2JACA

Glutaredoxin grx1p c30s mutant from yeast
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
108
structure length
108
Chain Sequence
MVSQETIKHVKDLIAENEIFVASKTYCPYSHAALNTLFEKLKVPRSKVLVLQLNDMKEGADIQAALYEINGQRTVPNIYINGKHIGGNDDLQELRETGELEELLEPIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTAREDOXIN-1
publication title Structure of Glutaredoxin Grx1P C30S Mutant from Yeast.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Electron transport
total genus 39
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2006-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00462 Glutaredoxin Glutaredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2jacA00
1F3BA 4L5OA 4YAVA 3VI5A 1PN9A 3PGTA 5G5FA 1XBSA 19GSA 1SENA 4PX1A 1FO5A 5G5EA 2HXKA 3H93A 4H86A 2K8VA 1F3AA 4GF0A 1G6WA 2OE3A 2JU5A 1WWJA 2YZUA 4TVEA 3VFIA 3IXRA 3HYPA 1DE1A 3UOMA 1SL1B 3ZMKA 1GSSA 5KN0A 3TKSA 4KCEA 4BWSA 1XVQA 3PH9A 4CW9A 4EXJA 2D2ZA 3UL3A 1TRSA 3GSSA 2HT9A 1TW9A 1I9DA 1OKTA 1B4QA 1SK2A 4K6XA 2O89A 4NXIA 3VURA 4X43A 3TRPA 5AIXA 2IL3A 1SJZA 6GSXA 3ERWA 5ENUA 2YV7A 3M1GA 3NIVA 2OBKA 3EE2A 5H5SA 4D73A 2XC2A 3FYGA 5ID2A 1X5EA 1WIKA 3GL3A 4TR1A 4K2DA 1XW6A 5HR3A 3C73A 3TKSC 5CAXA 4NHZA 3QAWA 4PXOA 1MDKA 2L5OA 4HQZA 4TRXA 4ZBDA 4YQMA 2F8FA 2I1UA 4MF5A 2B6MA 3ED3A 2H6XA 2K6VA 1F37A 2VLVA 2C0GA 4LLRA 4G19A 3QFAC 4MPFA 1XWGA 2FWHA 2H72A 2RIIA 2CVKA 5CYYA 4IBPA 2IMDA 5J41A 4DSRA 4NHWA 2PVQA 3F8UA 20GSA 2OJLA 2VCQA 1SL2B 2GQMA 2DJ0A 4KW6A 2K9FA 4HS1A 1PKWA 2FWEA 3KH9A 2OBIA 4PQ1A 2C3TA 2R37A 1OC9A 22GSA 2LS5A 1J08A 2PERA 4TOPA 5B6NA 2N5AA 3TJGA 4XS6A 3IAM2 4EDYA 3P2AA 1VF4A 2AJQB 4JRRA 3ME8A 1TRVA 1S3AA 2PUKC 1JZOA 1EP8A 3VI7A 4ECBA 4MJCA 2I9HA 2IMKA 3ZYWA 2Z9SA 3ZVJD 2QC7A 4F9ZA 1A8YA 5G30A 4KGIA 3D21A 3UVTA 1YF1A 2F8AA 2DMLA 3WGDA 2OE1A 4MCUA 4KSOA 1JHBA 4TXVA 1EWXA 2MZCA 5D9WA 2NVLA 2C0DA 4KX4A 1GUHA 2H70A 3L4NA 1YJ6A 4LMVA 1XOAA 