIPA 4BY1H 2HT1A 3M4QA 4GN4B 4JBMA 3PO2H 1QZHA 4AM3A 3KJOA 4B3MQ 1TWFH 1V43A 4AYBG 1NJIC 3VDYA 5GAGC 2R6GA 4DV5L 3RZOH 3U1KA 4FDBA 4QGUA 1EOVA 1WYDA 3J7ZC 1LYLA 4JOIA 4ME3A 4MTNA 4AYBE 4HJ9A 1M1KC 3TRZA 1YI2A 4IFDG 1I6HH 1JJCB 1Y1VG 1VQAA 4PMWA 4Y7NH 3PIPA 2IX0A 3AYHB 4QQBX 1P8LA 3B6YA 5ELOA 2IHEA 3WWVA 4QJFA 4YWLA 5AJ3Q 4GKJL 2CTEA 1HNXL 4DR1Q 4OX9Q 1N9WA 4JI0Q 1Y1VH 2NVTH 1UE1A 4JCVE 5M5XH 1NE3A 3RLFA 4P72A 3W5OA 1VQLA 1PVOA 3PCOB 4LF4Q 1VQDA 2ZJQA 1N33L 4TQUS 5M3FG 1QVFA 3CAMA 2JA8G 3KOJA 1CKOA 4JC0A 5FLXc 3D0FA 3F1ZA 4BBRG 2JA5G 1R9TH 3KJPA 4JI2L 2ES2A 3HKZG 2NZOA 4DAMA 1KD1C 4Y52H 4OWTB 2VUMG 5M3FH 1LUZA 1ASZA 2JA8H 4LIJA 2YTXA 4H02A 1XNRQ 4YHHL 4YY3L 1MKHA 1HNZL 4BBRH 3A5UA 2JA5H 4AIMA 1N34Q 4DK6C 1GM5A 2R7FA 4IPCA 2VUMH 1I3QH 1CSPA 5IE8A 2VQFQ 4AQYQ 1PH6A 1XNQQ 3I4NG 5JJKA 1IBKQ 4PZ8A 1I94L 3PGZA 1KXLA 2EQSA 3S2DH 3AEVA 2R93G 4XIGS 4LFBQ 2E5LQ 1ZZKA 4LUZA 1JMCA 3H3VI 2Q2IA 1Y1WG 3I4NH 1VCIA 2UU9Q 3GO5A 1YITA 5C4XG 4JG2A 3GTQH 3J7A5 1AH9A 4LFAQ 1YHAA 4X64L 2R93H 1GKHA 2YYZA 4LNQA 3RN2A 3A0JA 1X3EA 2ZM6L 5C44G 3CD6A 1Q1BA 2WFWA 4DV1L 2AMCB 5FJ8H 2JJQA 5IYDG 5GADC 1VS0A 1K3RA 5C4XH 2NVXH 1VQHA 2V1CC 3D31A 2CKZB 4QIWE 5HY6A 3W1BA 3BZKA 1PH9A 4B3ML 4OWWB 1YJNA 4JI5Q 1V1QA 1VQEA 3S16H 1BBWA 4AH6A 5C44H 2HH3A 5JEAJ 4JI8Q 5IYDH 2LXJA 3RLOA 1Z9FA 3A5ZB 4QL5A 1G51A 4PZ6A 4YWKA 3J81j 3CC7A 4OONA 2JA6H 1Q81C 1S3OA 3CCLA 4BBSG 2AWOA 2JEBI 3AEVB 4IJHA 2Y0SE 4GN5A 3J80i 1J4WA 1VQOA 1OXUA 2OPUA 5IYCG 4KLKA 3MEFA 5AJ3L 4DR1L 2Z6KA 3K81C 4APVA 3J80c 1WOCA 3TREA 4JI0L 1EC6A 1L0WA 3MXNB 5M5WH 2LSSA 4HJ7A 4BBSH 4LUOA 3KF6A 4LF4L 4GKKQ 4WJ4A 5IYCH 4C3JH 2ALYB 4LWCA 4UP7A 4B8TA 1AE2A 4A3EG 1VQCA 2XGTA 4P74A 2WP8J 1VIHA 5LMNW 2E3UA 1FL0A 4DV2L 1WCMH 1I50H 1VQPA 1SFOH 4DV7L 4DUYL 1S40A 3U4ZA 1X3FA 3PUWA 3AQQA 1UE6A 2MQHA 4A3EH 1H95A 1KRTA 2CFMA 2NVQH 2ZTEA 3PIOA 2I0QA 3OTOL 2MO0A 2DGYA 4DNIA 2OPVA 1KRSA 2OQKA 1YJWA 3HFZB 1N34L 1IL2A 2R92G 4OO1G 3BU2A 3GDEA 2VQFL 4AQYL 1VQNA 1PA6A 2K75A 4TVAB 3UDIA 1DT4A 4JI1Q 4DV6L 3PF5A 4BA2I 5K36G 2HIVA 2IT1A 1KQSA 3EN2A 2R92H 1OXVA 3G6EA 2R7ZG 4JV5L 4LFBL 4X62Q 2E5LL 2JE6I 1MJCA 2VS1A 3KF6B 4POFA 4JI4Q 5C0XI 2UU9L 2EIFA 1B8AA 1K73C 5JJLA 3GTOH 4LFAL 2AKWB 4LUVA 4DR3Q 1N8RC 2R7ZH 1DGSA 4A75A 2YTYA 2K5VA 1OXSC 1SLJA 1XTDA 2D62A 4JI7Q 2AWNA 2CTLA 4JBJA 3I55A 4OXPA 4GOPC 2CWPA 3M4OH 4P71A 1TWGH 3K7UC 2AXYA 3ULJA 2OCEA 2PI2A 3RR5A 5IWAL 3H0GG 4C2MH 4JI5L 4NXNQ 3HOVG 1SRUA 2VZAA 3AFQA 3HOZG 4DV4Q 3BZCA 4JI8L 1HR0Q 1C9OA 1TWAH 4DAYB 4GNXC 1FJGQ 1QVCA 4JYAL 1KIXA 1X55A 3CC4A 2A8VA 3DM3A 1E1TA 3T1YQ 3H0GH 1XMOL 3HOVH 4DR5Q 2BA1A 3HOZH 1HJPA 1G6PA 1Q82C 1QZGA 2MNAA 1YIJA 1N36L 2CTFA 4NB3A 1UEBA 3L0OA 3M85A 3U58A 2I5LX 1K0RA 2PNHA 1NMGA 3G71A 3CCQA 3STBD 3KDFA 3NBHB 3I56A 1KL9A 4GKKL 2MJHA 2B29A 4O0AA 4C3HH 1VQ5A 2HIXA 3JAMi 5HGQA 1TWCH 4C3IH 3NELA 3JC66 2N78A 4IPDA 2ZTDA 4PZ7A 1SE8A 3K0XA 5C0XJ 4DR2Q 3PUVA 4A76A 2MFIA 4IPGA 3M7NA 4WALA 3CMAA 1CKNB 1A8VA 4P75A 3STBC 2VQEQ 2HHHQ 4JOIC 1JJGA 1L1OC 2QGQA 4UY8C 4IO9A 3L7ZC 2UXBQ 1PH1A 3HOWG 1VQJA 4A3KG 4NXMQ 5GQOA 2YQRA 1PFSA 1Q7YC 1LM0A 4YCWA 1K8AC 2MO1A 2F52A 3SGIA 4HIKA 4DV0Q 4JI1L 4JI3L 4X66Q 3HOWH 3ULPA 2JEAI 4A3KH 1QUQB 2K5HA 1P16A 4X62L 2N3SA 2UXDQ 3KDFB 4JI4L 1JT8A 2DUDA 5FJ8G 4DR6L 5IY0A 4DKAC 2RCNA 2AHOB 1KC8C 4A3BH 1WI5A 4B3RQ 4DR3L 1WE8A 3EIVA 2H5XA 1XPUA 1K8GA 1MIUA 2KCTA 4JI7L 1X4NA 1K1GA 1JB7A 1EWIA 2D0OA 3G4SA 3ER0A 1S72A 2OTLA 2JA6G 2N49A 4P73A 4LF9Q 4X6AH 4NXNL 3J81i 2I5HA 3NENA
chains in the Genus database with same CATH superfamily
1PXUA 1SDFA 3S1QH 5LMNQ 1FJGL 2CCZA 2N8NA 1X54A 4Y7NB 1CTMA 1XMOH 5DNFA 3A8IE 1E1OA 3OW7A 3CRKC 3HOYH 1E7ZA 4B9WA 5DAUA 1EFWA 5IP9H 2NVTB 1V9NA 2VY3A 2MGSA 1Y8PB 3NP8A 3I72A 1XXGA 3PO3G 3DM1A 3E9HA 2ATWA 2K6AA 2PQUA 3I90A 4A3MG 4K8JA 3CW2C 5K5PA 2HD3A 3KBXA 1XYIA 3HOUH 4K0KQ 3CPWA 1B2TA 5EKLA 4PMBA 3IRBA 1GD7A 1X3GA 3KYHC 3GTMH 2CTKA 1YEZA 1N33Q 2EYLA 2VUMB 1IBKL 2CW0C 4X66L 3S1MH 3OPOA 4LF7Q 1K9MC 4G7OC 4Q0FA 2A69D 1HFGA 1FGUA 3FPPA 1BNZA 1YHQA 4B3TQ 2Q2UA 2ZQEA 1ENAA 1PV4A 3M3YH 4A3IG 4IFDI 3I4NB 2JZXA 3Q23A 3GV3A 3H94A 5DM63 1IBLQ 3GTQB 4NZTM 1K83H 2ZM6H 2DY7A 2WAQG 4A3LG 2FXQA 3QJYA 1K0SA 2AUKA 5LL6b 4KTAA 3A74A 5C4HA 3FEWX 5C4XB 3X3MA 1KNAA 3I7FA 1B70B 1BF4A 3QD7X 2F0JA 1J5EQ 2UUBQ 3SK4A 1WTVA 2K50A 4KK7A 2QDLA 2DNCA 3SK6A 1LTID 1Q1EA 2JN4A 3Q8DA 3JAMW 3OYYA 4FP5D 2DNEA 5KYLA 1SNDA 4R8NA 1GHKA 4J1MA 1U9RA 4DR5H 3GTPH 1OTCA 1J8IA 2YU9H 4OX9H 4ZKBB 1HNWL 1B44D 1PH4A 4YIJA 1A63A 1FR3A 4FO2A 1S5CD 5C0XG 4LF8L 1VDZA 2C35B 1PQXA 1CI3M 1VQBA 4LAAA 1KLUD 1V9PA 4XTCS 2F0QA 1I50B 4EGVA 4LF6Q 1K3BC 1I4GA 2PMZE 1TIID 3S1RB 4A3EB 3PF4A 2UXBH 2NVQB 3HGBA 4PV1C 1BCPC 2EVBA 2B3GA 1HHVA 4KHPL 3RZDH 3C3LA 2PW7A 1PMRA 2CVRA 4MZ9A 4ALPA 3ZJYC 3QG1A 1ZZIA 3I8ZA 1DCZA 5FLXL 1VQGA 2EXDA 1PH8A 5BR8Q 1Y14B 3GV6A 1LTRD 2LKVA 2UU9H 3U9OA 4POGA 4XQQA 3GTOB 3NWTA 1EIYB 5JAVA 4A3GG 4GLXA 1XJVA 1WHRA 3PUYA 3FHWA 3S24A 5JEAG 2GVBA 3M4OB 1A3UA 1X0AA 4U68A 3NWSA 4EQNA 1I5FA 5JJZA 1VQMA 2K52A 4DV4L 2DGRA 3CCMA 3SE0A 2HQEA 3D4RA 3T4AC 4R4CA 5D14A 2BA0A 2B63G 2KCCA 3HOVB 4GN3B 1CHQD 4KD3A 1ZEQX 2EXZA 3QIAA 1RDPD 5I4DA 2JA7H 2I5MX 3CQZH 1PTOH 5IWAQ 2BL5A 1XNQL 5CV6A 4A93H 1ILPA 4DAVA 3OMGA 1XMOQ 3KLRA 2HHHL 5BN4A 2NZ1D 2NN6I 2KBNA 4DUZL 1PH3A 2OWOA 3BDOA 3TS0A 5BN5A 2LS01 1NY4A 2K1HA 1BO0A 2FPHX 3NXWA 3SR1A 1PFMA 4IJLA 4JI1H 5FLXE 5IT9c 1IXRA 1F77A 1L2FA 2B8FA 2WIIB 3CRLC 5ELEA 3F2BA 1B7YB 1N32L 3UE0A 2BDNA 2PZWA 1NCVA 3FP9A 2EYMA 1U0LA 3A8KE 1NBWA 1Q8IA 5KIXA 4BXXG 1AEXA 1UWVA 4NPSA 4B3SL 2A6ED 1E2ZA 3BG3A 1CT1D 3K7AH 1EIFA 1HUMA 2F0SA 4H7BA 3DEOA 3RF2A 2ZJPA 2E76C 4GS3A 1UEAB 4MTKA 3TDQA 4PG3A 3J7AF 1JB3A 1D1KA 2NVYH 4A3FH 1XMQH 5EBCA 4L5SA 1IBML 3PO2G 4KHZA 2JA6B 3VKEA 2HUGA 3GKUA 1S5DD 1IW7D 2ZM6Q 1B1ZA 1E3PA 1O7LA 1EY5A 4DV1Q 2F0DA 4BY7H 3BVMA 1QVGA 4HMJA 4DA2A 2Y0SB 1YNJD 1JT8A 1V43A 5M5WB 1NJIC 2NUCA 4DV5L 1EOVA 1WYDA 1LYLA 2PQEA 3TRZA 4AYBE 2LRRA 1S03G 4WJWA 1YI2A 2TSSA 1Y1VG 4Y7NH 4XT1B 2E2HB 3AYHB 4QQBX 1P8LA 1KDAA 1TWHB 2J7ZA 4K14A 4YWLA 4OX9Q 4DR1Q 1SNPA 2F0PA 1F9QA 3TBIB 2NVTH 2AQ3B 5L37A 1WD0A 3W5OA 2FFMA 3VR2A 3PCOB 1PVOA 1CKOA 5FLXc 3D0FA 4G4KA 3F1ZA 1SJHD 4DR6H 2UXCH 1LTAD 1NUCA 1SJED 2NZOA 3A54A 3Q24A 4JPBW 5I2XA 1KD1C 3S15B 4Y52H 2UXDH 4X3UA 4B3RH 4AIMA 4DK6C 2R7FA 1BCPB 1MD2D 3R8BA 2VUMH 2D2CC 1PH6A 3EROA 3FMCA 2IWHA 4ILWA 1LACA 1SSOA 1STHA 2E5LQ 3E5SA 3H3VI 3I4NH 4LFCH 2UU9Q 4JG2A 3GTQH 1AH9A 3VR5A 4ULLA 3CD6A 3J7AK 2NVXH 2E2IB 5C4XH 5KNBA 1WTJA 3U9SA 3OSOA 3W1BA 1A6XA 1YJNA 1VQEA 4AH6A 2D9IA 1Z9FA 1HTPA 3A5ZB 3K6OA 3F2UA 4QL5A 4PZ6A 3J81j 2A1SA 1S3OA 3S9WA 2AWOA 1EWCA 1STEA 5IODA 1JOOA 2A73B 3J80i 4C1NK 1L0YB 2ICEC 1J4WA 4KLKA 4JI6H 5AJ3L 1HNXH 4APVA 1JC7A 3DWPA 2SEBD 2F4VH 3PIP3 3KF6A 2OT2A 3TN2A 2R3ZA 4RFBA 4FXDA 5IYCH 5I6YA 2Z6BA 1M8AA 4UP7A 1VIHA 1RD9D 5LMNW 1STGA 2E3UA 3O13A 1WD1A 4DV2L 2KVMA 1I50H 4DV3H 4YHHH 4A3EH 3SB1A 1KRTA 1HNZH 2NVQH 2ZTEA 4KMUC 2MO0A 2DGYA 3DWQA 3WOFA 3SEBA 3BU2A 2DJGC 1PA6A 4DAYA 1JICA 4JI1Q 1I94H 1UUPA 1YNND 3QWNA 5EKKA 3EN2A 4JV5L 2QKIC 1MJCA 3KF6B 3QO2A 5C0XI 1B8AA 1QCBD 3BYYB 3W3AA 3GTOH 3KLSX 5G3LF 5JVG3 2YTYA 2H1EA 4G57A 3I0PA 2RSOA 4GZYC 3CU7A 2F0EA 3M4OH 2CWPA 2ZXPA 1DZ1A 5A2QW 3ULJA 2OCEA 3RR5A 3H0GG 4JI5L 1SRUA 1EY6A 3HOZG 1L0XB 4DAYB 4JYAL 3I4MB 3DM3A 3HOVH 1ONLA 4C3IG 3L0OA 2N55A 5E4WC 1F2LA 1BUVT 1W6JA 1NR4A 3STBD 1PZID 3GTMB 4O0AA 2B2UA 5LMUH 1QG7A 3NELA 3AB9A 2EE1A 5EKIA 4HTHA 3E6ZX 1RF2D 4WALA 1A8VA 5KNCA 4DV7H 2QGQA 4HAEA 2NBFA 4S3SA 2SOBA 4UHVA 3HOWG 1VQJA 1EZ8A 1K83B 1AN8A 1ET9A 1K8OA 3OSSD 1K8AC 2VQFH 1IKLA 4DU9A 4HIKA 2RDFA 4JI3L 1FNWA 5JVH3 1EIHA 3KDGA 2VB3X 2EYJA 3N52A 4RHSA 4KY6A 2J0TD 4X62L 2UXDQ 2DUDA 2F0MA 2K32A 3IAYA 2RSNA 2PPBC 4C56C 5KEEA 2CH4A 4B3RQ 4LFAH 3OWEB 3MAQA 1WE8A 2H5XA 1IHZA 4IUTA 2O4XA 2KCTA 2DN8A 1EWIA 2D0OA 1S72A 1RTNA 3RZOB 4NXNL 3NENA 3OIQA 2A1AA 1I6HB 1HR0L 4DFAA 1EUJA 3N6RA 5JEAH 2BOSA 1HRJA 4AYBB 1WFQA 1KLGD 1T5XD 2ZTCA 3SVMA 2K5NA 1HPCA 3CPFA 3H6MA 1A3VA 1TT2A 2F3IA 2MHVA 1B9MA 1DTJA 1PYSB 2PQAA 1HZAA 2ICIA 5GAEC 1AW7A 4EX5A 1QOHA 1X6OA 2O5IC 5EJWA 4GKKH 4OO1I 4CDDC 3CCVA 1BBUA 5IT9W 4UDUC 2E2HH 1B9NA 5ELNA 1BVSA 1TWHH 2EYHA 2VQEL 1B3QA 5M3FB 1J6QA 1XNRL 5C3EG 4JI6Q 4YY3H 1HNXQ 1H9JA 5CBAE 2F4VQ 3CC2A 5CV5A 4XQNA 2JYOA 2L11A 2K28A 3FRPB 3MXGA 3P1HA 2PQAB 4IOCA 3D4DA 1O78A 2ZT9C 3IFDA 3S15H 2QEXA 2NN6G 2B2WA 4DV3Q 1RJTA 1E24A 4R4TA 4FXGC 4YHHQ 4CKCA 1JJ2A 3C1EA 1HNZQ 1PH2A 2UUCQ 1S4ZA 3D3RA 4RGMA 1V1PA 1Y1WB 2WAQE 4L5QA 2WACA 3NUCA 5C5MA 4DGZA 1LO5D 4LF9L 5FK9C 2PYKA 4MN3A 3TP6A 5LMNL 3RNUA 4OD6A 2F0UA 4K8IA 5FLMG 2RVLA 3J81E 4A3JG 1YJ9A 4A3DG 2MPMA 2QA4A 1CKMA 2UUAQ 3H3VC 4A3CG 4H8AA 5CV7A 5C3XA 4C3HG 5EPKA 3WDNA 2E2IH 3LX0A 1VIGA 4N8X1 3E3XA 3G7LA 3SXHA 5ISRA 4KV6A 2EJMA 2JA9A 3FKIG 4L5TA 1PZKD 3I73A 4NBQA 1V1PB 1EU4A 1WTRA 2A5HA 1EOTA 4QMFB 1LTLA 2BE5C 3T1HQ 1V8QA 3GD7A 2JP1A 1HQMC 3QB3A 3SK8A 1R4QB 1SFOB 2B2YC 4K0KL 4IUQA 3HG9A 5FKAC 1H9RA 5IP7H 3E9IA 5EPLA 4AQYH 4A3BG 2XSCA 1C0AA 1IBKH 1RTOA 5LMUQ 2Z0SA 1BBXC 4ID6A 1GO3E 2RHSB 4LF7L 1XPOA 4LFBH 1DOKA 1NTGA 1QNUA 3A8JE 2R92B 2ASBA 4B3TL 1RL2A 1YZ6A 2A68C 4DV7Q 3Q22A 4JBWA 3HKZE 4JW0A 1GVPA 4ZCKA 4OWXB 2NTSA 1IBLL 2RHQB 2HCCA 5AFWA 1VQFA 1F2ZA 2R7ZB 3MTSA 3NBIA 3U50C 1LT4D 5E3FA 3KFUA 2ID0A 3UDXA 1C7YA 2VKCA 5JOBA 3CCEA 1TWGB 4RG1A 1JWMD 1J5EL 2UUBL 3EVQA 3TMEA 3HOXG 3J81c 2PZTA 1G291 1PH5A 3T1YL 3DLLA 1OXXK 2EY5A 2Y3MA 2CH4W 2LXKA 1CA6A 1VQ4A 5GROA 1DD2A 1F9RA 4HCSA 5BN3A 3I70A 5C5LA 