2JA9A

Structure of the n-terminal deletion of yeast exosome component rrp40
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
175
structure length
175
Chain Sequence
KRYIPSVNDFVIGVIIGTFSDSYKVSLQNFSSSVSLSYMAFPNASKKNRPTLQVGDLVYARVCTAEKELEAEIECFDSTTGRDAGFGILEDGMIIDVNLNFARQLLFNNDFPLLKVLAAHTKFEVAIGLNGKIWVKCEELSNTLACYRTIMECCQKNDTAAFKDIAKRQFKEILT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Biochemical Characterization of the Yeast Exosome Component Rrp40
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
molecule keywords EXOSOME COMPLEX EXONUCLEASE RRP40
total genus 43
structure length 175
sequence length 175
ec nomenclature ec 3.1.13.-:
pdb deposition date 2006-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF15985 KH_6 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2ja9A01
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 2ja9A02
4B3RQ 2BH8A 2KCTA 5J3BA 1VQLA 4A3IH 3PF4A 2NN6G 2MO1A 1WYDA 3KLWA 4DV3Q 2B3GA 1PH5A 4YCWA 4LFBL 4DV0Q 1HR0L 3GTOH 2OQKA 1XPUA 3RZOH 1IBKQ 4BA2I 5IP9H 4JI3L 3TS0A 1ZZKA 1OXTA 2IX1A 4DUZL 3HOYG 3EN2A 1K83H 1CUKA 1OXUA 2YTXA 1EIYB 4LF8L 3PO2H 4UP9A 1OTCA 1L1OC 1YZ6A 3RLFA 4A3JH 4KLKA 2CKZB 4AYBE 2VW9A 1Y1WG 1HNXL 1V1QA 3K8AA 3L0OA 1YJ9A 2ZM6L 1HNZQ 1PA6A 4LF5Q 2QNDA 3RR5A 1H95A 1VQ7A 4IPCA 4JBWA 1G291 3ERSX 4UP8A 1E22A 3J80c 1D7QA 4DV0L 2N8NA 1EUJA 2L15A 1VIGA 4RG1A 4EQ5A 4HIDA 4UP7A 4XIGS 4HIMA 3HOWH 3PV0A 2HH2A 1CKNA 1Q46A 4JOIC 2DGYA 4K0KL 1VQJA 3CCEA 2KHIA 3NELA 4DUYL 3KDFB 1XNRL 2NN6I 2R7FA 1HZ9A 1VQHA 2BA0A 3S16H 4DV1L 3CAMA 2UU9Q 3I2ZA 4PMWA 1KAWA 3TREA 1N34L 1A62A 3JAMi 2BH2A 4A3EH 1LUZA 4C3JH 2CPQA 1AE2A 1GVPA 4X65L 3VDYA 4HJ5A 2JA7H 3A74A 4AIMA 3MEFA 2VUMG 1X3EA 2ANRA 2Q2UA 5LMNW 3HOZG 1XMOQ 1Z9FA 1VQ5A 4DV6L 1YIJA 4AQYL 2VY3A 5M5WH 1MJCA 1X56A 2KBNA 3U4ZA 4BBSH 1UE7A 1K9MC 2RHQB 4TVAB 3K0XA 3UDXA 4A76A 4BY1G 2PI2A 1XPOA 2OWOA 2F4VL 1N32Q 1IZ6A 3G6EA 3HFZB 1TXYA 4A3DG 1E3PA 2RF4A 4QIWE 1HH2P 3HKSA 2B63G 4A3GH 4IOCA 4X6AH 1HNWQ 4TQUS 4NXNQ 2R93G 4Y52H 4DUYQ 1X65A 2UUCL 1X54A 4POGA 2D0PA 2VZAA 3TS2A 2AWOA 3CQZH 5GROA 4OONA 4QGUA 4LNQA 4B8TA 2MO0A 2VQEQ 4JG2A 3W5OA 3K7AH 4O0AA 4DV4Q 3G48A 2CWPA 1MIUA 5JEAJ 1VQBA 5C44H 1QUQB 4GN3B 1N32L 2K5VA 2PQAB 3CC2A 2ZTDA 4R1JA 5C0XI 2ZJRA 4JI6L 1SRUA 3BJUA 1D8LA 1UE5A 4DR2Q 2A8VA 1ZZJA 2CTLA 1XMOL 2Q2IA 4AH6A 5GAGC 2DGRA 1WCMH 2EIFA 1PH8A 1DT4A 5ELOA 4LFBQ 2Z0SA 3W1BA 4GNXA 2JA6G 2JA8G 3S14H 3V69A 1KHIA 1U5KA 4NXMQ 1QVCA 2Z6KA 3IRBA 3T1YL 3PUVA 3PO3H 1KQSA 3PF5A 4R4OA 3ULLA 2R7DA 4A3MH 1YJWA 3S1RH 1VS0A 3CF5A 2Q2TA 1IBMQ 4YCVA 3FP9A 5C0XG 1TWGH 2HHHQ 2LSSA 5IYCH 1Y1VG 4YWLA 2DUDA 5GADC 1Q1BA 4IPDA 5H1SE 1VQKA 4APVA 2EQSA 4C2MH 4GOPA 1NE3A 3PCOB 3A5UA 5M3FH 3F1ZA 3CC7A 4LFCQ 3TEHB 2NVQH 3DLLA 2ZTCA 1YEZA 4DR6L 3CP0A 2KHJA 2K75A 3BZCA 4WANA 2HH3A 3EBEA 1TWFH 2OQ0A 3PIOA 1WVNA 1XNQQ 1P16A 3H3VH 1JJCB 4JI7Q 3OYYA 1IBLQ 3Q8DA 4KHPQ 4OO1I 3CCMA 3S1NH 3AQQA 5IT9c 3OTOQ 1YVCA 5JEAG 1S72A 1EWIA 4NPSA 2UUCQ 4DV2Q 2CTEA 2JA9A 2MQHA 1IXRA 3K7UC 4X64Q 4IFDI 3M85A 2ZJPA 4NBQA 3GTQH 2UXCQ 1HR0W 2HHHL 5C4XH 2ID0A 3B6YA 4DNIA 1RIPA 4C3HH 4HIOA 4A3FG 4LF6L 2OTJA 4JI0L 2F4VQ 2CTJA 5AJ3Q 3AEVA 1J6QA 4HJ8A 2XTIA 5M3FG 4MTNA 4P75A 4OWWB 1G6PA 1L2FA 2PNHA 4JI2Q 3KF8B 3RN2A 1IL2A 4A3LH 1WI5A 1Y1VH 1YHBA 3S2HH 3HOXH 3PIPA 3U58A 1PH2A 3U50C 1JJGA 1VQPA 5M3MG 1UE6A 5M5YH 3H0GH 4BY7G 4A93G 1I3QH 1Q8KA 1HZCA 1Q1EA 3FHWA 1K3RA 4KI0A 5FLMG 4X66Q 3GO5A 2QEXA 4JI8L 3I7FA 4KHZA 5BR8Q 4B3ML 3S17H 2ZJQA 1WOCA 3TRZA 4JI3Q 5C4XG 4L5TA 1ASZA 3AFPA 3NEMA 4GLAC 4HIKA 2JEBI 4WJ3M 2PI2E 1CSQA 1Y14B 4P71A 4LFCL 1EQRA 2UUBL 3U4VA 4MNOA 1X4NA 4WALA 2CQOA 2PQUA 5FLMH 1V43A 3GDEA 4QJFA 3I56A 2UUAL 4A93H 4B3RL 1BBWA 5M3MH 3HOXG 3KDFA 4A3KG 1FJGL 1C0AA 1AH9A 4JI5L 4DK6C 2ES2A 5IE8A 4LF9L 3RNUA 3RLOA 4DPGA 3S2DH 4JBJA 1PHJA 1YNXA 3OW2A 3PUXA 2JEAI 2UXBQ 1KHMA 2QA4A 2ZM6Q 4A3FH 1Q81C 4OX9Q 4AQYQ 1HZAA 1I5FA 4IPGA 3KF6B 4IOAA 2JVZA 4JI8Q 5BR8L 4B3MQ 4A3DH 1U0LA 1J5EL 4R4TA 5EAYA 2JQOA 3I55A 4A3KH 2GVAA 4DR1L 5GQOA 1JE5A 1NY4A 1SFOH 2YU9H 1M1KC 4LUOA 4BY1H 2V1CC 1EIFA 3AYHB 4LFAQ 4DR6Q 4JVHA 4JBKA 2HIXA 2OPVA 1P8LA 2CTMA 1JB7A 4HJ7A 4OO1G 1L1OB 2E8GA 1XNRQ 2KCMA 3K80C 4YY3L 1VIHA 2JA7G 1FJGQ 3BU2A 4LUZA 2NVYH 2Y0SE 2LXJA 4P72A 1T9HA 3H3VI 4P73A 4X64L 2FMRA 3H0GG 1EQQA 4X62Q 2VQFL 4GOPC 4B3SQ 2ATWA 4BY7H 1Q12A 1I6HH 3J7ZC 3RZDH 5IYCG 4JOIA 3CCVA 4A3LG 3EIVA 4GN5A 4KHPL 1CKMA 1OXSC 4DKAC 4A3MG 3BZKA 1GKHA 1AE3A 4POFA 4LF7L 4JV5L 1WJJA 4HJAA 2C35B 1K8AC 1PH6A 3GTMH 4GNXB 3PO3G 3HKZE 3LGJA 4L5QA 1IBKL 5JJIA 4A3GG 1YJNA 2YYZA 1XMQQ 4A75A 2WB1G 4IJHA 4MZ9A 4NB3A 3J81c 2E5LQ 1WFQA 4DR4L 2JA6H 3CCQA 2QGQA 5GAHC 2UXDQ 1XNQL 1WCMG 4PG3A 2UU9L 2UXBL 4P74A 1VQAA 4FDBA 2AXYA 4OWXB 1LYLA 1I94Q 1PYSB 4NXNL 3UDIA 1N36L 2UXCL 1VQOA 3HOZH 2LXKA 1A0IA 1G51A 1VQEA 3RLNA 3KJOA 4LFAL 4QMFB 2IHEA 3F2BA 2ANNA 3OTOL 2E5LL 1QZGA 4DV5Q 2AKWB 1XTDA 4LIJA 4DR1Q 2R93H 1HNXQ 3U1KA 5JJKA 4JV5Q 3GTJH 3TQYA 1M90C 2B63H 3S15H 4OWTB 4DR2L 4X66L 1KD1C 3W1GA 2PY9A 1BVSA 1QZHA 3HOUH 5E7NA 2JK8A 1R9TH 3NBHB 2F3IA 1VQGA 3HOWG 2B29A 3KJPA 3E0EA 4BBSG 1GD7A 4DV3L 1KL9A 3UE0A 1EOVA 2VQEL 4JI2L 1HR0Q 4JI1Q 4DV4L 4DV5L 1VQDA 1UE1A 4JI0Q 2Z6KC 1JT8A 2N78A 5AJ3L 4XTCS 4JBMA 1PVOA 2NVXH 5IYBH 4GNXC 2JA8H 1GM5A 1HNWL 4A3EG 3VKEA 2OTLA 1CKOA 2H5XA 3PGZA 1Y1WH 1JMCA 4IFDG 4A3JG 3NENA 4GKJQ 3CCJA 1DTJA 3D31A 3A5ZB 2K50A 2VL6A 5M5XH 2N49A 1EFWA 1OXVA 4YHHQ 4NXML 4DR5Q 3GD7A 3PUZA 2Y0SG 3JAMc 2UXDL 2JJQA 1IBLL 5K36G 1VQ4A 4JCVE 1RL2A 2RHSB 5C44G 4A3IG 4DV6Q 3PUWA 1TUAA 4DV7Q 4J15A 3F2CA 1KRSA 4ME3A 1PV4A 1VQCA 1PH3A 4LF8Q 4UY8C 1E24A 5HY6A 3G4SA 4OXPA 1SE8A 1YBYA 5ELNA 1A63A 1N8RC 3A0JA 2K52A 2HT1A 2I5MX 4A4IA 1SROA 1TWHH 3CCLA 2CWAA 4C3IH 4R4CA 4RMFA 2NZOA 3S24A 4JI5Q 1W3SA 2VQFQ 4B3SL 3HOYH 3PO2G 1YITA 2AHOB 5IP9G 1FVIA 4QL5A 3S1QH 2NVTH 1GO3E 2IHFA 5C4JH 2YQRA 4LWCA 4YWMA 3UDGA 2MJHA 1I50H 3CD6A 5JJLA 1N33Q 2VUMH 1K1GA 4GLVB 3F2DA 3JC66 3UDFA 1HZBA 1O7IA 1WE8A 4AYBG 3ULPA 3RN5A 4L5SA 3I4NG 1J5EQ 4AM3A 4R4QA 3E9HA 1TWCH 1QVGA 1HNZL 1Q7YC 2E2IH 3F8TA 3J81i 1J4WA 2R6GA 3PUYA 3ER0A 5DLQE 2F52A 4A3BG 4DR3Q 4QQBX 3GTPH 1MJEA 2CTFA 1N33L 1SMXA 2WAQG 2AMCB 4X62L 3HOVH 5FLXc 3CPWA 1K8GA 1N36Q 1DGSA 3WWVA 4BA1I 4GN4B 3KFUA 1ZTGA 1B70B 1CKNB 1SLJA 3PSIA 2WAQE 1PH9A 1I94L 1QVFA 3S1MH 4LUVA 3I4MH 1KRTA 2WB1E 2R92H 4B3TQ 4JI4Q 2HIVA 4LF4Q 1L1OA 3HKZG 1MKHA 1IYJB 5IP7G 1V9PA 5LMNL 1QUQA 2GVBA 3FKIH 4Y7NH 4JC0A 4IJLA 1X3GA 2A19A 3D0FA 3L7ZC 3CMEA 3CW2C 4GOPB 2I0QA 1PH7A 2Q2HA 4GLXA 1VQMA 3E9IA 1KXLA 1C9OA 1FGUA 2R92G 3I4MG 4IFDJ 1A8VA 5IYDG 4L5RC 2CTKA 3I4OA 1VCIA 4DUZQ 3M7NA 1W2BA 2ZTEA 3CXCA 4DR5L 4HJ9A 1X3FA 1K0RA 1PFSA 3CCSA 2K14A 3UE1A 3KOJA 4BBRH 2K5HA 3J81j 1YI2A 1XJVA 1Q82C 4LF7Q 3HOVG 1NJIC 3M4OH 4DV1Q 4DR7Q 1X55A 3SGIA 1UEBA 1LTLA 4DK3C 2MNAA 3H15A 4DAYB 3GTKH 4A3BH 1Q86C 1B8AA 5GAEC 2YTVA 2BA1A 4GS3A 1NBWA 4LF6Q 2BL5A 2K4KA 4QY7A 4JVYA 1VQFA 4LF4L 4PZ6A 3STBD 5IWAL 4GKJL 1NMGA 3KYHC 1NMFA 2UUBQ 4K0KQ 1Z47A 2PQAA 5IY0A 1FL0A 2JA5G 3AEVB 4PZ8A 3T1HL 2HQLA 3CPFA 3KF6A 2IT1A 4JI1L 4LF5L 2R7ZG 4GKKQ 2E2HH 4DR3L 4LW1A 2ALYB 4YWKA 1JJ2A 4R4IA 4X65Q 2EXDA 2OPUA 1PH1A 1EYGA 1ZZIA 5IP7H 4JYAL 4O2DA 3ULJA 2IX0A 2GN5A 4JI7L 1HJPA 5C3EG 4A3CG 4OX9L 4GKKL 2NZHA 3M9BA 2VS1A 5FJ8H 3GTGH 1S40A 2P2RA 3ZJYC 1E1OA 1SR3A 2OCEA 3T1HQ 4YHHL 1CSPA 1NTGA 2WFWA 4JI6Q 4BXXH 1VQ8A 4BXXG 2I5HA 1IBML 3M3YH 2E3UA 5LMNQ 2JZXA 4IPHA 2KENA 2JE6I 5C0XJ 1UWVA 5FJ8G 5IWAQ 4IO9A 4ALPA 2E2JH 4LF9Q 1LM0A 3MXNB 2D62A 3CC4A 5C3EH 2RCNA 4A3CH 1PYBA 1XPRA 2YV5A 1BBUA 1KIXA 3ICEA 1VQIA 1OXXK 1L0WA 4DAMA 2AWNA 1YHAA 3K81C 2CFMA 4YY3Q 3L2PA 1XMQL 4DR7L 3FKIG 1VQNA 2MFIA 1YHQA 2R7ZH 4DR4Q 5LMUL 2IY5B 3STBC 2A1AA 3DM3A 1X6OA 2ASBA 2JA5H 3CMAA 2YTYA 2N3SA 3AFQA 5IYBG 4JYAQ 1N9WA 1VQ6A 4WJ4A 5HGQA 1VQ9A 4H02A 1KC8C 1TWAH 2K5NA 4DV7L 1PH4A 1EC6A 1BKBA 2XGTA 4EX5A 1B7YB 1K73C 2I5LX 4YCUA 2VNUD 1X4MA 2PMZE 2D0OA 1N34Q 5LMUQ 3G71A 4UPAA 3HOUG 3CCRA 3J7A5 1S3OA 1SN8A 2FXQA 1ASYA 3M4QA 4BBRG 4B3TL 2CCZA 4JI4L 3GTLH 2WP8J 4DV2L 1E1TA 1X9NA 3J80i 1E7ZA 3CCUA 3T1YQ 4PZ7A 3I4NH 3M4PA 1J5KA 1C7YA 5IYDH 2UUAQ
chains in the Genus database with same CATH superfamily
2HDLA 3VA7A 4N8FA 4A3IH 2MO1A 4DV3Q 1D1IA 3J81E 3TN2A 5FLXL 3DEOA 1XPUA 4EVOA 1OXTA 2R61A 4KLKA 3P20A 5DAUA 3D4WA 2VW9A 4N8X1 1HNZQ 3L0OA 2ZM6L 3FPPA 4DV6H 5CV6A 4HSVA 4IPCA 3ERSX 1LTRD 4J1MA 1E22A 4DV0L 1KDBA 4B3SH 1S5BD 1JORA 4XIGS 3HOWH 2Q8TA 1Q46A 1VQJA 1CQFA 1BCPB 2PO4A 1XNRL 1HZ9A 2BA0A 2OXPA 1YNND 4DV1L 2UU9Q 3SDZA 4PMWA 1KAWA 3HOXB 1A62A 3MXPA 1YNJD 3FRPB 3JAMi 3FKIB 4X65L 2ANRA 4HJ5A 2B2WC 3MEFA 2Q2UA 1WTRA 2UXCH 1XTCD 2R7ZB 1XMOQ 1VQ5A 4CDEC 1YIJA 1HRJA 2VY3A 5M5WH 1X56A 2OT2A 3U4ZA 4A76A 1N33H 3QJYA 1N32Q 2LRRA 1E3PA 1WTWA 2RF4A 1HH2P 2HD3A 2X06A 2B63G 4TQUS 4K2LA 1R9TB 1X65A 1X54A 3KBXA 2D0PA 4POGA 1ONLA 2AWOA 3CQZH 4OONA 4B8TA 2AUJD 1KDCA 1GUOA 3W5OA 5JEAJ 5IGEA 2F0EA 4GN3B 2PQAB 4QMGA 3DUZA 5E3FA 1D8LA 2HDMA 1IL8A 1XMOL 1SNOA 2EIFA 4IQZA 1DT4A 4LFBQ 3OMGA 2Z0SA 3W1BA 3V69A 4DR5H 4XQJA 3GTPB 4YHHH 1KHIA 2F0JA 3RF2A 4NXMQ 2CH4W 1HXYD 1QVCA 1K83B 4XT1B 3A8IE 3T1YL 5EPJA 4F8MA 1KQSA 4R4OA 2BDNA 3LX0A 2R7DA 3OWEB 2WB1B 5JOBA 1YJWA 1HTPA 1VS0A 1XNQH 3CF5A 4YCVA 1SSOA 2HHHQ 1TWGH 4AQYH 2LSSA 1LO5D 4IPDA 5H1SE 4BBRB 2EQSA 1N32H 3N52A 1SXTA 3BVMA 1DOLA 1GUWA 3TP6A 3DLLA 2NVQH 2XRQD 3CP0A 3R8BA 2K75A 3BZCA 5M3MB 1E2ZA 2HH3A 2KEDA 3Q23A 4H8AA 4JI7Q 3ONAB 1U4MA 3CCMA 1CI3M 3OTOQ 2CW0D 5CGKA 3K57A 1IKMA 1EWIA 2UUCQ 4DV2Q 1HNZH 4X64Q 4FVMA 2ZJPA 2QILA 1C48A 2YU9B 2KJXA 4A3IB 1HR0W 2XSCA 2ID0A 3B6YA 1RIPA 2OTJA 2NTSA 3EROA 5A2QW 2XTIA 5IT9L 4ZQ3A 1UG8A 1ENFA 1L2FA 3KF8B 1IL2A 4A3LH 2D5DA 1H9SA 2MGSA 4BY7G 4A93G 1TS3A 3BVGA 5FLMG 1O7ZA 2A68D 2NYZD 1PRTC 4FXKC 1X9ZA 3S17H 1EWHA 3J80W 1WOCA 3TRZA 5C4XG 3T56B 4JI2H 4XXEA 4X62H 4CKBA 2DN8A 3U4VA 2CQOA 1V43A 3GDEA 4B3RL 5KYIA 1O80A 3GTMB 4A3KG 2ES2A 4LF9L 1A2TA 4DV7H 3A7AB 1F9QA 3KLSA 4DPGA 3NHHA 4JBJA 5C3EB 1B44D 1Y1VB 5C4JB 3NQIA 3OW2A 4A3KB 4DA2A 3K5NA 2UXBQ 1KHMA 1UUPA 4O42A 1Q81C 4AQYQ 4OX9Q 2JVZA 3K6OA 3VR3A 