4ACSA 1YEPA 1RQMA 1FAAA 3MDKA 2JZSA 1GTIA 3IC4A 3HA9A 1PA3A 2JSZA 2R4VA 1THXA 5C04A 4EO3A 2H01A 3ERFA 2LKUA 3ZRDA 4YQVA 4J56E 1K0CA 4IS0A 6GSVA 4MPGA 2WFCA 3HZ8A 1AQVA 1EOHA 4N11A 3CTFA 3EURA 2P31A 2ON7A 3DVWA 4AJ8A 2MMAA 4KH7A 3DGQA 2H74A 1JZRA 2KOKA 5DCGA 1HQOA 1ZL9A 2KLXA 4TN8A 2GDRA 1M2DA 2EC4A 2G2QA 4FYUA 1QUWA 1R5PA 5HR0A 2H19A 4NWYA 4D73B 1BQ7A 5ECPB 5J9CA 2X99A 2LQOA 1QFNA 3KTLA 4KA0A 5ID2B 3BBYA 5JWOB 1FVKA 3OR5A 1TKDB 2G0FA 3KTBA 3ZFLA 2JZTA 2ZUPA 1V98A 4L0UA 4TXOA 4I2TA 3VWVA 4WEYA 1EZKA 3GYKA 1A0FA 4HOJA 5DDLA 4IHUA 2V1MA 4O5RA 5EPFA 1QGVA 3NOFA 3ZMLA 4AGSA 4ZXGA 3I69A 1FVJA 5G1LA 1WE0A 2LJKA 1ON4A 4V2LA 1A23A 2L59A 1Z5YE 2C0EA 2E2GA 4OCEA 4MP4A 3KJYA 1PX6A 4O92A 2F9SA 4RI7A 4ZB8A 5DVBA 3QCPA 4RQRA 2EIRA 4JEDA 1SYRA 1FOVA 3I43A 4V1Ap 1OC9B 5IMZA 4P3YB 3SBCA 1XCCA 4KE3A 2LNSA 1GRXA 3D0ZA 5B8BA 2O87A 2OE0A 3ERGA 2CAIA 4POLA 4Q5RA 4FIWA 4PNFA 1GUMA 2VM1A 3J7Yb 1SL0B 2A4VA 2YJ7A 1QXHA 2FGXA 2PGTA 2HE3A 3L9UA 3FEUA 2CVBA 4GQCA 2PVOC 2LTKA 5EL8A 3RHCA 2WZ9A 1A2MA 1JZDA 1GSEA 1GTBA 2TIRA 4HJ2A 2H30A 3ME7A 2E7PA 4JE1A 4DVCA 1ML6A 3WD6A 2YN1A 4MJEA 3CRUA 2RLIA 3L0HA 1GTAA 2M46A 5KEJA 4KDUA 2WCIA 1BX9A 1J9BA 3CRTA 4I97A 1VF2A 2B5EA 5LNKe 3QPMA 2FWFA 1PSQA 2X8CA 5G1KA 3TOTA 1TI1A 3F4SA 1A2JA 6GSYA 2QGVA 4ZB9A 5FWGA 5ECQB 4I2UA 3ZL5A 4LA1A 3VWWA 3H4KA 4OFMA 4OFTA 5COHA 4RUVA 1M0UA 5H5RA 1AAZA 2JL4A 4NV5A 4TW5A 3FR9A 1N2AA 3C7MA 3KXOA 2CV4A 3H79A 2XBQA 2A2RA 4WR4A 1V40A 3ZFBA 2H0IA 3I9V2 4XTSA 2H73A 3BCKA 4WKWA 2GQKA 5HFKA 1EGOA 2L6CA 5CRDA 4BL7A 1YEXA 3W8SA 1O7UA 4PUAA 5D9XA 1TU8A 4G10A 2LRTA 3D4TA 1T7PB 4FYBA 1S3DA 4TXOB 4Q5NA 3UARA 5DQSA 5ECNB 2X8HA 1ZZYA 5F06A 5HQPA 2XPEA 5HR1A 4MH2A 3TKRA 1GP1A 4QL9A 1T8EB 4MK3A 2GSRA 5JWQB 3DMLA 2HSYA 5DAKA 5HR2A 2CVDA 4Q5FA 2OADA 3A2VA 4KCAA 1NSWA 1K3YA 1WMJA 2WS2A 2YJHA 5GSTA 2E2MA 1GULA 3EVIA 4XIHA 1X5DA 2VOCA 8GSSA 5F8BA 4EVMA 3LJRA 1R5AA 2M80A 4E8HA 4ECCA 3F4TA 