2RF4A 3IKJA 1Y8NB 1EEID 3PV0A 4C3HB 5EAYA 1VQIA 3M4YA 1TWCB 4FJSA 3I4MH 1Q90A 1W2BA 1VBIA 1PH7A 4LF6L 1PRTC 1RHPA 4BS9A 3CXCA 1VQ7A 1ZZJA 5M3MG 4WJ3M 2CQOA 1MHWC 4X3KA 4KD4A 3TSSA 3DHQA 3J80L 3LWUA 3ND9A 2X69A 4HJAA 3HZXA 4DV0L 1YHBA 2Z6KC 2E8GA 3A55A 3AU7A 2G9HD 1CA5A 1JMCA 4A3KB 4K5WA 2VW9A 3ICEA 4NP5A 5BR8L 1MSHA 4G7HC 4YY3Q 3TZUA 1NXUA 1PTOD 4HSVA 3VA5A 1K28A 3HKSA 4TRDA 3L2PA 4RH6A 1DOLA 2EJGC 4H0LC 2OXPA 3K5MA 4HJ5A 4UPAA 3OW2A 2NVXB 4JI7H 3CCRA 4LJZC 3NHHA 1DOMA 1G8ZD 4FVMA 4XYQA 3CCJA 1WVLA 1YVCA 5C6AA 5IOCA 4E6IA 4DV4H 4GLVB 4QIWB 3NE5B 4JK1C 1STAA 4BY1G 2VL6A 5C4JB 4X64Q 2YTVA 3ULLA 4HIMA 2Q8TA 4CBVA 1A15A 1X56A 2HT1A 1TQOA 1QZHA 1HUNA 2B2VC 3RZOH 2R6GA 4FDBA 1PRTF 3J7ZC 3MA2B 4JOIA 4ME3A 5KGUA 4PMCA 1I6HH 1XNQH 3W2DA 2B2YA 1JJCB 4DR2H 3P75A 2A6HC 2GA4B 2IX0A 1EYDA 2HHHH 3WWVA 4IFDH 1FD7D 4I7ZC 3PO3B 1N9WA 3VYTA 1UE1A 3NTHA 3J80E 3RLFA 1O7YA 3FVQA 4LF4Q 4A3MB 2ZJQA 4TQUS 1QVFA 1X32A 1SMYD 3CAMA 3K0YA 3KOJA 2JA8G 2PW5A 4BBRG 1U4MA 2X6GA 2JA5G 2H4OA 1ODHA 1N32H 2EY6A 3EQLC 3HKZG 4OWTB 3T53B 5M3FH 1LUZA 1WTHA 1ASZA 1CZGA 2YTXA 1MKHA 1WTPA 2QEJC 4B3SH 4JVZA 5IE8A 1CSPA 3OMCA 4RA8A 4AQYQ 4A3IB 1IBKQ 4K6DA 1EZ6A 3PGZA 1E2VA 2EQSA 2R93G 4XIGS 3S14B 4LFBQ 4TKOB 2WAQB 4DNRB 3AMUA 5C4ZA 1VCIA 3GO5A 1YITA 3D6CA 1HCZA 3BVGA 3MXNA 1IBMH 1GKHA 2ZXOA 3R93A 4LNQA 2FMCA 2LY7A 2ZM6L 1X3EA 5C44G 2WV6D 3MXUA 4DV1L 1Y1WH 2JJQA 1SNQA 1XTCD 2CKZB 2RQXA 5IGEA 4OWWB 4O1NA 2SDFA 3S16H 1BBWA 1H9KA 4LF5H 2G5DA 1ML0D 2KOLA 5IYDH 5LHY1 4P2CB 5FOBB 3CC7A 4OONA 4OIJA 1Q81C 4BBSG 1JCKB 4IJHA 4GN5A 3FDTA 1CK1A 4C3JG 1RCVD 4DR1L 2Z6KA 3K81C 3J80c 1WOCA 3MXNB 5NUCA 4DN4M 2PT7G 4CKBA 4WJ4A 3EZJA 2ALYB 4LWCA 4B8TA 1AE2A 1ZXTA 4P74A 1ICFB 1SYGA 1AN7A 4G08A 4O42A 1F2MA 1SFOH 3GTGB 1A3TA 4DUYL 1LTTD 4K2KA 3U4ZA 1X3FA 3WOEA 1I4XA 1H95A 1PRTB 5I2YA 3OTOL 3HFZB 4IQZA 3VR3A 4OO1G 3GDEA 4TVAB 1BR9A 3UDIA 5EQ0A 4DV6L 2XRQD 4BA2I 2WKCA 3VR4A 1OXVA 2R92H 1EFID 4IUUA 2E5LL 2JE6I 4PNYA 4DR7H 4A3GB 2UU9L 2EIFA 4L63B 2RDHA 5K36H 5JJLA 2CQAA 1Z6HA 2B2VA 5FO8B 5J39A 2R7ZH 3NBHA 3S1NB 1DGSA 1ICWA 2NN6H 4JI7Q 4DAPA 4JBJA 4GOPC 2AXYA 4P71A 1TWGH 3K7UC 3UI2A 4DR4H 2B63B 1DONA 4DV4Q 3BZCA 3VYUA 1O7ZA 3SK5A 4GNXC 1QVCA 5CYUA 2A8VA 1X55A 2XNAC 1PFBA 4F88A 3Q0AA 1E1TA 1SYCA 4DR5Q 2BA1A 1G6PA 1QZGA 1N36L 4NB3A 1UEBA 3U58A 1S20A 2I5LX 2M9VA 3C1FA 1K0RA 2PNHA 3G71A 3NBHB 3KBGA 4K5VA 2HDLA 1ZYRC 5T1IA 4V0BA 4C3HH 4X65H 5HGQA 1TWCH 4RGNA 1B50A 2LMCB 3A7LA 4DR2Q 3PUVA 3GTLB 2MFIA 3CMAA 1CKNB 4DV2H 3JAML 2HHHQ 1JJGA 3NTIA 4UY8C 2K04A 3L7ZC 2UXBQ 1D1IA 1SEBD 1EL0A 2YQRA 1LM0A 4WFN3 4Z9CB 5DT9A 3KDKA 3SGIA 1Y69U 4JI1L 3BYTB 3DXJC 2Z9HA 1JOKA 2NYZD 4ME5A 4A3KH 1QUQB 4XYOA 2JEAI 4ZQ3A 4E9JA 1BOSA 2V4DA 4JV5H 3NQIA 1STNA 2N3SA 4DK0A 1KAAA 4IURA 5IY0A 3J81W 1WI5A 3EIVA 1XPUA 3HRZC 4OCHA 3ERQA 1X4NA 2DJFC 3R2TA 3ER0A 3PO2B 4P73A 3A56A 1TWFB 2FHTA 2E75C 4UP9A 1Q86C 3HOYG 2ANNA 2C5CA 5LL6S 3BVZA 5C4JH 2B8GA 2L1BA 2F0NA 3CP0A 2QW7A 4JYAH 5IP9G 2CTMA 3QR8A 2R7DA 3I4LA 4I7AA 3E0EA 3RN5A 4GKJH 3ERSX 3NQTA 4MHEA 2D9UA 4L8JA 3T56B 3VA7A 2A19A 2OTJA 2IY5B 1Y1VB 5M5XB 4FF4A 1WCMG 5JJIA 2PMZB 3RMHA 2XVSA 4ZK9B 2E2DC 4LF5Q 1EY7A 1X3PA 4ZUJA 1M90C 3HOUG 2L15A 1KAWA 4RKLA 4IOAA 3JAME 4JI2H 1SYDA 1T9HA 1MGSA 1R9TB 2JK8A 3H3VH 1SNMA 3PO3H 1EY9A 1TS5A 2CW0D 3GQBA 2ZJRA 1MJEA 2KA7A 2LTLA 2KENA 4QF4A 4A3MH 3UOEA 1DM0B 1I3QB 2PI2E 4KJNA 1VQ6A 4JI3H 3S2DB 4BA1I 2Q2HA 2UXDL 3LWEA 4L5RC 1EYAA 1QWYA 3CF5A 2KCMA 3PUZA 4K2LA 4GOPA 1V8CA 3I3CA 2YV5A 1JWUD 2A69C 2KHJA 4J15A 4A3IH 1A2TA 2MP1A 1H9SA 4GNXA 4B3MH 2CWFA 3S14H 3G48A 2P2RA 4A3LH 4NXNH 4YWMA 2EOTA 3M9BA 3P20A 3CCUA 4DR7Q 3K5NA 1HR0H 1VMPA 1XMQQ 3NTKA 1NR2A 3F2CA 4RMFA 1TUAA 1KHIA 3I4OA 3NK9A 3KF8A 2CTJA 4JI0H 5I6WA 1PDQA 4KI0A 4DR4Q 4FXKC 4GOPB 3LGJA 1D8LA 1HA5A 5GAHC 1YNXA 3TEHB 4HCEA 2D0PA 4X3SA 3JAMc 1H9SB 1RODA 4GNXB 1BCPD 5CC4A 1TVXA 2EY1A 2DY8A 5C0XH 1MBYA 1U5KA 2HQLA 1XNRH 4JI6L 1D5ZC 1EY0A 3MC0B 1WTWA 1CQVA 1N34H 2F4VL 1KABA 3AFPA 2ANRA 2L9HA 4X65Q 4FJUA 4NDXA 1WVNA 2CWAA 1O7IA 4HEDA 3KF8B 4DR6Q 1GUWA 1GOZA 2UXCQ 3GTGH 1UE7A 4DV2Q 4DV3L 3M4PA 4OIKA 2JVZA 1QJOA 2QNDA 4LK1C 1GJXA 1SROA 4R8IA 2UUCL 1Q12A 3T51B 5IYBG 2IX1A 2BH8A 3UDFA 3EA6A 1D7QA 2Q2TA 1IYJB 3SDZA 3SHLA 2FJ2A 4LF9H 1X4MA 4JV5Q 4A3GH 4JI8H 1HZBA 4LFCQ 2EPBA 1JE5A 2NTTA 4IPHA 1A62A 2UUAL 1E22A 3MZ5A 2JA7G 3S1NH 1IKMA 1YBYA 4QUCA 3H0GB 2R61A 3HOZB 1G6ZA 4R4IA 1BXTA 4FF1A 4A93G 1SBBB 1EQRA 2B63H 4KKSA 1LABA 2WB1G 1VQ8A 5IGGA 1EWHA 1GUTA 2GN5A 4C3IB 3C2PA 4JYAQ 3URYA 1UAPA 2PY9A 3T1HL 1HH2P 2F0IA 2ENBA 5J3BA 3PQIA 4GKJQ 2MUYA 4K0KH 1ILQA 1JWSD 4NXML 4KY5A 1JQYD 3V2TA 1FKAH 2L5TA 5LMUL 1Q3LA 5DLQE 3UE1A 3GTLH 1SN8A 1PYBA 3HOWB 4LF7H 4JI2Q 4ZUIA 1Q8KA 3TZDA 2JSOA 4JI4H 4B3TH 1EY4A 4JVHA 2XTIA 4JBKA 5DEHA 2IJ0A 2FMRA 1FGBD 3CMEA 4HJ8A 4DR3H 1ZKOA 1VMCA 2SNSA 4HMIA 5H1SE 1X9NA 2M00A 2VNUD 4XDXA 4EQPA 4A3FG 1DYQA 1I94Q 2NZHA 4JI3Q 4J6HA 2EJFC 4BXXH 1HFNA 1ENCA 3BJUA 1J5EH 3I91A 2A6EC 4DK3C 3S16B 4OO1H 1SNCA 4BY7G 1IL8A 4EQOA 1FJGH 3T1YH 1TS4A 1FVIA 3H91A 4CJ1B 1BKBA 1GUGA 4UP8A 1RIPA 4GN4B 4JBMA 3PO2H 3KJOA 4CDEC 1TWFH 1EY8A 3EFXD 4B3MQ 3VDYA 2XN9C 3U1KA 4QGUA 2LTMA 1IW7C 4OL7A 4MTNA 2IW3A 4X3TA 5FLXW 5KYIA 5D3DA 1VQAA 4PMWA 1YNJC 2AUJD 5J22A 3PIPA 3B6YA 5ELOA 2IHEA 3LNNA 1C8CA 2C9OA 4QJFA 4LF6H 4JI0Q 1Y1VH 4PDBA 4JCVE 5M5XH 1KTKA 1NE3A 4XT3B 3OWFA 1LTBD 1VQLA 1G2TA 1N33L 3GTKB 5A2QL 4H44C 4DV0H 5C3EB 4X66H 5M5YB 4HSPA 1R9TH 4IUNA 3GTJB 2ES2A 2Z1CA 2VUMG 1DXMA 5D65A 1BQQT 2Z8LA 1XNRQ 4YY3L 1HXYD 2WINB 3A5UA 3M7GA 2EZVA 1SAPA 1WTXA 1N34Q 3FPUB 1SE4A 4IPCA 1I3QH 2VQFQ 2F3WA 4WORA 3I4NG 2E2JB 1CQFA 4K6LA 3AEVA 3S2DH 5CBEE 4FF2A 3BDLA 4KHVA 3MWYW 4LUZA 3VR6A 1ZZKA 2Q2IA 5C4XG 3DEPA 3J7A5 3S17B 4LFAQ 4X64L 2YYZA 3T13A 3RN2A 3A0JA 1B53A 2I46A 1Q1BA 4ZLTF 2AMCB 4HR7B 4A3JB 1O80A 4A3DB 3BZKA 1HNWH 1LT5D 1V1QA 4RCOA 5ELDA 1J9OA 3NCVA 5JEAJ 4LF8H 4RGOS 2L4NA 4JI8Q 2Z4HA 4WRDA 2K7VA 3RLOA 2PZUA 1G51A 5I9PA 3MEHA 1TS3A 3AEVB 2Y0SE 1SXTA 1VQOA 1OXUA 2OPUA 3FKIB 5IYCG 3MEFA 5EGTA 3TREA 1EC6A 1H9MA 5A2QE 2LSSA 4KHPH 1WTOA 4LF4L 4GKKQ 2F0VA 1SYEA 4NZRM 5I9OA 3BZDB 4A3EG 1VQCA 2XGTA 5E1FA 4N8FA 1PZJD 1EEFD 1FL0A 1WCMH 1VQPA 1QB5D 4A3BB 4DK1A 2ZXRA 1XX8A 1UE6A 2MQHA 1JORA 2CFMA 3PIOA 2OPVA 1YJWA 1IL2A 4AQYL 1VQNA 3NSWA 1D6EC 1UG8A 1DT4A 2I07B 2M8WA 2NB0A 1EU3A 2F4IA 2HIVA 2EY2A 2IPKD 3G6EA 4LFBL 1PLFA 2SNMA 2VS1A 4KKTA 4POFA 4JI4Q 5IT9L 1KNEA 4KJOA 4XXEA 3KUPA 4DR3Q 1N8RC 1YNNC 4A75A 2K5VA 1OXSC 1SLJA 1TU2B 3QOLA 3S2HB 1LT3D 4DV1H 1F2YA 2D62A 2AWNA 3KLSA 3HOXB 4B08A 3I55A 1XRHA 4F87A 3MXPA 2E74C 5IWAL 3HOVG 3AFQA 5IGFA 1TR5A 3D4WA 1C9OA 1FJGQ 4M1UB 2KEEA 5ELBA 1SEIA 1KIXA 3CC4A 3T1YQ 1XMOL 3H0GH 3HOZH 2F03A 3HEJA 1Q82C 4RWSC 2MNAA 2CTFA 1S5FD 4DR1H 4DUZH 3M85A 1TKWB 4OHJA 1NMGA 4ZKCB 3CCQA 3BDCA 1VQ5A 3Q6SA 2HIXA 4G7ZC 4C3IH 4IPDA 1S5ED 4PZ7A 2PO4A 4A76A 5M3MB 4IPGA 3M7NA 3STBC 4DUYH 1L1OC 4IO9A 1G91A 1E0BA 3OTOH 4MIUA 1GUNA 2XIWA 4DF7A 2RA4A 2MO1A 4DV0Q 3T16A 4DV6H 4X66Q 3HOWH 3ULPA 3BS1A 5IT9E 2QDBA 4RCNA 4CJ2C 2E5LH 5FJ8G 4ABNA 1HA6A 1I4HA 1Y8OB 2RCNA 1KC8C 2J4XA 1IYUA 2F0LA 2L55A 1NAPA 4LMQD 3MFGA 1MIUA 2RKSA 4JI7L 5JPMC 1K1GA 1JB7A 1EIGA 1I6UA 4BY1B 2CPMA 4N9PA 2JA6G 2B2TC 2N49A 3GR5A 4DV5H 2BDOA 2JXMB 3J81i 4M8AA 5IYBH 1VQKA 2Y0SG 2RCFA 4J8QA 4RAUC 1A0IA 1B3AA 2RDGA 4DR5L 2CPQA 1IYVA 4QUFA 2HH2A 2F1MA 2B39A 4OX9L 1N36H 4R1JA 3F2DA 4IUPA 1HNWQ 1CFMA 1A2UA 4LF8Q 3K80C 2KJXA 2KQ3A 1S5BD 1WTQA 1BCPF 4DR2L 1AZPA 4QY7A 1II3A 3HP3A 4ZAIA 3RLNA 2EYPA 1SE2A 2JA8B 2UXBL 3EBEA 3QOJA 2FFKB 4I65A 4BBRB 2JA5B 4KHPQ 3GTKH 3HKZB 2G8YA 4QCLA 4GLAC 4CDFC 5IGCA 1J5KA 5C3EH 5M5YH 4CGYB 4DXGA 3GTJH 4YCVA 4XQJA 5IGDA 3IFTA 4LW1A 1GUOA 2M2LA 4F7XA 2CHBD 2OEOA 3H09A 2KCNA 2R93B 2LF0A 4V190 1I4QA 2X6LA 2XWJB 2E2JH 3KLWA 1EQQA 2GVAA 1W6KA 1CKNA 1CM9A 3TQYA 3F8TA 4MNOA 1IZ6A 1CSQA 1JE4A 2WKDA 4ODGA 1WJJA 3VYSA 2KHIA 5C44B 3V05A 3VYRA 1Z47A 3S17H 4F8MA 4CHTB 2EDGA 2IHFA 4YCUA 4DXFA 5LL6X 5FLMH 4A3JH 1QUQA 4A3DH 2BE5D 1UE5A 3I2ZA 2K33A 3L9AX 3KK7A 4A3CH 4BBSB 1I6VC 1XNQQ 4A4IA 4LF5L 3K5LA 1L1OA 3V69A 4C3JB 3MVVA 5J1ZA 1AP0A 1KDBA 2K1BA 2KEDA 4IFDJ 1I4PA 5IP7G 3FKIH 5CMDA 5ELFA 2IX3A 3UDGA 4DUZQ 3GP7A 4DPGA 1X65A 5CV4A 3E0JA 4OGQC 4R4OA 4R9WA 3ITPA 2A68D 2F0KA 1XPRA 1MSZA 1HR0W 1N32Q 4A3BH 1QILA 3CCSA 4DUYQ 2B2UC 1VQ9A 1L1OB 1SR3A 1CZWA 1LT6D 2B2TA 2VB2X 3OTOQ 4B3SQ 1SMXA 3NPPA 1SYBA 4RKBA 1U4RA 4DV6Q 2F3VA 3D6WA 1SNOA 3U4VA 4RHRA 3RUZA 2XRSD 4JI5H 4C2MB 2OQ0A 4JVYA 4IN3A 4DR7L 2K4KA 3FAUA 3G6JB 5CV9A 1XMQL 1TWAB 3C46A 1IBMQ 1KHMA 1GXDC 1EQTA 1AE3A 2K5QA 1F9PA 3TP8A 1G2SA 5CGKA 1NMFA 3S2HH 1JOQA 3HOXH 3PUXA 1HZ9A 1SYFA 5EBDA 5CORA 1GUSA 3I4MG 4DR4L 3MHBA 4DV5Q 2Q8IB 1PHJA 3TS2A 1PRTD 3W1GA 1NSNS 4ZRZA 2WB1E 2K5DA 1V1OA 4IALA 5F2DA 1W3SA 2X06A 4WANA 5TSSA 3TP7A 3EJIA 1N36Q 3CKIB 1LTSD 1T5EA 1Q46A 1OXTA 3K58A 2MJ8A 2L12A 4X65L 2M6QA 1ET6A 3RD4A 3K8AA 3NEMA 5M3MH 4DR6L 1CUKA 2PNRC 4R4QA 2IL8A 2UXCL 4KKUA 4X62H 1FNVA 1EYCA 3H15A 2JQOA 1HZCA 4HIOA 4EQ5A 3S1RH 4B3RL 1RKNA 2UUCH 1TXYA 1ZTGA 4HIDA 1TY0A 2BH2A 3J7YW 2F0WA 5IGBA 1PTOC 3J7AV 1EQVA 1HTLD 1I4RA 4LFCL 4O2DA 1ASYA 3S1QB 2K14A 2P5ZX 2QILA 1VF7A 2UUAH 3GABA 5E7NA 3PSIA 2B2WC 3HOYB 4BY1H 5E4XA 3M4QA 2A6HD 4AM3A 1TY2A 4AYBG 5GAGC 2Q8RE 5KRUA 1M1KC 4HJ9A 3OHXC 4IFDG 1NNXA 4BWGB 1MI2A 3T1HH 2KHSA 1WCMB 2VQEH 5FO7B 5AJ3Q 4GKJL 1D5XC 5KNDA 1HNXL 2CTEA 3HOUB 1OO9B 4NXMH 4P72A 3CHBD 2QCPX 3X3NA 1VQDA 5DM73 3V96A 1KDCA 1UNSA 5M3FG 4JC0A 1TS2A 2EYFA 2O5JC 3S1MB 4JI2L 3KJPA 2EYOA 