5FO7B 1U0LA 2A6EC 4GKJH 2JQOA 3I55A 2GVAA 4DR1L 1SEBD 5JVG3 5GQOA 4BY1H 2YU9H 1M1KC 1TKWB 2OPVA 4OIKA 4NMZA 4LFCH 1W6JA 3KLRA 5T1IA 4HTHA 1HUNA 1L1OB 1K3BC 2E8GA 2KCMA 2MHVA 3MZ5A 1IYUA 4G57A 4XQQA 4A93B 1BOSA 3BU2A 1S03G 4LUZA 5FLXW 4X3SA 4B3MH 1EL0A 3MA2B 2EYPA 2VB2X 2VQFL 2ATWA 1EIHA 1X0AA 3A8JE 1I6HH 5FLXE 1SMYD 3RZDH 4JOIA 2UUAH 2KQ3A 4GN5A 1QNUA 4DR3H 4A3MG 3BZKA 1GKHA 3Q6SA 2EY5A 3SR1A 1BR9A 4HJAA 1PH6A 2E74C 1R4QB 4DAYA 2YYZA 1XMQQ 2K6AA 4MZ9A 3JAML 1IBKH 2JA6H 3CCQA 2PMZB 5JEAH 1KNEA 2AXYA 4OWXB 1CT1D 1PYSB 2RA4A 1EYAA 3PQIA 2UXCL 5I4DA 3HOZH 3EVQA 2F0WA 2AUKA 2FINB 4RH6A 2P5ZX 2IHEA 3F2BA 3Q22A 3S1QB 1RHPA 4DV5Q 4NW2A 1SJHD 1KD1C 2EDGA 2PY9A 5A2QL 2CW0C 2JK8A 1R9TH 4F87A 3NBHB 5COYA 4RGOS 1GD7A 2R92B 1JB3A 5T1GA 1HR0Q 2BE5D 3G6JB 1V9NA 2Z6KC 4Z9CB 5IYBH 3GTGB 1I6HB 3RMHA 2OTLA 3PGZA 2UXCQ 5JAVA 3SK8A 4GKJQ 1DTJA 3AB9A 1HQRD 2JA7B 2K50A 4C2MB 2EYHA 2PNRC 1WTVA 2Y0SG 5CV7A 4DK1A 3M7GA 5CV4A 5K36G 2SOBA 4DV6Q 2FPHX 1TUAA 1SYDA 4DV7Q 5D65A 3KF8A 4ME3A 2BCOA 3EJIA 4CJ2C 4IUVA 3G4SA 1YBYA 3A0JA 4KY7A 4QUCA 2I5MX 2M9VA 2EJFC 3CCLA 1FKAH 4C3IH 2L0CA 2VQFQ 2F0TA 3HOYH 3S1QH 2IHFA 5C4JH 4LWCA 2FHTA 3R2IA 2SNSA 2L9HA 3CD6A 2RKSA 3V05A 4BBSB 2C9OA 3UDFA 4KD4A 2O4CA 1O7IA 1WE8A 1N34H 3E5SA 4R4QA 1QVGA 1HNZL 4B8CD 1A3TA 1L0YB 3J81i 1J4WA 3TDQA 2PCFB 5C5MA 1D6EC 4B08A 1N33L 1T5XD 4RAUC 2B2UA 4DR4H 3KFUA 1ZTGA 2F0IA 2M00A 3PSIA 3C46A 5FOBB 3SEBA 1R4PB 4B3TQ 4LF4Q 1L1OA 2HCIA 5IP7G 2ZXOA 2GVBA 3CRLC 4IJLA 1X3GA 3L7ZC 3EA6A 1EY7A 1PH7A 2Q2HA 1VQMA 2EY2A 1FGUA 2JSOA 2JYOA 2CTKA 3K5MA 1IYVA 4DR5L 1K0RA 2NTTA 2F0SA 2K14A 4LF7Q 2K5HA 3IAYA 3OSOA 1NJIC 3SGIA 3H15A 3KBGA 1LTLA 2MNAA 1Q86C 1B8AA 5EJWA 5GAEC 2BA1A 4JK1C 3J80E 4C3JB 2ICIA 3RUZA 4LF4L 4PZ6A 5IWAL 2WV6D 1JOQA 4GKJL 2IWHA 2UUBQ 3KYHC 5D3IB 1S20A 2QEJC 2IT1A 5A2QE 1HA5A 2R7ZG 4GKKQ 4YWKA 2K33A 1FGBD 2F0LA 1EYGA 5IP7H 3DEPA 3ULJA 2IX0A 2GN5A 4JI7L 2E76C 5E4WC 4BS9A 2K7VA 2VS1A 2K04A 3PIP3 3GTGH 1CHPD 2CQAA 3X3NA 3ZJYC 1E1OA 4L8JA 5KEEA 1VQ8A 2JZXA 3MHBA 4IPHA 4QIWB 1BBXC 3A7LA 1LM0A 3MXNB 1PYBA 4H7BA 1VBIA 1G8ZD 1OXXK 1QE6A 1JOOA 4DR7L 2MFIA 3BVZA 2LFNA 1IW7D 1NCVA 3DM3A 2JA5H 4O1NA 1SYGA 4DN4M 3CMAA 4WJ4A 1I94H 1TWAH 2K5NA 4EQOA 3BZDB 3BYTB 4PV1C 2F0OA 1X4MA 1RDPD 5IGGA 4DR2H 4B3TL 2CCZA 3GTLH 3I4NH 2F3VA 1RCVD 4IZ8A 2KCTA 2NN6G 1PH5A 2UXDH 4DV0Q 3GTOH 2OQKA 3RZOH 4BA2I 4NXNH 1GHJA 5CYUA 2IX1A 4X3UA 4LF8L 2IX3A 5DEHA 1EIYB 3QD7X 1EZ8A 4UP9A 1CZGA 4A3BB 1YZ6A 4DXGA 1WTQA 1YJ9A 4JI0H 4LF5Q 5IT9E 3VYUA 1QOHA 4EQNA 3J80c 1D7QA 1AN7A 2N8NA 4LF7H 1EUJA 2L15A 4HIDA 5M3FB 3QO2A 1WTHA 2HH2A 3KDFB 2NN6I 3S15B 4IURA 1VQHA 4XYOA 3OOCA 2J7ZA 2RSOA 4H13C 3MWYW 1N34L 2XWJB 2BH2A 1B3QA 1MD2D 1KDAA 1LUZA 1S4ZA 1AE2A 1SYCA 2JA7H 2VUMG 3M4YA 1F9SA 3QWNA 1RF2D 5DM73 3HOZG 2RDGA 2K32A 1TIID 1MHWC 1TT2A 4DNTB 1GUTA 2NVXB 1QCBD 2KBNA 1MGSA 4BBSH 2RHQB 4IALA 3K0XA 3UDXA 1XPOA 2PI2A 3HFZB 4K5VA 2K03A 3HOYB 1JWMD 5HGTA 4X66H 5NUCA 5C44B 5L37A 1HNWQ 2R93G 2EYLA 2K5QA 2OF1A 1NNXA 5GROA 4QGUA 1I3QB 2QDBA 3W3AA 2VQEQ 4DV4Q 3G48A 1MIUA 4ZUIA 1VQBA 1JOKA 1BCPC 2ZJRA 5ELEA 1ZEQX 1ZZJA 2CVRA 5GAGC 4IFDH 1NXUA 1WCMH 3CQZB 5ELOA 1ICWA 2JA8G 5KNCA 1U5KA 1V8QA 2ZXPA 1KAAA 4NDXA 1ZXTA 4ODGA 3PF5A 4EQPA 3GABA 5A35A 2Z1CA 4DU9A 1PRTF 3ULLA 1IBMQ 4LF8H 3FP9A 2PW7A 5IYCH 2DUDA 1Q1BA 3D4RA 2A68C 3EFXD 4C2MH 5KRUA 2K1HA 1NE3A 1B2TA 3TEHB 1AZPA 4DR6L 3J81L 2EE1A 1JWSD 3EBEA 1TWFH 2OQ0A 4RWSC 3H3VH 1JJCB 1IBLQ 3Q8DA 1TY2A 4OO1I 1CHQD 3AQQA 1YVCA 2EZVA 1DOKA 5CR3A 2F0PA 2O5JC 2CTEA 2JA9A 3K7UC 1V1PA 1SFOB 2J0TD 1LLRD 3GTJB 4S3SA 2HHHL 5C4XH 4A3FG 4KTAA 2F4VQ 5AJ3Q 3AEVA 4HJ8A 1H9MA 2E5LH 1G6PA 4JI2Q 3RN2A 1HA6A 1H9RA 1XMQH 1WI5A 1YHBA 1MBYA 3MFYA 3S2HH 3HOXH 1PH2A 1AW7A 1IHZA 1VQPA 5M3MG 3H0GH 4FJUA 3CCEA 1HZCA 3FHWA 1K3RA 4KI0A 5CV5A 4X66Q 3GO5A 3GTKB 3I7FA 4B3ML 3P7JA 4ZLTF 2EVBA 4L5TA 3HP3A 3VA5A 1PZJD 1ASZA 5G3LD 4FF3A 1FNWA 1B9NA 2PI2E 4ULLA 1CSQA 1SNQA 1Y14B 4LFCL 2UUBL 4ME5A 4MNOA 4WALA 1BBWA 4FP5D 1O7LA 1ET9A 5LHY1 1F9RA 3I90A 4JI5L 4DK6C 3C2PA 4BY7B 3RLOA 3OHXC 1PHJA 1DYQA 4KKSA 2F03A 1SAPA 2ZM6Q 4NZTM 4R8IA 1I5FA 4IPGA 4RA8A 3MXGA 1J5EL 4R4TA 4B3TH 1LT4D 1SFOH 4LUOA 5I2XA 1EIFA 1B3AA 1LABA 2XN9C 1P8LA 2CTMA 2HUGA 3X3MA 2WACA 1TWGB 2E2HB 3IKJA 2F0NA 1XNRQ 2CWHA 1VIHA 2JA7G 5KIXA 2NVYH 3A55A 3O13A 2Y0SE 2PYKA 4XT3B 1NUCA 3I4NB 3H3VI 2ZM6H 4P73A 1CZWA 3H0GG 2FMRA 4GOPC 3ITPA 1JWUD 2JP1A 1Q12A 2KOLA 2MUYA 4HCSA 2XRSD 3CCVA 1CKMA 1OXSC 1EU3A 2BE5C 4LF7L 4JV5L 4QUFA 3Q24A 2C35B 1FD7D 3PO3G 3HKZE 1IBKL 5TSSA 2WB1G 2E5LQ 4DR4L 2ZXRA 1LT6D 5GAHC 2H4OA 2UXDQ 4PG3A 2UXBL 1CQVA 5HURA 2M8WA 1LYLA 1I94Q 4WJWA 3BDOA 1TU2B 1VQOA 3RLNA 2VQFH 2NN6H 3KJOA 1Q8IA 2F0QA 1PTOF 3OTOL 2EJGC 1XTDA 4DR6H 1RODA 4LJZC 4WORA 3GV3A 4JV5Q 3S15H 2M6QA 1X3PA 3HOVB 1G91A 1V8CA 3OSSD 2K5DA 2O5IC 3HOWG 4DFAA 5G3LF 5I9PA 3NCVA 3E0EA 4DV3L 2NVYB 3DMUA 2A69C 3HOUB 1I4QA 2CH4A 1VQDA 5CBAE 3OW7A 1UE1A 2N78A 4XTCS 1GHKA 2F0HA 2XVSA 2NVXH 4JVZA 1AEXA 1RJTA 2JA8H 1HNWL 4JV5H 4A3EG 3KUPA 1SBBB 1JMCA 4IFDG 4OHJA 4YHHQ 4NXML 1H9SB 2JJQA 4JCVE 1RL2A 3ND8A 1RKNA 4A3IG 3T16A 4J15A 1KRSA 4LF8Q 1E24A 3JAME 3I72A 3VR2A 1SE8A 5ELNA 1KABA 3QOLA 1JC7A 2K52A 1NR2A 4FXDA 1LTAD 1HHVA 2CWAA 1LTTD 3PMFA 4LAAA 4R4CA 4RMFA 3S24A 4JI5Q 3PO2G 1EU4A 3M4OB 1PFBA 5IP9G 1WD1A 3MEHA 3WOFA 4YWMA 2MJHA 3I70A 1I50H 5JJLA 4BY1B 1I4RA 3OIQA 1I6UA 2VUMH 4DNRB 4GLVB 3QIAA 2CWFA 1J5EQ 4AM3A 1TWCH 3FMCA 1Q90A 2QW7A 2E2IH 2JA6B 3QOJA 4ZKBB 2R6GA 3ER0A 1XYIA 1STHA 4I7ZC 3QG1A 4QQBX 1SMXA 1F0XA 4IUUA 4KV6A 2FFKB 4GN4B 1TS5A 1SLJA 1I4GA 3TMEA 3S1MH 1KRTA 1PRTB 4JW0A 2ICEC 4JYAH 3ERQA 5J22A 1MKHA 3HOZB 1VF7A 2PW5A 3OWFA 4Y7NH 4PMCA 3I4MB 4JC0A 3Q0AA 1MSGA 3CMEA 2B8FA 5C4XB 3DWPA 3FVQA 3C1FA 4A3FB 1Y8OB 3E9IA 4IFDJ 4FXGC 3I4OA 2PZTA 2F0DA 4DUZQ 2PZWA 1ILPA 3NBHA 1STBA 1PTOB 1XJVA 3UE1A 3KOJA 3M4OH 1Q82C 5EBDA 4DV1Q 1GXDC 3SB1A 4RHSA 1UEBA 4DF7A 3GTKH 2A1SA 4JI3H 2LKVA 1J9OA 4CKEA 4QY7A 2F4VH 1VQFA 2X69A 3BS1A 4KHVA 1BUVT 5EKLA 1NMFA 1ENCA 1Y69U 2PQAA 4G7HC 2UUCH 2JA5G 2F0KA 3WDNA 4HSPA 4JPBW 3T1HL 4C1NK 3CPFA 3KF6A 4JI1L 1ML0D 4RGTA 2L1BA 2E2HH 1WTOA 4LW1A 1SYBA 1SYFA 1FJGH 2JXMB 1ILQA 1VF5C 1HJPA 1EY4A 3M9BA 2JA8B 4K2KA 5D14A 2LTLA 2OCEA 2EYMA 1NTGA 2VXWA 4JI6Q 1IBML 2E3UA 3M3YH 2Z4IA 2KECA 2JE6I 4IO9A 5IWAQ 4LF9Q 1A6XA 4JI8H 1Y8PB 3CC4A 4HMIA 2RCNA 3JAMW 2BDOA 1XPRA 1KIXA 3ICEA 1Y8NB 4DAMA 2AWNA 1YHAA 3VYRA 1YNNC 1HFGA 3L2PA 1N36H 1J5EH 4ZUJA 4K8IA 1VQNA 2R7ZH 4RKBA 5LMUL 2IY5B 1JCKB 3STBC 1EY6A 2A1AA 4LFBH 2ASBA 2N3SA 3AFQA 5IYBG 4Q5VA 1VQ6A 5HGQA 1VQ9A 3S16B 4H02A 4JI5H 1EC6A 2CHBD 2XGTA 4DV3H 3MFGA 1DJRD 3NQTA 4HN7A 1K73C 2KCNA 2D0OA 2LS01 2UUBH 4ZK9B 5JPMC 3CCRA 1IW7C 1S3OA 2FXQA 3M4QA 4KY6A 2A6HC 1E1TA 3CCUA 1EQVA 2IW3A 3SK6A 5IODA 5M5WB 1J5KA 1SE2A 2BH8A 1VQLA 3PF4A 1WYDA 3KLWA 4A3GB 2PT7G 4LFBL 1HR0L 1IBKQ 5IP9H 4JI3L 3TS0A 4DUZL 3EN2A 1K83H 2O4XA 1OXUA 2YTXA 3NBIA 5M9OA 3PO2H 1OTCA 1L1OC 1BDOA 4A3JH 2RBMA 3G7LA 1Y1WG 1HNXL 1V1QA 3K8AA 2QNDA 1PXUA 1BCPF 1VQ7A 4JBWA 3GP7A 3HOWB 4UP8A 2B2UC 1ZKOA 4G4KA 1TQOA 1VIGA 4EQ5A 4UP7A 2EY6A 1XMOH 3PV0A 4JOIC 4CDCC 3NELA 4DUYL 2DJFC 1A3UA 2XNAC 5BN3A 2R7FA 4NKLA 3S16H 2DY7A 3VR4A 4KMUC 3N6RA 1Z7TA 1WTXA 3V96A 4A3EH 5EKKA 4C3JH 4Y7NB 2CPQA 1GVPA 1QJOA 1UNSA 4E6IA 2FJ2A 3A74A 1PMRA 1X3EA 5LMNW 4FO2A 3BYYB 4OX9H 4ZRZA 1UE7A 1K9MC 3FAUA 4DR1H 4C3IG 4BY1G 2F4VL 3KK7A 1IZ6A 1DCZA 1SDFA 3G6EA 1TXYA 4EC5A 3UOEA 4QIWE 2E75C 4G08A 4PQXA 4RCNA 1H9JA 3S1NB 4IOCA 4A3GH 5IGFA 4NXNQ 4X6AH 4DUYQ 1K28A 2VZAA 1STNA 5I6YA 1KTKA 1QG7A 4JG2A 5EPLA 4O0AA 3PO2B 2CWPA 5K36H 4DR7H 1QUQB 3MTSA 1N32L 4R1JA 2E2IB 5C0XI 4B3RH 2F0VA 2TSSA 2VUMB 1UE5A 4DR2Q 2A8VA 3URYA 4K0KH 3OETA 2DGRA 1F2ZA 3S14H 4DV2H 3HEJA 1JR0D 2Z6KA 3IRBA 3J7YW 4OO1H 3GR5A 3PUVA 3PO3H 2NBFA 5FKAC 3S1RH 5C3WA 4L6TB 3H6MA 4DAPA 4OD6A 4YWLA 1ENAA 5GADC 3A8KE 4WFN3 1VQKA 4GOPA 3D6CA 2L4NA 3PCOB 3A5UA 2K5WA 3F1ZA 3CC7A 2N88A 1GUSA 3T4AC 2MJ8A 4NP5A 4OL7A 1KLGD 2KHJA 3SVMA 4WANA 3T51B 1MSHA 5IWAH 1WVNA 1XNQQ 1P16A 1O78A 4AYBB 1PTOH 1ZYRC 4UDUC 3S1NH 5IT9c 3E3XA 1CA5A 5JEAG 1S72A 4NPSA 5ELFA 4IFDI 5EPKA 5EKIA 5CMDA 2VKCA 5CORA 5BR8H 1M8AA 5C6AA 4DNIA 4HIOA 4LF6L 4JI0L 2CTJA 1J6QA 4ZAIA 4MTNA 2Q8IB 4OWWB 1S5FD 4CHTB 3U58A 2EY1A 1JJGA 1TWCB 2L12A 3F2UA 3PIO3 4OIJA 2QEXA 4JI8L 5BR8Q 4KHZA 3J7AK 2ZJQA 5I6WA 4JI3Q 4GLAC 3NEMA 4HIKA 4RKLA 4DV0H 3MVVA 2EYJA 3S17B 2Z4HA 1X4NA 4QCLA 2PQUA 1EIGA 1IBLH 4QJFA 2G5DA 1SMYC 3OIPA 1SJED 5M3MH 1PTOD 2SDFA 5IT9W 3HOXG 3KDFA 1FJGL 2Y0SB 1RTOA 4WRDA 1CTMA 3TZDA 2NVTB 1YNXA 2QA4A 3C3LA 4A3FH 3MAQA 4K6LA 4IOAA 4JI8Q 5BR8L 4B3MQ 2Z6BA 1ZYRD 1U4LA 5EAYA 4A3KH 1HNXH 4JVHA 2LY7A 4LFAQ 4JBKA 3ZYYX 2HIXA 4M1UB 1JB7A 1Q3LA 2B2WA 3VR5A 1B1ZA 3AU7A 1ICFB 3C1EA 3P1HA 3SK4A 1KLUD 4CJ0B 1WCMB 2LXJA 4R9WA 4RHRA 4A3JB 1EQQA 4BY7H 3HG9A 4X62Q 2RDHA 4JI6H 1QWYA 2A74C 5IYCG 4A3LG 3EIVA 2C5CA 1AE3A 1C4QA 1HNWH 1WJJA 3DHQA 3GTMH 4GNXB 4R8NA 3LGJA 2M2LA 1YJNA 3IFDA 2EPBA 1HCZA 1EEFD 4IJHA 4NB3A 3J81c 1WFQA 1B50A 1WCMG 2UU9L 4X3KA 3I4LA 1VQAA 2K1BA 2D9UA 4NXNL 3UDIA 5KGUA 1N36L 1A0IA 1G51A 1VQEA 2I46A 3CHBD 5ELDA 1G2SA 4QMFB 1ESRA 2ANNA 5LMUH 1QZGA 2AKWB 4DAVA 4DR1Q 2ZT9C 4LIJA 2R93H 3U1KA 1ESFA 2G9DA 3GTJH 3TQYA 2A73B 4DR2L 4X66L 4IUTA 3W1GA 4DUYH 1BVSA 2KUMA 1QZHA 1HFNA 2L11A 2F3IA 1B4OA 3QB3A 3FDTA 2F3WA 4BBSG 2E2JB 1GUNA 4JI2L 5IGDA 3NXWA 4DV4L 2D9IA 1E2VA 5AFWA 4DV5L 1TWHB 5AJ3L 4JBMA 1PVOA 4A3MB 2I07B 5ELBA 3HZXA 3OMCA 1GM5A 3VKEA 1CKOA 5E4XA 1X32A 3D31A 3A5ZB 2VL6A 1SEIA 2N49A 4TRDA 2R3ZA 1F2YA 1OXVA 4JI1H 4DR5Q 3PUZA 1DD2A 1IBLL 4KD3A 4M8AA 1VQ4A 2RHSB 4QF4A 3PUWA 2BOSA 4FJSA 3EQLC 1PV4A 1VQCA 2HQEA 2F0MA 1GUGA 4RGNA 1CM9A 5HY6A 1WTPA 3DWQA 1STGA 4DV5H 1PTOC 1SROA 2O2LD 1W3SA 3S14B 2AHOB 2CPMA 1QB5D 1PFNA 4QL5A 4LMQD 2NVTH 1XRHA 1B9MA 3UDGA 1N33Q 3UI2A 1K1GA 5EGTA 5ELCA 3F2DA 1STAA 2N55A 3JC66 4J8QA 1HZBA 4AYBG 3ULPA 3RN5A 3I4NG 1LTGD 4CBVA 4FF4A 3E9HA 1IKLA 2J4XA 5M5YB 1SE3A 3I91A 1Z6HA 1DONA 4LF4H 3F8TA 3SXHA 3K59A 1I50B 1SNMA 5DLQE 2F52A 4A3BG 4DR3Q 4TSSA 1MJEA 1G2TA 1A2UA 1RD9D 3CPWA 2F0UA 1K8GA 4YY3H 1DGSA 3TP8A 