3FRCA 4TR3A 2FWGA 1WPIA 3PR8A 3LWAA 2EIQA 2REMA 4NMUA 1ERVA 4ZB6A 1SJ6A 2GT5A 3HZ4A 3Q19A 1CQHA 2DMMA 1TP9A 3AY8A 2AAWA 1EV4A 2IMIA 2GZPA 2HNLA 2MYGA 2PN8A 3DWVA 1RW1A 3F3RA 2DSAA 2C0FA 3QDNA 3SWLA 10GSA 3U5RE 1FW1A 2AUVA 1USBA 2AYTA 2C4JA 1A8LA 3EYTA 2HI7A 2VL2A 2KHPA 1QK8A 4WR5A 4GRFA 2PU9C 1ZMAA 4IKHA 4ID0A 1ABAA 4L8EA 4HDEA 2M72A 1V2AA 3GFKA 18GSA 2H66A 1GL8A 3APOA 4JBBA 2YP6A 1V58A 1T3BA 4HJMA 3A5WA 5ECSA 1O6JA 1XZOA 3IV4A 4HEA2 3A3TA 4EUYA 4K7IA 2LRCA 4BVYA 2LSTA 2RM5A 4OFNA 3CXGA 2H0HA 1MDJA 5DJLA 3QAGA 1XIYA 3O3TA 3ZTLA 2QSIA 3GH9A 3C1RA 1NM3A 3BD2A 2VL2C 3FHKA 3VLNA 1G7EA 3Q18A 5E4WA 4N0VA 2IWTA 3MWHA 5D9TA 5D96A 5A4WA 2PMTA 1T1VA 2ALBA 1X0RA 5KN3A 4K7NA 2J9HA 3CBUA 1TJDA 2CT6A 2A2SA 1XWKA 5J9BA 2I3YA 2X8GA 2TRXA 3R2QA 3TJKA 4G9HA 3CSIA 1ERUA 2KP2A 2H75A 4X1UA 9GSSA 2VD1A 2WRTA 3G7JA 3FZ9A 4DEJA 1SKSB 4BVXA 1ZCPA 3F9UA 4NPBA 3UJ1A 1B9YC 4J2FA 2NPBA 5F0GA 1X5CA 4BWQA 4ZBBA 1URMA 1TK8B 3KMOA 2GT6A 3UAPA 4POBA 1CQGA 4EF0A 1SK1A 3GA4A 1EEMA 4GSSA 4OO4A 5C00A 2DJ2A 2C3NA 5DAKB 1OKDA 7GSSA 1A0RP 2I81A 5IPGA 1GLPA 2VLUA 3US3A 5IO0A 1M2BA 3FZ4A 1IYHA 4GTUA 1B8XA 2GSSA 2HRNA 1QQ2A 3GN3A 3ZVJA 2FA8A 2R6KA 4MMMA 2LJRA 1B9XC 1Q98A 3D4MA 4FO5A 2LUSA 3L78A 1M2AA 2LJAA 1Z7PA 1LBKA 4L0WA 3RAZA 1XXUA 3TDGA 2CAQA 2HZEB 1DUGA 2K8SA 4IELA 3GNJA 12GSA 4WBJA 2WJUA 2E0QA 5IOXA 1F9MA 2GQLA 2H71A 1DE2A 5GAND 4TR4A 2AHEA 4ZIJA 2V41A 1MDIA 4HUAA 5CRGA 4JU5A 3KP9A 1EV9A 3KD0A 5J3RA 2LNTA 1UVZA 4F82A 4EL1A 4LL4B 3ZREA 1Z6NA 2VCTA 4GCIA 4IP1A 1KEBA 3ZIVA 5ELAA 4JR4A 1SKWB 1HNAA 4IN0A 2JZRA 5ECKB 1JLWA 3IPZA 4RQXA 1O73A 4QL7A 3IOSA 3W8JA 2DIYA 3ZITA 4IQAA 4BPYA 1KNGA 2JSYA 3RBTA 1ILOA 4IJIA 1YZXA 2JADA 3C1SA 2CZ3A 3Q74A 3GV1A 3WYWA 4YAPA 2NDOA 1OVNA 3JCML 3DXBA 3DKSA 1V9WA 2VCWA 3GH6A 4ZL7A 1AXDA 3H8QA 2O85A 3G7YA 2H8LA 4HZ4A 3EMXA 1M99A 2OACA 1ST9A 5AN1A 4EKZA 2YPMA 3K8NA 4ECIA 3LGCA 3DEXA 2DJJA 1RK4A 5DCHA 3MSZA 3HVSA 1GUKA 