4DAMA 2JA8H 4LIJA 4H02A 4YHHL 1SMYC 3M3YB 1HQRD 1PTOF 4RGTA 1HNZL 4BBRH 4QB4A 2JA5H 1GM5A 2KECA 2TMPA 1AZQA 1PYWD 1QNKA 1BDOA 1FNUA 4U673 5JJKA 3DWAA 4NW2A 3K59A 1X9ZA 4PZ8A 1I94L 1KXLA 3PMFA 3PIO3 2O4CA 1X3QA 2RBMA 5EPJA 2F0OA 3OOCA 1Y1WG 5LMNH 1F0XA 3ZYYX 5CV8A 1ESFA 1YHAA 2HDMA 2R93H 2Z4IA 1GHJA 2WFWA 3GTPB 5GADC 4PQXA 5FJ8H 5IYDG 1VS0A 1K3RA 2YU9B 4CDCC 1VQHA 2V1CC 3D31A 3J80W 4QIWE 5HY6A 4Q5VA 1PH9A 4B3ML 4JI5Q 2HH3A 5C44H 4CKEA 1C48A 1ESRA 4KN4C 2LXJA 4QMGA 2F0HA 4YWKA 2JA6H 3CCLA 2JEBI 3R2IA 3J81L 4TSSA 4JI0L 4N9TA 1L0WA 1U4PA 5M5WH 4HJ7A 1F9SA 4LUOA 4BBSH 2LFNA 1N33H 3RZDB 5D3IB 4C3JH 2O2LD 1XWEA 1LLRD 4NMZA 2WP8J 2K05A 4DNTB 1CHPD 2FMMA 3D8GA 1VF5C 1MSGA 2KUMA 4DV7L 4KN7C 3TP5A 1S40A 3PUWA 3AQQA 1IBLH 1FYCA 3ND8A 4KY7A 4OELB 2I0QA 4K5XA 4DNIA 3OIPA 1KRSA 2OQKA 1N34L 2R92G 4FYDA 2VQFL 1C4QA 1Z2IA 2K75A 4FF3A 2F0TA 1M4VA 3PF5A 5K36G 3DUZA 3A7AB 1K8MA 2IT1A 1KQSA 2R7ZG 2UUBH 2VXWA 3K57A 3IL8A 1STYA 4X62Q 1STBA 2NWGA 1K73C 4LFAL 4X64H 2AKWB 4LUVA 5T1GA 5JPNC 3R3OA 2F0GA 5FO9B 4EC5A 2A74C 1XTDA 5HURA 4IUVA 2CTLA 4ZYSA 4OXPA 3MFYA 2K01A 2PI2A 4B9XA 3K5OA 2JA7B 3CQZB 3L3OC 3ONAB 1PTOB 4C2MH 4NXNQ 2VZAA 2F0FA 4EVOA 4JI8L 1HR0Q 1TWAH 4A93B 2PCFB 3P7JA 4C1NI 1ZYRD 1HJPA 2WB1B 1YIJA 1U4LA 1SE3A 4IZ8A 4CJ0B 4H13C 3KDFA 3I56A 4LF4H 1KL9A 4GKKL 2MJHA 2B29A 4L6TB 3JAMi 2FINB 1D2BA 3JC66 2N78A 4B8CD 2ZTDA 1SE8A 3K0XA 5C0XJ 2BCOA 5C3WA 1LV9A 5COYA 2L0CA 5HGTA 4P75A 5ELCA 1AFPA 5BR8H 2AQ2B 2VQEQ 4JOIC 1ENFA 1PH1A 1JR0D 2CWHA 4A3KG 4NXMQ 5GQOA 2D5DA 1PFSA 1Q7YC 2N88A 1R4PB 4YCWA 1QE6A 5A35A 2F52A 5IIFA 3K7AB 2XWBB 2HCIA 2K5HA 1B4OA 1P16A 2AQ1B 2OF1A 1PFNA 3OETA 3KDFB 4JI4L 3DMUA 2K03A 4FNFA 3HS0C 2QF7A 4DKAC 2AHOB 4OEMB 4A3FB 2NVYB 1DJRD 1E2WA 2K5WA 4DR3L 5G3LD 4HN7A 1K8GA 1Z7TA 5CR3A 4BY7B 4NKLA 3G4SA 5M9OA 2OTLA 1D5MC 4LF9Q 4X6AH 2G9DA 5IWAH 4UAIA 1EYGA 1LTGD 2I5HA
chains in the Genus database with same CATH topology
4UP9A 5IYBH 3S1QH 2A1AA 5LMNQ 1Q86C 3HOYG 1HR0L 1VQKA 5C4JH 2UXDL 1FJGL 2ANNA 2Y0SG 2CCZA 1EUJA 2N8NA 3CP0A 5IP9G 1X54A 1A0IA 2CTMA 1WFQA 2R7DA 2ZTCA 3E0EA 4DR5L 3RN5A 2K5NA 2CPQA 2HH2A 3CPFA 1E1OA 3ERSX 3HOYH 4OX9L 1E7ZA 2F3IA 4R1JA 2OTJA 2A19A 2IY5B 1DTJA 1PYSB 2PQAA 1EFWA 5IP9H 3F2DA 1HZAA 5GAEC 1HNWQ 2VY3A 1WCMG 4EX5A 5JJIA 1X6OA 4LF5Q 4LF8Q 4OO1I 3K80C 1M90C 3HOUG 2L15A 3PO3G 1KAWA 3E9HA 3CCVA 1BBUA 4IOAA 4DR2L 2E2HH 4QY7A 1T9HA 2ATWA 5ELNA 2PQUA 2JK8A 4A3MG 3H3VH 1BVSA 1TWHH 2VQEL 3CW2C 3RLNA 1XNRL 1J6QA 3HOUH 5C3EG 2ZJRA 4JI6Q 1MJEA 3PO3H 1HNXQ 4K0KQ 3CPWA 2UXBL 3EBEA 2KENA 3IRBA 1GD7A 2F4VQ 4A3MH 1X3GA 3CC2A 3KYHC 3GTKH 3GTMH 4KHPQ 2CTKA 1YEZA 1N33Q 4GLAC 1J5KA 5C3EH 1IBKL 5M5YH 2PI2E 1VQ6A 4X66L 3S1MH 1Y1WH 2PQAB 4IOCA 4LF7Q 1K9MC 3GTJH 4YCVA 3S15H 1FGUA 4BA1I 2Q2HA 2QEXA 2NN6G 1YHQA 2Q2UA 4LW1A 4DV3Q 4B3TQ 1PV4A 4L5RC 4A3IG 3M3YH 1E24A 3CF5A 4R4TA 4YHHQ 4IFDI 1JJ2A 2JZXA 2KCMA 3PUZA 4GOPA 1HNZQ 1IBLQ 1PH2A 2YV5A 1K83H 2UUCQ 2WAQG 4A3LG 2FXQA 2KHJA 4J15A 2E2JH 3KLWA 4A3IH 1EQQA 3A74A 2WAQE 4L5QA 2GVAA 4GNXA 1CKNA 3S14H 3I7FA 1B70B 3F8TA 3G48A 1IZ6A 1CSQA 4MNOA 3TQYA 1J5EQ 2UUBQ 4LF9L 4A3LH 2P2RA 1WJJA 2K50A 2KHIA 3M9BA 4YWMA 3CCUA 3RNUA 5LMNL 4DR7Q 1Z47A 5FLMG 4A3JG 1YJ9A 1XMQQ 1Q1EA 3GTGH 3Q8DA 3S17H 4A3DG 2QA4A 3OYYA 1CKMA 3F2CA 4RMFA 2UUAQ 1TUAA 4A3CG 3GTPH 1OTCA 2E2IH 2IHFA 2YU9H 1KHIA 3I4OA 4YCUA 5FLMH 4A3JH 2CTJA 1QUQA 4A3DH 1VIGA 1UE5A 3I2ZA 4KI0A 4DR4Q 4GOPB 1HNWL 2JA9A 3LGJA 1PH4A 4A3CH 1A63A 1D8LA 3FKIG 4L5TA 4A4IA 5GAHC 5C0XG 1YNXA 3TEHB 4LF5L 4LF8L 1L1OA 4NBQA 2C35B 3V69A 2D0PA 4QMFB 3JAMc 1LTLA 4GNXB 3T1HQ 4IFDJ 1VQBA 5IP7G 3GD7A 3FKIH 1V9PA 4XTCS 4LF6Q 1U5KA 2HQLA 3UDGA 4JI6L 4K0KL 2PMZE 4DUZQ 3PF4A 4DPGA 1X65A 5IP7H 2F4VL 3E9IA 2B3GA 4R4OA 4KHPL 3AFPA 3RZDH 2ANRA 1XPRA 4A3BG 4X65Q 1C0AA 5LMUQ 4MZ9A 2Z0SA 4ALPA 2CWAA 1WVNA 1O7IA 3ZJYC 3KF8B 4DR6Q 1GO3E 2RHSB 4LF7L 1HR0W 1ZZIA 1N32Q 2UXCQ 1XPOA 1NTGA 1UE7A 1VQGA 2EXDA 4DV2Q 1PH8A 5BR8Q 1Y14B 4B3TL 1RL2A 1YZ6A 3CCSA 4DV3L 4DV7Q 2ASBA 3M4PA 4DUYQ 2JVZA 1VQ9A 4JBWA 1L1OB 3HKZE 4OWXB 1GVPA 1SR3A 2QNDA 4POGA 1IBLL 2RHQB 3OTOQ 1SROA 1EIYB 4B3SQ 1VQFA 2UUCL 1Q12A 3U50C 5IYBG 1SMXA 2IX1A 4A3GG 2BH8A 4GLXA 3UDFA 1XJVA 3KFUA 2ID0A 3FHWA 3PUYA 3UDXA 1C7YA 1D7QA 4DV6Q 3S24A 5JEAG 2GVBA 2Q2TA 1IYJB 3U4VA 3CCEA 4RG1A 1I5FA 1VQMA 2K52A 1J5EL 2UUBL 4JV5Q 4DV4L 1X4MA 4A3GH 2OQ0A 4JVYA 1HZBA 3CCMA 2DGRA 3HOXG 4LFCQ 4DR7L 2K4KA 3J81c 1XMQL 1G291 1JE5A 4IPHA 1PH5A 1IBMQ 1KHMA 1A62A 4R4CA 1E22A 3T1YL 2UUAL 2JA7G 3S1NH 1AE3A 1YBYA 1OXXK 2BA0A 3DLLA 2B63G 1NMFA 3S2HH 4GN3B 3HOXH 4R4IA 2LXKA 3PUXA 4A93G 1HZ9A 1VQ4A 5GROA 3I4MG 2JA7H 4DR4L 1EQRA 2I5MX 3CQZH 4DV5Q 2B63H 1PHJA 3TS2A 5IWAQ 2BL5A 2RF4A 2WB1G 1EYGA 1XNQL 1VQ8A 3W1GA 3PV0A 2GN5A 4A93H 5EAYA 1VQIA 2WB1E 4JYAQ 3I4MH 2PY9A 3T1HL 1HH2P 1XMOQ 2HHHL 1W3SA 5J3BA 1W2BA 1PH7A 4LF6L 4GKJQ 4WANA 2NN6I 1N36Q 3CXCA 1VQ7A 2KBNA 4DUZL 1PH3A 2OWOA 1Q46A 5M3MG 4WJ3M 1ZZJA 4NXML 3TS0A 2CQOA 1OXTA 1NY4A 4HJAA 4X65L 4DV0L 4IJLA 1YHBA 2Z6KC 5LMUL 5IT9c 1IXRA 5DLQE 1L2FA 2E8GA 1SN8A 1PYBA 3K8AA 3NEMA 1CUKA 3UE1A 5M3MH 4JI2Q 3GTLH 4R4QA 1B7YB 3F2BA 1N32L 2UXCL 1Q8KA 2VW9A 3UE0A 3ICEA 3H15A 5BR8L 4JVHA 2JQOA 1HZCA 2XTIA 4JBKA 3FP9A 1U0LA 4HIOA 4EQ5A 4YY3Q 2FMRA 3CMEA 3S1RH 4B3RL 1NBWA 4HJ8A 4BXXG 1UWVA 3HKSA 4NPSA 4B3SL 5H1SE 3L2PA 1TXYA 1X9NA 2VNUD 1ZTGA 4HJ5A 3OW2A 4UPAA 4HIDA 3CCRA 3K7AH 4A3FG 1EIFA 1I94Q 2NZHA 4JI3Q 2BH2A 3CCJA 4BXXH 1YVCA 3BJUA 2ZJPA 4GS3A 4DK3C 4GLVB 4PG3A 4LFCL 4O2DA 1ASYA 4BY7G 4BY1G 4A3FH 2NVYH 2VL6A 2K14A 4L5SA 1IBML 3PO2G 4KHZA 4X64Q 2YTVA 3ULLA 3VKEA 4HIMA 1FVIA 5E7NA 2ZM6Q 1E3PA 1BKBA 4DV1Q 3PSIA 4UP8A 4BY7H 1X56A 1QVGA 1RIPA 4BY1H 2HT1A 3M4QA 4GN4B 4JBMA 3PO2H 1QZHA 4AM3A 3KJOA 4B3MQ 1TWFH 1V43A 4AYBG 1NJIC 3VDYA 5GAGC 2R6GA 4DV5L 3RZOH 3U1KA 4FDBA 4QGUA 1EOVA 1WYDA 3J7ZC 1LYLA 4JOIA 4ME3A 4MTNA 4AYBE 4HJ9A 1M1KC 3TRZA 1YI2A 4IFDG 1I6HH 1JJCB 1Y1VG 1VQAA 4PMWA 4Y7NH 3PIPA 2IX0A 3AYHB 4QQBX 1P8LA 3B6YA 5ELOA 2IHEA 3WWVA 4QJFA 4YWLA 5AJ3Q 4GKJL 2CTEA 1HNXL 4DR1Q 4OX9Q 1N9WA 4JI0Q 1Y1VH 2NVTH 1UE1A 4JCVE 5M5XH 1NE3A 3RLFA 4P72A 3W5OA 1VQLA 1PVOA 3PCOB 4LF4Q 1VQDA 2ZJQA 1N33L 4TQUS 5M3FG 1QVFA 3CAMA 2JA8G 3KOJA 1CKOA 4JC0A 5FLXc 3D0FA 3F1ZA 4BBRG 2JA5G 1R9TH 3KJPA 4JI2L 2ES2A 3HKZG 2NZOA 4DAMA 1KD1C 4Y52H 4OWTB 2VUMG 5M3FH 1LUZA 1ASZA 2JA8H 4LIJA 2YTXA 4H02A 1XNRQ 4YHHL 4YY3L 1MKHA 1HNZL 4BBRH 3A5UA 2JA5H 4AIMA 1N34Q 4DK6C 1GM5A 2R7FA 4IPCA 2VUMH 1I3QH 1CSPA 5IE8A 2VQFQ 4AQYQ 1PH6A 1XNQQ 3I4NG 5JJKA 1IBKQ 4PZ8A 1I94L 3PGZA 1KXLA 2EQSA 3S2DH 3AEVA 2R93G 4XIGS 4LFBQ 2E5LQ 1ZZKA 4LUZA 1JMCA 3H3VI 2Q2IA 1Y1WG 3I4NH 1VCIA 2UU9Q 3GO5A 1YITA 5C4XG 4JG2A 3GTQH 3J7A5 1AH9A 4LFAQ 1YHAA 4X64L 2R93H 1GKHA 2YYZA 4LNQA 3RN2A 3A0JA 1X3EA 2ZM6L 5C44G 3CD6A 1Q1BA 2WFWA 4DV1L 2AMCB 5FJ8H 2JJQA 5IYDG 5GADC 1VS0A 1K3RA 5C4XH 2NVXH 1VQHA 2V1CC 3D31A 2CKZB 4QIWE 5HY6A 3W1BA 3BZKA 1PH9A 4B3ML 4OWWB 1YJNA 4JI5Q 1V1QA 1VQEA 3S16H 1BBWA 4AH6A 5C44H 2HH3A 5JEAJ 4JI8Q 5IYDH 2LXJA 3RLOA 1Z9FA 3A5ZB 4QL5A 1G51A 4PZ6A 4YWKA 3J81j 3CC7A 4OONA 2JA6H 1Q81C 1S3OA 3CCLA 4BBSG 2AWOA 2JEBI 3AEVB 4IJHA 2Y0SE 4GN5A 3J80i 1J4WA 1VQOA 1OXUA 2OPUA 5IYCG 4KLKA 3MEFA 5AJ3L 4DR1L 2Z6KA 3K81C 4APVA 3J80c 1WOCA 3TREA 4JI0L 1EC6A 1L0WA 3MXNB 5M5WH 2LSSA 4HJ7A 4BBSH 4LUOA 3KF6A 4LF4L 4GKKQ 4WJ4A 5IYCH 4C3JH 2ALYB 4LWCA 4UP7A 4B8TA 1AE2A 4A3EG 1VQCA 2XGTA 4P74A 2WP8J 1VIHA 5LMNW 2E3UA 1FL0A 4DV2L 1WCMH 1I50H 1VQPA 1SFOH 4DV7L 4DUYL 1S40A 3U4ZA 1X3FA 3PUWA 3AQQA 1UE6A 2MQHA 4A3EH 1H95A 1KRTA 2CFMA 2NVQH 2ZTEA 3PIOA 2I0QA 3OTOL 2MO0A 2DGYA 4DNIA 2OPVA 1KRSA 2OQKA 1YJWA 3HFZB 1N34L 1IL2A 2R92G 4OO1G 3BU2A 3GDEA 2VQFL 4AQYL 1VQNA 1PA6A 2K75A 4TVAB 3UDIA 1DT4A 4JI1Q 4DV6L 3PF5A 4BA2I 5K36G 2HIVA 2IT1A 1KQSA 3EN2A 2R92H 1OXVA 3G6EA 2R7ZG 4JV5L 4LFBL 4X62Q 2E5LL 2JE6I 1MJCA 2VS1A 3KF6B 4POFA 4JI4Q 5C0XI 2UU9L 2EIFA 1B8AA 1K73C 5JJLA 3GTOH 4LFAL 2AKWB 4LUVA 4DR3Q 1N8RC 2R7ZH 1DGSA 4A75A 2YTYA 2K5VA 1OXSC 1SLJA 1XTDA 2D62A 4JI7Q 2AWNA 2CTLA 4JBJA 3I55A 4OXPA 4GOPC 2CWPA 3M4OH 4P71A 1TWGH 3K7UC 2AXYA 3ULJA 2OCEA 2PI2A 3RR5A 5IWAL 3H0GG 4C2MH 4JI5L 4NXNQ 3HOVG 1SRUA 2VZAA 3AFQA 3HOZG 4DV4Q 3BZCA 4JI8L 1HR0Q 1C9OA 1TWAH 4DAYB 4GNXC 1FJGQ 1QVCA 4JYAL 1KIXA 1X55A 3CC4A 2A8VA 3DM3A 1E1TA 3T1YQ 3H0GH 1XMOL 3HOVH 4DR5Q 2BA1A 3HOZH 1HJPA 1G6PA 1Q82C 1QZGA 2MNAA 1YIJA 1N36L 2CTFA 4NB3A 1UEBA 3L0OA 3M85A 3U58A 2I5LX 1K0RA 2PNHA 1NMGA 3G71A 3CCQA 3STBD 3KDFA 3NBHB 3I56A 1KL9A 4GKKL 2MJHA 2B29A 4O0AA 4C3HH 1VQ5A 2HIXA 3JAMi 5HGQA 1TWCH 4C3IH 3NELA 3JC66 2N78A 4IPDA 2ZTDA 4PZ7A 1SE8A 3K0XA 5C0XJ 4DR2Q 3PUVA 4A76A 2MFIA 4IPGA 3M7NA 4WALA 3CMAA 1CKNB 1A8VA 4P75A 3STBC 2VQEQ 2HHHQ 4JOIC 1JJGA 1L1OC 2QGQA 4UY8C 4IO9A 3L7ZC 2UXBQ 1PH1A 3HOWG 1VQJA 4A3KG 4NXMQ 5GQOA 2YQRA 1PFSA 1Q7YC 1LM0A 4YCWA 1K8AC 2MO1A 2F52A 3SGIA 4HIKA 4DV0Q 4JI1L 4JI3L 4X66Q 3HOWH 3ULPA 2JEAI 4A3KH 1QUQB 2K5HA 1P16A 4X62L 2N3SA 2UXDQ 3KDFB 4JI4L 1JT8A 2DUDA 5FJ8G 4DR6L 5IY0A 4DKAC 2RCNA 2AHOB 1KC8C 4A3BH 1WI5A 4B3RQ 4DR3L 1WE8A 3EIVA 2H5XA 1XPUA 1K8GA 1MIUA 2KCTA 4JI7L 1X4NA 1K1GA 1JB7A 1EWIA 2D0OA 3G4SA 3ER0A 1S72A 2OTLA 2JA6G 2N49A 4P73A 4LF9Q 4X6AH 4NXNL 3J81i 2I5HA 3NENA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UP9 A;  5IYB H;  3S1Q H;  2A1A A;  5LMN Q;  1Q86 C;  3HOY G;  1HR0 L;  1VQK A;  5C4J H;  2UXD L;  1FJG L;  2ANN A;  2Y0S G;  2CCZ A;  1EUJ A;  2N8N A;  3CP0 A;  5IP9 G;  1X54 A;  1A0I A;  2CTM A;  1WFQ A;  2R7D A;  2ZTC A;  3E0E A;  4DR5 L;  3RN5 A;  2K5N A;  2CPQ A;  2HH2 