1QNKA 4BA1I 1CKNB 1B70B 5IIFA 1PQXA 2WAQE 1PH9A 1I94L 1QVFA 2R92H 4JI4Q 3OPOA 4PNYA 5LMNL 4EGVA 1D5MC 2MPMA 3NSWA 4LF9H 4KJNA 4KN4C 2A19A 1SE4A 3CW2C 3HGBA 4J6HA 2LF0A 4GLXA 1Z2IA 3S9WA 1KXLA 1U4RA 2B2VA 3I4MG 1A8VA 1EY0A 5IYDG 4L5RC 3M7NA 1VCIA 1W2BA 1FYCA 2ZTEA 5FO8B 1X3FA 3CCSA 4F7XA 3HOVG 3J81j 1YI2A 3NTKA 4B9WA 1X55A 2K01A 4GZYC 2TMPA 4DK3C 4DAYB 4LF6Q 2WKDA 2YTVA 2BL5A 4GS3A 1NBWA 2RCFA 2K4KA 4OGQC 4JVYA 1XXGA 1V1PB 3NE5B 2E2DC 2VB3X 3LWUA 4K0KQ 2WKCA 4MIUA 5IY0A 2B8GA 1FL0A 4DV1H 3AEVB 1FNUA 3KDGA 1KNAA 1FR3A 3FPUB 4LF5L 2Z9HA 4K5WA 2OPUA 1PH1A 5C3XA 4JYAL 4O2DA 1TY0A 1LTSD 2MP1A 5C3EG 1E2WA 2P2RA 1SR3A 5FO9B 5K5PA 2WFWA 4BXXG 1OO9B 2KENA 4IUNA 5C0XJ 1UWVA 2EYOA 5FJ8G 4ALPA 1CA6A 5JVH3 2E2JH 4OCHA 1PZID 4A3CH 1H9KA 2YV5A 1BBUA 5KNBA 1S5ED 3NTHA 4YY3Q 2CFMA 3I0PA 1J8IA 3BG3A 1D5XC 1XMQL 1EYCA 3VR6A 2HCCA 3OTOH 1PRTD 1NSNS 1X6OA 2OEOA 2YTYA 4JYAQ 1VDZA 1BQQT 1KC8C 1I4HA 1PH4A 2B2YA 2RDFA 1BKBA 4K5XA 4Q0FA 4IUPA 2I5LX 4K14A 2PMZE 3R2TA 1FNVA 3HOUG 3SHLA 5I9OA 3J7A5 2PPBC 1SN8A 4F88A 4CDFC 4BBRG 2B2TA 4JI4L 1S5CD 1X9NA 3J80i 3ND9A 1C7YA 2UUAQ 4B3RQ 5J3BA 3I8ZA 5LL6X 3GTLB 1CK1A 2B3GA 4H44C 4YCWA 3WOEA 4NXMH 4ZKCB 4DXFA 1ZZKA 3HOYG 3SK5A 1CUKA 3K7AB 3RLFA 2CKZB 4AYBE 2KCCA 1PA6A 5DT9A 3RR5A 3W2DA 1H95A 4FYDA 1SNPA 4XYQA 2K05A 1G291 3L3OC 3K58A 4FF2A 4IUQA 3MC0B 4RG1A 2KA7A 4HIMA 4X3TA 2DNEA 1CKNA 2B39A 2DGYA 3RD4A 4K0KL 2KHIA 1EY9A 4X64H 2B63B 1TWFB 3CAMA 3I2ZA 3QR8A 3TREA 1IBMH 3NPPA 4L63B 1LV9A 3VDYA 3NUCA 4AIMA 3S2DB 4KN7C 2XIWA 5J39A 3J7AV 4NZRM 3L9AX 1Z9FA 4DV6L 4N9PA 4AQYL 1I6VC 1MJCA 2A5HA 4ILWA 5IYDH 4TVAB 2OWOA 2UXBH 4RFBA 1QILA 3D4DA 4U673 4KK7A 2Z8LA 4A3DG 3T1YH 3RZOB 3HKSA 2AQ1B 4Y52H 2UUCL 1D5ZC 4YIJA 1BXTA 1LACA 3NWTA 3TS2A 5JJZA 4LNQA 2MO0A 5EQ0A 3K7AH 1K8OA 3GTQB 3T13A 5C44H 1ODHA 1STYA 2K5VA 3CC2A 4JI6L 2ZTDA 4A3EB 4G7ZC 1JE4A 1ET6A 1SRUA 2D2CC 3BJUA 1EY5A 2CTLA 2Q2IA 4QB4A 4AH6A 4DK0A 3KLSX 4MN3A 1PH8A 3TSSA 4GNXA 2JA6G 5M5XB 2KEEA 2QKIC 3I3CA 1TVXA 4DV4H 3S2HB 2NVQB 5C4HA 4A3MH 5FK9C 3J81W 2Q2TA 5C0XG 1L0XB 1Y1VG 4DUZH 2DJGC 4APVA 1LT5D 2L55A 5M3FH 3AMUA 3RZDB 4LFCQ 3HRZC 5CV8A 2ZTCA 1YEZA 3LWEA 2RQXA 4RCOA 3J80L 2FMCA 4HAEA 3S1RB 3PIOA 3NTIA 1F2MA 2EXZA 3OYYA 1T5EA 5BN4A 4KHPQ 5E1FA 5IGBA 4KKUA 4XQNA 2UU9H 3BDLA 1Y1WB 1DZ1A 2A6HD 2MQHA 1IXRA 4LK1C 3M85A 4NBQA 1K0SA 3GTQH 3V2TA 4FF1A 3A56A 4C3HH 1PFMA 3D3RA 5M3FG 4LF6H 4P75A 3H0GB 2PNHA 1WHRA 3H3VC 1Y1VH 3DXJC 5C0XH 3PIPA 3U50C 2JN4A 5C5LA 4PDBA 3HS0C 1UE6A 5M5YH 2KHSA 1I3QH 1Q8KA 1XNQL 1Q1EA 1S40A 4UY8C 5CBEE 2NWGA 3E0JA 1S5DD 3E6ZX 1EEID 1MSZA 4CKCA 1SNCA 1O7YA 3AFPA 2IJ0A 2JEBI 4WJ3M 4RGMA 4P71A 2WINB 1EQRA 4ZYSA 3MXNA 3T53B 5FLMH 2ENBA 3I56A 2UUAL 4A93H 1TS4A 4PMBA 1VMCA 1AH9A 1C0AA 1TS2A 5IE8A 1BNZA 2F1MA 3J7AF 3RNUA 3H91A 3S2DH 1PLFA 2EYFA 2JEAI 3PUXA 4V190 1MI2A 4K8JA 1E0BA 4P2CB 1HZAA 1SNDA 2HHHH 3KF6B 4A3DH 3EZJA 4JI4H 1JE5A 1NY4A 2DNCA 3GV6A 4DR6Q 2V1CC 3AYHB 2PQEA 2Y3MA 1GOZA 4HJ7A 1HTLD 4OO1G 2FFMA 3K80C 4YY3L 4KY5A 4G7OC 1FJGQ 1DOMA 2X6GA 4ABNA 3IFTA 4GKKH 2L5TA 4P72A 4V0BA 1T9HA 1EQTA 1EYDA 2EJMA 4X64L 4B3SQ 5C4ZA 3J7ZC 3PO3B 3DWAA 3R93A 4CDDC 4KHPL 4DKAC 4UHVA 4POFA 3K5OA 1K8AC 5F2DA 5EBCA 4C3HG 4L5QA 5JJIA 4A3GG 1WTJA 4XDXA 4A75A 5LL6b 2VQEH 2G8YA 2QGQA 5BN5A 2QDLA 2ZQEA 2NUCA 1PDQA 4P74A 4FDBA 5D3DA 1U9RA 1RTNA 3U9OA 2LXKA 3GQBA 2IL8A 1WVLA 1EFID 4LFAL 4C3JG 4HCEA 2E5LL 4K6DA 4E9JA 4LFAH 3CKIB 1HNXQ 2B2TC 5JJKA 3GKUA 1M90C 2B63H 4OWTB 2NZ1D 1D1KA 3HOUH 5E7NA 1DM0B 1VQGA 1HQMC 4KJOA 2B29A 1SYEA 4CGYB 2DY8A 2F0FA 3KJPA 1KL9A 3UE0A 1EOVA 2VQEL 1V1OA 4JI1Q 2XWBB 1U4PA 4N9TA 4JI0Q 1JQYD 1JT8A 1EZ6A 4C3IB 1EOTA 3NP8A 4GNXC 1CFMA 4B9XA 1Y1WH 2H5XA 1AZQA 4X65H 4A3JG 3NENA 3CCJA 2AQ2B 2RSNA 2FMMA 5IOCA 5M5XH 1B53A 2H1EA 1EFWA 5I2YA 1NR4A 3GD7A 3LNNA 3JAMc 2UXDL 1II3A 5C44G 2R93B 1GJXA 1XX8A 3F2CA 2QF7A 2PZUA 1PH3A 3GTOB 4KKTA 3HKZB 3K0YA 4OXPA 1A63A 1N8RC 3NK9A 2HT1A 4TKOB 4A4IA 1TWHH 3NWSA 3IL8A 4C1NI 1D2BA 1BF4A 2NZOA 4B3SL 2WAQB 1YITA 1BO0A 1FVIA 1GO3E 1YNJC 2YQRA 5KNDA 4C56C 2LTMA 1PYWD 2KVMA 3MXUA 3P75A 3D6WA 2GA4B 4L5SA 1LTBD 1HUMA 2F4IA 4MHEA 1EY8A 2EOTA 1Q7YC 3SE0A 3R3OA 1I4XA 3PUYA 2RVLA 1TWAB 3M3YB 5J1ZA 3GTPH 2CTFA 2WAQG 2QCPX 2AMCB 4I7AA 4U68A 4X62L 1F77A 3HOVH 5FLXc 4I65A 3TP7A 4A3DB 1N36Q 3WWVA 4HMJA 4OELB 2A69D 3H94A 3U9SA 3FEWX 2AQ3B 4LUVA 3I4MH 1BCPD 2B2VC 2SNMA 2WB1E 1F9PA 2F0GA 2HIVA 4JI7H 3HKZG 2A6ED 5ISRA 1IYJB 1V9PA 1QUQA 3FKIH 1C8CA 5LMNH 3D0FA 1HR0H 4ID6A 4C3HB 4GOPB 2I0QA 3T1HH 1C9OA 1F2LA 2R92G 4DGZA 2X6LA 3CXCA 4HJ9A 2V4DA 1PFSA 4BBRH 5JPNC 4HEDA 3D8GA 4DR7Q 4H0LC 4A3BH 5CC4A 2SEBD 3KDKA 4BWGB 2LMCB 4OEMB 1W6KA 2G9HD 2B2YC 2NB0A 3STBD 3H09A 1NMGA 1K8MA 1Z47A 4PZ8A 2HQLA 3A54A 2K28A 4KHPH 4DR3L 2ALYB 3K5LA 5LL6S 1JJ2A 4R4IA 4X65Q 2EXDA 2JA5B 1ZZIA 3S1MB 1A3VA 1EWCA 1AP0A 1TR5A 1XNRH 3DM1A 1WD0A 3VYTA 4A3CG 5DNFA 4OX9L 4GKKL 1PZKD 2NZHA 1VMPA 5DM63 5FJ8H 1AFPA 4IN3A 3CRKC 1NAPA 3T1HQ 1XWEA 1CSPA 4YHHL 4BXXH 2I5HA 5LMNQ 5CV9A 1STEA 1G6ZA 2D62A 3TZUA 4CJ1B 5IGCA 5C3EH 3BDCA 3I73A 4ZCKA 4UAIA 3TP5A 1VQIA 2Q8RE 4FNFA 1L0WA 3K81C 4HR7B 3FKIG 1UEAB 1YHQA 4DR4Q 2IPKD 4LF5H 1X3QA 1JICA 1N9WA 1LTID 1LT3D 3TBIB 1AN8A 4DV7L 4EX5A 1B7YB 4YCUA 2VNUD 2WIIB 3CU7A 1N34Q 5LMUQ 3G71A 1M4VA 4UPAA 3VYSA 1I4PA 4MTKA 1ASYA 1DXMA 2WP8J 4DV2L 1A15A 1E7ZA 1UAPA 3T1YQ 4PZ7A 3M4PA 1HPCA 5KYLA
chains in the Genus database with same CATH topology
4B3RQ 2BH8A 2KCTA 5J3BA 1VQLA 4A3IH 3PF4A 2NN6G 2MO1A 1WYDA 3KLWA 4DV3Q 2B3GA 1PH5A 4YCWA 4LFBL 4DV0Q 1HR0L 3GTOH 2OQKA 1XPUA 3RZOH 1IBKQ 4BA2I 5IP9H 4JI3L 3TS0A 1ZZKA 1OXTA 2IX1A 4DUZL 3HOYG 3EN2A 1K83H 1CUKA 1OXUA 2YTXA 1EIYB 4LF8L 3PO2H 4UP9A 1OTCA 1L1OC 1YZ6A 3RLFA 4A3JH 4KLKA 2CKZB 4AYBE 2VW9A 1Y1WG 1HNXL 1V1QA 3K8AA 3L0OA 1YJ9A 2ZM6L 1HNZQ 1PA6A 4LF5Q 2QNDA 3RR5A 1H95A 1VQ7A 4IPCA 4JBWA 1G291 3ERSX 4UP8A 1E22A 3J80c 1D7QA 4DV0L 2N8NA 1EUJA 2L15A 1VIGA 4RG1A 4EQ5A 4HIDA 4UP7A 4XIGS 4HIMA 3HOWH 3PV0A 2HH2A 1CKNA 1Q46A 4JOIC 2DGYA 4K0KL 1VQJA 3CCEA 2KHIA 3NELA 4DUYL 3KDFB 1XNRL 2NN6I 2R7FA 1HZ9A 1VQHA 2BA0A 3S16H 4DV1L 3CAMA 2UU9Q 3I2ZA 4PMWA 1KAWA 3TREA 1N34L 1A62A 3JAMi 2BH2A 4A3EH 1LUZA 4C3JH 2CPQA 1AE2A 1GVPA 4X65L 3VDYA 4HJ5A 2JA7H 3A74A 4AIMA 3MEFA 2VUMG 1X3EA 2ANRA 2Q2UA 5LMNW 3HOZG 1XMOQ 1Z9FA 1VQ5A 4DV6L 1YIJA 4AQYL 2VY3A 5M5WH 1MJCA 1X56A 2KBNA 3U4ZA 4BBSH 1UE7A 1K9MC 2RHQB 4TVAB 3K0XA 3UDXA 4A76A 4BY1G 2PI2A 1XPOA 2OWOA 2F4VL 1N32Q 1IZ6A 3G6EA 3HFZB 1TXYA 4A3DG 1E3PA 2RF4A 4QIWE 1HH2P 3HKSA 2B63G 4A3GH 4IOCA 4X6AH 1HNWQ 4TQUS 4NXNQ 2R93G 4Y52H 4DUYQ 1X65A 2UUCL 1X54A 4POGA 2D0PA 2VZAA 3TS2A 2AWOA 3CQZH 5GROA 4OONA 4QGUA 4LNQA 4B8TA 2MO0A 2VQEQ 4JG2A 3W5OA 3K7AH 4O0AA 4DV4Q 3G48A 2CWPA 1MIUA 5JEAJ 1VQBA 5C44H 1QUQB 4GN3B 1N32L 2K5VA 2PQAB 3CC2A 2ZTDA 4R1JA 5C0XI 2ZJRA 4JI6L 1SRUA 3BJUA 1D8LA 1UE5A 4DR2Q 2A8VA 1ZZJA 2CTLA 1XMOL 2Q2IA 4AH6A 5GAGC 2DGRA 1WCMH 2EIFA 1PH8A 1DT4A 5ELOA 4LFBQ 2Z0SA 3W1BA 4GNXA 2JA6G 2JA8G 3S14H 3V69A 1KHIA 1U5KA 4NXMQ 1QVCA 2Z6KA 3IRBA 3T1YL 3PUVA 3PO3H 1KQSA 3PF5A 4R4OA 3ULLA 2R7DA 4A3MH 1YJWA 3S1RH 1VS0A 3CF5A 2Q2TA 1IBMQ 4YCVA 3FP9A 5C0XG 1TWGH 2HHHQ 2LSSA 5IYCH 1Y1VG 4YWLA 2DUDA 5GADC 1Q1BA 4IPDA 5H1SE 1VQKA 4APVA 2EQSA 4C2MH 4GOPA 1NE3A 3PCOB 3A5UA 5M3FH 3F1ZA 3CC7A 4LFCQ 3TEHB 2NVQH 3DLLA 2ZTCA 1YEZA 4DR6L 3CP0A 2KHJA 2K75A 3BZCA 4WANA 2HH3A 3EBEA 1TWFH 2OQ0A 3PIOA 1WVNA 1XNQQ 1P16A 3H3VH 1JJCB 4JI7Q 3OYYA 1IBLQ 3Q8DA 4KHPQ 4OO1I 3CCMA 3S1NH 3AQQA 5IT9c 3OTOQ 1YVCA 5JEAG 1S72A 1EWIA 4NPSA 2UUCQ 4DV2Q 2CTEA 2JA9A 2MQHA 1IXRA 3K7UC 4X64Q 4IFDI 3M85A 2ZJPA 4NBQA 3GTQH 2UXCQ 1HR0W 2HHHL 5C4XH 2ID0A 3B6YA 4DNIA 1RIPA 4C3HH 4HIOA 4A3FG 4LF6L 2OTJA 4JI0L 2F4VQ 2CTJA 5AJ3Q 3AEVA 1J6QA 4HJ8A 2XTIA 5M3FG 4MTNA 4P75A 4OWWB 1G6PA 1L2FA 2PNHA 4JI2Q 3KF8B 3RN2A 1IL2A 4A3LH 1WI5A 1Y1VH 1YHBA 3S2HH 3HOXH 3PIPA 3U58A 1PH2A 3U50C 1JJGA 1VQPA 5M3MG 1UE6A 5M5YH 3H0GH 4BY7G 4A93G 1I3QH 1Q8KA 1HZCA 1Q1EA 3FHWA 1K3RA 4KI0A 5FLMG 4X66Q 3GO5A 2QEXA 4JI8L 3I7FA 4KHZA 5BR8Q 4B3ML 3S17H 2ZJQA 1WOCA 3TRZA 4JI3Q 5C4XG 4L5TA 1ASZA 3AFPA 3NEMA 4GLAC 4HIKA 2JEBI 4WJ3M 2PI2E 1CSQA 1Y14B 4P71A 4LFCL 1EQRA 2UUBL 3U4VA 4MNOA 1X4NA 4WALA 2CQOA 2PQUA 5FLMH 1V43A 3GDEA 4QJFA 3I56A 2UUAL 4A93H 4B3RL 1BBWA 5M3MH 3HOXG 3KDFA 4A3KG 1FJGL 1C0AA 1AH9A 4JI5L 4DK6C 2ES2A 5IE8A 4LF9L 3RNUA 3RLOA 4DPGA 3S2DH 4JBJA 1PHJA 1YNXA 3OW2A 3PUXA 2JEAI 2UXBQ 1KHMA 2QA4A 2ZM6Q 4A3FH 1Q81C 4OX9Q 4AQYQ 1HZAA 1I5FA 4IPGA 3KF6B 4IOAA 2JVZA 4JI8Q 5BR8L 4B3MQ 4A3DH 1U0LA 1J5EL 4R4TA 5EAYA 2JQOA 3I55A 4A3KH 2GVAA 4DR1L 5GQOA 1JE5A 1NY4A 1SFOH 2YU9H 1M1KC 4LUOA 4BY1H 2V1CC 1EIFA 3AYHB 4LFAQ 4DR6Q 4JVHA 4JBKA 2HIXA 2OPVA 1P8LA 2CTMA 1JB7A 4HJ7A 4OO1G 1L1OB 2E8GA 1XNRQ 2KCMA 3K80C 4YY3L 1VIHA 2JA7G 1FJGQ 3BU2A 4LUZA 2NVYH 2Y0SE 2LXJA 4P72A 1T9HA 3H3VI 4P73A 4X64L 2FMRA 3H0GG 1EQQA 4X62Q 2VQFL 4GOPC 4B3SQ 2ATWA 4BY7H 1Q12A 1I6HH 3J7ZC 3RZDH 5IYCG 4JOIA 3CCVA 4A3LG 3EIVA 4GN5A 4KHPL 1CKMA 1OXSC 4DKAC 4A3MG 3BZKA 1GKHA 1AE3A 4POFA 4LF7L 4JV5L 1WJJA 4HJAA 2C35B 1K8AC 1PH6A 3GTMH 4GNXB 3PO3G 3HKZE 3LGJA 4L5QA 1IBKL 5JJIA 4A3GG 1YJNA 2YYZA 1XMQQ 4A75A 2WB1G 4IJHA 4MZ9A 4NB3A 3J81c 2E5LQ 1WFQA 4DR4L 2JA6H 3CCQA 2QGQA 5GAHC 2UXDQ 1XNQL 1WCMG 4PG3A 2UU9L 2UXBL 4P74A 1VQAA 4FDBA 2AXYA 4OWXB 1LYLA 1I94Q 1PYSB 4NXNL 3UDIA 1N36L 2UXCL 1VQOA 3HOZH 2LXKA 1A0IA 1G51A 1VQEA 3RLNA 3KJOA 4LFAL 4QMFB 2IHEA 3F2BA 2ANNA 3OTOL 2E5LL 1QZGA 4DV5Q 2AKWB 1XTDA 4LIJA 4DR1Q 2R93H 1HNXQ 3U1KA 5JJKA 4JV5Q 3GTJH 3TQYA 1M90C 2B63H 3S15H 4OWTB 4DR2L 4X66L 1KD1C 3W1GA 2PY9A 1BVSA 1QZHA 3HOUH 5E7NA 2JK8A 1R9TH 3NBHB 2F3IA 1VQGA 3HOWG 2B29A 3KJPA 3E0EA 4BBSG 1GD7A 4DV3L 1KL9A 3UE0A 1EOVA 2VQEL 4JI2L 1HR0Q 4JI1Q 4DV4L 4DV5L 1VQDA 1UE1A 4JI0Q 2Z6KC 1JT8A 2N78A 5AJ3L 4XTCS 4JBMA 1PVOA 2NVXH 5IYBH 4GNXC 2JA8H 1GM5A 1HNWL 4A3EG 3VKEA 2OTLA 1CKOA 2H5XA 3PGZA 1Y1WH 1JMCA 4IFDG 4A3JG 3NENA 4GKJQ 3CCJA 1DTJA 3D31A 3A5ZB 2K50A 2VL6A 5M5XH 2N49A 1EFWA 1OXVA 4YHHQ 4NXML 4DR5Q 3GD7A 3PUZA 2Y0SG 3JAMc 2UXDL 2JJQA 1IBLL 5K36G 1VQ4A 4JCVE 1RL2A 2RHSB 5C44G 4A3IG 4DV6Q 3PUWA 1TUAA 4DV7Q 4J15A 3F2CA 