1G0TA 2V2GA 4V1Ag 3DYRA 3FKFA 3WT2A 1AC1A 3ZIJA 2F51A 5A4UA 1PRXA 2N5FA 2VCVA 1U3AA 2FCHA 1AIUA 3GKXA 5IPHA 5L71A 1TXXA 3CSHA 1XWAA 2V6KA 4OD7A 5ECMB 4NAXA 1UN2A 3F3QA 3G9BA 5LCZA 1OC3A 4Q5QA 2L6DA 1YF0A 3LXTA 1A24A 3BJ5A 1BEDA 2B7KA 4YQUA 5ELGA 4ILFA 4JR6A 1ZYQB 3IHQA 4PURA 4RI6A 4HZ2A 3ISOA 5IOWA 1M9AA 3LFLA 1NHYA 4XS4B 5G31A 3N5OA 4PQIA 4EE0A 2FA4A 2R5GA 5ECIB 3HXSA 1MTCA 1FB0A 1GSFA 3GKKA 3A2WA 3UIWA 3HY2A 1K0MA 4MDCA 3APSA 5IMVA 4MABA 4I8BA 2L4QA 2J23A 2RM6A 4I5QA 3KEBA 1OE7A 4ECJA 1O8XA 2HRFA 2X64A 3GKNA 2PPTA 2FLSA 3EU3A 2MMOA 4FYCA 2H6ZA 3KM6A 1LJRA 1Z6MA 3F4RA 2I4AA 4OO5A 4MLYA 1K0DA 4KDYA 5D93A 4ZBAA 2LEGA 1LU4A 3GL5A 3E0UA 3KH7A 3M0FA 1IYIA 4YH2A 4HI7A 3IK9A 1YQ1A 1GSQA 2JACA 3TRXA 4ML1A 3QAVA 4NV2A 1Y6EA 1AUCA 4L5LA 4MZBA 1T4ZA 5JCWA 1GSUA 1Z9HA 5F07A 3UBLA 5JWRB 1HNCA 3LORA 5J4UA 3GX8A 4F03A 1U3IA 3UMAA 5AGYA 1AQWA 4GLTA 1NW2A 4EDZA 1TK5B 3FK8A 3UVHA 1SU9A 14GSA 3TB2A 4X0XA 1X9WB 4KUNA 1OAZA 2B3SA 2IFQA 2IPAA 1HYUA 3P8WA 4PNGA 1B48A 6GSTA 1Z7RA 1UA5A 3KCMA 4IP6A 3HD5A 3F6FA 1WP0A 5CREA 4ISDA 4DSSB 3QD9A 3UBKA 1TI3A 4I6XA 2GGTA 3P7XA 2DLXA 1ZYEA 2AB6A 3ZZXA 5EVOA 4O32A 2VM2A 5F05A 2DJ3A 2MMZA 2HLSA 5A5KA 3EMPA 2IMFA 5ECLB 4AJ7A 2YWIA 1T00A 5DALB 3RPPA 4HU9A 5CRWA 5D9VA 1YDKA 3TOUA 5ECRB 1G7OA 5CRHA 2YV9A 1B4PA 2EIOA 2O7KA 3IR4A 1FG4A 4MZWA 1TRUA 4BA7A 2HZEA 4PGTA 1XPVA 4OCFA 5IMDA 4KNDA 1O85A 1XW5A 1EP7A 3HJOA 5KN2A 3U6VA 2CZ2A 2ES7A 1K0AA 3IRAA 1BJXA 2CQ9A 1GTUA 2YWOA 5J5NA 4TR0A 3KZQA 3S9FA 2MBSA 2HFDA 2H1BA 3UEMA 1TRWA 4PUFC 3DD3A 1A2LA 1TTZA 3Q6OA 4J57E 4ML6A 4TKYA 2IIYA 2ZNMA 1TU7A 5AIVA 4IGJA 4E8EA 4MJAA 1K3OA 1UC7A 5IIZA 4MF6A 3GHAA 2VCXA 2YZHA 1C72A 1R7HA 3DVXA 2FNOA 2N5BA 5E59A 1EOGA 1VGLA 3KGKA 1SJIA 3TJFA 2ON5A 3TCOA 3DIEA 2MMNA 3RDWA 3BCIA 3M9JA 1JLVA 4QQ7A 3E9JB 1MD3A 2V32A 1DSBA 3QOUA 5GSSA 3GKMA 3HKRA 1U87A 17GSA 5ECHB 5A4VA 2BJXA 2CX3A 3IBHA 2FUG2 2C80A 2H1GA 1XFLA 1K0BA 