A;  3CPF A;  1E1O A;  3ERS X;  3HOY H;  4OX9 L;  1E7Z A;  2F3I A;  4R1J A;  2OTJ A;  2A19 A;  2IY5 B;  1DTJ A;  1PYS B;  2PQA A;  1EFW A;  5IP9 H;  3F2D A;  1HZA A;  5GAE C;  1HNW Q;  2VY3 A;  1WCM G;  4EX5 A;  5JJI A;  1X6O A;  4LF5 Q;  4LF8 Q;  4OO1 I;  3K80 C;  1M90 C;  3HOU G;  2L15 A;  3PO3 G;  1KAW A;  3E9H A;  3CCV A;  1BBU A;  4IOA A;  4DR2 L;  2E2H H;  4QY7 A;  1T9H A;  2ATW A;  5ELN A;  2PQU A;  2JK8 A;  4A3M G;  3H3V H;  1BVS A;  1TWH H;  2VQE L;  3CW2 C;  3RLN A;  1XNR L;  1J6Q A;  3HOU H;  5C3E G;  2ZJR A;  4JI6 Q;  1MJE A;  3PO3 H;  1HNX Q;  4K0K Q;  3CPW A;  2UXB L;  3EBE A;  2KEN A;  3IRB A;  1GD7 A;  2F4V Q;  4A3M H;  1X3G A;  3CC2 A;  3KYH C;  3GTK H;  3GTM H;  4KHP Q;  2CTK A;  1YEZ A;  1N33 Q;  4GLA C;  1J5K A;  5C3E H;  1IBK L;  5M5Y H;  2PI2 E;  1VQ6 A;  4X66 L;  3S1M H;  1Y1W H;  2PQA B;  4IOC A;  4LF7 Q;  1K9M C;  3GTJ H;  4YCV A;  3S15 H;  1FGU A;  4BA1 I;  2Q2H A;  2QEX A;  2NN6 G;  1YHQ A;  2Q2U A;  4LW1 A;  4DV3 Q;  4B3T Q;  1PV4 A;  4L5R C;  4A3I G;  3M3Y H;  1E24 A;  3CF5 A;  4R4T A;  4YHH Q;  4IFD I;  1JJ2 A;  2JZX A;  2KCM A;  3PUZ A;  4GOP A;  1HNZ Q;  1IBL Q;  1PH2 A;  2YV5 A;  1K83 H;  2UUC Q;  2WAQ G;  4A3L G;  2FXQ A;  2KHJ A;  4J15 A;  2E2J H;  3KLW A;  4A3I H;  1EQQ A;  3A74 A;  2WAQ E;  4L5Q A;  2GVA A;  4GNX A;  1CKN A;  3S14 H;  3I7F A;  1B70 B;  3F8T A;  3G48 A;  1IZ6 A;  1CSQ A;  4MNO A;  3TQY A;  1J5E Q;  2UUB Q;  4LF9 L;  4A3L H;  2P2R A;  1WJJ A;  2K50 A;  2KHI A;  3M9B A;  4YWM A;  3CCU A;  3RNU A;  5LMN L;  4DR7 Q;  1Z47 A;  5FLM G;  4A3J G;  1YJ9 A;  1XMQ Q;  1Q1E A;  3GTG H;  3Q8D A;  3S17 H;  4A3D G;  2QA4 A;  3OYY A;  1CKM A;  3F2C A;  4RMF A;  2UUA Q;  1TUA A;  4A3C G;  3GTP H;  1OTC A;  2E2I H;  2IHF A;  2YU9 H;  1KHI A;  3I4O A;  4YCU A;  5FLM H;  4A3J H;  2CTJ A;  1QUQ A;  4A3D H;  1VIG A;  1UE5 A;  3I2Z A;  4KI0 A;  4DR4 Q;  4GOP B;  1HNW L;  2JA9 A;  3LGJ A;  1PH4 A;  4A3C H;  1A63 A;  1D8L A;  3FKI G;  4L5T A;  4A4I A;  5GAH C;  5C0X G;  1YNX A;  3TEH B;  4LF5 L;  4LF8 L;  1L1O A;  4NBQ A;  2C35 B;  3V69 A;  2D0P A;  4QMF B;  3JAM c;  1LTL A;  4GNX B;  3T1H Q;  4IFD J;  1VQB A;  5IP7 G;  3GD7 A;  3FKI H;  1V9P A;  4XTC S;  4LF6 Q;  1U5K A;  2HQL A;  3UDG A;  4JI6 L;  4K0K L;  2PMZ E;  4DUZ Q;  3PF4 A;  4DPG A;  1X65 A;  5IP7 H;  2F4V L;  3E9I A;  2B3G A;  4R4O A;  4KHP L;  3AFP A;  3RZD H;  2ANR A;  1XPR A;  4A3B G;  4X65 Q;  1C0A A;  5LMU Q;  4MZ9 A;  2Z0S A;  4ALP A;  2CWA A;  1WVN A;  1O7I A;  3ZJY C;  3KF8 B;  4DR6 Q;  1GO3 E;  2RHS B;  4LF7 L;  1HR0 W;  1ZZI A;  1N32 Q;  2UXC Q;  1XPO A;  1NTG A;  1UE7 A;  1VQG A;  2EXD A;  4DV2 Q;  1PH8 A;  5BR8 Q;  1Y14 B;  4B3T L;  1RL2 A;  1YZ6 A;  3CCS A;  4DV3 L;  4DV7 Q;  2ASB A;  3M4P A;  4DUY Q;  2JVZ A;  1VQ9 A;  4JBW A;  1L1O B;  3HKZ E;  4OWX B;  1GVP A;  1SR3 A;  2QND A;  4POG A;  1IBL L;  2RHQ B;  3OTO Q;  1SRO A;  1EIY B;  4B3S Q;  1VQF A;  2UUC L;  1Q12 A;  3U50 C;  5IYB G;  1SMX A;  2IX1 A;  4A3G G;  2BH8 A;  4GLX A;  3UDF A;  1XJV A;  3KFU A;  2ID0 A;  3FHW A;  3PUY A;  3UDX A;  1C7Y A;  1D7Q A;  4DV6 Q;  3S24 A;  5JEA G;  2GVB A;  2Q2T A;  1IYJ B;  3U4V A;  3CCE A;  4RG1 A;  1I5F A;  1VQM A;  2K52 A;  1J5E L;  2UUB L;  4JV5 Q;  4DV4 L;  1X4M A;  4A3G H;  2OQ0 A;  4JVY A;  1HZB A;  3CCM A;  2DGR A;  3HOX G;  4LFC Q;  4DR7 L;  2K4K A;  3J81 c;  1XMQ L;  1G29 1;  1JE5 A;  4IPH A;  1PH5 A;  1IBM Q;  1KHM A;  1A62 A;  4R4C A;  1E22 A;  3T1Y L;  2UUA L;  2JA7 G;  3S1N H;  1AE3 A;  1YBY A;  1OXX K;  2BA0 A;  3DLL A;  2B63 G;  1NMF A;  3S2H H;  4GN3 B;  3HOX H;  4R4I A;  2LXK A;  3PUX A;  4A93 G;  1HZ9 A;  1VQ4 A;  5GRO A;  3I4M G;  2JA7 H;  4DR4 L;  1EQR A;  2I5M X;  3CQZ H;  4DV5 Q;  2B63 H;  1PHJ A;  3TS2 A;  5IWA Q;  2BL5 A;  2RF4 A;  2WB1 G;  1EYG A;  1XNQ L;  1VQ8 A;  3W1G A;  3PV0 A;  2GN5 A;  4A93 H;  5EAY A;  1VQI A;  2WB1 E;  4JYA Q;  3I4M H;  2PY9 A;  3T1H L;  1HH2 P;  1XMO Q;  2HHH L;  1W3S A;  5J3B A;  1W2B A;  1PH7 A;  4LF6 L;  4GKJ Q;  4WAN A;  2NN6 I;  1N36 Q;  3CXC A;  1VQ7 A;  2KBN A;  4DUZ L;  1PH3 A;  2OWO A;  1Q46 A;  5M3M G;  4WJ3 M;  1ZZJ A;  4NXM L;  3TS0 A;  2CQO A;  1OXT A;  1NY4 A;  4HJA A;  4X65 L;  4DV0 L;  4IJL A;  1YHB A;  2Z6K C;  5LMU L;  5IT9 c;  1IXR A;  5DLQ E;  1L2F A;  2E8G A;  1SN8 A;  1PYB A;  3K8A A;  3NEM A;  1CUK A;  3UE1 A;  5M3M H;  4JI2 Q;  3GTL H;  4R4Q A;  1B7Y B;  3F2B A;  1N32 L;  2UXC L;  1Q8K A;  2VW9 A;  3UE0 A;  3ICE A;  3H15 A;  5BR8 L;  4JVH A;  2JQO A;  1HZC A;  2XTI A;  4JBK A;  3FP9 A;  1U0L A;  4HIO A;  4EQ5 A;  4YY3 Q;  2FMR A;  3CME A;  3S1R H;  4B3R L;  1NBW A;  4HJ8 A;  4BXX G;  1UWV A;  3HKS A;  4NPS A;  4B3S L;  5H1S E;  3L2P A;  1TXY A;  1X9N A;  2VNU D;  1ZTG A;  4HJ5 A;  3OW2 A;  4UPA A;  4HID A;  3CCR A;  3K7A H;  4A3F G;  1EIF A;  1I94 Q;  2NZH A;  4JI3 Q;  2BH2 A;  3CCJ A;  4BXX H;  1YVC A;  3BJU A;  2ZJP A;  4GS3 A;  4DK3 C;  4GLV B;  4PG3 A;  4LFC L;  4O2D A;  1ASY A;  4BY7 G;  4BY1 G;  4A3F H;  2NVY H;  2VL6 A;  2K14 A;  4L5S A;  1IBM L;  3PO2 G;  4KHZ A;  4X64 Q;  2YTV A;  3ULL A;  3VKE A;  4HIM A;  1FVI A;  5E7N A;  2ZM6 Q;  1E3P A;  1BKB A;  4DV1 Q;  3PSI A;  4UP8 A;  4BY7 H;  1X56 A;  1QVG A;  1RIP A;  4BY1 H;  2HT1 A;  3M4Q A;  4GN4 B;  4JBM A;  3PO2 H;  1QZH A;  4AM3 A;  3KJO A;  4B3M Q;  1TWF H;  1V43 A;  4AYB G;  1NJI C;  3VDY A;  5GAG C;  2R6G A;  4DV5 L;  3RZO H;  3U1K A;  4FDB A;  4QGU A;  1EOV A;  1WYD A;  3J7Z C;  1LYL A;  4JOI A;  4ME3 A;  4MTN A;  4AYB E;  4HJ9 A;  1M1K C;  3TRZ A;  1YI2 A;  4IFD G;  1I6H H;  1JJC B;  1Y1V G;  1VQA A;  4PMW A;  4Y7N H;  3PIP A;  2IX0 A;  3AYH B;  4QQB X;  1P8L A;  3B6Y A;  5ELO A;  2IHE A;  3WWV A;  4QJF A;  4YWL A;  5AJ3 Q;  4GKJ L;  2CTE A;  1HNX L;  4DR1 Q;  4OX9 Q;  1N9W A;  4JI0 Q;  1Y1V H;  2NVT H;  1UE1 A;  4JCV E;  5M5X H;  1NE3 A;  3RLF A;  4P72 A;  3W5O A;  1VQL A;  1PVO A;  3PCO B;  4LF4 Q;  1VQD A;  2ZJQ A;  1N33 L;  4TQU S;  5M3F G;  1QVF A;  3CAM A;  2JA8 G;  3KOJ A;  1CKO A;  4JC0 A;  5FLX c;  3D0F A;  3F1Z A;  4BBR G;  2JA5 G;  1R9T H;  3KJP A;  4JI2 L;  2ES2 A;  3HKZ G;  2NZO A;  4DAM A;  1KD1 C;  4Y52 H;  4OWT B;  2VUM G;  5M3F H;  1LUZ A;  1ASZ A;  2JA8 H;  4LIJ A;  2YTX A;  4H02 A;  1XNR Q;  4YHH L;  4YY3 L;  1MKH A;  1HNZ L;  4BBR H;  3A5U A;  2JA5 H;  4AIM A;  1N34 Q;  4DK6 C;  1GM5 A;  2R7F A;  4IPC A;  2VUM H;  1I3Q H;  1CSP A;  5IE8 A;  2VQF Q;  4AQY Q;  1PH6 A;  1XNQ Q;  3I4N G;  5JJK A;  1IBK Q;  4PZ8 A;  1I94 L;  3PGZ A;  1KXL A;  2EQS A;  3S2D H;  3AEV A;  2R93 G;  4XIG S;  4LFB Q;  2E5L Q;  1ZZK A;  4LUZ A;  1JMC A;  3H3V I;  2Q2I A;  1Y1W G;  3I4N H;  1VCI A;  2UU9 Q;  3GO5 A;  1YIT A;  5C4X G;  4JG2 A;  3GTQ H;  3J7A 5;  1AH9 A;  4LFA Q;  1YHA A;  4X64 L;  2R93 H;  1GKH A;  2YYZ A;  4LNQ A;  3RN2 A;  3A0J A;  1X3E A;  2ZM6 L;  5C44 G;  3CD6 A;  1Q1B A;  2WFW A;  4DV1 L;  2AMC B;  5FJ8 H;  2JJQ A;  5IYD G;  5GAD C;  1VS0 A;  1K3R A;  5C4X H;  2NVX H;  1VQH A;  2V1C C;  3D31 A;  2CKZ B;  4QIW E;  5HY6 A;  3W1B A;  3BZK A;  1PH9 A;  4B3M L;  4OWW B;  1YJN A;  4JI5 Q;  1V1Q A;  1VQE A;  3S16 H;  1BBW A;  4AH6 A;  5C44 H;  2HH3 A;  5JEA J;  4JI8 Q;  5IYD H;  2LXJ A;  3RLO A;  1Z9F A;  3A5Z B;  4QL5 A;  1G51 A;  4PZ6 A;  4YWK A;  3J81 j;  3CC7 A;  4OON A;  2JA6 H;  1Q81 C;  1S3O A;  3CCL A;  4BBS G;  2AWO A;  2JEB I;  3AEV B;  4IJH A;  2Y0S E;  4GN5 A;  3J80 i;  1J4W A;  1VQO A;  1OXU A;  2OPU A;  5IYC G;  4KLK A;  3MEF A;  5AJ3 L;  4DR1 L;  2Z6K A;  3K81 C;  4APV A;  3J80 c;  1WOC A;  3TRE A;  4JI0 L;  1EC6 A;  1L0W A;  3MXN B;  5M5W H;  2LSS A;  4HJ7 A;  4BBS H;  4LUO A;  3KF6 A;  4LF4 L;  4GKK Q;  4WJ4 A;  5IYC H;  4C3J H;  2ALY B;  4LWC A;  4UP7 A;  4B8T A;  1AE2 A;  4A3E G;  1VQC A;  2XGT A;  4P74 A;  2WP8 J;  1VIH A;  5LMN W;  2E3U A;  1FL0 A;  4DV2 L;  1WCM H;  1I50 H;  1VQP A;  1SFO H;  4DV7 L;  4DUY L;  1S40 A;  3U4Z A;  1X3F A;  3PUW A;  3AQQ A;  1UE6 A;  2MQH A;  4A3E H;  1H95 A;  1KRT A;  2CFM A;  2NVQ H;  2ZTE A;  3PIO A;  2I0Q A;  3OTO L;  2MO0 A;  2DGY A;  4DNI A;  2OPV A;  1KRS A;  2OQK A;  1YJW A;  3HFZ B;  1N34 L;  1IL2 A;  2R92 G;  4OO1 G;  3BU2 A;  3GDE A;  2VQF L;  4AQY L;  1VQN A;  1PA6 A;  2K75 A;  4TVA B;  3UDI A;  1DT4 A;  4JI1 Q;  4DV6 L;  3PF5 A;  4BA2 I;  5K36 G;  2HIV A;  2IT1 A;  1KQS A;  3EN2 A;  2R92 H;  1OXV A;  3G6E A;  2R7Z G;  4JV5 L;  4LFB L;  4X62 Q;  2E5L L;  2JE6 I;  1MJC A;  2VS1 A;  3KF6 B;  4POF A;  4JI4 Q;  5C0X I;  2UU9 L;  2EIF A;  1B8A A;  1K73 C;  5JJL A;  3GTO H;  4LFA L;  2AKW B;  4LUV A;  4DR3 Q;  1N8R C;  2R7Z H;  1DGS A;  4A75 A;  2YTY A;  2K5V A;  1OXS C;  1SLJ A;  1XTD A;  2D62 A;  4JI7 Q;  2AWN A;  2CTL A;  4JBJ A;  3I55 A;  4OXP A;  4GOP C;  2CWP A;  3M4O H;  4P71 A;  1TWG H;  3K7U C;  2AXY A;  3ULJ A;  2OCE A;  2PI2 A;  3RR5 A;  5IWA L;  3H0G G;  4C2M H;  4JI5 L;  4NXN Q;  3HOV G;  1SRU A;  2VZA A;  3AFQ A;  3HOZ G;  4DV4 Q;  3BZC A;  4JI8 L;  1HR0 Q;  1C9O A;  1TWA H;  4DAY B;  4GNX C;  1FJG Q;  1QVC A;  4JYA L;  1KIX A;  1X55 A;  3CC4 A;  2A8V A;  3DM3 A;  1E1T A;  3T1Y Q;  3H0G H;  1XMO L;  3HOV H;  4DR5 Q;  2BA1 A;  3HOZ H;  1HJP A;  1G6P A;  1Q82 C;  1QZG A;  2MNA A;  1YIJ A;  1N36 L;  2CTF A;  4NB3 A;  1UEB A;  3L0O A;  3M85 A;  3U58 A;  2I5L X;  1K0R A;  2PNH A;  1NMG A;  3G71 A;  3CCQ A;  3STB D;  3KDF A;  3NBH B;  3I56 A;  1KL9 A;  4GKK L;  2MJH A;  2B29 A;  4O0A A;  4C3H H;  1VQ5 A;  2HIX A;  3JAM i;  5HGQ A;  1TWC H;  4C3I H;  3NEL A;  3JC6 6;  2N78 A;  4IPD A;  2ZTD A;  4PZ7 A;  1SE8 A;  3K0X A;  5C0X J;  4DR2 Q;  3PUV A;  4A76 A;  2MFI A;  4IPG A;  3M7N A;  4WAL A;  3CMA A;  1CKN B;  1A8V A;  4P75 A;  3STB C;  2VQE Q;  2HHH Q;  4JOI C;  1JJG A;  1L1O C;  2QGQ A;  4UY8 C;  4IO9 A;  3L7Z C;  2UXB Q;  1PH1 A;  3HOW G;  1VQJ A;  4A3K G;  4NXM Q;  5GQO A;  2YQR A;  1PFS A;  1Q7Y C;  1LM0 A;  4YCW A;  1K8A C;  2MO1 A;  2F52 A;  3SGI A;  4HIK A;  4DV0 Q;  4JI1 L;  4JI3 L;  4X66 Q;  3HOW H;  3ULP A;  2JEA I;  4A3K H;  1QUQ B;  2K5H A;  1P16 A;  4X62 L;  2N3S A;  2UXD Q;  3KDF B;  4JI4 L;  1JT8 A;  2DUD A;  5FJ8 G;  4DR6 L;  5IY0 A;  4DKA C;  2RCN A;  2AHO B;  1KC8 C;  4A3B H;  1WI5 A;  4B3R Q;  4DR3 L;  1WE8 A;  3EIV A;  2H5X A;  1XPU A;  1K8G A;  1MIU A;  2KCT A;  4JI7 L;  1X4N A;  1K1G A;  1JB7 A;  1EWI A;  2D0O A;  3G4S A;  3ER0 A;  1S72 A;  2OTL A;  2JA6 G;  2N49 A;  4P73 A;  4LF9 Q;  4X6A H;  4NXN L;  3J81 i;  2I5H A;  3NEN A; 