1KRSA 4ME3A 1PV4A 1VQCA 1PH3A 4LF8Q 4UY8C 1E24A 5HY6A 3G4SA 4OXPA 1SE8A 1YBYA 5ELNA 1A63A 1N8RC 3A0JA 2K52A 2HT1A 2I5MX 4A4IA 1SROA 1TWHH 3CCLA 2CWAA 4C3IH 4R4CA 4RMFA 2NZOA 3S24A 4JI5Q 1W3SA 2VQFQ 4B3SL 3HOYH 3PO2G 1YITA 2AHOB 5IP9G 1FVIA 4QL5A 3S1QH 2NVTH 1GO3E 2IHFA 5C4JH 2YQRA 4LWCA 4YWMA 3UDGA 2MJHA 1I50H 3CD6A 5JJLA 1N33Q 2VUMH 1K1GA 4GLVB 3F2DA 3JC66 3UDFA 1HZBA 1O7IA 1WE8A 4AYBG 3ULPA 3RN5A 4L5SA 3I4NG 1J5EQ 4AM3A 4R4QA 3E9HA 1TWCH 1QVGA 1HNZL 1Q7YC 2E2IH 3F8TA 3J81i 1J4WA 2R6GA 3PUYA 3ER0A 5DLQE 2F52A 4A3BG 4DR3Q 4QQBX 3GTPH 1MJEA 2CTFA 1N33L 1SMXA 2WAQG 2AMCB 4X62L 3HOVH 5FLXc 3CPWA 1K8GA 1N36Q 1DGSA 3WWVA 4BA1I 4GN4B 3KFUA 1ZTGA 1B70B 1CKNB 1SLJA 3PSIA 2WAQE 1PH9A 1I94L 1QVFA 3S1MH 4LUVA 3I4MH 1KRTA 2WB1E 2R92H 4B3TQ 4JI4Q 2HIVA 4LF4Q 1L1OA 3HKZG 1MKHA 1IYJB 5IP7G 1V9PA 5LMNL 1QUQA 2GVBA 3FKIH 4Y7NH 4JC0A 4IJLA 1X3GA 2A19A 3D0FA 3L7ZC 3CMEA 3CW2C 4GOPB 2I0QA 1PH7A 2Q2HA 4GLXA 1VQMA 3E9IA 1KXLA 1C9OA 1FGUA 2R92G 3I4MG 4IFDJ 1A8VA 5IYDG 4L5RC 2CTKA 3I4OA 1VCIA 4DUZQ 3M7NA 1W2BA 2ZTEA 3CXCA 4DR5L 4HJ9A 1X3FA 1K0RA 1PFSA 3CCSA 2K14A 3UE1A 3KOJA 4BBRH 2K5HA 3J81j 1YI2A 1XJVA 1Q82C 4LF7Q 3HOVG 1NJIC 3M4OH 4DV1Q 4DR7Q 1X55A 3SGIA 1UEBA 1LTLA 4DK3C 2MNAA 3H15A 4DAYB 3GTKH 4A3BH 1Q86C 1B8AA 5GAEC 2YTVA 2BA1A 4GS3A 1NBWA 4LF6Q 2BL5A 2K4KA 4QY7A 4JVYA 1VQFA 4LF4L 4PZ6A 3STBD 5IWAL 4GKJL 1NMGA 3KYHC 1NMFA 2UUBQ 4K0KQ 1Z47A 2PQAA 5IY0A 1FL0A 2JA5G 3AEVB 4PZ8A 3T1HL 2HQLA 3CPFA 3KF6A 2IT1A 4JI1L 4LF5L 2R7ZG 4GKKQ 2E2HH 4DR3L 4LW1A 2ALYB 4YWKA 1JJ2A 4R4IA 4X65Q 2EXDA 2OPUA 1PH1A 1EYGA 1ZZIA 5IP7H 4JYAL 4O2DA 3ULJA 2IX0A 2GN5A 4JI7L 1HJPA 5C3EG 4A3CG 4OX9L 4GKKL 2NZHA 3M9BA 2VS1A 5FJ8H 3GTGH 1S40A 2P2RA 3ZJYC 1E1OA 1SR3A 2OCEA 3T1HQ 4YHHL 1CSPA 1NTGA 2WFWA 4JI6Q 4BXXH 1VQ8A 4BXXG 2I5HA 1IBML 3M3YH 2E3UA 5LMNQ 2JZXA 4IPHA 2KENA 2JE6I 5C0XJ 1UWVA 5FJ8G 5IWAQ 4IO9A 4ALPA 2E2JH 4LF9Q 1LM0A 3MXNB 2D62A 3CC4A 5C3EH 2RCNA 4A3CH 1PYBA 1XPRA 2YV5A 1BBUA 1KIXA 3ICEA 1VQIA 1OXXK 1L0WA 4DAMA 2AWNA 1YHAA 3K81C 2CFMA 4YY3Q 3L2PA 1XMQL 4DR7L 3FKIG 1VQNA 2MFIA 1YHQA 2R7ZH 4DR4Q 5LMUL 2IY5B 3STBC 2A1AA 3DM3A 1X6OA 2ASBA 2JA5H 3CMAA 2YTYA 2N3SA 3AFQA 5IYBG 4JYAQ 1N9WA 1VQ6A 4WJ4A 5HGQA 1VQ9A 4H02A 1KC8C 1TWAH 2K5NA 4DV7L 1PH4A 1EC6A 1BKBA 2XGTA 4EX5A 1B7YB 1K73C 2I5LX 4YCUA 2VNUD 1X4MA 2PMZE 2D0OA 1N34Q 5LMUQ 3G71A 4UPAA 3HOUG 3CCRA 3J7A5 1S3OA 1SN8A 2FXQA 1ASYA 3M4QA 4BBRG 4B3TL 2CCZA 4JI4L 3GTLH 2WP8J 4DV2L 1E1TA 1X9NA 3J80i 1E7ZA 3CCUA 3T1YQ 4PZ7A 3I4NH 3M4PA 1J5KA 1C7YA 5IYDH 2UUAQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B3R Q;  2BH8 A;  2KCT A;  5J3B A;  1VQL A;  4A3I H;  3PF4 A;  2NN6 G;  2MO1 A;  1WYD A;  3KLW A;  4DV3 Q;  2B3G A;  1PH5 A;  4YCW A;  4LFB L;  4DV0 Q;  1HR0 L;  3GTO H;  2OQK A;  1XPU A;  3RZO H;  1IBK Q;  4BA2 I;  5IP9 H;  4JI3 L;  3TS0 A;  1ZZK A;  1OXT A;  2IX1 A;  4DUZ L;  3HOY G;  3EN2 A;  1K83 H;  1CUK A;  1OXU A;  2YTX A;  1EIY B;  4LF8 L;  3PO2 H;  4UP9 A;  1OTC A;  1L1O C;  1YZ6 A;  3RLF A;  4A3J H;  4KLK A;  2CKZ B;  4AYB E;  2VW9 A;  1Y1W G;  1HNX L;  1V1Q A;  3K8A A;  3L0O A;  1YJ9 A;  2ZM6 L;  1HNZ Q;  1PA6 A;  4LF5 Q;  2QND A;  3RR5 A;  1H95 A;  1VQ7 A;  4IPC A;  4JBW A;  1G29 1;  3ERS X;  4UP8 A;  1E22 A;  3J80 c;  1D7Q A;  4DV0 L;  2N8N A;  1EUJ A;  2L15 A;  1VIG A;  4RG1 A;  4EQ5 A;  4HID A;  4UP7 A;  4XIG S;  4HIM A;  3HOW H;  3PV0 A;  2HH2 A;  1CKN A;  1Q46 A;  4JOI C;  2DGY A;  4K0K L;  1VQJ A;  3CCE A;  2KHI A;  3NEL A;  4DUY L;  3KDF B;  1XNR L;  2NN6 I;  2R7F A;  1HZ9 A;  1VQH A;  2BA0 A;  3S16 H;  4DV1 L;  3CAM A;  2UU9 Q;  3I2Z A;  4PMW A;  1KAW A;  3TRE A;  1N34 L;  1A62 A;  3JAM i;  2BH2 A;  4A3E H;  1LUZ A;  4C3J H;  2CPQ A;  1AE2 A;  1GVP A;  4X65 L;  3VDY A;  4HJ5 A;  2JA7 H;  3A74 A;  4AIM A;  3MEF A;  2VUM G;  1X3E A;  2ANR A;  2Q2U A;  5LMN W;  3HOZ G;  1XMO Q;  1Z9F A;  1VQ5 A;  4DV6 L;  1YIJ A;  4AQY L;  2VY3 A;  5M5W H;  1MJC A;  1X56 A;  2KBN A;  3U4Z A;  4BBS H;  1UE7 A;  1K9M C;  2RHQ B;  4TVA B;  3K0X A;  3UDX A;  4A76 A;  4BY1 G;  2PI2 A;  1XPO A;  2OWO A;  2F4V L;  1N32 Q;  1IZ6 A;  3G6E A;  3HFZ B;  1TXY A;  4A3D G;  1E3P A;  2RF4 A;  4QIW E;  1HH2 P;  3HKS A;  2B63 G;  4A3G H;  4IOC A;  4X6A H;  1HNW Q;  4TQU S;  4NXN Q;  2R93 G;  4Y52 H;  4DUY Q;  1X65 A;  2UUC L;  1X54 A;  4POG A;  2D0P A;  2VZA A;  3TS2 A;  2AWO A;  3CQZ H;  5GRO A;  4OON A;  4QGU A;  4LNQ A;  4B8T A;  2MO0 A;  2VQE Q;  4JG2 A;  3W5O A;  3K7A H;  4O0A A;  4DV4 Q;  3G48 A;  2CWP A;  1MIU A;  5JEA J;  1VQB A;  5C44 H;  1QUQ B;  4GN3 B;  1N32 L;  2K5V A;  2PQA B;  3CC2 A;  2ZTD A;  4R1J A;  5C0X I;  2ZJR A;  4JI6 L;  1SRU A;  3BJU A;  1D8L A;  1UE5 A;  4DR2 Q;  2A8V A;  1ZZJ A;  2CTL A;  1XMO L;  2Q2I A;  4AH6 A;  5GAG C;  2DGR A;  1WCM H;  2EIF A;  1PH8 A;  1DT4 A;  5ELO A;  4LFB Q;  2Z0S A;  3W1B A;  4GNX A;  2JA6 G;  2JA8 G;  3S14 H;  3V69 A;  1KHI A;  1U5K A;  4NXM Q;  1QVC A;  2Z6K A;  3IRB A;  3T1Y L;  3PUV A;  3PO3 H;  1KQS A;  3PF5 A;  4R4O A;  3ULL A;  2R7D A;  4A3M H;  1YJW A;  3S1R H;  1VS0 A;  3CF5 A;  2Q2T A;  1IBM Q;  4YCV A;  3FP9 A;  5C0X G;  1TWG H;  2HHH Q;  2LSS A;  5IYC H;  1Y1V G;  4YWL A;  2DUD A;  5GAD C;  1Q1B A;  4IPD A;  5H1S E;  1VQK A;  4APV A;  2EQS A;  4C2M H;  4GOP A;  1NE3 A;  3PCO B;  3A5U A;  5M3F H;  3F1Z A;  3CC7 A;  4LFC Q;  3TEH B;  2NVQ H;  3DLL A;  2ZTC A;  1YEZ A;  4DR6 L;  3CP0 A;  2KHJ A;  2K75 A;  3BZC A;  4WAN A;  2HH3 A;  3EBE A;  1TWF H;  2OQ0 A;  3PIO A;  1WVN A;  1XNQ Q;  1P16 A;  3H3V H;  1JJC B;  4JI7 Q;  3OYY A;  1IBL Q;  3Q8D A;  4KHP Q;  4OO1 I;  3CCM A;  3S1N H;  3AQQ A;  5IT9 c;  3OTO Q;  1YVC A;  5JEA G;  1S72 A;  1EWI A;  4NPS A;  2UUC Q;  4DV2 Q;  2CTE A;  2JA9 A;  2MQH A;  1IXR A;  3K7U C;  4X64 Q;  4IFD I;  3M85 A;  2ZJP A;  4NBQ A;  3GTQ H;  2UXC Q;  1HR0 W;  2HHH L;  5C4X H;  2ID0 A;  3B6Y A;  4DNI A;  1RIP A;  4C3H H;  4HIO A;  4A3F G;  4LF6 L;  2OTJ A;  4JI0 L;  2F4V Q;  2CTJ A;  5AJ3 Q;  3AEV A;  1J6Q A;  4HJ8 A;  2XTI A;  5M3F G;  4MTN A;  4P75 A;  4OWW B;  1G6P A;  1L2F A;  2PNH A;  4JI2 Q;  3KF8 B;  3RN2 A;  1IL2 A;  4A3L H;  1WI5 A;  1Y1V H;  1YHB A;  3S2H H;  3HOX H;  3PIP A;  3U58 A;  1PH2 A;  3U50 C;  1JJG A;  1VQP A;  5M3M G;  1UE6 A;  5M5Y H;  3H0G H;  4BY7 G;  4A93 G;  1I3Q H;  1Q8K A;  1HZC A;  1Q1E A;  3FHW A;  1K3R A;  4KI0 A;  5FLM G;  4X66 Q;  3GO5 A;  2QEX A;  4JI8 L;  3I7F A;  4KHZ A;  5BR8 Q;  4B3M L;  3S17 H;  2ZJQ A;  1WOC A;  3TRZ A;  4JI3 Q;  5C4X G;  4L5T A;  1ASZ A;  3AFP A;  3NEM A;  4GLA C;  4HIK A;  2JEB I;  4WJ3 M;  2PI2 E;  1CSQ A;  1Y14 B;  4P71 A;  4LFC L;  1EQR A;  2UUB L;  3U4V A;  4MNO A;  1X4N A;  4WAL A;  2CQO A;  2PQU A;  5FLM H;  1V43 A;  3GDE A;  4QJF A;  3I56 A;  2UUA L;  4A93 H;  4B3R L;  1BBW A;  5M3M H;  3HOX G;  3KDF A;  4A3K G;  1FJG L;  1C0A A;  1AH9 A;  4JI5 L;  4DK6 C;  2ES2 A;  5IE8 A;  4LF9 L;  3RNU A;  3RLO A;  4DPG A;  3S2D H;  4JBJ A;  1PHJ A;  1YNX A;  3OW2 A;  3PUX A;  2JEA I;  2UXB Q;  1KHM A;  2QA4 A;  2ZM6 Q;  4A3F H;  1Q81 C;  4OX9 Q;  4AQY Q;  1HZA A;  1I5F A;  4IPG A;  3KF6 B;  4IOA A;  2JVZ A;  4JI8 Q;  5BR8 L;  4B3M Q;  4A3D H;  1U0L A;  1J5E L;  4R4T A;  5EAY A;  2JQO A;  3I55 A;  4A3K H;  2GVA A;  4DR1 L;  5GQO A;  1JE5 A;  1NY4 A;  1SFO H;  2YU9 H;  1M1K C;  4LUO A;  4BY1 H;  2V1C C;  1EIF A;  3AYH B;  4LFA Q;  4DR6 Q;  4JVH A;  4JBK A;  2HIX A;  2OPV A;  1P8L A;  2CTM A;  1JB7 A;  4HJ7 A;  4OO1 G;  1L1O B;  2E8G A;  1XNR Q;  2KCM A;  3K80 C;  4YY3 L;  1VIH A;  2JA7 G;  1FJG Q;  3BU2 A;  4LUZ A;  2NVY H;  2Y0S E;  2LXJ A;  4P72 A;  1T9H A;  3H3V I;  4P73 A;  4X64 L;  2FMR A;  3H0G G;  1EQQ A;  4X62 Q;  2VQF L;  4GOP C;  4B3S Q;  2ATW A;  4BY7 H;  1Q12 A;  1I6H H;  3J7Z C;  3RZD H;  5IYC G;  4JOI A;  3CCV A;  4A3L G;  3EIV A;  4GN5 A;  4KHP L;  1CKM A;  1OXS C;  4DKA C;  4A3M G;  3BZK A;  1GKH A;  1AE3 A;  4POF A;  4LF7 L;  4JV5 L;  1WJJ A;  4HJA A;  2C35 B;  1K8A C;  1PH6 A;  3GTM H;  4GNX B;  3PO3 G;  3HKZ E;  3LGJ A;  4L5Q A;  1IBK L;  5JJI A;  4A3G G;  1YJN A;  2YYZ A;  1XMQ Q;  4A75 A;  2WB1 G;  4IJH A;  4MZ9 A;  4NB3 A;  3J81 c;  2E5L Q;  1WFQ A;  4DR4 L;  2JA6 H;  3CCQ A;  2QGQ A;  5GAH C;  2UXD Q;  1XNQ L;  1WCM G;  4PG3 A;  2UU9 L;  2UXB L;  4P74 A;  1VQA A;  4FDB A;  2AXY A;  4OWX B;  1LYL A;  1I94 Q;  1PYS B;  4NXN L;  3UDI A;  1N36 L;  2UXC L;  1VQO A;  3HOZ H;  2LXK A;  1A0I A;  1G51 A;  1VQE A;  3RLN A;  3KJO A;  4LFA L;  4QMF B;  2IHE A;  3F2B A;  2ANN A;  3OTO L;  2E5L L;  1QZG A;  4DV5 Q;  2AKW B;  1XTD A;  4LIJ A;  4DR1 Q;  2R93 H;  1HNX Q;  3U1K A;  5JJK A;  4JV5 Q;  3GTJ H;  3TQY A;  1M90 C;  2B63 H;  3S15 H;  4OWT B;  4DR2 L;  4X66 L;  1KD1 C;  3W1G A;  2PY9 A;  1BVS A;  1QZH A;  3HOU H;  5E7N A;  2JK8 A;  1R9T H;  3NBH B;  2F3I A;  1VQG A;  3HOW G;  2B29 A;  3KJP A;  3E0E A;  4BBS G;  1GD7 A;  4DV3 L;  1KL9 A;  3UE0 A;  1EOV A;  2VQE L;  4JI2 L;  1HR0 Q;  4JI1 Q;  4DV4 L;  4DV5 L;  1VQD A;  1UE1 A;  4JI0 Q;  2Z6K C;  1JT8 A;  2N78 A;  5AJ3 L;  4XTC S;  4JBM A;  1PVO A;  2NVX H;  5IYB H;  4GNX C;  2JA8 H;  1GM5 A;  1HNW L;  4A3E G;  3VKE A;  2OTL A;  1CKO A;  2H5X A;  3PGZ A;  1Y1W H;  1JMC A;  4IFD G;  4A3J G;  3NEN A;  4GKJ Q;  3CCJ A;  1DTJ A;  3D31 A;  3A5Z B;  2K50 A;  2VL6 A;  5M5X H;  2N49 A;  1EFW A;  1OXV A;  4YHH Q;  4NXM L;  4DR5 Q;  3GD7 A;  3PUZ A;  2Y0S G;  3JAM c;  2UXD L;  2JJQ A;  1IBL L;  5K36 G;  1VQ4 A;  4JCV E;  1RL2 A;  2RHS B;  5C44 G;  4A3I G;  4DV6 Q;  3PUW A;  1TUA A;  4DV7 Q;  4J15 A;  3F2C A;  1KRS A;  4ME3 A;  1PV4 A;  1VQC A;  1PH3 A;  4LF8 Q;  4UY8 C;  1E24 A;  5HY6 A;  3G4S A;  4OXP A;  1SE8 A;  1YBY A;  5ELN A;  1A63 A;  1N8R C;  3A0J A;  2K52 A;  2HT1 A;  2I5M X;  4A4I A;  1SRO A;  1TWH H;  3CCL A;  2CWA A;  4C3I H;  4R4C A;  4RMF A;  2NZO A;  3S24 A;  4JI5 Q;  1W3S A;  2VQF Q;  4B3S L;  3HOY H;  3PO2 G;  1YIT A;  2AHO B;  5IP9 G;  1FVI A;  4QL5 A;  3S1Q H;  2NVT H;  1GO3 E;  2IHF A;  5C4J H;  2YQR A;  4LWC A;  4YWM A;  3UDG A;  2MJH A;  