#chains in the Genus database with same CATH topology
 1PXU A;  1SDF A;  3S1Q H;  5LMN Q;  1FJG L;  2CCZ A;  2N8N A;  1X54 A;  4Y7N B;  1CTM A;  1XMO H;  5DNF A;  3A8I E;  1E1O A;  3OW7 A;  3CRK C;  3HOY H;  1E7Z A;  4B9W A;  5DAU A;  1EFW A;  5IP9 H;  2NVT B;  1V9N A;  2VY3 A;  2MGS A;  1Y8P B;  3NP8 A;  3I72 A;  1XXG A;  3PO3 G;  3DM1 A;  3E9H A;  2ATW A;  2K6A A;  2PQU A;  3I90 A;  4A3M G;  4K8J A;  3CW2 C;  5K5P A;  2HD3 A;  3KBX A;  1XYI A;  3HOU H;  4K0K Q;  3CPW A;  1B2T A;  5EKL A;  4PMB A;  3IRB A;  1GD7 A;  1X3G A;  3KYH C;  3GTM H;  2CTK A;  1YEZ A;  1N33 Q;  2EYL A;  2VUM B;  1IBK L;  2CW0 C;  4X66 L;  3S1M H;  3OPO A;  4LF7 Q;  1K9M C;  4G7O C;  4Q0F A;  2A69 D;  1HFG A;  1FGU A;  3FPP A;  1BNZ A;  1YHQ A;  4B3T Q;  2Q2U A;  2ZQE A;  1ENA A;  1PV4 A;  3M3Y H;  4A3I G;  4IFD I;  3I4N B;  2JZX A;  3Q23 A;  3GV3 A;  3H94 A;  5DM6 3;  1IBL Q;  3GTQ B;  4NZT M;  1K83 H;  2ZM6 H;  2DY7 A;  2WAQ G;  4A3L G;  2FXQ A;  3QJY A;  1K0S A;  2AUK A;  5LL6 b;  4KTA A;  3A74 A;  5C4H A;  3FEW X;  5C4X B;  3X3M A;  1KNA A;  3I7F A;  1B70 B;  1BF4 A;  3QD7 X;  2F0J A;  1J5E Q;  2UUB Q;  3SK4 A;  1WTV A;  2K50 A;  4KK7 A;  2QDL A;  2DNC A;  3SK6 A;  1LTI D;  1Q1E A;  2JN4 A;  3Q8D A;  3JAM W;  3OYY A;  4FP5 D;  2DNE A;  5KYL A;  1SND A;  4R8N A;  1GHK A;  4J1M A;  1U9R A;  4DR5 H;  3GTP H;  1OTC A;  1J8I A;  2YU9 H;  4OX9 H;  4ZKB B;  1HNW L;  1B44 D;  1PH4 A;  4YIJ A;  1A63 A;  1FR3 A;  4FO2 A;  1S5C D;  5C0X G;  4LF8 L;  1VDZ A;  2C35 B;  1PQX A;  1CI3 M;  1VQB A;  4LAA A;  1KLU D;  1V9P A;  4XTC S;  2F0Q A;  1I50 B;  4EGV A;  4LF6 Q;  1K3B C;  1I4G A;  2PMZ E;  1TII D;  3S1R B;  4A3E B;  3PF4 A;  2UXB H;  2NVQ B;  3HGB A;  4PV1 C;  1BCP C;  2EVB A;  2B3G A;  1HHV A;  4KHP L;  3RZD H;  3C3L A;  2PW7 A;  1PMR A;  2CVR A;  4MZ9 A;  4ALP A;  3ZJY C;  3QG1 A;  1ZZI A;  3I8Z A;  1DCZ A;  5FLX L;  1VQG A;  2EXD A;  1PH8 A;  5BR8 Q;  1Y14 B;  3GV6 A;  1LTR D;  2LKV A;  2UU9 H;  3U9O A;  4POG A;  4XQQ A;  3GTO B;  3NWT A;  1EIY B;  5JAV A;  4A3G G;  4GLX A;  1XJV A;  1WHR A;  3PUY A;  3FHW A;  3S24 A;  5JEA G;  2GVB A;  3M4O B;  1A3U A;  1X0A A;  4U68 A;  3NWS A;  4EQN A;  1I5F A;  5JJZ A;  1VQM A;  2K52 A;  4DV4 L;  2DGR A;  3CCM A;  3SE0 A;  2HQE A;  3D4R A;  3T4A C;  4R4C A;  5D14 A;  2BA0 A;  2B63 G;  2KCC A;  3HOV B;  4GN3 B;  1CHQ D;  4KD3 A;  1ZEQ X;  2EXZ A;  3QIA A;  1RDP D;  5I4D A;  2JA7 H;  2I5M X;  3CQZ H;  1PTO H;  5IWA Q;  2BL5 A;  1XNQ L;  5CV6 A;  4A93 H;  1ILP A;  4DAV A;  3OMG A;  1XMO Q;  3KLR A;  2HHH L;  5BN4 A;  2NZ1 D;  2NN6 I;  2KBN A;  4DUZ L;  1PH3 A;  2OWO A;  3BDO A;  3TS0 A;  5BN5 A;  2LS0 1;  1NY4 A;  2K1H A;  1BO0 A;  2FPH X;  3NXW A;  3SR1 A;  1PFM A;  4IJL A;  4JI1 H;  5FLX E;  5IT9 c;  1IXR A;  1F77 A;  1L2F A;  2B8F A;  2WII B;  3CRL C;  5ELE A;  3F2B A;  1B7Y B;  1N32 L;  3UE0 A;  2BDN A;  2PZW A;  1NCV A;  3FP9 A;  2EYM A;  1U0L A;  3A8K E;  1NBW A;  1Q8I A;  5KIX A;  4BXX G;  1AEX A;  1UWV A;  4NPS A;  4B3S L;  2A6E D;  1E2Z A;  3BG3 A;  1CT1 D;  3K7A H;  1EIF A;  1HUM A;  2F0S A;  4H7B A;  3DEO A;  3RF2 A;  2ZJP A;  2E76 C;  4GS3 A;  1UEA B;  4MTK A;  3TDQ A;  4PG3 A;  3J7A F;  1JB3 A;  1D1K A;  2NVY H;  4A3F H;  1XMQ H;  5EBC A;  4L5S A;  1IBM L;  3PO2 G;  4KHZ A;  2JA6 B;  3VKE A;  2HUG A;  3GKU A;  1S5D D;  1IW7 D;  2ZM6 Q;  1B1Z A;  1E3P A;  1O7L A;  1EY5 A;  4DV1 Q;  2F0D A;  4BY7 H;  3BVM A;  1QVG A;  4HMJ A;  4DA2 A;  2Y0S B;  1YNJ D;  1JT8 A;  1V43 A;  5M5W B;  1NJI C;  2NUC A;  4DV5 L;  1EOV A;  1WYD A;  1LYL A;  2PQE A;  3TRZ A;  4AYB E;  2LRR A;  1S03 G;  4WJW A;  1YI2 A;  2TSS A;  1Y1V G;  4Y7N H;  4XT1 B;  2E2H B;  3AYH B;  4QQB X;  1P8L A;  1KDA A;  1TWH B;  2J7Z A;  4K14 A;  4YWL A;  4OX9 Q;  4DR1 Q;  1SNP A;  2F0P A;  1F9Q A;  3TBI B;  2NVT H;  2AQ3 B;  5L37 A;  1WD0 A;  3W5O A;  2FFM A;  3VR2 A;  3PCO B;  1PVO A;  1CKO A;  5FLX c;  3D0F A;  4G4K A;  3F1Z A;  1SJH D;  4DR6 H;  2UXC H;  1LTA D;  1NUC A;  1SJE D;  2NZO A;  3A54 A;  3Q24 A;  4JPB W;  5I2X A;  1KD1 C;  3S15 B;  4Y52 H;  2UXD H;  4X3U A;  4B3R H;  4AIM A;  4DK6 C;  2R7F A;  1BCP B;  1MD2 D;  3R8B A;  2VUM H;  2D2C C;  1PH6 A;  3ERO A;  3FMC A;  2IWH A;  4ILW A;  1LAC A;  1SSO A;  1STH A;  2E5L Q;  3E5S A;  3H3V I;  3I4N H;  4LFC H;  2UU9 Q;  4JG2 A;  3GTQ H;  1AH9 A;  3VR5 A;  4ULL A;  3CD6 A;  3J7A K;  2NVX H;  2E2I B;  5C4X H;  5KNB A;  1WTJ A;  3U9S A;  3OSO A;  3W1B A;  1A6X A;  1YJN A;  1VQE A;  4AH6 A;  2D9I A;  1Z9F A;  1HTP A;  3A5Z B;  3K6O A;  3F2U A;  4QL5 A;  4PZ6 A;  3J81 j;  2A1S A;  1S3O A;  3S9W A;  2AWO A;  1EWC A;  1STE A;  5IOD A;  1JOO A;  2A73 B;  3J80 i;  4C1N K;  1L0Y B;  2ICE C;  1J4W A;  4KLK A;  4JI6 H;  5AJ3 L;  1HNX H;  4APV A;  1JC7 A;  3DWP A;  2SEB D;  2F4V H;  3PIP 3;  3KF6 A;  2OT2 A;  3TN2 A;  2R3Z A;  4RFB A;  4FXD A;  5IYC H;  5I6Y A;  2Z6B A;  1M8A A;  4UP7 A;  1VIH A;  1RD9 D;  5LMN W;  1STG A;  2E3U A;  3O13 A;  1WD1 A;  4DV2 L;  2KVM A;  1I50 H;  4DV3 H;  4YHH H;  4A3E H;  3SB1 A;  1KRT A;  1HNZ H;  2NVQ H;  2ZTE A;  4KMU C;  2MO0 A;  2DGY A;  3DWQ A;  3WOF A;  3SEB A;  3BU2 A;  2DJG C;  1PA6 A;  4DAY A;  1JIC A;  4JI1 Q;  1I94 H;  1UUP A;  1YNN D;  3QWN A;  5EKK A;  3EN2 A;  4JV5 L;  2QKI C;  1MJC A;  3KF6 B;  3QO2 A;  5C0X I;  1B8A A;  1QCB D;  3BYY B;  3W3A A;  3GTO H;  3KLS X;  5G3L F;  5JVG 3;  2YTY A;  2H1E A;  4G57 A;  3I0P A;  2RSO A;  4GZY C;  3CU7 A;  2F0E A;  3M4O H;  2CWP A;  2ZXP A;  1DZ1 A;  5A2Q W;  3ULJ A;  2OCE A;  3RR5 A;  3H0G G;  4JI5 L;  1SRU A;  1EY6 A;  3HOZ G;  1L0X B;  4DAY B;  4JYA L;  3I4M B;  3DM3 A;  3HOV H;  1ONL A;  4C3I G;  3L0O A;  2N55 A;  5E4W C;  1F2L A;  1BUV T;  1W6J A;  1NR4 A;  3STB D;  1PZI D;  3GTM B;  4O0A A;  2B2U A;  5LMU H;  1QG7 A;  3NEL A;  3AB9 A;  2EE1 A;  5EKI A;  4HTH A;  3E6Z X;  1RF2 D;  4WAL A;  1A8V A;  5KNC A;  4DV7 H;  2QGQ A;  4HAE A;  2NBF A;  4S3S A;  2SOB A;  4UHV A;  3HOW G;  1VQJ A;  1EZ8 A;  1K83 B;  1AN8 A;  1ET9 A;  1K8O A;  3OSS D;  1K8A C;  2VQF H;  1IKL A;  4DU9 A;  4HIK A;  2RDF A;  4JI3 L;  1FNW A;  5JVH 3;  1EIH A;  3KDG A;  2VB3 X;  2EYJ A;  3N52 A;  4RHS A;  4KY6 A;  2J0T D;  4X62 L;  2UXD Q;  2DUD A;  2F0M A;  2K32 A;  3IAY A;  2RSN A;  2PPB C;  4C56 C;  5KEE A;  2CH4 A;  4B3R Q;  4LFA H;  3OWE B;  3MAQ A;  1WE8 A;  2H5X A;  1IHZ A;  4IUT A;  2O4X A;  2KCT A;  2DN8 A;  1EWI A;  2D0O A;  1S72 A;  1RTN A;  3RZO B;  4NXN L;  3NEN A;  3OIQ A;  2A1A A;  1I6H B;  1HR0 L;  4DFA A;  1EUJ A;  3N6R A;  5JEA H;  2BOS A;  1HRJ A;  4AYB B;  1WFQ A;  1KLG D;  1T5X D;  2ZTC A;  3SVM A;  2K5N A;  1HPC A;  3CPF A;  3H6M A;  1A3V A;  1TT2 A;  2F3I A;  2MHV A;  1B9M A;  1DTJ A;  1PYS B;  2PQA A;  1HZA A;  2ICI A;  5GAE C;  1AW7 A;  4EX5 A;  1QOH A;  1X6O A;  2O5I C;  5EJW A;  4GKK H;  4OO1 I;  4CDD C;  3CCV A;  1BBU A;  5IT9 W;  4UDU C;  2E2H H;  1B9N A;  5ELN A;  1BVS A;  1TWH H;  2EYH A;  2VQE L;  1B3Q A;  5M3F B;  1J6Q A;  1XNR L;  5C3E G;  4JI6 Q;  4YY3 H;  1HNX Q;  1H9J A;  5CBA E;  2F4V Q;  3CC2 A;  5CV5 A;  4XQN A;  2JYO A;  2L11 A;  2K28 A;  3FRP B;  3MXG A;  3P1H A;  2PQA B;  4IOC A;  3D4D A;  1O78 A;  2ZT9 C;  3IFD A;  3S15 H;  2QEX A;  2NN6 G;  2B2W A;  4DV3 Q;  1RJT A;  1E24 A;  4R4T A;  4FXG C;  4YHH Q;  4CKC A;  1JJ2 A;  3C1E A;  1HNZ Q;  1PH2 A;  2UUC Q;  1S4Z A;  3D3R A;  4RGM A;  1V1P A;  1Y1W B;  2WAQ E;  4L5Q A;  2WAC A;  3NUC A;  5C5M A;  4DGZ A;  1LO5 D;  4LF9 L;  5FK9 C;  2PYK A;  4MN3 A;  3TP6 A;  5LMN L;  3RNU A;  4OD6 A;  2F0U A;  4K8I A;  5FLM G;  2RVL A;  3J81 E;  4A3J G;  1YJ9 A;  4A3D G;  2MPM A;  2QA4 A;  1CKM A;  2UUA Q;  3H3V C;  4A3C G;  4H8A A;  5CV7 A;  5C3X A;  4C3H G;  5EPK A;  3WDN A;  2E2I H;  3LX0 A;  1VIG A;  4N8X 1;  3E3X A;  3G7L A;  3SXH A;  5ISR A;  4KV6 A;  2EJM A;  2JA9 A;  3FKI G;  4L5T A;  1PZK D;  3I73 A;  4NBQ A;  1V1P B;  1EU4 A;  1WTR A;  2A5H A;  1EOT A;  4QMF B;  1LTL A;  2BE5 C;  3T1H Q;  1V8Q A;  3GD7 A;  2JP1 A;  1HQM C;  3QB3 A;  3SK8 A;  1R4Q B;  1SFO B;  2B2Y C;  4K0K L;  4IUQ A;  3HG9 A;  5FKA C;  1H9R A;  5IP7 H;  3E9I A;  5EPL A;  4AQY H;  4A3B G;  2XSC A;  1C0A A;  1IBK H;  1RTO A;  5LMU Q;  2Z0S A;  1BBX C;  4ID6 A;  1GO3 E;  2RHS B;  4LF7 L;  1XPO A;  4LFB H;  1DOK A;  1NTG A;  1QNU A;  3A8J E;  2R92 B;  2ASB A;  4B3T L;  1RL2 A;  1YZ6 A;  2A68 C;  4DV7 Q;  3Q22 A;  4JBW A;  3HKZ E;  4JW0 A;  