1I50 H;  3CD6 A;  5JJL A;  1N33 Q;  2VUM H;  1K1G A;  4GLV B;  3F2D A;  3JC6 6;  3UDF A;  1HZB A;  1O7I A;  1WE8 A;  4AYB G;  3ULP A;  3RN5 A;  4L5S A;  3I4N G;  1J5E Q;  4AM3 A;  4R4Q A;  3E9H A;  1TWC H;  1QVG A;  1HNZ L;  1Q7Y C;  2E2I H;  3F8T A;  3J81 i;  1J4W A;  2R6G A;  3PUY A;  3ER0 A;  5DLQ E;  2F52 A;  4A3B G;  4DR3 Q;  4QQB X;  3GTP H;  1MJE A;  2CTF A;  1N33 L;  1SMX A;  2WAQ G;  2AMC B;  4X62 L;  3HOV H;  5FLX c;  3CPW A;  1K8G A;  1N36 Q;  1DGS A;  3WWV A;  4BA1 I;  4GN4 B;  3KFU A;  1ZTG A;  1B70 B;  1CKN B;  1SLJ A;  3PSI A;  2WAQ E;  1PH9 A;  1I94 L;  1QVF A;  3S1M H;  4LUV A;  3I4M H;  1KRT A;  2WB1 E;  2R92 H;  4B3T Q;  4JI4 Q;  2HIV A;  4LF4 Q;  1L1O A;  3HKZ G;  1MKH A;  1IYJ B;  5IP7 G;  1V9P A;  5LMN L;  1QUQ A;  2GVB A;  3FKI H;  4Y7N H;  4JC0 A;  4IJL A;  1X3G A;  2A19 A;  3D0F A;  3L7Z C;  3CME A;  3CW2 C;  4GOP B;  2I0Q A;  1PH7 A;  2Q2H A;  4GLX A;  1VQM A;  3E9I A;  1KXL A;  1C9O A;  1FGU A;  2R92 G;  3I4M G;  4IFD J;  1A8V A;  5IYD G;  4L5R C;  2CTK A;  3I4O A;  1VCI A;  4DUZ Q;  3M7N A;  1W2B A;  2ZTE A;  3CXC A;  4DR5 L;  4HJ9 A;  1X3F A;  1K0R A;  1PFS A;  3CCS A;  2K14 A;  3UE1 A;  3KOJ A;  4BBR H;  2K5H A;  3J81 j;  1YI2 A;  1XJV A;  1Q82 C;  4LF7 Q;  3HOV G;  1NJI C;  3M4O H;  4DV1 Q;  4DR7 Q;  1X55 A;  3SGI A;  1UEB A;  1LTL A;  4DK3 C;  2MNA A;  3H15 A;  4DAY B;  3GTK H;  4A3B H;  1Q86 C;  1B8A A;  5GAE C;  2YTV A;  2BA1 A;  4GS3 A;  1NBW A;  4LF6 Q;  2BL5 A;  2K4K A;  4QY7 A;  4JVY A;  1VQF A;  4LF4 L;  4PZ6 A;  3STB D;  5IWA L;  4GKJ L;  1NMG A;  3KYH C;  1NMF A;  2UUB Q;  4K0K Q;  1Z47 A;  2PQA A;  5IY0 A;  1FL0 A;  2JA5 G;  3AEV B;  4PZ8 A;  3T1H L;  2HQL A;  3CPF A;  3KF6 A;  2IT1 A;  4JI1 L;  4LF5 L;  2R7Z G;  4GKK Q;  2E2H H;  4DR3 L;  4LW1 A;  2ALY B;  4YWK A;  1JJ2 A;  4R4I A;  4X65 Q;  2EXD A;  2OPU A;  1PH1 A;  1EYG A;  1ZZI A;  5IP7 H;  4JYA L;  4O2D A;  3ULJ A;  2IX0 A;  2GN5 A;  4JI7 L;  1HJP A;  5C3E G;  4A3C G;  4OX9 L;  4GKK L;  2NZH A;  3M9B A;  2VS1 A;  5FJ8 H;  3GTG H;  1S40 A;  2P2R A;  3ZJY C;  1E1O A;  1SR3 A;  2OCE A;  3T1H Q;  4YHH L;  1CSP A;  1NTG A;  2WFW A;  4JI6 Q;  4BXX H;  1VQ8 A;  4BXX G;  2I5H A;  1IBM L;  3M3Y H;  2E3U A;  5LMN Q;  2JZX A;  4IPH A;  2KEN A;  2JE6 I;  5C0X J;  1UWV A;  5FJ8 G;  5IWA Q;  4IO9 A;  4ALP A;  2E2J H;  4LF9 Q;  1LM0 A;  3MXN B;  2D62 A;  3CC4 A;  5C3E H;  2RCN A;  4A3C H;  1PYB A;  1XPR A;  2YV5 A;  1BBU A;  1KIX A;  3ICE A;  1VQI A;  1OXX K;  1L0W A;  4DAM A;  2AWN A;  1YHA A;  3K81 C;  2CFM A;  4YY3 Q;  3L2P A;  1XMQ L;  4DR7 L;  3FKI G;  1VQN A;  2MFI A;  1YHQ A;  2R7Z H;  4DR4 Q;  5LMU L;  2IY5 B;  3STB C;  2A1A A;  3DM3 A;  1X6O A;  2ASB A;  2JA5 H;  3CMA A;  2YTY A;  2N3S A;  3AFQ A;  5IYB G;  4JYA Q;  1N9W A;  1VQ6 A;  4WJ4 A;  5HGQ A;  1VQ9 A;  4H02 A;  1KC8 C;  1TWA H;  2K5N A;  4DV7 L;  1PH4 A;  1EC6 A;  1BKB A;  2XGT A;  4EX5 A;  1B7Y B;  1K73 C;  2I5L X;  4YCU A;  2VNU D;  1X4M A;  2PMZ E;  2D0O A;  1N34 Q;  5LMU Q;  3G71 A;  4UPA A;  3HOU G;  3CCR A;  3J7A 5;  1S3O A;  1SN8 A;  2FXQ A;  1ASY A;  3M4Q A;  4BBR G;  4B3T L;  2CCZ A;  4JI4 L;  3GTL H;  2WP8 J;  4DV2 L;  1E1T A;  1X9N A;  3J80 i;  1E7Z A;  3CCU A;  3T1Y Q;  4PZ7 A;  3I4N H;  3M4P A;  1J5K A;  1C7Y A;  5IYD H;  2UUA Q; 
#chains in the Genus database with same CATH topology
 2HDL A;  3VA7 A;  4N8F A;  4A3I H;  2MO1 A;  4DV3 Q;  1D1I A;  3J81 E;  3TN2 A;  5FLX L;  3DEO A;  1XPU A;  4EVO A;  1OXT A;  2R61 A;  4KLK A;  3P20 A;  5DAU A;  3D4W A;  2VW9 A;  4N8X 1;  1HNZ Q;  3L0O A;  2ZM6 L;  3FPP A;  4DV6 H;  5CV6 A;  4HSV A;  4IPC A;  3ERS X;  1LTR D;  4J1M A;  1E22 A;  4DV0 L;  1KDB A;  4B3S H;  1S5B D;  1JOR A;  4XIG S;  3HOW H;  2Q8T A;  1Q46 A;  1VQJ A;  1CQF A;  1BCP B;  2PO4 A;  1XNR L;  1HZ9 A;  2BA0 A;  2OXP A;  1YNN D;  4DV1 L;  2UU9 Q;  3SDZ A;  4PMW A;  1KAW A;  3HOX B;  1A62 A;  3MXP A;  1YNJ D;  3FRP B;  3JAM i;  3FKI B;  4X65 L;  2ANR A;  4HJ5 A;  2B2W C;  3MEF A;  2Q2U A;  1WTR A;  2UXC H;  1XTC D;  2R7Z B;  1XMO Q;  1VQ5 A;  4CDE C;  1YIJ A;  1HRJ A;  2VY3 A;  5M5W H;  1X56 A;  2OT2 A;  3U4Z A;  4A76 A;  1N33 H;  3QJY A;  1N32 Q;  2LRR A;  1E3P A;  1WTW A;  2RF4 A;  1HH2 P;  2HD3 A;  2X06 A;  2B63 G;  4TQU S;  4K2L A;  1R9T B;  1X65 A;  1X54 A;  3KBX A;  2D0P A;  4POG A;  1ONL A;  2AWO A;  3CQZ H;  4OON A;  4B8T A;  2AUJ D;  1KDC A;  1GUO A;  3W5O A;  5JEA J;  5IGE A;  2F0E A;  4GN3 B;  2PQA B;  4QMG A;  3DUZ A;  5E3F A;  1D8L A;  2HDM A;  1IL8 A;  1XMO L;  1SNO A;  2EIF A;  4IQZ A;  1DT4 A;  4LFB Q;  3OMG A;  2Z0S A;  3W1B A;  3V69 A;  4DR5 H;  4XQJ A;  3GTP B;  4YHH H;  1KHI A;  2F0J A;  3RF2 A;  4NXM Q;  2CH4 W;  1HXY D;  1QVC A;  1K83 B;  4XT1 B;  3A8I E;  3T1Y L;  5EPJ A;  4F8M A;  1KQS A;  4R4O A;  2BDN A;  3LX0 A;  2R7D A;  3OWE B;  2WB1 B;  5JOB A;  1YJW A;  1HTP A;  1VS0 A;  1XNQ H;  3CF5 A;  4YCV A;  1SSO A;  2HHH Q;  1TWG H;  4AQY H;  2LSS A;  1LO5 D;  4IPD A;  5H1S E;  4BBR B;  2EQS A;  1N32 H;  3N52 A;  1SXT A;  3BVM A;  1DOL A;  1GUW A;  3TP6 A;  3DLL A;  2NVQ H;  2XRQ D;  3CP0 A;  3R8B A;  2K75 A;  3BZC A;  5M3M B;  1E2Z A;  2HH3 A;  2KED A;  3Q23 A;  4H8A A;  4JI7 Q;  3ONA B;  1U4M A;  3CCM A;  1CI3 M;  3OTO Q;  2CW0 D;  5CGK A;  3K57 A;  1IKM A;  1EWI A;  2UUC Q;  4DV2 Q;  1HNZ H;  4X64 Q;  4FVM A;  2ZJP A;  2QIL A;  1C48 A;  2YU9 B;  2KJX A;  4A3I B;  1HR0 W;  2XSC A;  2ID0 A;  3B6Y A;  1RIP A;  2OTJ A;  2NTS A;  3ERO A;  5A2Q W;  2XTI A;  5IT9 L;  4ZQ3 A;  1UG8 A;  1ENF A;  1L2F A;  3KF8 B;  1IL2 A;  4A3L H;  2D5D A;  1H9S A;  2MGS A;  4BY7 G;  4A93 G;  1TS3 A;  3BVG A;  5FLM G;  1O7Z A;  2A68 D;  2NYZ D;  1PRT C;  4FXK C;  1X9Z A;  3S17 H;  1EWH A;  3J80 W;  1WOC A;  3TRZ A;  5C4X G;  3T56 B;  4JI2 H;  4XXE A;  4X62 H;  4CKB A;  2DN8 A;  3U4V A;  2CQO A;  1V43 A;  3GDE A;  4B3R L;  5KYI A;  1O80 A;  3GTM B;  4A3K G;  2ES2 A;  4LF9 L;  1A2T A;  4DV7 H;  3A7A B;  1F9Q A;  3KLS A;  4DPG A;  3NHH A;  4JBJ A;  5C3E B;  1B44 D;  1Y1V B;  5C4J B;  3NQI A;  3OW2 A;  4A3K B;  4DA2 A;  3K5N A;  2UXB Q;  1KHM A;  1UUP A;  4O42 A;  1Q81 C;  4AQY Q;  4OX9 Q;  2JVZ A;  3K6O A;  3VR3 A;  5FO7 B;  1U0L A;  2A6E C;  4GKJ H;  2JQO A;  3I55 A;  2GVA A;  4DR1 L;  1SEB D;  5JVG 3;  5GQO A;  4BY1 H;  2YU9 H;  1M1K C;  1TKW B;  2OPV A;  4OIK A;  4NMZ A;  4LFC H;  1W6J A;  3KLR A;  5T1I A;  4HTH A;  1HUN A;  1L1O B;  1K3B C;  2E8G A;  2KCM A;  2MHV A;  3MZ5 A;  1IYU A;  4G57 A;  4XQQ A;  4A93 B;  1BOS A;  3BU2 A;  1S03 G;  4LUZ A;  5FLX W;  4X3S A;  4B3M H;  1EL0 A;  3MA2 B;  2EYP A;  2VB2 X;  2VQF L;  2ATW A;  1EIH A;  1X0A A;  3A8J E;  1I6H H;  5FLX E;  1SMY D;  3RZD H;  4JOI A;  2UUA H;  2KQ3 A;  4GN5 A;  1QNU A;  4DR3 H;  4A3M G;  3BZK A;  1GKH A;  3Q6S A;  2EY5 A;  3SR1 A;  1BR9 A;  4HJA A;  1PH6 A;  2E74 C;  1R4Q B;  4DAY A;  2YYZ A;  1XMQ Q;  2K6A A;  4MZ9 A;  3JAM L;  1IBK H;  2JA6 H;  3CCQ A;  2PMZ B;  5JEA H;  1KNE A;  2AXY A;  4OWX B;  1CT1 D;  1PYS B;  2RA4 A;  1EYA A;  3PQI A;  2UXC L;  5I4D A;  3HOZ H;  3EVQ A;  2F0W A;  2AUK A;  2FIN B;  4RH6 A;  2P5Z X;  2IHE A;  3F2B A;  3Q22 A;  3S1Q B;  1RHP A;  4DV5 Q;  4NW2 A;  1SJH D;  1KD1 C;  2EDG A;  2PY9 A;  5A2Q L;  2CW0 C;  2JK8 A;  1R9T H;  4F87 A;  3NBH B;  5COY A;  4RGO S;  1GD7 A;  2R92 B;  1JB3 A;  5T1G A;  1HR0 Q;  2BE5 D;  3G6J B;  1V9N A;  2Z6K C;  4Z9C B;  5IYB H;  3GTG B;  1I6H B;  3RMH A;  2OTL A;  3PGZ A;  2UXC Q;  5JAV A;  3SK8 A;  4GKJ Q;  1DTJ A;  3AB9 A;  1HQR D;  2JA7 B;  2K50 A;  4C2M B;  2EYH A;  2PNR C;  1WTV A;  2Y0S G;  5CV7 A;  4DK1 A;  3M7G A;  5CV4 A;  5K36 G;  2SOB A;  4DV6 Q;  2FPH X;  1TUA A;  1SYD A;  4DV7 Q;  5D65 A;  3KF8 A;  4ME3 A;  2BCO A;  3EJI A;  4CJ2 C;  4IUV A;  3G4S A;  1YBY A;  3A0J A;  4KY7 A;  4QUC A;  2I5M X;  2M9V A;  2EJF C;  3CCL A;  1FKA H;  4C3I H;  2L0C A;  2VQF Q;  2F0T A;  3HOY H;  3S1Q H;  2IHF A;  5C4J H;  4LWC A;  2FHT A;  3R2I A;  2SNS A;  2L9H A;  3CD6 A;  2RKS A;  3V05 A;  4BBS B;  2C9O A;  3UDF A;  4KD4 A;  2O4C A;  1O7I A;  1WE8 A;  1N34 H;  3E5S A;  4R4Q A;  1QVG A;  1HNZ L;  4B8C D;  1A3T A;  1L0Y B;  3J81 i;  1J4W A;  3TDQ A;  2PCF B;  5C5M A;  1D6E C;  4B08 A;  1N33 L;  1T5X D;  4RAU C;  2B2U A;  4DR4 H;  3KFU A;  1ZTG A;  2F0I A;  2M00 A;  3PSI A;  3C46 A;  5FOB B;  3SEB A;  1R4P B;  4B3T Q;  4LF4 Q;  1L1O A;  2HCI A;  5IP7 G;  2ZXO A;  2GVB A;  3CRL C;  4IJL A;  1X3G A;  3L7Z C;  3EA6 A;  1EY7 A;  1PH7 A;  2Q2H A;  1VQM A;  2EY2 A;  1FGU A;  2JSO A;  2JYO A;  2CTK A;  3K5M A;  1IYV A;  4DR5 L;  1K0R A;  2NTT A;  2F0S A;  2K14 A;  4LF7 Q;  2K5H A;  3IAY A;  3OSO A;  1NJI C;  3SGI A;  3H15 A;  3KBG A;  1LTL A;  2MNA A;  1Q86 C;  1B8A A;  5EJW A;  5GAE C;  2BA1 A;  4JK1 C;  3J80 E;  4C3J B;  2ICI A;  3RUZ A;  4LF4 L;  4PZ6 A;  5IWA L;  2WV6 D;  1JOQ A;  4GKJ L;  2IWH A;  2UUB Q;  3KYH C;  5D3I B;  1S20 A;  2QEJ C;  2IT1 A;  5A2Q E;  1HA5 A;  2R7Z G;  4GKK Q;  4YWK A;  2K33 A;  1FGB D;  2F0L A;  1EYG A;  5IP7 H;  3DEP A;  3ULJ A;  2IX0 A;  2GN5 A;  4JI7 L;  2E76 C;  5E4W C;  4BS9 A;  2K7V A;  2VS1 A;  2K04 A;  3PIP 3;  3GTG H;  1CHP D;  2CQA A;  3X3N A;  3ZJY C;  1E1O A;  4L8J A;  5KEE A;  1VQ8 A;  2JZX A;  3MHB A;  4IPH A;  4QIW B;  1BBX C;  3A7L A;  1LM0 A;  3MXN B;  1PYB A;  4H7B A;  1VBI A;  1G8Z D;  1OXX K;  1QE6 A;  1JOO A;  4DR7 L;  2MFI A;  3BVZ A;  2LFN A;  1IW7 D;  1NCV A;  3DM3 A;  2JA5 H;  4O1N A;  1SYG A;  4DN4 M;  3CMA A;  4WJ4 A;  1I94 H;  1TWA H;  2K5N A;  4EQO A;  3BZD B;  3BYT B;  4PV1 C;  2F0O A;  1X4M A;  1RDP D;  5IGG A;  4DR2 H;  4B3T L;  2CCZ A;  3GTL H;  3I4N H;  2F3V A;  1RCV D;  4IZ8 A;  2KCT A;  2NN6 G;  1PH5 A;  2UXD H;  4DV0 Q;  3GTO H;  2OQK A;  3RZO H;  4BA2 I;  4NXN H;  1GHJ A;  5CYU A;  2IX1 A;  4X3U A;  4LF8 L;  2IX3 A;  5DEH A;  1EIY B;  3QD7 X;  1EZ8 A;  4UP9 A;  1CZG A;  4A3B B;  1YZ6 A;  4DXG A;  1WTQ A;  1YJ9 A;  4JI0 H;  4LF5 Q;  5IT9 E;  3VYU A;  1QOH A;  4EQN A;  3J80 c;  1D7Q A;  1AN7 A;  2N8N A;  4LF7 H;  1EUJ A;  2L15 A;  4HID A;  5M3F B;  3QO2 A;  1WTH A;  2HH2 A;  3KDF B;  2NN6 I;  3S15 B;  4IUR A;  1VQH A;  4XYO A;  3OOC A;  2J7Z A;  2RSO A;  4H13 C;  3MWY W;  1N34 L;  2XWJ B;  2BH2 A;  1B3Q A;  1MD2 D;  1KDA A;  1LUZ A;  1S4Z A;  1AE2 A;  1SYC A;  2JA7 H;  2VUM G;  3M4Y A;  1F9S A;  3QWN A;  1RF2 D;  5DM7 3;  3HOZ G;  2RDG A;  2K32 A;  1TII D;  1MHW C;  1TT2 A;  4DNT B;  1GUT A;  2NVX B;  1QCB D;  2KBN A;  1MGS A;  4BBS H;  2RHQ B;  4IAL A;  3K0X A;  3UDX A;  1XPO A;  2PI2 A;  3HFZ B;  4K5V A;  2K03 A;  3HOY B;  1JWM D;  5HGT A;  4X66 H;  5NUC A;  5C44 B;  5L37 A;  1HNW Q;  2R93 G;  2EYL A;  2K5Q A;  2OF1 A;  1NNX A;  5GRO A;  4QGU A;  1I3Q B;  2QDB A;  3W3A A;  2VQE Q;  4DV4 Q;  3G48 A;  1MIU A;  4ZUI A;  1VQB A;  1JOK A;  1BCP C;  2ZJR A;  5ELE A;  1ZEQ X;  1ZZJ A;  2CVR A;  5GAG C;  4IFD H;  1NXU A;  1WCM H;  3CQZ B;  5ELO A;  1ICW A;  2JA8 G;  5KNC A;  1U5K A;  1V8Q A;  2ZXP A;  1KAA A;  4NDX A;  1ZXT A;  4ODG A;  3PF5 A;  4EQP A;  3GAB A;  5A35 A;  2Z1C A;  4DU9 A;  1PRT F;  3ULL A;  1IBM Q;  4LF8 H;  3FP9 A;  2PW7 A;  5IYC H;  2DUD A;  1Q1B A;  3D4R A;  2A68 C;  3EFX D;  4C2M H;  5KRU A;  2K1H A;  1NE3 A;  1B2T A;  3TEH B;  1AZP A;  4DR6 L;  3J81 L;  2EE1 A;  1JWS D;  3EBE A;  1TWF H;  2OQ0 A;  4RWS C;  3H3V H;  1JJC B;  1IBL Q;  3Q8D A;  1TY2 A;  4OO1 I;  1CHQ D;  3AQQ A;  1YVC A;  2EZV A;  1DOK A;  5CR3 A;  2F0P A;  2O5J C;  2CTE A;  2JA9 A;  3K7U C;  1V1P A;  1SFO B;  2J0T D;  1LLR D;  3GTJ B;  4S3S A;  2HHH L;  5C4X H;  4A3F G;  4KTA A;  2F4V Q;  5AJ3 Q;  3AEV A;  4HJ8 A;  1H9M A;  2E5L H;  1G6P A;  4JI2 Q;  3RN2 A;  1HA6 A;  1H9R A;  1XMQ H;  1WI5 A;  1YHB A;  1MBY A;  3MFY A;  3S2H H;  3HOX H;  1PH2 A;  1AW7 A;  1IHZ A;  1VQP A;  5M3M G;  3H0G H;  4FJU A;  3CCE A;  1HZC A;  3FHW A;  1K3R A;  4KI0 A;  5CV5 A;  4X66 Q;  3GO5 A;  3GTK B;  3I7F A;  4B3M L;  3P7J A;  4ZLT F;  2EVB A;  4L5T A;  3HP3 A;  3VA5 A;  1PZJ D;  1ASZ A;  5G3L D;  4FF3 A;  1FNW A;  1B9N A;  2PI2 E;  4ULL A;  1CSQ A;  1SNQ A;  1Y14 B;  4LFC L;  2UUB L;  4ME5 A;  4MNO A;  4WAL A;  1BBW A;  4FP5 D;  1O7L A;  1ET9 A;  5LHY 1;  1F9R A;  3I90 A;  4JI5 L;  4DK6 C;  3C2P A;  4BY7 B;  3RLO A;  3OHX C;  1PHJ A;  1DYQ A;  4KKS A;  2F03 A;  1SAP A;  2ZM6 Q;  4NZT M;  4R8I A;  1I5F A;  4IPG A;  4RA8 A;  3MXG A;  1J5E L;  4R4T A;  4B3T H;  1LT4 D;  1SFO H;  4LUO A;  5I2X A;  1EIF A;  1B3A A;  1LAB A;  2XN9 C;  1P8L A;  2CTM A;  2HUG A;  3X3M A;  2WAC A;  1TWG B;  2E2H B;  3IKJ A;  2F0N A;  1XNR Q;  2CWH A;  1VIH A;  2JA7 G;  5KIX A;  2NVY H;  3A55 A;  3O13 A;  2Y0S E;  2PYK A;  4XT3 B;  1NUC A;  3I4N B;  3H3V I;  2ZM6 H;  4P73 A;  1CZW A;  3H0G G;  2FMR A;  4GOP C;  3ITP A;  1JWU D;  2JP1 A;  1Q12 A;  2KOL A;  2MUY A;  4HCS A;  2XRS D;  3CCV A;  1CKM A;  1OXS C;  1EU3 A;  2BE5 C;  4LF7 L;  4JV5 L;  4QUF A;  3Q24 A;  2C35 B;  1FD7 D;  3PO3 G;  3HKZ E;  1IBK L;  5TSS A;  2WB1 G;  2E5L Q;  4DR4 L;  2ZXR A;  1LT6 D;  5GAH C;  2H4O A;  2UXD Q;  4PG3 A;  2UXB L;  1CQV A;  5HUR A;  2M8W A;  1LYL A;  1I94 Q;  4WJW A;  3BDO A;  1TU2 B;  1VQO A;  3RLN A;  2VQF H;  2NN6 H;  3KJO A;  1Q8I A;  2F0Q A;  1PTO F;  3OTO L;  2EJG C;  1XTD A;  4DR6 H;  1ROD A;  4LJZ C;  4WOR A;  3GV3 A;  4JV5 Q;  3S15 H;  2M6Q A;  1X3P A;  3HOV B;  1G91 A;  1V8C A;  3OSS D;  2K5D A;  2O5I C;  3HOW G;  4DFA A;  5G3L F;  5I9P A;  3NCV A;  3E0E A;  4DV3 L;  2NVY B;  3DMU A;  2A69 C;  3HOU B;  1I4Q A;  2CH4 A;  1VQD A;  5CBA E;  3OW7 A;  1UE1 A;  2N78 A;  4XTC S;  1GHK A;  2F0H A;  2XVS A;  2NVX H;  4JVZ A;  1AEX A;  1RJT A;  2JA8 H;  1HNW L;  4JV5 H;  4A3E G;  3KUP A;  1SBB B;  1JMC A;  4IFD G;  4OHJ A;  4YHH Q;  4NXM L;  1H9S B;  2JJQ A;  4JCV E;  1RL2 A;  3ND8 A;  1RKN A;  4A3I G;  3T16 A;  4J15 A;  1KRS A;  4LF8 Q;  1E24 A;  3JAM E;  3I72 A;  3VR2 A;  1SE8 A;  5ELN A;  1KAB A;  3QOL A;  1JC7 A;  2K52 A;  1NR2 A;  4FXD A;  1LTA D;  1HHV A;  2CWA A;  1LTT D;  3PMF A;  4LAA A;  4R4C A;  4RMF A;  3S24 A;  4JI5 Q;  3PO2 G;  1EU4 A;  3M4O B;  1PFB A;  5IP9 G;  1WD1 A;  3MEH A;  3WOF A;  4YWM A;  2MJH A;  3I70 A;  1I50 H;  5JJL A;  4BY1 B;  1I4R A;  3OIQ A;  1I6U A;  2VUM H;  4DNR B;  4GLV B;  3QIA A;  2CWF A;  1J5E Q;  4AM3 A;  1TWC H;  3FMC A;  1Q90 A;  2QW7 A;  2E2I H;  2JA6 B;  3QOJ A;  4ZKB B;  2R6G A;  3ER0 A;  1XYI A;  1STH A;  4I7Z C;  3QG1 A;  4QQB X;  1SMX A;  1F0X A;  4IUU A;  4KV6 A;  2FFK B;  4GN4 B;  1TS5 A;  1SLJ A;  1I4G A;  3TME A;  3S1M H;  1KRT A;  1PRT B;  4JW0 A;  2ICE C;  4JYA H;  3ERQ A;  5J22 A;  1MKH A;  3HOZ B;  1VF7 A;  2PW5 A;  3OWF A;  4Y7N H;  4PMC A;  3I4M B;  4JC0 A;  3Q0A A;  1MSG A;  3CME A;  2B8F A;  5C4X B;  3DWP A;  3FVQ A;  3C1F A;  4A3F B;  1Y8O B;  3E9I A;  4IFD J;  4FXG C;  3I4O A;  2PZT A;  2F0D A;  4DUZ Q;  2PZW A;  1ILP A;  3NBH A;  1STB A;  1PTO B;  1XJV A;  3UE1 A;  3KOJ A;  3M4O H;  1Q82 C;  5EBD A;  4DV1 Q;  1GXD C;  3SB1 A;  4RHS A;  1UEB A;  4DF7 A;  3GTK H;  2A1S A;  4JI3 H;  2LKV A;  1J9O A;  4CKE A;  4QY7 A;  2F4V H;  1VQF A;  2X69 A;  3BS1 A;  4KHV A;  1BUV T;  5EKL A;  1NMF A;  1ENC A;  1Y69 U;  2PQA A;  4G7H C;  2UUC H;  2JA5 G;  2F0K A;  3WDN A;  4HSP A;  4JPB W;  3T1H L;  4C1N K;  3CPF A;  3KF6 A;  4JI1 L;  1ML0 D;  4RGT A;  2L1B A;  2E2H H;  1WTO A;  4LW1 A;  1SYB A;  1SYF A;  1FJG H;  2JXM B;  1ILQ A;  1VF5 C;  1HJP A;  1EY4 A;  3M9B A;  2JA8 B;  4K2K A;  5D14 A;  2LTL A;  2OCE A;  2EYM A;  1NTG A;  2VXW A;  4JI6 Q;  1IBM L;  2E3U A;  3M3Y H;  2Z4I A;  2KEC A;  2JE6 I;  4IO9 A;  5IWA Q;  4LF9 Q;  1A6X A;  4JI8 H;  1Y8P B;  3CC4 A;  4HMI A;  2RCN A;  3JAM W;  2BDO A;  1XPR A;  1KIX A;  3ICE A;  1Y8N B;  4DAM A;  2AWN A;  1YHA A;  3VYR A;  1YNN C;  1HFG A;  3L2P A;  1N36 H;  1J5E H;  4ZUJ A;  4K8I A;  1VQN A;  2R7Z H;  4RKB A;  5LMU L;  2IY5 B;  1JCK B;  3STB C;  1EY6 A;  2A1A A;  4LFB H;  2ASB A;  2N3S A;  3AFQ A;  5IYB G;  4Q5V A;  1VQ6 A;  5HGQ A;  1VQ9 A;  3S16 B;  4H02 A;  4JI5 H;  1EC6 A;  2CHB D;  2XGT A;  4DV3 H;  3MFG A;  1DJR D;  3NQT A;  4HN7 A;  1K73 C;  2KCN A;  2D0O A;  2LS0 1;  2UUB H;  4ZK9 B;  5JPM C;  3CCR A;  1IW7 C;  1S3O A;  2FXQ A;  3M4Q A;  4KY6 A;  2A6H C;  1E1T A;  3CCU A;  1EQV A;  2IW3 A;  3SK6 A;  5IOD A;  5M5W B;  1J5K A;  1SE2 A;  2BH8 A;  1VQL A;  3PF4 A;  1WYD A;  3KLW A;  4A3G B;  2PT7 G;  4LFB L;  1HR0 L;  1IBK Q;  5IP9 H;  4JI3 L;  3TS0 A;  4DUZ L;  3EN2 A;  1K83 H;  2O4X A;  1OXU A;  2YTX A;  3NBI A;  5M9O A;  3PO2 H;  1OTC A;  1L1O C;  1BDO A;  4A3J H;  2RBM A;  3G7L A;  1Y1W G;  1HNX L;  1V1Q A;  3K8A A;  2QND A;  1PXU A;  1BCP F;  1VQ7 A;  4JBW A;  3GP7 A;  3HOW B;  4UP8 A;  2B2U C;  1ZKO A;  4G4K A;  1TQO A;  1VIG A;  4EQ5 A;  4UP7 A;  2EY6 A;  1XMO H;  3PV0 A;  4JOI C;  4CDC C;  3NEL A;  4DUY L;  2DJF C;  1A3U A;  2XNA C;  5BN3 A;  2R7F A;  4NKL A;  3S16 H;  2DY7 A;  3VR4 A;  4KMU C;  3N6R A;  1Z7T A;  1WTX A;  3V96 A;  4A3E H;  5EKK A;  4C3J H;  4Y7N B;  2CPQ A;  1GVP A;  1QJO A;  1UNS A;  4E6I A;  2FJ2 A;  3A74 A;  1PMR A;  1X3E A;  5LMN W;  4FO2 A;  3BYY B;  4OX9 H;  4ZRZ A;  1UE7 A;  1K9M C;  3FAU A;  4DR1 H;  4C3I G;  4BY1 G;  2F4V L;  3KK7 A;  1IZ6 A;  1DCZ A;  1SDF A;  3G6E A;  1TXY A;  4EC5 A;  3UOE A;  4QIW E;  2E75 C;  4G08 A;  4PQX A;  4RCN A;  1H9J A;  3S1N B;  4IOC A;  4A3G H;  5IGF A;  4NXN Q;  4X6A H;  4DUY Q;  1K28 A;  2VZA A;  1STN A;  5I6Y A;  1KTK A;  1QG7 A;  4JG2 A;  5EPL A;  4O0A A;  3PO2 B;  2CWP A;  5K36 H;  4DR7 H;  1QUQ B;  3MTS A;  1N32 L;  4R1J A;  2E2I B;  5C0X I;  4B3R H;  2F0V A;  2TSS A;  2VUM B;  1UE5 A;  4DR2 Q;  2A8V A;  3URY A;  4K0K H;  3OET A;  2DGR A;  1F2Z A;  3S14 H;  4DV2 H;  3HEJ A;  1JR0 D;  2Z6K A;  3IRB A;  3J7Y W;  4OO1 H;  3GR5 A;  3PUV A;  3PO3 H;  2NBF A;  5FKA C;  3S1R H;  5C3W A;  4L6T B;  3H6M A;  4DAP A;  4OD6 A;  4YWL A;  1ENA A;  5GAD C;  3A8K E;  4WFN 3;  1VQK A;  4GOP A;  3D6C A;  2L4N A;  3PCO B;  3A5U A;  2K5W A;  3F1Z A;  3CC7 A;  2N88 A;  1GUS A;  3T4A C;  2MJ8 A;  4NP5 A;  4OL7 A;  1KLG D;  2KHJ A;  3SVM A;  4WAN A;  3T51 B;  1MSH A;  5IWA H;  1WVN A;  1XNQ Q;  1P16 A;  1O78 A;  4AYB B;  1PTO H;  1ZYR C;  4UDU C;  3S1N H;  5IT9 c;  3E3X A;  1CA5 A;  5JEA G;  1S72 A;  4NPS A;  5ELF A;  4IFD I;  5EPK A;  5EKI A;  5CMD A;  2VKC A;  5COR A;  5BR8 H;  1M8A A;  5C6A A;  4DNI A;  4HIO A;  4LF6 L;  4JI0 L;  2CTJ A;  1J6Q A;  4ZAI A;  4MTN A;  2Q8I B;  4OWW B;  1S5F D;  4CHT B;  3U58 A;  2EY1 A;  1JJG A;  1TWC B;  2L12 A;  3F2U A;  3PIO 3;  4OIJ A;  2QEX A;  4JI8 L;  5BR8 Q;  4KHZ A;  3J7A K;  2ZJQ A;  5I6W A;  4JI3 Q;  4GLA C;  3NEM A;  4HIK A;  4RKL A;  4DV0 H;  3MVV A;  2EYJ A;  3S17 B;  2Z4H A;  1X4N A;  4QCL A;  2PQU A;  1EIG A;  1IBL H;  4QJF A;  2G5D A;  1SMY C;  3OIP A;  1SJE D;  5M3M H;  1PTO D;  2SDF A;  5IT9 W;  3HOX G;  3KDF A;  1FJG L;  2Y0S B;  1RTO A;  4WRD A;  1CTM A;  3TZD A;  2NVT B;  1YNX A;  2QA4 A;  3C3L A;  4A3F H;  3MAQ A;  4K6L A;  4IOA A;  4JI8 Q;  5BR8 L;  4B3M Q;  2Z6B A;  1ZYR D;  1U4L A;  5EAY A;  4A3K H;  1HNX H;  4JVH A;  2LY7 A;  4LFA Q;  4JBK A;  3ZYY X;  2HIX A;  4M1U B;  1JB7 A;  1Q3L A;  2B2W A;  3VR5 A;  1B1Z A;  3AU7 A;  1ICF B;  3C1E A;  3P1H A;  3SK4 A;  1KLU D;  4CJ0 B;  1WCM B;  2LXJ A;  4R9W A;  4RHR A;  4A3J B;  1EQQ A;  4BY7 H;  3HG9 A;  4X62 Q;  2RDH A;  4JI6 H;  1QWY A;  2A74 C;  5IYC G;  4A3L G;  3EIV A;  2C5C A;  1AE3 A;  1C4Q A;  1HNW H;  1WJJ A;  3DHQ A;  3GTM H;  4GNX B;  4R8N A;  3LGJ A;  2M2L A;  1YJN A;  3IFD A;  2EPB A;  1HCZ A;  1EEF D;  4IJH A;  4NB3 A;  3J81 c;  1WFQ A;  1B50 A;  1WCM G;  2UU9 L;  4X3K A;  3I4L A;  1VQA A;  2K1B A;  2D9U A;  4NXN L;  3UDI A;  5KGU A;  1N36 L;  1A0I A;  1G51 A;  1VQE A;  2I46 A;  3CHB D;  5ELD A;  1G2S A;  4QMF B;  1ESR A;  2ANN A;  5LMU H;  1QZG A;  2AKW B;  4DAV A;  4DR1 Q;  2ZT9 C;  4LIJ A;  2R93 H;  3U1K A;  1ESF A;  2G9D A;  3GTJ H;  3TQY A;  2A73 B;  4DR2 L;  4X66 L;  4IUT A;  3W1G A;  4DUY H;  1BVS A;  2KUM A;  1QZH A;  1HFN A;  2L11 A;  2F3I A;  1B4O A;  