1GVP A;  4ZCK A;  4OWX B;  2NTS A;  1IBL L;  2RHQ B;  2HCC A;  5AFW A;  1VQF A;  1F2Z A;  2R7Z B;  3MTS A;  3NBI A;  3U50 C;  1LT4 D;  5E3F A;  3KFU A;  2ID0 A;  3UDX A;  1C7Y A;  2VKC A;  5JOB A;  3CCE A;  1TWG B;  4RG1 A;  1JWM D;  1J5E L;  2UUB L;  3EVQ A;  3TME A;  3HOX G;  3J81 c;  2PZT A;  1G29 1;  1PH5 A;  3T1Y L;  3DLL A;  1OXX K;  2EY5 A;  2Y3M A;  2CH4 W;  2LXK A;  1CA6 A;  1VQ4 A;  5GRO A;  1DD2 A;  1F9R A;  4HCS A;  5BN3 A;  3I70 A;  5C5L A;  2RF4 A;  3IKJ A;  1Y8N B;  1EEI D;  3PV0 A;  4C3H B;  5EAY A;  1VQI A;  3M4Y A;  1TWC B;  4FJS A;  3I4M H;  1Q90 A;  1W2B A;  1VBI A;  1PH7 A;  4LF6 L;  1PRT C;  1RHP A;  4BS9 A;  3CXC A;  1VQ7 A;  1ZZJ A;  5M3M G;  4WJ3 M;  2CQO A;  1MHW C;  4X3K A;  4KD4 A;  3TSS A;  3DHQ A;  3J80 L;  3LWU A;  3ND9 A;  2X69 A;  4HJA A;  3HZX A;  4DV0 L;  1YHB A;  2Z6K C;  2E8G A;  3A55 A;  3AU7 A;  2G9H D;  1CA5 A;  1JMC A;  4A3K B;  4K5W A;  2VW9 A;  3ICE A;  4NP5 A;  5BR8 L;  1MSH A;  4G7H C;  4YY3 Q;  3TZU A;  1NXU A;  1PTO D;  4HSV A;  3VA5 A;  1K28 A;  3HKS A;  4TRD A;  3L2P A;  4RH6 A;  1DOL A;  2EJG C;  4H0L C;  2OXP A;  3K5M A;  4HJ5 A;  4UPA A;  3OW2 A;  2NVX B;  4JI7 H;  3CCR A;  4LJZ C;  3NHH A;  1DOM A;  1G8Z D;  4FVM A;  4XYQ A;  3CCJ A;  1WVL A;  1YVC A;  5C6A A;  5IOC A;  4E6I A;  4DV4 H;  4GLV B;  4QIW B;  3NE5 B;  4JK1 C;  1STA A;  4BY1 G;  2VL6 A;  5C4J B;  4X64 Q;  2YTV A;  3ULL A;  4HIM A;  2Q8T A;  4CBV A;  1A15 A;  1X56 A;  2HT1 A;  1TQO A;  1QZH A;  1HUN A;  2B2V C;  3RZO H;  2R6G A;  4FDB A;  1PRT F;  3J7Z C;  3MA2 B;  4JOI A;  4ME3 A;  5KGU A;  4PMC A;  1I6H H;  1XNQ H;  3W2D A;  2B2Y A;  1JJC B;  4DR2 H;  3P75 A;  2A6H C;  2GA4 B;  2IX0 A;  1EYD A;  2HHH H;  3WWV A;  4IFD H;  1FD7 D;  4I7Z C;  3PO3 B;  1N9W A;  3VYT A;  1UE1 A;  3NTH A;  3J80 E;  3RLF A;  1O7Y A;  3FVQ A;  4LF4 Q;  4A3M B;  2ZJQ A;  4TQU S;  1QVF A;  1X32 A;  1SMY D;  3CAM A;  3K0Y A;  3KOJ A;  2JA8 G;  2PW5 A;  4BBR G;  1U4M A;  2X6G A;  2JA5 G;  2H4O A;  1ODH A;  1N32 H;  2EY6 A;  3EQL C;  3HKZ G;  4OWT B;  3T53 B;  5M3F H;  1LUZ A;  1WTH A;  1ASZ A;  1CZG A;  2YTX A;  1MKH A;  1WTP A;  2QEJ C;  4B3S H;  4JVZ A;  5IE8 A;  1CSP A;  3OMC A;  4RA8 A;  4AQY Q;  4A3I B;  1IBK Q;  4K6D A;  1EZ6 A;  3PGZ A;  1E2V A;  2EQS A;  2R93 G;  4XIG S;  3S14 B;  4LFB Q;  4TKO B;  2WAQ B;  4DNR B;  3AMU A;  5C4Z A;  1VCI A;  3GO5 A;  1YIT A;  3D6C A;  1HCZ A;  3BVG A;  3MXN A;  1IBM H;  1GKH A;  2ZXO A;  3R93 A;  4LNQ A;  2FMC A;  2LY7 A;  2ZM6 L;  1X3E A;  5C44 G;  2WV6 D;  3MXU A;  4DV1 L;  1Y1W H;  2JJQ A;  1SNQ A;  1XTC D;  2CKZ B;  2RQX A;  5IGE A;  4OWW B;  4O1N A;  2SDF A;  3S16 H;  1BBW A;  1H9K A;  4LF5 H;  2G5D A;  1ML0 D;  2KOL A;  5IYD H;  5LHY 1;  4P2C B;  5FOB B;  3CC7 A;  4OON A;  4OIJ A;  1Q81 C;  4BBS G;  1JCK B;  4IJH A;  4GN5 A;  3FDT A;  1CK1 A;  4C3J G;  1RCV D;  4DR1 L;  2Z6K A;  3K81 C;  3J80 c;  1WOC A;  3MXN B;  5NUC A;  4DN4 M;  2PT7 G;  4CKB A;  4WJ4 A;  3EZJ A;  2ALY B;  4LWC A;  4B8T A;  1AE2 A;  1ZXT A;  4P74 A;  1ICF B;  1SYG A;  1AN7 A;  4G08 A;  4O42 A;  1F2M A;  1SFO H;  3GTG B;  1A3T A;  4DUY L;  1LTT D;  4K2K A;  3U4Z A;  1X3F A;  3WOE A;  1I4X A;  1H95 A;  1PRT B;  5I2Y A;  3OTO L;  3HFZ B;  4IQZ A;  3VR3 A;  4OO1 G;  3GDE A;  4TVA B;  1BR9 A;  3UDI A;  5EQ0 A;  4DV6 L;  2XRQ D;  4BA2 I;  2WKC A;  3VR4 A;  1OXV A;  2R92 H;  1EFI D;  4IUU A;  2E5L L;  2JE6 I;  4PNY A;  4DR7 H;  4A3G B;  2UU9 L;  2EIF A;  4L63 B;  2RDH A;  5K36 H;  5JJL A;  2CQA A;  1Z6H A;  2B2V A;  5FO8 B;  5J39 A;  2R7Z H;  3NBH A;  3S1N B;  1DGS A;  1ICW A;  2NN6 H;  4JI7 Q;  4DAP A;  4JBJ A;  4GOP C;  2AXY A;  4P71 A;  1TWG H;  3K7U C;  3UI2 A;  4DR4 H;  2B63 B;  1DON A;  4DV4 Q;  3BZC A;  3VYU A;  1O7Z A;  3SK5 A;  4GNX C;  1QVC A;  5CYU A;  2A8V A;  1X55 A;  2XNA C;  1PFB A;  4F88 A;  3Q0A A;  1E1T A;  1SYC A;  4DR5 Q;  2BA1 A;  1G6P A;  1QZG A;  1N36 L;  4NB3 A;  1UEB A;  3U58 A;  1S20 A;  2I5L X;  2M9V A;  3C1F A;  1K0R A;  2PNH A;  3G71 A;  3NBH B;  3KBG A;  4K5V A;  2HDL A;  1ZYR C;  5T1I A;  4V0B A;  4C3H H;  4X65 H;  5HGQ A;  1TWC H;  4RGN A;  1B50 A;  2LMC B;  3A7L A;  4DR2 Q;  3PUV A;  3GTL B;  2MFI A;  3CMA A;  1CKN B;  4DV2 H;  3JAM L;  2HHH Q;  1JJG A;  3NTI A;  4UY8 C;  2K04 A;  3L7Z C;  2UXB Q;  1D1I A;  1SEB D;  1EL0 A;  2YQR A;  1LM0 A;  4WFN 3;  4Z9C B;  5DT9 A;  3KDK A;  3SGI A;  1Y69 U;  4JI1 L;  3BYT B;  3DXJ C;  2Z9H A;  1JOK A;  2NYZ D;  4ME5 A;  4A3K H;  1QUQ B;  4XYO A;  2JEA I;  4ZQ3 A;  4E9J A;  1BOS A;  2V4D A;  4JV5 H;  3NQI A;  1STN A;  2N3S A;  4DK0 A;  1KAA A;  4IUR A;  5IY0 A;  3J81 W;  1WI5 A;  3EIV A;  1XPU A;  3HRZ C;  4OCH A;  3ERQ A;  1X4N A;  2DJF C;  3R2T A;  3ER0 A;  3PO2 B;  4P73 A;  3A56 A;  1TWF B;  2FHT A;  2E75 C;  4UP9 A;  1Q86 C;  3HOY G;  2ANN A;  2C5C A;  5LL6 S;  3BVZ A;  5C4J H;  2B8G A;  2L1B A;  2F0N A;  3CP0 A;  2QW7 A;  4JYA H;  5IP9 G;  2CTM A;  3QR8 A;  2R7D A;  3I4L A;  4I7A A;  3E0E A;  3RN5 A;  4GKJ H;  3ERS X;  3NQT A;  4MHE A;  2D9U A;  4L8J A;  3T56 B;  3VA7 A;  2A19 A;  2OTJ A;  2IY5 B;  1Y1V B;  5M5X B;  4FF4 A;  1WCM G;  5JJI A;  2PMZ B;  3RMH A;  2XVS A;  4ZK9 B;  2E2D C;  4LF5 Q;  1EY7 A;  1X3P A;  4ZUJ A;  1M90 C;  3HOU G;  2L15 A;  1KAW A;  4RKL A;  4IOA A;  3JAM E;  4JI2 H;  1SYD A;  1T9H A;  1MGS A;  1R9T B;  2JK8 A;  3H3V H;  1SNM A;  3PO3 H;  1EY9 A;  1TS5 A;  2CW0 D;  3GQB A;  2ZJR A;  1MJE A;  2KA7 A;  2LTL A;  2KEN A;  4QF4 A;  4A3M H;  3UOE A;  1DM0 B;  1I3Q B;  2PI2 E;  4KJN A;  1VQ6 A;  4JI3 H;  3S2D B;  4BA1 I;  2Q2H A;  2UXD L;  3LWE A;  4L5R C;  1EYA A;  1QWY A;  3CF5 A;  2KCM A;  3PUZ A;  4K2L A;  4GOP A;  1V8C A;  3I3C A;  2YV5 A;  1JWU D;  2A69 C;  2KHJ A;  4J15 A;  4A3I H;  1A2T A;  2MP1 A;  1H9S A;  4GNX A;  4B3M H;  2CWF A;  3S14 H;  3G48 A;  2P2R A;  4A3L H;  4NXN H;  4YWM A;  2EOT A;  3M9B A;  3P20 A;  3CCU A;  4DR7 Q;  3K5N A;  1HR0 H;  1VMP A;  1XMQ Q;  3NTK A;  1NR2 A;  3F2C A;  4RMF A;  1TUA A;  1KHI A;  3I4O A;  3NK9 A;  3KF8 A;  2CTJ A;  4JI0 H;  5I6W A;  1PDQ A;  4KI0 A;  4DR4 Q;  4FXK C;  4GOP B;  3LGJ A;  1D8L A;  1HA5 A;  5GAH C;  1YNX A;  3TEH B;  4HCE A;  2D0P A;  4X3S A;  3JAM c;  1H9S B;  1ROD A;  4GNX B;  1BCP D;  5CC4 A;  1TVX A;  2EY1 A;  2DY8 A;  5C0X H;  1MBY A;  1U5K A;  2HQL A;  1XNR H;  4JI6 L;  1D5Z C;  1EY0 A;  3MC0 B;  1WTW A;  1CQV A;  1N34 H;  2F4V L;  1KAB A;  3AFP A;  2ANR A;  2L9H A;  4X65 Q;  4FJU A;  4NDX A;  1WVN A;  2CWA A;  1O7I A;  4HED A;  3KF8 B;  4DR6 Q;  1GUW A;  1GOZ A;  2UXC Q;  3GTG H;  1UE7 A;  4DV2 Q;  4DV3 L;  3M4P A;  4OIK A;  2JVZ A;  1QJO A;  2QND A;  4LK1 C;  1GJX A;  1SRO A;  4R8I A;  2UUC L;  1Q12 A;  3T51 B;  5IYB G;  2IX1 A;  2BH8 A;  3UDF A;  3EA6 A;  1D7Q A;  2Q2T A;  1IYJ B;  3SDZ A;  3SHL A;  2FJ2 A;  4LF9 H;  1X4M A;  4JV5 Q;  4A3G H;  4JI8 H;  1HZB A;  4LFC Q;  2EPB A;  1JE5 A;  2NTT A;  4IPH A;  1A62 A;  2UUA L;  1E22 A;  3MZ5 A;  2JA7 G;  3S1N H;  1IKM A;  1YBY A;  4QUC A;  3H0G B;  2R61 A;  3HOZ B;  1G6Z A;  4R4I A;  1BXT A;  4FF1 A;  4A93 G;  1SBB B;  1EQR A;  2B63 H;  4KKS A;  1LAB A;  2WB1 G;  1VQ8 A;  5IGG A;  1EWH A;  1GUT A;  2GN5 A;  4C3I B;  3C2P A;  4JYA Q;  3URY A;  1UAP A;  2PY9 A;  3T1H L;  1HH2 P;  2F0I A;  2ENB A;  5J3B A;  3PQI A;  4GKJ Q;  2MUY A;  4K0K H;  1ILQ A;  1JWS D;  4NXM L;  4KY5 A;  1JQY D;  3V2T A;  1FKA H;  2L5T A;  5LMU L;  1Q3L A;  5DLQ E;  3UE1 A;  3GTL H;  1SN8 A;  1PYB A;  3HOW B;  4LF7 H;  4JI2 Q;  4ZUI A;  1Q8K A;  3TZD A;  2JSO A;  4JI4 H;  4B3T H;  1EY4 A;  4JVH A;  2XTI A;  4JBK A;  5DEH A;  2IJ0 A;  2FMR A;  1FGB D;  3CME A;  4HJ8 A;  4DR3 H;  1ZKO A;  1VMC A;  2SNS A;  4HMI A;  5H1S E;  1X9N A;  2M00 A;  2VNU D;  4XDX A;  4EQP A;  4A3F G;  1DYQ A;  1I94 Q;  2NZH A;  4JI3 Q;  4J6H A;  2EJF C;  4BXX H;  1HFN A;  1ENC A;  3BJU A;  1J5E H;  3I91 A;  2A6E C;  4DK3 C;  3S16 B;  4OO1 H;  1SNC A;  4BY7 G;  1IL8 A;  4EQO A;  1FJG H;  3T1Y H;  1TS4 A;  1FVI A;  3H91 A;  4CJ1 B;  1BKB A;  1GUG A;  4UP8 A;  1RIP A;  4GN4 B;  4JBM A;  3PO2 H;  3KJO A;  4CDE C;  1TWF H;  1EY8 A;  3EFX D;  4B3M Q;  3VDY A;  2XN9 C;  3U1K A;  4QGU A;  2LTM A;  1IW7 C;  4OL7 A;  4MTN A;  2IW3 A;  4X3T A;  5FLX W;  5KYI A;  5D3D A;  1VQA A;  4PMW A;  1YNJ C;  2AUJ D;  5J22 A;  3PIP A;  3B6Y A;  5ELO A;  2IHE A;  3LNN A;  1C8C A;  2C9O A;  4QJF A;  4LF6 H;  4JI0 Q;  1Y1V H;  4PDB A;  4JCV E;  5M5X H;  1KTK A;  1NE3 A;  4XT3 B;  3OWF A;  1LTB D;  1VQL A;  1G2T A;  1N33 L;  3GTK B;  5A2Q L;  4H44 C;  4DV0 H;  5C3E B;  4X66 H;  5M5Y B;  4HSP A;  1R9T H;  4IUN A;  3GTJ B;  2ES2 A;  2Z1C A;  2VUM G;  1DXM A;  5D65 A;  1BQQ T;  2Z8L A;  1XNR Q;  4YY3 L;  1HXY D;  2WIN B;  3A5U A;  3M7G A;  2EZV A;  1SAP A;  1WTX A;  1N34 Q;  3FPU B;  1SE4 A;  4IPC A;  1I3Q H;  2VQF Q;  2F3W A;  4WOR A;  3I4N G;  2E2J B;  1CQF A;  4K6L A;  3AEV A;  3S2D H;  5CBE E;  4FF2 A;  3BDL A;  4KHV A;  3MWY W;  4LUZ A;  3VR6 A;  1ZZK A;  2Q2I A;  5C4X G;  3DEP A;  3J7A 5;  3S17 B;  4LFA Q;  4X64 L;  2YYZ A;  3T13 A;  3RN2 A;  3A0J A;  1B53 A;  2I46 A;  1Q1B A;  4ZLT F;  2AMC B;  4HR7 B;  4A3J B;  1O80 A;  4A3D B;  3BZK A;  1HNW H;  1LT5 D;  1V1Q A;  4RCO A;  5ELD A;  1J9O A;  3NCV A;  5JEA J;  4LF8 H;  4RGO S;  2L4N A;  4JI8 Q;  2Z4H A;  4WRD A;  2K7V A;  3RLO A;  2PZU A;  1G51 A;  5I9P A;  3MEH A;  1TS3 A;  3AEV B;  2Y0S E;  1SXT A;  1VQO A;  1OXU A;  2OPU A;  