3QB3 A;  3FDT A;  2F3W A;  4BBS G;  2E2J B;  1GUN A;  4JI2 L;  5IGD A;  3NXW A;  4DV4 L;  2D9I A;  1E2V A;  5AFW A;  4DV5 L;  1TWH B;  5AJ3 L;  4JBM A;  1PVO A;  4A3M B;  2I07 B;  5ELB A;  3HZX A;  3OMC A;  1GM5 A;  3VKE A;  1CKO A;  5E4X A;  1X32 A;  3D31 A;  3A5Z B;  2VL6 A;  1SEI A;  2N49 A;  4TRD A;  2R3Z A;  1F2Y A;  1OXV A;  4JI1 H;  4DR5 Q;  3PUZ A;  1DD2 A;  1IBL L;  4KD3 A;  4M8A A;  1VQ4 A;  2RHS B;  4QF4 A;  3PUW A;  2BOS A;  4FJS A;  3EQL C;  1PV4 A;  1VQC A;  2HQE A;  2F0M A;  1GUG A;  4RGN A;  1CM9 A;  5HY6 A;  1WTP A;  3DWQ A;  1STG A;  4DV5 H;  1PTO C;  1SRO A;  2O2L D;  1W3S A;  3S14 B;  2AHO B;  2CPM A;  1QB5 D;  1PFN A;  4QL5 A;  4LMQ D;  2NVT H;  1XRH A;  1B9M A;  3UDG A;  1N33 Q;  3UI2 A;  1K1G A;  5EGT A;  5ELC A;  3F2D A;  1STA A;  2N55 A;  3JC6 6;  4J8Q A;  1HZB A;  4AYB G;  3ULP A;  3RN5 A;  3I4N G;  1LTG D;  4CBV A;  4FF4 A;  3E9H A;  1IKL A;  2J4X A;  5M5Y B;  1SE3 A;  3I91 A;  1Z6H A;  1DON A;  4LF4 H;  3F8T A;  3SXH A;  3K59 A;  1I50 B;  1SNM A;  5DLQ E;  2F52 A;  4A3B G;  4DR3 Q;  4TSS A;  1MJE A;  1G2T A;  1A2U A;  1RD9 D;  3CPW A;  2F0U A;  1K8G A;  4YY3 H;  1DGS A;  3TP8 A;  1QNK A;  4BA1 I;  1CKN B;  1B70 B;  5IIF A;  1PQX A;  2WAQ E;  1PH9 A;  1I94 L;  1QVF A;  2R92 H;  4JI4 Q;  3OPO A;  4PNY A;  5LMN L;  4EGV A;  1D5M C;  2MPM A;  3NSW A;  4LF9 H;  4KJN A;  4KN4 C;  2A19 A;  1SE4 A;  3CW2 C;  3HGB A;  4J6H A;  2LF0 A;  4GLX A;  1Z2I A;  3S9W A;  1KXL A;  1U4R A;  2B2V A;  3I4M G;  1A8V A;  1EY0 A;  5IYD G;  4L5R C;  3M7N A;  1VCI A;  1W2B A;  1FYC A;  2ZTE A;  5FO8 B;  1X3F A;  3CCS A;  4F7X A;  3HOV G;  3J81 j;  1YI2 A;  3NTK A;  4B9W A;  1X55 A;  2K01 A;  4GZY C;  2TMP A;  4DK3 C;  4DAY B;  4LF6 Q;  2WKD A;  2YTV A;  2BL5 A;  4GS3 A;  1NBW A;  2RCF A;  2K4K A;  4OGQ C;  4JVY A;  1XXG A;  1V1P B;  3NE5 B;  2E2D C;  2VB3 X;  3LWU A;  4K0K Q;  2WKC A;  4MIU A;  5IY0 A;  2B8G A;  1FL0 A;  4DV1 H;  3AEV B;  1FNU A;  3KDG A;  1KNA A;  1FR3 A;  3FPU B;  4LF5 L;  2Z9H A;  4K5W A;  2OPU A;  1PH1 A;  5C3X A;  4JYA L;  4O2D A;  1TY0 A;  1LTS D;  2MP1 A;  5C3E G;  1E2W A;  2P2R A;  1SR3 A;  5FO9 B;  5K5P A;  2WFW A;  4BXX G;  1OO9 B;  2KEN A;  4IUN A;  5C0X J;  1UWV A;  2EYO A;  5FJ8 G;  4ALP A;  1CA6 A;  5JVH 3;  2E2J H;  4OCH A;  1PZI D;  4A3C H;  1H9K A;  2YV5 A;  1BBU A;  5KNB A;  1S5E D;  3NTH A;  4YY3 Q;  2CFM A;  3I0P A;  1J8I A;  3BG3 A;  1D5X C;  1XMQ L;  1EYC A;  3VR6 A;  2HCC A;  3OTO H;  1PRT D;  1NSN S;  1X6O A;  2OEO A;  2YTY A;  4JYA Q;  1VDZ A;  1BQQ T;  1KC8 C;  1I4H A;  1PH4 A;  2B2Y A;  2RDF A;  1BKB A;  4K5X A;  4Q0F A;  4IUP A;  2I5L X;  4K14 A;  2PMZ E;  3R2T A;  1FNV A;  3HOU G;  3SHL A;  5I9O A;  3J7A 5;  2PPB C;  1SN8 A;  4F88 A;  4CDF C;  4BBR G;  2B2T A;  4JI4 L;  1S5C D;  1X9N A;  3J80 i;  3ND9 A;  1C7Y A;  2UUA Q;  4B3R Q;  5J3B A;  3I8Z A;  5LL6 X;  3GTL B;  1CK1 A;  2B3G A;  4H44 C;  4YCW A;  3WOE A;  4NXM H;  4ZKC B;  4DXF A;  1ZZK A;  3HOY G;  3SK5 A;  1CUK A;  3K7A B;  3RLF A;  2CKZ B;  4AYB E;  2KCC A;  1PA6 A;  5DT9 A;  3RR5 A;  3W2D A;  1H95 A;  4FYD A;  1SNP A;  4XYQ A;  2K05 A;  1G29 1;  3L3O C;  3K58 A;  4FF2 A;  4IUQ A;  3MC0 B;  4RG1 A;  2KA7 A;  4HIM A;  4X3T A;  2DNE A;  1CKN A;  2B39 A;  2DGY A;  3RD4 A;  4K0K L;  2KHI A;  1EY9 A;  4X64 H;  2B63 B;  1TWF B;  3CAM A;  3I2Z A;  3QR8 A;  3TRE A;  1IBM H;  3NPP A;  4L63 B;  1LV9 A;  3VDY A;  3NUC A;  4AIM A;  3S2D B;  4KN7 C;  2XIW A;  5J39 A;  3J7A V;  4NZR M;  3L9A X;  1Z9F A;  4DV6 L;  4N9P A;  4AQY L;  1I6V C;  1MJC A;  2A5H A;  4ILW A;  5IYD H;  4TVA B;  2OWO A;  2UXB H;  4RFB A;  1QIL A;  3D4D A;  4U67 3;  4KK7 A;  2Z8L A;  4A3D G;  3T1Y H;  3RZO B;  3HKS A;  2AQ1 B;  4Y52 H;  2UUC L;  1D5Z C;  4YIJ A;  1BXT A;  1LAC A;  3NWT A;  3TS2 A;  5JJZ A;  4LNQ A;  2MO0 A;  5EQ0 A;  3K7A H;  1K8O A;  3GTQ B;  3T13 A;  5C44 H;  1ODH A;  1STY A;  2K5V A;  3CC2 A;  4JI6 L;  2ZTD A;  4A3E B;  4G7Z C;  1JE4 A;  1ET6 A;  1SRU A;  2D2C C;  3BJU A;  1EY5 A;  2CTL A;  2Q2I A;  4QB4 A;  4AH6 A;  4DK0 A;  3KLS X;  4MN3 A;  1PH8 A;  3TSS A;  4GNX A;  2JA6 G;  5M5X B;  2KEE A;  2QKI C;  3I3C A;  1TVX A;  4DV4 H;  3S2H B;  2NVQ B;  5C4H A;  4A3M H;  5FK9 C;  3J81 W;  2Q2T A;  5C0X G;  1L0X B;  1Y1V G;  4DUZ H;  2DJG C;  4APV A;  1LT5 D;  2L55 A;  5M3F H;  3AMU A;  3RZD B;  4LFC Q;  3HRZ C;  5CV8 A;  2ZTC A;  1YEZ A;  3LWE A;  2RQX A;  4RCO A;  3J80 L;  2FMC A;  4HAE A;  3S1R B;  3PIO A;  3NTI A;  1F2M A;  2EXZ A;  3OYY A;  1T5E A;  5BN4 A;  4KHP Q;  5E1F A;  5IGB A;  4KKU A;  4XQN A;  2UU9 H;  3BDL A;  1Y1W B;  1DZ1 A;  2A6H D;  2MQH A;  1IXR A;  4LK1 C;  3M85 A;  4NBQ A;  1K0S A;  3GTQ H;  3V2T A;  4FF1 A;  3A56 A;  4C3H H;  1PFM A;  3D3R A;  5M3F G;  4LF6 H;  4P75 A;  3H0G B;  2PNH A;  1WHR A;  3H3V C;  1Y1V H;  3DXJ C;  5C0X H;  3PIP A;  3U50 C;  2JN4 A;  5C5L A;  4PDB A;  3HS0 C;  1UE6 A;  5M5Y H;  2KHS A;  1I3Q H;  1Q8K A;  1XNQ L;  1Q1E A;  1S40 A;  4UY8 C;  5CBE E;  2NWG A;  3E0J A;  1S5D D;  3E6Z X;  1EEI D;  1MSZ A;  4CKC A;  1SNC A;  1O7Y A;  3AFP A;  2IJ0 A;  2JEB I;  4WJ3 M;  4RGM A;  4P71 A;  2WIN B;  1EQR A;  4ZYS A;  3MXN A;  3T53 B;  5FLM H;  2ENB A;  3I56 A;  2UUA L;  4A93 H;  1TS4 A;  4PMB A;  1VMC A;  1AH9 A;  1C0A A;  1TS2 A;  5IE8 A;  1BNZ A;  2F1M A;  3J7A F;  3RNU A;  3H91 A;  3S2D H;  1PLF A;  2EYF A;  2JEA I;  3PUX A;  4V19 0;  1MI2 A;  4K8J A;  1E0B A;  4P2C B;  1HZA A;  1SND A;  2HHH H;  3KF6 B;  4A3D H;  3EZJ A;  4JI4 H;  1JE5 A;  1NY4 A;  2DNC A;  3GV6 A;  4DR6 Q;  2V1C C;  3AYH B;  2PQE A;  2Y3M A;  1GOZ A;  4HJ7 A;  1HTL D;  4OO1 G;  2FFM A;  3K80 C;  4YY3 L;  4KY5 A;  4G7O C;  1FJG Q;  1DOM A;  2X6G A;  4ABN A;  3IFT A;  4GKK H;  2L5T A;  4P72 A;  4V0B A;  1T9H A;  1EQT A;  1EYD A;  2EJM A;  4X64 L;  4B3S Q;  5C4Z A;  3J7Z C;  3PO3 B;  3DWA A;  3R93 A;  4CDD C;  4KHP L;  4DKA C;  4UHV A;  4POF A;  3K5O A;  1K8A C;  5F2D A;  5EBC A;  4C3H G;  4L5Q A;  5JJI A;  4A3G G;  1WTJ A;  4XDX A;  4A75 A;  5LL6 b;  2VQE H;  2G8Y A;  2QGQ A;  5BN5 A;  2QDL A;  2ZQE A;  2NUC A;  1PDQ A;  4P74 A;  4FDB A;  5D3D A;  1U9R A;  1RTN A;  3U9O A;  2LXK A;  3GQB A;  2IL8 A;  1WVL A;  1EFI D;  4LFA L;  4C3J G;  4HCE A;  2E5L L;  4K6D A;  4E9J A;  4LFA H;  3CKI B;  1HNX Q;  2B2T C;  5JJK A;  3GKU A;  1M90 C;  2B63 H;  4OWT B;  2NZ1 D;  1D1K A;  3HOU H;  5E7N A;  1DM0 B;  1VQG A;  1HQM C;  4KJO A;  2B29 A;  1SYE A;  4CGY B;  2DY8 A;  2F0F A;  3KJP A;  1KL9 A;  3UE0 A;  1EOV A;  2VQE L;  1V1O A;  4JI1 Q;  2XWB B;  1U4P A;  4N9T A;  4JI0 Q;  1JQY D;  1JT8 A;  1EZ6 A;  4C3I B;  1EOT A;  3NP8 A;  4GNX C;  1CFM A;  4B9X A;  1Y1W H;  2H5X A;  1AZQ A;  4X65 H;  4A3J G;  3NEN A;  3CCJ A;  2AQ2 B;  2RSN A;  2FMM A;  5IOC A;  5M5X H;  1B53 A;  2H1E A;  1EFW A;  5I2Y A;  1NR4 A;  3GD7 A;  3LNN A;  3JAM c;  2UXD L;  1II3 A;  5C44 G;  2R93 B;  1GJX A;  1XX8 A;  3F2C A;  2QF7 A;  2PZU A;  1PH3 A;  3GTO B;  4KKT A;  3HKZ B;  3K0Y A;  4OXP A;  1A63 A;  1N8R C;  3NK9 A;  2HT1 A;  4TKO B;  4A4I A;  1TWH H;  3NWS A;  3IL8 A;  4C1N I;  1D2B A;  1BF4 A;  2NZO A;  4B3S L;  2WAQ B;  1YIT A;  1BO0 A;  1FVI A;  1GO3 E;  1YNJ C;  2YQR A;  5KND A;  4C56 C;  2LTM A;  1PYW D;  2KVM A;  3MXU A;  3P75 A;  3D6W A;  2GA4 B;  4L5S A;  1LTB D;  1HUM A;  2F4I A;  4MHE A;  1EY8 A;  2EOT A;  1Q7Y C;  3SE0 A;  3R3O A;  1I4X A;  3PUY A;  2RVL A;  1TWA B;  3M3Y B;  5J1Z A;  3GTP H;  2CTF A;  2WAQ G;  2QCP X;  2AMC B;  4I7A A;  4U68 A;  4X62 L;  1F77 A;  3HOV H;  5FLX c;  4I65 A;  3TP7 A;  4A3D B;  1N36 Q;  3WWV A;  4HMJ A;  4OEL B;  2A69 D;  3H94 A;  3U9S A;  3FEW X;  2AQ3 B;  4LUV A;  3I4M H;  1BCP D;  2B2V C;  2SNM A;  2WB1 E;  1F9P A;  2F0G A;  2HIV A;  4JI7 H;  3HKZ G;  2A6E D;  5ISR A;  1IYJ B;  1V9P A;  1QUQ A;  3FKI H;  1C8C A;  5LMN H;  3D0F A;  1HR0 H;  4ID6 A;  4C3H B;  4GOP B;  2I0Q A;  3T1H H;  1C9O A;  1F2L A;  2R92 G;  4DGZ A;  2X6L A;  3CXC A;  4HJ9 A;  2V4D A;  1PFS A;  4BBR H;  5JPN C;  4HED A;  3D8G A;  4DR7 Q;  4H0L C;  4A3B H;  5CC4 A;  2SEB D;  3KDK A;  4BWG B;  2LMC B;  4OEM B;  1W6K A;  2G9H D;  2B2Y C;  2NB0 A;  3STB D;  3H09 A;  1NMG A;  1K8M A;  1Z47 A;  4PZ8 A;  2HQL A;  3A54 A;  2K28 A;  4KHP H;  4DR3 L;  2ALY B;  3K5L A;  5LL6 S;  1JJ2 A;  4R4I A;  4X65 Q;  2EXD A;  2JA5 B;  1ZZI A;  3S1M B;  1A3V A;  1EWC A;  1AP0 A;  1TR5 A;  1XNR H;  3DM1 A;  1WD0 A;  3VYT A;  4A3C G;  5DNF A;  4OX9 L;  4GKK L;  1PZK D;  2NZH A;  1VMP A;  5DM6 3;  5FJ8 H;  1AFP A;  4IN3 A;  3CRK C;  1NAP A;  3T1H Q;  1XWE A;  1CSP A;  4YHH L;  4BXX H;  2I5H A;  5LMN Q;  5CV9 A;  1STE A;  1G6Z A;  2D62 A;  3TZU A;  4CJ1 B;  5IGC A;  5C3E H;  3BDC A;  3I73 A;  4ZCK A;  4UAI A;  3TP5 A;  1VQI A;  2Q8R E;  4FNF A;  1L0W A;  3K81 C;  4HR7 B;  3FKI G;  1UEA B;  1YHQ A;  4DR4 Q;  2IPK D;  4LF5 H;  1X3Q A;  1JIC A;  1N9W A;  1LTI D;  1LT3 D;  3TBI B;  1AN8 A;  4DV7 L;  4EX5 A;  1B7Y B;  4YCU A;  2VNU D;  2WII B;  3CU7 A;  1N34 Q;  5LMU Q;  3G71 A;  1M4V A;  4UPA A;  3VYS A;  1I4P A;  4MTK A;  1ASY A;  1DXM A;  2WP8 J;  4DV2 L;  1A15 A;  1E7Z A;  1UAP A;  3T1Y Q;  4PZ7 A;  3M4P A;  1HPC A;  5KYL A; 
#chains in the Genus database with same CATH homology