3FKI B;  5IYC G;  3MEF A;  5EGT A;  3TRE A;  1EC6 A;  1H9M A;  5A2Q E;  2LSS A;  4KHP H;  1WTO A;  4LF4 L;  4GKK Q;  2F0V A;  1SYE A;  4NZR M;  5I9O A;  3BZD B;  4A3E G;  1VQC A;  2XGT A;  5E1F A;  4N8F A;  1PZJ D;  1EEF D;  1FL0 A;  1WCM H;  1VQP A;  1QB5 D;  4A3B B;  4DK1 A;  2ZXR A;  1XX8 A;  1UE6 A;  2MQH A;  1JOR A;  2CFM A;  3PIO A;  2OPV A;  1YJW A;  1IL2 A;  4AQY L;  1VQN A;  3NSW A;  1D6E C;  1UG8 A;  1DT4 A;  2I07 B;  2M8W A;  2NB0 A;  1EU3 A;  2F4I A;  2HIV A;  2EY2 A;  2IPK D;  3G6E A;  4LFB L;  1PLF A;  2SNM A;  2VS1 A;  4KKT A;  4POF A;  4JI4 Q;  5IT9 L;  1KNE A;  4KJO A;  4XXE A;  3KUP A;  4DR3 Q;  1N8R C;  1YNN C;  4A75 A;  2K5V A;  1OXS C;  1SLJ A;  1TU2 B;  3QOL A;  3S2H B;  1LT3 D;  4DV1 H;  1F2Y A;  2D62 A;  2AWN A;  3KLS A;  3HOX B;  4B08 A;  3I55 A;  1XRH A;  4F87 A;  3MXP A;  2E74 C;  5IWA L;  3HOV G;  3AFQ A;  5IGF A;  1TR5 A;  3D4W A;  1C9O A;  1FJG Q;  4M1U B;  2KEE A;  5ELB A;  1SEI A;  1KIX A;  3CC4 A;  3T1Y Q;  1XMO L;  3H0G H;  3HOZ H;  2F03 A;  3HEJ A;  1Q82 C;  4RWS C;  2MNA A;  2CTF A;  1S5F D;  4DR1 H;  4DUZ H;  3M85 A;  1TKW B;  4OHJ A;  1NMG A;  4ZKC B;  3CCQ A;  3BDC A;  1VQ5 A;  3Q6S A;  2HIX A;  4G7Z C;  4C3I H;  4IPD A;  1S5E D;  4PZ7 A;  2PO4 A;  4A76 A;  5M3M B;  4IPG A;  3M7N A;  3STB C;  4DUY H;  1L1O C;  4IO9 A;  1G91 A;  1E0B A;  3OTO H;  4MIU A;  1GUN A;  2XIW A;  4DF7 A;  2RA4 A;  2MO1 A;  4DV0 Q;  3T16 A;  4DV6 H;  4X66 Q;  3HOW H;  3ULP A;  3BS1 A;  5IT9 E;  2QDB A;  4RCN A;  4CJ2 C;  2E5L H;  5FJ8 G;  4ABN A;  1HA6 A;  1I4H A;  1Y8O B;  2RCN A;  1KC8 C;  2J4X A;  1IYU A;  2F0L A;  2L55 A;  1NAP A;  4LMQ D;  3MFG A;  1MIU A;  2RKS A;  4JI7 L;  5JPM C;  1K1G A;  1JB7 A;  1EIG A;  1I6U A;  4BY1 B;  2CPM A;  4N9P A;  2JA6 G;  2B2T C;  2N49 A;  3GR5 A;  4DV5 H;  2BDO A;  2JXM B;  3J81 i;  4M8A A;  5IYB H;  1VQK A;  2Y0S G;  2RCF A;  4J8Q A;  4RAU C;  1A0I A;  1B3A A;  2RDG A;  4DR5 L;  2CPQ A;  1IYV A;  4QUF A;  2HH2 A;  2F1M A;  2B39 A;  4OX9 L;  1N36 H;  4R1J A;  3F2D A;  4IUP A;  1HNW Q;  1CFM A;  1A2U A;  4LF8 Q;  3K80 C;  2KJX A;  2KQ3 A;  1S5B D;  1WTQ A;  1BCP F;  4DR2 L;  1AZP A;  4QY7 A;  1II3 A;  3HP3 A;  4ZAI A;  3RLN A;  2EYP A;  1SE2 A;  2JA8 B;  2UXB L;  3EBE A;  3QOJ A;  2FFK B;  4I65 A;  4BBR B;  2JA5 B;  4KHP Q;  3GTK H;  3HKZ B;  2G8Y A;  4QCL A;  4GLA C;  4CDF C;  5IGC A;  1J5K A;  5C3E H;  5M5Y H;  4CGY B;  4DXG A;  3GTJ H;  4YCV A;  4XQJ A;  5IGD A;  3IFT A;  4LW1 A;  1GUO A;  2M2L A;  4F7X A;  2CHB D;  2OEO A;  3H09 A;  2KCN A;  2R93 B;  2LF0 A;  4V19 0;  1I4Q A;  2X6L A;  2XWJ B;  2E2J H;  3KLW A;  1EQQ A;  2GVA A;  1W6K A;  1CKN A;  1CM9 A;  3TQY A;  3F8T A;  4MNO A;  1IZ6 A;  1CSQ A;  1JE4 A;  2WKD A;  4ODG A;  1WJJ A;  3VYS A;  2KHI A;  5C44 B;  3V05 A;  3VYR A;  1Z47 A;  3S17 H;  4F8M A;  4CHT B;  2EDG A;  2IHF A;  4YCU A;  4DXF A;  5LL6 X;  5FLM H;  4A3J H;  1QUQ A;  4A3D H;  2BE5 D;  1UE5 A;  3I2Z A;  2K33 A;  3L9A X;  3KK7 A;  4A3C H;  4BBS B;  1I6V C;  1XNQ Q;  4A4I A;  4LF5 L;  3K5L A;  1L1O A;  3V69 A;  4C3J B;  3MVV A;  5J1Z A;  1AP0 A;  1KDB A;  2K1B A;  2KED A;  4IFD J;  1I4P A;  5IP7 G;  3FKI H;  5CMD A;  5ELF A;  2IX3 A;  3UDG A;  4DUZ Q;  3GP7 A;  4DPG A;  1X65 A;  5CV4 A;  3E0J A;  4OGQ C;  4R4O A;  4R9W A;  3ITP A;  2A68 D;  2F0K A;  1XPR A;  1MSZ A;  1HR0 W;  1N32 Q;  4A3B H;  1QIL A;  3CCS A;  4DUY Q;  2B2U C;  1VQ9 A;  1L1O B;  1SR3 A;  1CZW A;  1LT6 D;  2B2T A;  2VB2 X;  3OTO Q;  4B3S Q;  1SMX A;  3NPP A;  1SYB A;  4RKB A;  1U4R A;  4DV6 Q;  2F3V A;  3D6W A;  1SNO A;  3U4V A;  4RHR A;  3RUZ A;  2XRS D;  4JI5 H;  4C2M B;  2OQ0 A;  4JVY A;  4IN3 A;  4DR7 L;  2K4K A;  3FAU A;  3G6J B;  5CV9 A;  1XMQ L;  1TWA B;  3C46 A;  1IBM Q;  1KHM A;  1GXD C;  1EQT A;  1AE3 A;  2K5Q A;  1F9P A;  3TP8 A;  1G2S A;  5CGK A;  1NMF A;  3S2H H;  1JOQ A;  3HOX H;  3PUX A;  1HZ9 A;  1SYF A;  5EBD A;  5COR A;  1GUS A;  3I4M G;  4DR4 L;  3MHB A;  4DV5 Q;  2Q8I B;  1PHJ A;  3TS2 A;  1PRT D;  3W1G A;  1NSN S;  4ZRZ A;  2WB1 E;  2K5D A;  1V1O A;  4IAL A;  5F2D A;  1W3S A;  2X06 A;  4WAN A;  5TSS A;  3TP7 A;  3EJI A;  1N36 Q;  3CKI B;  1LTS D;  1T5E A;  1Q46 A;  1OXT A;  3K58 A;  2MJ8 A;  2L12 A;  4X65 L;  2M6Q A;  1ET6 A;  3RD4 A;  3K8A A;  3NEM A;  5M3M H;  4DR6 L;  1CUK A;  2PNR C;  4R4Q A;  2IL8 A;  2UXC L;  4KKU A;  4X62 H;  1FNV A;  1EYC A;  3H15 A;  2JQO A;  1HZC A;  4HIO A;  4EQ5 A;  3S1R H;  4B3R L;  1RKN A;  2UUC H;  1TXY A;  1ZTG A;  4HID A;  1TY0 A;  2BH2 A;  3J7Y W;  2F0W A;  5IGB A;  1PTO C;  3J7A V;  1EQV A;  1HTL D;  1I4R A;  4LFC L;  4O2D A;  1ASY A;  3S1Q B;  2K14 A;  2P5Z X;  2QIL A;  1VF7 A;  2UUA H;  3GAB A;  5E7N A;  3PSI A;  2B2W C;  3HOY B;  4BY1 H;  5E4X A;  3M4Q A;  2A6H D;  4AM3 A;  1TY2 A;  4AYB G;  5GAG C;  2Q8R E;  5KRU A;  1M1K C;  4HJ9 A;  3OHX C;  4IFD G;  1NNX A;  4BWG B;  1MI2 A;  3T1H H;  2KHS A;  1WCM B;  2VQE H;  5FO7 B;  5AJ3 Q;  4GKJ L;  1D5X C;  5KND A;  1HNX L;  2CTE A;  3HOU B;  1OO9 B;  4NXM H;  4P72 A;  3CHB D;  2QCP X;  3X3N A;  1VQD A;  5DM7 3;  3V96 A;  1KDC A;  1UNS A;  5M3F G;  4JC0 A;  1TS2 A;  2EYF A;  2O5J C;  3S1M B;  4JI2 L;  3KJP A;  2EYO A;  4DAM A;  2JA8 H;  4LIJ A;  4H02 A;  4YHH L;  1SMY C;  3M3Y B;  1HQR D;  1PTO F;  4RGT A;  1HNZ L;  4BBR H;  4QB4 A;  2JA5 H;  1GM5 A;  2KEC A;  2TMP A;  1AZQ A;  1PYW D;  1QNK A;  1BDO A;  1FNU A;  4U67 3;  5JJK A;  3DWA A;  4NW2 A;  3K59 A;  1X9Z A;  4PZ8 A;  1I94 L;  1KXL A;  3PMF A;  3PIO 3;  2O4C A;  1X3Q A;  2RBM A;  5EPJ A;  2F0O A;  3OOC A;  1Y1W G;  5LMN H;  1F0X A;  3ZYY X;  5CV8 A;  1ESF A;  1YHA A;  2HDM A;  2R93 H;  2Z4I A;  1GHJ A;  2WFW A;  3GTP B;  5GAD C;  4PQX A;  5FJ8 H;  5IYD G;  1VS0 A;  1K3R A;  2YU9 B;  4CDC C;  1VQH A;  2V1C C;  3D31 A;  3J80 W;  4QIW E;  5HY6 A;  4Q5V A;  1PH9 A;  4B3M L;  4JI5 Q;  2HH3 A;  5C44 H;  4CKE A;  1C48 A;  1ESR A;  4KN4 C;  2LXJ A;  4QMG A;  2F0H A;  4YWK A;  2JA6 H;  3CCL A;  2JEB I;  3R2I A;  3J81 L;  4TSS A;  4JI0 L;  4N9T A;  1L0W A;  1U4P A;  5M5W H;  4HJ7 A;  1F9S A;  4LUO A;  4BBS H;  2LFN A;  1N33 H;  3RZD B;  5D3I B;  4C3J H;  2O2L D;  1XWE A;  1LLR D;  4NMZ A;  2WP8 J;  2K05 A;  4DNT B;  1CHP D;  2FMM A;  3D8G A;  1VF5 C;  1MSG A;  2KUM A;  4DV7 L;  4KN7 C;  3TP5 A;  1S40 A;  3PUW A;  3AQQ A;  1IBL H;  1FYC A;  3ND8 A;  4KY7 A;  4OEL B;  2I0Q A;  4K5X A;  4DNI A;  3OIP A;  1KRS A;  2OQK A;  1N34 L;  2R92 G;  4FYD A;  2VQF L;  1C4Q A;  1Z2I A;  2K75 A;  4FF3 A;  2F0T A;  1M4V A;  3PF5 A;  5K36 G;  3DUZ A;  3A7A B;  1K8M A;  2IT1 A;  1KQS A;  2R7Z G;  2UUB H;  2VXW A;  3K57 A;  3IL8 A;  1STY A;  4X62 Q;  1STB A;  2NWG A;  1K73 C;  4LFA L;  4X64 H;  2AKW B;  4LUV A;  5T1G A;  5JPN C;  3R3O A;  2F0G A;  5FO9 B;  4EC5 A;  2A74 C;  1XTD A;  5HUR A;  4IUV A;  2CTL A;  4ZYS A;  4OXP A;  3MFY A;  2K01 A;  2PI2 A;  4B9X A;  3K5O A;  2JA7 B;  3CQZ B;  3L3O C;  3ONA B;  1PTO B;  4C2M H;  4NXN Q;  2VZA A;  2F0F A;  4EVO A;  4JI8 L;  1HR0 Q;  1TWA H;  4A93 B;  2PCF B;  3P7J A;  4C1N I;  1ZYR D;  1HJP A;  2WB1 B;  1YIJ A;  1U4L A;  1SE3 A;  4IZ8 A;  4CJ0 B;  4H13 C;  3KDF A;  3I56 A;  4LF4 H;  1KL9 A;  4GKK L;  2MJH A;  2B29 A;  4L6T B;  3JAM i;  2FIN B;  1D2B A;  3JC6 6;  2N78 A;  4B8C D;  2ZTD A;  1SE8 A;  3K0X A;  5C0X J;  2BCO A;  5C3W A;  1LV9 A;  5COY A;  2L0C A;  5HGT A;  4P75 A;  5ELC A;  1AFP A;  5BR8 H;  2AQ2 B;  2VQE Q;  4JOI C;  1ENF A;  1PH1 A;  1JR0 D;  2CWH A;  4A3K G;  4NXM Q;  5GQO A;  2D5D A;  1PFS A;  1Q7Y C;  2N88 A;  1R4P B;  4YCW A;  1QE6 A;  5A35 A;  2F52 A;  5IIF A;  3K7A B;  2XWB B;  2HCI A;  2K5H A;  1B4O A;  1P16 A;  2AQ1 B;  2OF1 A;  1PFN A;  3OET A;  3KDF B;  4JI4 L;  3DMU A;  2K03 A;  4FNF A;  3HS0 C;  2QF7 A;  4DKA C;  2AHO B;  4OEM B;  4A3F B;  2NVY B;  1DJR D;  1E2W A;  2K5W A;  4DR3 L;  5G3L D;  4HN7 A;  1K8G A;  1Z7T A;  5CR3 A;  4BY7 B;  4NKL A;  3G4S A;  5M9O A;  2OTL A;  1D5M C;  4LF9 Q;  4X6A H;  2G9D A;  5IWA H;  4UAI A;  1EYG A;  1LTG D;  2I5H A; 
#chains in the Genus database with same CATH homology