 4B3R Q;  2BH8 A;  2KCT A;  5J3B A;  1VQL A;  4A3I H;  3PF4 A;  2NN6 G;  2MO1 A;  1WYD A;  3KLW A;  4DV3 Q;  2B3G A;  1PH5 A;  4YCW A;  4LFB L;  4DV0 Q;  1HR0 L;  3GTO H;  2OQK A;  1XPU A;  3RZO H;  1IBK Q;  4BA2 I;  5IP9 H;  4JI3 L;  3TS0 A;  1ZZK A;  1OXT A;  2IX1 A;  4DUZ L;  3HOY G;  3EN2 A;  1K83 H;  1CUK A;  1OXU A;  2YTX A;  1EIY B;  4LF8 L;  3PO2 H;  4UP9 A;  1OTC A;  1L1O C;  1YZ6 A;  3RLF A;  4A3J H;  4KLK A;  2CKZ B;  4AYB E;  2VW9 A;  1Y1W G;  1HNX L;  1V1Q A;  3K8A A;  3L0O A;  1YJ9 A;  2ZM6 L;  1HNZ Q;  1PA6 A;  4LF5 Q;  2QND A;  3RR5 A;  1H95 A;  1VQ7 A;  4IPC A;  4JBW A;  1G29 1;  3ERS X;  4UP8 A;  1E22 A;  3J80 c;  1D7Q A;  4DV0 L;  2N8N A;  1EUJ A;  2L15 A;  1VIG A;  4RG1 A;  4EQ5 A;  4HID A;  4UP7 A;  4XIG S;  4HIM A;  3HOW H;  3PV0 A;  2HH2 A;  1CKN A;  1Q46 A;  4JOI C;  2DGY A;  4K0K L;  1VQJ A;  3CCE A;  2KHI A;  3NEL A;  4DUY L;  3KDF B;  1XNR L;  2NN6 I;  2R7F A;  1HZ9 A;  1VQH A;  2BA0 A;  3S16 H;  4DV1 L;  3CAM A;  2UU9 Q;  3I2Z A;  4PMW A;  1KAW A;  3TRE A;  1N34 L;  1A62 A;  3JAM i;  2BH2 A;  4A3E H;  1LUZ A;  4C3J H;  2CPQ A;  1AE2 A;  1GVP A;  4X65 L;  3VDY A;  4HJ5 A;  2JA7 H;  3A74 A;  4AIM A;  3MEF A;  2VUM G;  1X3E A;  2ANR A;  2Q2U A;  5LMN W;  3HOZ G;  1XMO Q;  1Z9F A;  1VQ5 A;  4DV6 L;  1YIJ A;  4AQY L;  2VY3 A;  5M5W H;  1MJC A;  1X56 A;  2KBN A;  3U4Z A;  4BBS H;  1UE7 A;  1K9M C;  2RHQ B;  4TVA B;  3K0X A;  3UDX A;  4A76 A;  4BY1 G;  2PI2 A;  1XPO A;  2OWO A;  2F4V L;  1N32 Q;  1IZ6 A;  3G6E A;  3HFZ B;  1TXY A;  4A3D G;  1E3P A;  2RF4 A;  4QIW E;  1HH2 P;  3HKS A;  2B63 G;  4A3G H;  4IOC A;  4X6A H;  1HNW Q;  4TQU S;  4NXN Q;  2R93 G;  4Y52 H;  4DUY Q;  1X65 A;  2UUC L;  1X54 A;  4POG A;  2D0P A;  2VZA A;  3TS2 A;  2AWO A;  3CQZ H;  5GRO A;  4OON A;  4QGU A;  4LNQ A;  4B8T A;  2MO0 A;  2VQE Q;  4JG2 A;  3W5O A;  3K7A H;  4O0A A;  4DV4 Q;  3G48 A;  2CWP A;  1MIU A;  5JEA J;  1VQB A;  5C44 H;  1QUQ B;  4GN3 B;  1N32 L;  2K5V A;  2PQA B;  3CC2 A;  2ZTD A;  4R1J A;  5C0X I;  2ZJR A;  4JI6 L;  1SRU A;  3BJU A;  1D8L A;  1UE5 A;  4DR2 Q;  2A8V A;  1ZZJ A;  2CTL A;  1XMO L;  2Q2I A;  4AH6 A;  5GAG C;  2DGR A;  1WCM H;  2EIF A;  1PH8 A;  1DT4 A;  5ELO A;  4LFB Q;  2Z0S A;  3W1B A;  4GNX A;  2JA6 G;  2JA8 G;  3S14 H;  3V69 A;  1KHI A;  1U5K A;  4NXM Q;  1QVC A;  2Z6K A;  3IRB A;  3T1Y L;  3PUV A;  3PO3 H;  1KQS A;  3PF5 A;  4R4O A;  3ULL A;  2R7D A;  4A3M H;  1YJW A;  3S1R H;  1VS0 A;  3CF5 A;  2Q2T A;  1IBM Q;  4YCV A;  3FP9 A;  5C0X G;  1TWG H;  2HHH Q;  2LSS A;  5IYC H;  1Y1V G;  4YWL A;  2DUD A;  5GAD C;  1Q1B A;  4IPD A;  5H1S E;  1VQK A;  4APV A;  2EQS A;  4C2M H;  4GOP A;  1NE3 A;  3PCO B;  3A5U A;  5M3F H;  3F1Z A;  3CC7 A;  4LFC Q;  3TEH B;  2NVQ H;  3DLL A;  2ZTC A;  1YEZ A;  4DR6 L;  3CP0 A;  2KHJ A;  2K75 A;  3BZC A;  4WAN A;  2HH3 A;  3EBE A;  1TWF H;  2OQ0 A;  3PIO A;  1WVN A;  1XNQ Q;  1P16 A;  3H3V H;  1JJC B;  4JI7 Q;  3OYY A;  1IBL Q;  3Q8D A;  4KHP Q;  4OO1 I;  3CCM A;  3S1N H;  3AQQ A;  5IT9 c;  3OTO Q;  1YVC A;  5JEA G;  1S72 A;  1EWI A;  4NPS A;  2UUC Q;  4DV2 Q;  2CTE A;  2JA9 A;  2MQH A;  1IXR A;  3K7U C;  4X64 Q;  4IFD I;  3M85 A;  2ZJP A;  4NBQ A;  3GTQ H;  2UXC Q;  1HR0 W;  2HHH L;  5C4X H;  2ID0 A;  3B6Y A;  4DNI A;  1RIP A;  4C3H H;  4HIO A;  4A3F G;  4LF6 L;  2OTJ A;  4JI0 L;  2F4V Q;  2CTJ A;  5AJ3 Q;  3AEV A;  1J6Q A;  4HJ8 A;  2XTI A;  5M3F G;  4MTN A;  4P75 A;  4OWW B;  1G6P A;  1L2F A;  2PNH A;  4JI2 Q;  3KF8 B;  3RN2 A;  1IL2 A;  4A3L H;  1WI5 A;  1Y1V H;  1YHB A;  3S2H H;  3HOX H;  3PIP A;  3U58 A;  1PH2 A;  3U50 C;  1JJG A;  1VQP A;  5M3M G;  1UE6 A;  5M5Y H;  3H0G H;  4BY7 G;  4A93 G;  1I3Q H;  1Q8K A;  1HZC A;  1Q1E A;  3FHW A;  1K3R A;  4KI0 A;  5FLM G;  4X66 Q;  3GO5 A;  2QEX A;  4JI8 L;  3I7F A;  4KHZ A;  5BR8 Q;  4B3M L;  3S17 H;  2ZJQ A;  1WOC A;  3TRZ A;  4JI3 Q;  5C4X G;  4L5T A;  1ASZ A;  3AFP A;  3NEM A;  4GLA C;  4HIK A;  2JEB I;  4WJ3 M;  2PI2 E;  1CSQ A;  1Y14 B;  4P71 A;  4LFC L;  1EQR A;  2UUB L;  3U4V A;  4MNO A;  1X4N A;  4WAL A;  2CQO A;  2PQU A;  5FLM H;  1V43 A;  3GDE A;  4QJF A;  3I56 A;  2UUA L;  4A93 H;  4B3R L;  1BBW A;  5M3M H;  3HOX G;  3KDF A;  4A3K G;  1FJG L;  1C0A A;  1AH9 A;  4JI5 L;  4DK6 C;  2ES2 A;  5IE8 A;  4LF9 L;  3RNU A;  3RLO A;  4DPG A;  3S2D H;  4JBJ A;  1PHJ A;  1YNX A;  3OW2 A;  3PUX A;  2JEA I;  2UXB Q;  1KHM A;  2QA4 A;  2ZM6 Q;  4A3F H;  1Q81 C;  4OX9 Q;  4AQY Q;  1HZA A;  1I5F A;  4IPG A;  3KF6 B;  4IOA A;  2JVZ A;  4JI8 Q;  5BR8 L;  4B3M Q;  4A3D H;  1U0L A;  1J5E L;  4R4T A;  5EAY A;  2JQO A;  3I55 A;  4A3K H;  2GVA A;  4DR1 L;  5GQO A;  1JE5 A;  1NY4 A;  1SFO H;  2YU9 H;  1M1K C;  4LUO A;  4BY1 H;  2V1C C;  1EIF A;  3AYH B;  4LFA Q;  4DR6 Q;  4JVH A;  4JBK A;  2HIX A;  2OPV A;  1P8L A;  2CTM A;  1JB7 A;  4HJ7 A;  4OO1 G;  1L1O B;  2E8G A;  1XNR Q;  2KCM A;  3K80 C;  4YY3 L;  1VIH A;  2JA7 G;  1FJG Q;  3BU2 A;  4LUZ A;  2NVY H;  2Y0S E;  2LXJ A;  4P72 A;  1T9H A;  3H3V I;  4P73 A;  4X64 L;  2FMR A;  3H0G G;  1EQQ A;  4X62 Q;  2VQF L;  4GOP C;  4B3S Q;  2ATW A;  4BY7 H;  1Q12 A;  1I6H H;  3J7Z C;  3RZD H;  5IYC G;  4JOI A;  3CCV A;  4A3L G;  3EIV A;  4GN5 A;  4KHP L;  1CKM A;  1OXS C;  4DKA C;  4A3M G;  3BZK A;  1GKH A;  1AE3 A;  4POF A;  4LF7 L;  4JV5 L;  1WJJ A;  4HJA A;  2C35 B;  1K8A C;  1PH6 A;  3GTM H;  4GNX B;  3PO3 G;  3HKZ E;  3LGJ A;  4L5Q A;  1IBK L;  5JJI A;  4A3G G;  1YJN A;  2YYZ A;  1XMQ Q;  4A75 A;  2WB1 G;  4IJH A;  4MZ9 A;  4NB3 A;  3J81 c;  2E5L Q;  1WFQ A;  4DR4 L;  2JA6 H;  3CCQ A;  2QGQ A;  5GAH C;  2UXD Q;  1XNQ L;  1WCM G;  4PG3 A;  2UU9 L;  2UXB L;  4P74 A;  1VQA A;  4FDB A;  2AXY A;  4OWX B;  1LYL A;  1I94 Q;  1PYS B;  4NXN L;  3UDI A;  1N36 L;  2UXC L;  1VQO A;  3HOZ H;  2LXK A;  1A0I A;  1G51 A;  1VQE A;  3RLN A;  3KJO A;  4LFA L;  4QMF B;  2IHE A;  3F2B A;  2ANN A;  3OTO L;  2E5L L;  1QZG A;  4DV5 Q;  2AKW B;  1XTD A;  4LIJ A;  4DR1 Q;  2R93 H;  1HNX Q;  3U1K A;  5JJK A;  4JV5 Q;  3GTJ H;  3TQY A;  1M90 C;  2B63 H;  3S15 H;  4OWT B;  4DR2 L;  4X66 L;  1KD1 C;  3W1G A;  2PY9 A;  1BVS A;  1QZH A;  3HOU H;  5E7N A;  2JK8 A;  1R9T H;  3NBH B;  2F3I A;  1VQG A;  3HOW G;  2B29 A;  3KJP A;  3E0E A;  4BBS G;  1GD7 A;  4DV3 L;  1KL9 A;  3UE0 A;  1EOV A;  2VQE L;  4JI2 L;  1HR0 Q;  4JI1 Q;  4DV4 L;  4DV5 L;  1VQD A;  1UE1 A;  4JI0 Q;  2Z6K C;  1JT8 A;  2N78 A;  5AJ3 L;  4XTC S;  4JBM A;  1PVO A;  2NVX H;  5IYB H;  4GNX C;  2JA8 H;  1GM5 A;  1HNW L;  4A3E G;  3VKE A;  2OTL A;  1CKO A;  2H5X A;  3PGZ A;  1Y1W H;  1JMC A;  4IFD G;  4A3J G;  3NEN A;  4GKJ Q;  3CCJ A;  1DTJ A;  3D31 A;  3A5Z B;  2K50 A;  2VL6 A;  5M5X H;  2N49 A;  1EFW A;  1OXV A;  4YHH Q;  4NXM L;  4DR5 Q;  3GD7 A;  3PUZ A;  2Y0S G;  3JAM c;  2UXD L;  2JJQ A;  1IBL L;  5K36 G;  1VQ4 A;  4JCV E;  1RL2 A;  2RHS B;  5C44 G;  4A3I G;  4DV6 Q;  3PUW A;  1TUA A;  4DV7 Q;  4J15 A;  3F2C A;  1KRS A;  4ME3 A;  1PV4 A;  1VQC A;  1PH3 A;  4LF8 Q;  4UY8 C;  1E24 A;  5HY6 A;  3G4S A;  4OXP A;  1SE8 A;  1YBY A;  5ELN A;  1A63 A;  1N8R C;  3A0J A;  2K52 A;  2HT1 A;  2I5M X;  4A4I A;  1SRO A;  1TWH H;  3CCL A;  2CWA A;  4C3I H;  4R4C A;  4RMF A;  2NZO A;  3S24 A;  4JI5 Q;  1W3S A;  2VQF Q;  4B3S L;  3HOY H;  3PO2 G;  1YIT A;  2AHO B;  5IP9 G;  1FVI A;  4QL5 A;  3S1Q H;  2NVT H;  1GO3 E;  2IHF A;  5C4J H;  2YQR A;  4LWC A;  4YWM A;  3UDG A;  2MJH A;  1I50 H;  3CD6 A;  5JJL A;  1N33 Q;  2VUM H;  1K1G A;  4GLV B;  3F2D A;  3JC6 6;  3UDF A;  1HZB A;  1O7I A;  1WE8 A;  4AYB G;  3ULP A;  3RN5 A;  4L5S A;  3I4N G;  1J5E Q;  4AM3 A;  4R4Q A;  3E9H A;  1TWC H;  1QVG A;  1HNZ L;  1Q7Y C;  2E2I H;  3F8T A;  3J81 i;  1J4W A;  2R6G A;  3PUY A;  3ER0 A;  5DLQ E;  2F52 A;  4A3B G;  4DR3 Q;  4QQB X;  3GTP H;  1MJE A;  2CTF A;  1N33 L;  1SMX A;  2WAQ G;  2AMC B;  4X62 L;  3HOV H;  5FLX c;  3CPW A;  1K8G A;  1N36 Q;  1DGS A;  3WWV A;  4BA1 I;  4GN4 B;  3KFU A;  1ZTG A;  1B70 B;  1CKN B;  1SLJ A;  3PSI A;  2WAQ E;  1PH9 A;  1I94 L;  1QVF A;  3S1M H;  4LUV A;  3I4M H;  1KRT A;  2WB1 E;  2R92 H;  4B3T Q;  4JI4 Q;  2HIV A;  4LF4 Q;  1L1O A;  3HKZ G;  1MKH A;  1IYJ B;  5IP7 G;  1V9P A;  5LMN L;  1QUQ A;  2GVB A;  3FKI H;  4Y7N H;  4JC0 A;  4IJL A;  1X3G A;  2A19 A;  3D0F A;  3L7Z C;  3CME A;  3CW2 C;  4GOP B;  2I0Q A;  1PH7 A;  2Q2H A;  4GLX A;  1VQM A;  3E9I A;  1KXL A;  1C9O A;  1FGU A;  2R92 G;  3I4M G;  4IFD J;  1A8V A;  5IYD G;  4L5R C;  2CTK A;  3I4O A;  1VCI A;  4DUZ Q;  3M7N A;  1W2B A;  2ZTE A;  3CXC A;  4DR5 L;  4HJ9 A;  1X3F A;  1K0R A;  1PFS A;  3CCS A;  2K14 A;  3UE1 A;  3KOJ A;  4BBR H;  2K5H A;  3J81 j;  1YI2 A;  1XJV A;  1Q82 C;  4LF7 Q;  3HOV G;  1NJI C;  3M4O H;  4DV1 Q;  4DR7 Q;  1X55 A;  3SGI A;  1UEB A;  1LTL A;  4DK3 C;  2MNA A;  3H15 A;  4DAY B;  3GTK H;  4A3B H;  1Q86 C;  1B8A A;  5GAE C;  2YTV A;  2BA1 A;  4GS3 A;  1NBW A;  4LF6 Q;  2BL5 A;  2K4K A;  4QY7 A;  4JVY A;  1VQF A;  4LF4 L;  4PZ6 A;  3STB D;  5IWA L;  4GKJ L;  1NMG A;  3KYH C;  1NMF A;  2UUB Q;  4K0K Q;  1Z47 A;  2PQA A;  5IY0 A;  1FL0 A;  2JA5 G;  3AEV B;  4PZ8 A;  3T1H L;  2HQL A;  3CPF A;  3KF6 A;  2IT1 A;  4JI1 L;  4LF5 L;  2R7Z G;  4GKK Q;  2E2H H;  4DR3 L;  4LW1 A;  2ALY B;  4YWK A;  1JJ2 A;  4R4I A;  4X65 Q;  2EXD A;  2OPU A;  1PH1 A;  1EYG A;  1ZZI A;  5IP7 H;  4JYA L;  4O2D A;  3ULJ A;  2IX0 A;  2GN5 A;  4JI7 L;  1HJP A;  5C3E G;  4A3C G;  4OX9 L;  4GKK L;  2NZH A;  3M9B A;  2VS1 A;  5FJ8 H;  3GTG H;  1S40 A;  2P2R A;  3ZJY C;  1E1O A;  1SR3 A;  2OCE A;  3T1H Q;  4YHH L;  1CSP A;  1NTG A;  2WFW A;  4JI6 Q;  4BXX H;  1VQ8 A;  4BXX G;  2I5H A;  1IBM L;  3M3Y H;  2E3U A;  5LMN Q;  2JZX A;  4IPH A;  2KEN A;  2JE6 I;  5C0X J;  1UWV A;  5FJ8 G;  5IWA Q;  4IO9 A;  4ALP A;  2E2J H;  4LF9 Q;  1LM0 A;  3MXN B;  2D62 A;  3CC4 A;  5C3E H;  2RCN A;  4A3C H;  1PYB A;  1XPR A;  2YV5 A;  1BBU A;  1KIX A;  3ICE A;  1VQI A;  1OXX K;  1L0W A;  4DAM A;  2AWN A;  1YHA A;  3K81 C;  2CFM A;  4YY3 Q;  3L2P A;  1XMQ L;  4DR7 L;  3FKI G;  1VQN A;  2MFI A;  1YHQ A;  2R7Z H;  4DR4 Q;  5LMU L;  2IY5 B;  3STB C;  2A1A A;  3DM3 A;  1X6O A;  2ASB A;  2JA5 H;  3CMA A;  2YTY A;  2N3S A;  3AFQ A;  5IYB G;  4JYA Q;  1N9W A;  1VQ6 A;  4WJ4 A;  5HGQ A;  1VQ9 A;  4H02 A;  1KC8 C;  1TWA H;  2K5N A;  4DV7 L;  1PH4 A;  1EC6 A;  1BKB A;  2XGT A;  4EX5 A;  1B7Y B;  1K73 C;  2I5L X;  4YCU A;  2VNU D;  1X4M A;  2PMZ E;  2D0O A;  1N34 Q;  5LMU Q;  3G71 A;  4UPA A;  3HOU G;  3CCR A;  3J7A 5;  1S3O A;  1SN8 A;  2FXQ A;  1ASY A;  3M4Q A;  4BBR G;  4B3T L;  2CCZ A;  4JI4 L;  3GTL H;  2WP8 J;  4DV2 L;  1E1T A;  1X9N A;  3J80 i;  1E7Z A;  3CCU A;  3T1Y Q;  4PZ7 A;  3I4N H;  3M4P A;  1J5K A;  1C7Y A;  5IYD H;  2UUA Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...