 4UP9 A;  5IYB H;  3S1Q H;  2A1A A;  5LMN Q;  1Q86 C;  3HOY G;  1HR0 L;  1VQK A;  5C4J H;  2UXD L;  1FJG L;  2ANN A;  2Y0S G;  2CCZ A;  1EUJ A;  2N8N A;  3CP0 A;  5IP9 G;  1X54 A;  1A0I A;  2CTM A;  1WFQ A;  2R7D A;  2ZTC A;  3E0E A;  4DR5 L;  3RN5 A;  2K5N A;  2CPQ A;  2HH2 A;  3CPF A;  1E1O A;  3ERS X;  3HOY H;  4OX9 L;  1E7Z A;  2F3I A;  4R1J A;  2OTJ A;  2A19 A;  2IY5 B;  1DTJ A;  1PYS B;  2PQA A;  1EFW A;  5IP9 H;  3F2D A;  1HZA A;  5GAE C;  1HNW Q;  2VY3 A;  1WCM G;  4EX5 A;  5JJI A;  1X6O A;  4LF5 Q;  4LF8 Q;  4OO1 I;  3K80 C;  1M90 C;  3HOU G;  2L15 A;  3PO3 G;  1KAW A;  3E9H A;  3CCV A;  1BBU A;  4IOA A;  4DR2 L;  2E2H H;  4QY7 A;  1T9H A;  2ATW A;  5ELN A;  2PQU A;  2JK8 A;  4A3M G;  3H3V H;  1BVS A;  1TWH H;  2VQE L;  3CW2 C;  3RLN A;  1XNR L;  1J6Q A;  3HOU H;  5C3E G;  2ZJR A;  4JI6 Q;  1MJE A;  3PO3 H;  1HNX Q;  4K0K Q;  3CPW A;  2UXB L;  3EBE A;  2KEN A;  3IRB A;  1GD7 A;  2F4V Q;  4A3M H;  1X3G A;  3CC2 A;  3KYH C;  3GTK H;  3GTM H;  4KHP Q;  2CTK A;  1YEZ A;  1N33 Q;  4GLA C;  1J5K A;  5C3E H;  1IBK L;  5M5Y H;  2PI2 E;  1VQ6 A;  4X66 L;  3S1M H;  1Y1W H;  2PQA B;  4IOC A;  4LF7 Q;  1K9M C;  3GTJ H;  4YCV A;  3S15 H;  1FGU A;  4BA1 I;  2Q2H A;  2QEX A;  2NN6 G;  1YHQ A;  2Q2U A;  4LW1 A;  4DV3 Q;  4B3T Q;  1PV4 A;  4L5R C;  4A3I G;  3M3Y H;  1E24 A;  3CF5 A;  4R4T A;  4YHH Q;  4IFD I;  1JJ2 A;  2JZX A;  2KCM A;  3PUZ A;  4GOP A;  1HNZ Q;  1IBL Q;  1PH2 A;  2YV5 A;  1K83 H;  2UUC Q;  2WAQ G;  4A3L G;  2FXQ A;  2KHJ A;  4J15 A;  2E2J H;  3KLW A;  4A3I H;  1EQQ A;  3A74 A;  2WAQ E;  4L5Q A;  2GVA A;  4GNX A;  1CKN A;  3S14 H;  3I7F A;  1B70 B;  3F8T A;  3G48 A;  1IZ6 A;  1CSQ A;  4MNO A;  3TQY A;  1J5E Q;  2UUB Q;  4LF9 L;  4A3L H;  2P2R A;  1WJJ A;  2K50 A;  2KHI A;  3M9B A;  4YWM A;  3CCU A;  3RNU A;  5LMN L;  4DR7 Q;  1Z47 A;  5FLM G;  4A3J G;  1YJ9 A;  1XMQ Q;  1Q1E A;  3GTG H;  3Q8D A;  3S17 H;  4A3D G;  2QA4 A;  3OYY A;  1CKM A;  3F2C A;  4RMF A;  2UUA Q;  1TUA A;  4A3C G;  3GTP H;  1OTC A;  2E2I H;  2IHF A;  2YU9 H;  1KHI A;  3I4O A;  4YCU A;  5FLM H;  4A3J H;  2CTJ A;  1QUQ A;  4A3D H;  1VIG A;  1UE5 A;  3I2Z A;  4KI0 A;  4DR4 Q;  4GOP B;  1HNW L;  2JA9 A;  3LGJ A;  1PH4 A;  4A3C H;  1A63 A;  1D8L A;  3FKI G;  4L5T A;  4A4I A;  5GAH C;  5C0X G;  1YNX A;  3TEH B;  4LF5 L;  4LF8 L;  1L1O A;  4NBQ A;  2C35 B;  3V69 A;  2D0P A;  4QMF B;  3JAM c;  1LTL A;  4GNX B;  3T1H Q;  4IFD J;  1VQB A;  5IP7 G;  3GD7 A;  3FKI H;  1V9P A;  4XTC S;  4LF6 Q;  1U5K A;  2HQL A;  3UDG A;  4JI6 L;  4K0K L;  2PMZ E;  4DUZ Q;  3PF4 A;  4DPG A;  1X65 A;  5IP7 H;  2F4V L;  3E9I A;  2B3G A;  4R4O A;  4KHP L;  3AFP A;  3RZD H;  2ANR A;  1XPR A;  4A3B G;  4X65 Q;  1C0A A;  5LMU Q;  4MZ9 A;  2Z0S A;  4ALP A;  2CWA A;  1WVN A;  1O7I A;  3ZJY C;  3KF8 B;  4DR6 Q;  1GO3 E;  2RHS B;  4LF7 L;  1HR0 W;  1ZZI A;  1N32 Q;  2UXC Q;  1XPO A;  1NTG A;  1UE7 A;  1VQG A;  2EXD A;  4DV2 Q;  1PH8 A;  5BR8 Q;  1Y14 B;  4B3T L;  1RL2 A;  1YZ6 A;  3CCS A;  4DV3 L;  4DV7 Q;  2ASB A;  3M4P A;  4DUY Q;  2JVZ A;  1VQ9 A;  4JBW A;  1L1O B;  3HKZ E;  4OWX B;  1GVP A;  1SR3 A;  2QND A;  4POG A;  1IBL L;  2RHQ B;  3OTO Q;  1SRO A;  1EIY B;  4B3S Q;  1VQF A;  2UUC L;  1Q12 A;  3U50 C;  5IYB G;  1SMX A;  2IX1 A;  4A3G G;  2BH8 A;  4GLX A;  3UDF A;  1XJV A;  3KFU A;  2ID0 A;  3FHW A;  3PUY A;  3UDX A;  1C7Y A;  1D7Q A;  4DV6 Q;  3S24 A;  5JEA G;  2GVB A;  2Q2T A;  1IYJ B;  3U4V A;  3CCE A;  4RG1 A;  1I5F A;  1VQM A;  2K52 A;  1J5E L;  2UUB L;  4JV5 Q;  4DV4 L;  1X4M A;  4A3G H;  2OQ0 A;  4JVY A;  1HZB A;  3CCM A;  2DGR A;  3HOX G;  4LFC Q;  4DR7 L;  2K4K A;  3J81 c;  1XMQ L;  1G29 1;  1JE5 A;  4IPH A;  1PH5 A;  1IBM Q;  1KHM A;  1A62 A;  4R4C A;  1E22 A;  3T1Y L;  2UUA L;  2JA7 G;  3S1N H;  1AE3 A;  1YBY A;  1OXX K;  2BA0 A;  3DLL A;  2B63 G;  1NMF A;  3S2H H;  4GN3 B;  3HOX H;  4R4I A;  2LXK A;  3PUX A;  4A93 G;  1HZ9 A;  1VQ4 A;  5GRO A;  3I4M G;  2JA7 H;  4DR4 L;  1EQR A;  2I5M X;  3CQZ H;  4DV5 Q;  2B63 H;  1PHJ A;  3TS2 A;  5IWA Q;  2BL5 A;  2RF4 A;  2WB1 G;  1EYG A;  1XNQ L;  1VQ8 A;  3W1G A;  3PV0 A;  2GN5 A;  4A93 H;  5EAY A;  1VQI A;  2WB1 E;  4JYA Q;  3I4M H;  2PY9 A;  3T1H L;  1HH2 P;  1XMO Q;  2HHH L;  1W3S A;  5J3B A;  1W2B A;  1PH7 A;  4LF6 L;  4GKJ Q;  4WAN A;  2NN6 I;  1N36 Q;  3CXC A;  1VQ7 A;  2KBN A;  4DUZ L;  1PH3 A;  2OWO A;  1Q46 A;  5M3M G;  4WJ3 M;  1ZZJ A;  4NXM L;  3TS0 A;  2CQO A;  1OXT A;  1NY4 A;  4HJA A;  4X65 L;  4DV0 L;  4IJL A;  1YHB A;  2Z6K C;  5LMU L;  5IT9 c;  1IXR A;  5DLQ E;  1L2F A;  2E8G A;  1SN8 A;  1PYB A;  3K8A A;  3NEM A;  1CUK A;  3UE1 A;  5M3M H;  4JI2 Q;  3GTL H;  4R4Q A;  1B7Y B;  3F2B A;  1N32 L;  2UXC L;  1Q8K A;  2VW9 A;  3UE0 A;  3ICE A;  3H15 A;  5BR8 L;  4JVH A;  2JQO A;  1HZC A;  2XTI A;  4JBK A;  3FP9 A;  1U0L A;  4HIO A;  4EQ5 A;  4YY3 Q;  2FMR A;  3CME A;  3S1R H;  4B3R L;  1NBW A;  4HJ8 A;  4BXX G;  1UWV A;  3HKS A;  4NPS A;  4B3S L;  5H1S E;  3L2P A;  1TXY A;  1X9N A;  2VNU D;  1ZTG A;  4HJ5 A;  3OW2 A;  4UPA A;  4HID A;  3CCR A;  3K7A H;  4A3F G;  1EIF A;  1I94 Q;  2NZH A;  4JI3 Q;  2BH2 A;  3CCJ A;  4BXX H;  1YVC A;  3BJU A;  2ZJP A;  4GS3 A;  4DK3 C;  4GLV B;  4PG3 A;  4LFC L;  4O2D A;  1ASY A;  4BY7 G;  4BY1 G;  4A3F H;  2NVY H;  2VL6 A;  2K14 A;  4L5S A;  1IBM L;  3PO2 G;  4KHZ A;  4X64 Q;  2YTV A;  3ULL A;  3VKE A;  4HIM A;  1FVI A;  5E7N A;  2ZM6 Q;  1E3P A;  1BKB A;  4DV1 Q;  3PSI A;  4UP8 A;  4BY7 H;  1X56 A;  1QVG A;  1RIP A;  4BY1 H;  2HT1 A;  3M4Q A;  4GN4 B;  4JBM A;  3PO2 H;  1QZH A;  4AM3 A;  3KJO A;  4B3M Q;  1TWF H;  1V43 A;  4AYB G;  1NJI C;  3VDY A;  5GAG C;  2R6G A;  4DV5 L;  3RZO H;  3U1K A;  4FDB A;  4QGU A;  1EOV A;  1WYD A;  3J7Z C;  1LYL A;  4JOI A;  4ME3 A;  4MTN A;  4AYB E;  4HJ9 A;  1M1K C;  3TRZ A;  1YI2 A;  4IFD G;  1I6H H;  1JJC B;  1Y1V G;  1VQA A;  4PMW A;  4Y7N H;  3PIP A;  2IX0 A;  3AYH B;  4QQB X;  1P8L A;  3B6Y A;  5ELO A;  2IHE A;  3WWV A;  4QJF A;  4YWL A;  5AJ3 Q;  4GKJ L;  2CTE A;  1HNX L;  4DR1 Q;  4OX9 Q;  1N9W A;  4JI0 Q;  1Y1V H;  2NVT H;  1UE1 A;  4JCV E;  5M5X H;  1NE3 A;  3RLF A;  4P72 A;  3W5O A;  1VQL A;  1PVO A;  3PCO B;  4LF4 Q;  1VQD A;  2ZJQ A;  1N33 L;  4TQU S;  5M3F G;  1QVF A;  3CAM A;  2JA8 G;  3KOJ A;  1CKO A;  4JC0 A;  5FLX c;  3D0F A;  3F1Z A;  4BBR G;  2JA5 G;  1R9T H;  3KJP A;  4JI2 L;  2ES2 A;  3HKZ G;  2NZO A;  4DAM A;  1KD1 C;  4Y52 H;  4OWT B;  2VUM G;  5M3F H;  1LUZ A;  1ASZ A;  2JA8 H;  4LIJ A;  2YTX A;  4H02 A;  1XNR Q;  4YHH L;  4YY3 L;  1MKH A;  1HNZ L;  4BBR H;  3A5U A;  2JA5 H;  4AIM A;  1N34 Q;  4DK6 C;  1GM5 A;  2R7F A;  4IPC A;  2VUM H;  1I3Q H;  1CSP A;  5IE8 A;  2VQF Q;  4AQY Q;  1PH6 A;  1XNQ Q;  3I4N G;  5JJK A;  1IBK Q;  4PZ8 A;  1I94 L;  3PGZ A;  1KXL A;  2EQS A;  3S2D H;  3AEV A;  2R93 G;  4XIG S;  4LFB Q;  2E5L Q;  1ZZK A;  4LUZ A;  1JMC A;  3H3V I;  2Q2I A;  1Y1W G;  3I4N H;  1VCI A;  2UU9 Q;  3GO5 A;  1YIT A;  5C4X G;  4JG2 A;  3GTQ H;  3J7A 5;  1AH9 A;  4LFA Q;  1YHA A;  4X64 L;  2R93 H;  1GKH A;  2YYZ A;  4LNQ A;  3RN2 A;  3A0J A;  1X3E A;  2ZM6 L;  5C44 G;  3CD6 A;  1Q1B A;  2WFW A;  4DV1 L;  2AMC B;  5FJ8 H;  2JJQ A;  5IYD G;  5GAD C;  1VS0 A;  1K3R A;  5C4X H;  2NVX H;  1VQH A;  2V1C C;  3D31 A;  2CKZ B;  4QIW E;  5HY6 A;  3W1B A;  3BZK A;  1PH9 A;  4B3M L;  4OWW B;  1YJN A;  4JI5 Q;  1V1Q A;  1VQE A;  3S16 H;  1BBW A;  4AH6 A;  5C44 H;  2HH3 A;  5JEA J;  4JI8 Q;  5IYD H;  2LXJ A;  3RLO A;  1Z9F A;  3A5Z B;  4QL5 A;  1G51 A;  4PZ6 A;  4YWK A;  3J81 j;  3CC7 A;  4OON A;  2JA6 H;  1Q81 C;  1S3O A;  3CCL A;  4BBS G;  2AWO A;  2JEB I;  3AEV B;  4IJH A;  2Y0S E;  4GN5 A;  3J80 i;  1J4W A;  1VQO A;  1OXU A;  2OPU A;  5IYC G;  4KLK A;  3MEF A;  5AJ3 L;  4DR1 L;  2Z6K A;  3K81 C;  4APV A;  3J80 c;  1WOC A;  3TRE A;  4JI0 L;  1EC6 A;  1L0W A;  3MXN B;  5M5W H;  2LSS A;  4HJ7 A;  4BBS H;  4LUO A;  3KF6 A;  4LF4 L;  4GKK Q;  4WJ4 A;  5IYC H;  4C3J H;  2ALY B;  4LWC A;  4UP7 A;  4B8T A;  1AE2 A;  4A3E G;  1VQC A;  2XGT A;  4P74 A;  2WP8 J;  1VIH A;  5LMN W;  2E3U A;  1FL0 A;  4DV2 L;  1WCM H;  1I50 H;  1VQP A;  1SFO H;  4DV7 L;  4DUY L;  1S40 A;  3U4Z A;  1X3F A;  3PUW A;  3AQQ A;  1UE6 A;  2MQH A;  4A3E H;  1H95 A;  1KRT A;  2CFM A;  2NVQ H;  2ZTE A;  3PIO A;  2I0Q A;  3OTO L;  2MO0 A;  2DGY A;  4DNI A;  2OPV A;  1KRS A;  2OQK A;  1YJW A;  3HFZ B;  1N34 L;  1IL2 A;  2R92 G;  4OO1 G;  3BU2 A;  3GDE A;  2VQF L;  4AQY L;  1VQN A;  1PA6 A;  2K75 A;  4TVA B;  3UDI A;  1DT4 A;  4JI1 Q;  4DV6 L;  3PF5 A;  4BA2 I;  5K36 G;  2HIV A;  2IT1 A;  1KQS A;  3EN2 A;  2R92 H;  1OXV A;  3G6E A;  2R7Z G;  4JV5 L;  4LFB L;  4X62 Q;  2E5L L;  2JE6 I;  1MJC A;  2VS1 A;  3KF6 B;  4POF A;  4JI4 Q;  5C0X I;  2UU9 L;  2EIF A;  1B8A A;  1K73 C;  5JJL A;  3GTO H;  4LFA L;  2AKW B;  4LUV A;  4DR3 Q;  1N8R C;  2R7Z H;  1DGS A;  4A75 A;  2YTY A;  2K5V A;  1OXS C;  1SLJ A;  1XTD A;  2D62 A;  4JI7 Q;  2AWN A;  2CTL A;  4JBJ A;  3I55 A;  4OXP A;  4GOP C;  2CWP A;  3M4O H;  4P71 A;  1TWG H;  3K7U C;  2AXY A;  3ULJ A;  2OCE A;  2PI2 A;  3RR5 A;  5IWA L;  3H0G G;  4C2M H;  4JI5 L;  4NXN Q;  3HOV G;  1SRU A;  2VZA A;  3AFQ A;  3HOZ G;  4DV4 Q;  3BZC A;  4JI8 L;  1HR0 Q;  1C9O A;  1TWA H;  4DAY B;  4GNX C;  1FJG Q;  1QVC A;  4JYA L;  1KIX A;  1X55 A;  3CC4 A;  2A8V A;  3DM3 A;  1E1T A;  3T1Y Q;  3H0G H;  1XMO L;  3HOV H;  4DR5 Q;  2BA1 A;  3HOZ H;  1HJP A;  1G6P A;  1Q82 C;  1QZG A;  2MNA A;  1YIJ A;  1N36 L;  2CTF A;  4NB3 A;  1UEB A;  3L0O A;  3M85 A;  3U58 A;  2I5L X;  1K0R A;  2PNH A;  1NMG A;  3G71 A;  3CCQ A;  3STB D;  3KDF A;  3NBH B;  3I56 A;  1KL9 A;  4GKK L;  2MJH A;  2B29 A;  4O0A A;  4C3H H;  1VQ5 A;  2HIX A;  3JAM i;  5HGQ A;  1TWC H;  4C3I H;  3NEL A;  3JC6 6;  2N78 A;  4IPD A;  2ZTD A;  4PZ7 A;  1SE8 A;  3K0X A;  5C0X J;  4DR2 Q;  3PUV A;  4A76 A;  2MFI A;  4IPG A;  3M7N A;  4WAL A;  3CMA A;  1CKN B;  1A8V A;  4P75 A;  3STB C;  2VQE Q;  2HHH Q;  4JOI C;  1JJG A;  1L1O C;  2QGQ A;  4UY8 C;  4IO9 A;  3L7Z C;  2UXB Q;  1PH1 A;  3HOW G;  1VQJ A;  4A3K G;  4NXM Q;  5GQO A;  2YQR A;  1PFS A;  1Q7Y C;  1LM0 A;  4YCW A;  1K8A C;  2MO1 A;  2F52 A;  3SGI A;  4HIK A;  4DV0 Q;  4JI1 L;  4JI3 L;  4X66 Q;  3HOW H;  3ULP A;  2JEA I;  4A3K H;  1QUQ B;  2K5H A;  1P16 A;  4X62 L;  2N3S A;  2UXD Q;  3KDF B;  4JI4 L;  1JT8 A;  2DUD A;  5FJ8 G;  4DR6 L;  5IY0 A;  4DKA C;  2RCN A;  2AHO B;  1KC8 C;  4A3B H;  1WI5 A;  4B3R Q;  4DR3 L;  1WE8 A;  3EIV A;  2H5X A;  1XPU A;  1K8G A;  1MIU A;  2KCT A;  4JI7 L;  1X4N A;  1K1G A;  1JB7 A;  1EWI A;  2D0O A;  3G4S A;  3ER0 A;  1S72 A;  2OTL A;  2JA6 G;  2N49 A;  4P73 A;  4LF9 Q;  4X6A H;  4NXN L;  3J81 i;  2I5H A;  3NEN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...