2VIMA 4CDOA 4K0GA 2GVPA 2NTOA 5INYA 5IMAA 3GSTA 1N8JA 1WOUA 2DIZA 4XS1A 3RPNA 3L9SA 2L4CA 2DJ1A 3TKQA 3GTUA 3W6GA 3QR6A 1GSYA 1FHEA 3C8EA 1XVWA 3CMIA 1PQNA 4KAEA 3PINA 2IFQB 5CP1A 1H75A 1BYEA 5IM9A 2VAFA 3P90A 2RUFA 3HDCA 3BOAA 3M9KA 2PBJA 1O8WA 3IDVA 2WGRA 2K18A 3LSZA 1PL2A 4LL1B 1Y25A 1W4VA 4XS4A 4AF2A 3LXZA 1E2YA 1K0NA 4N10A 5JCUA 4XCSA 2GZYA 4F2IA 4OWYA 2WULA 4HQSA 1PMTA 4IJ3A 4K1FA 5JCGA 1YKAA 2AV4A 2OKAA 3TGZA 4IVFA 2DBCA 5D73A 3VPQA 2LRNA 1SYXA 1GSDA 2PWJA 3ZLPA 3EINA 3CTGA 1VF1A 5D8IA 3VWUA 1EGRA 3LQ7A 3VWXA 2HSHA 2LQQA 1X9SB 4Z7XA 4KSMA 2MBTA 2KUCA 1KTEA 1SD9A 5IMFA 2H1DA 3N9JA 1OC8A 3F63A 4K0NA 4ZL9A 1NHOA 5FT3A 5CO3A 2H1AA 1WJKA 1M7TA 3MAKA 2VUPA 5LD0A 4WETA 1PGTA 1GNEA 2VD0A 3LEFA 1S3CA 4KDXA 2IJYA 1GLQA 3VPTA 3M3MA 1WRYA 3TJJA 5FHIA 2V6OA 1ACVA 2HYXA 5G2ZA 4N30A 2FHEA 4GSTA 4POKA 4DSQA 4IQ1A 11GSA 3D5JA 6GSWA 1KBNA 2GLRA 1FB6A 4O7HA 4V2MA 1HNBA 5CNWA 2YCDA 3FR6A 2RUEA 2BMXA 2H76A 4K9ZA 1QMVA 2YWMA 3O6TA 3CSJA 2XPDA 3LYKA 1DBYA 3NZNA 1M9BA 2R2JA 3GRXA 1YY7A 4DSSA 1W89A 1SKRB 2YANA 4GQFA 2VLTA 3HCZA 2CX4A 3WT1A 2XHFA 1XOBA 3LYPA 4XRDA 2FD3A 4V2NA 3CYNA 3J7Yk 4TR1B 3HHVA 1AW9A 1V57A 1GWCA 1YKCA 3D22A 5AISA 1BG5A 2B7JA 1ZOFA 5HFGA 5DALA 3VK9A 2GZZA 2DC5A 3G7IA 3GMFA 1O81A 1MD4A 1VRSD 3FY7A 6GSUA 1ERWA 2C1YA 3GTUB 3TJBA 4MZCA 2P5QA 4CHSA 5B6MA 1K0OA 1TDIA 4PQHA 2NBSA 2P5RA 2ZCTA 3EU4A 4MH3A 1ERTA 5ECOB 5IMCA 2YWNA 3QFBC 3FR3A 3GX0A 4MF7A 3IAS2 3L9VA 2GTUA 3TRQA 1F2EA 2OA7A 5HFIA 2HZFA 1JFUA 4F0BA 2GS3A 3D6IA 1GH2A 2B1KA 4EC0A 1H4OA 1PD21 5GZZB 3HJMA 4K8MA 3KIJA 2TRCP 2VO4A 4POMA 1PL1A 1Z3EA 5DBQA 4G2EA 4XHMA 4WF5A 3TUEA 1EEJA 4N0ZA 1J0FA 4ULXA 5KN1A 3FW2A 3I6AA 3HVVA 3QMXA 2O8VB 3GUSA 1HD2A 3H1NA 1TOFA 3TKPA 6GSSA 1K3LA 4WF4A 2C8UA 1E6BA 4FH8A 3HJPA 1XW9A 3MNGA 3A2XA 3FZAA 1PKZA 4HU7A 13GSA 1BAYA 4IW9A 4ZILA 3GURA 2F3MA 1T4YA 2WB9A 2L5LA 2B5XA 3EC3A 5B8AA 1JZWA 1I5GA 5IQYA 16GSA 1U88A 1Q4JA 2IN3A 5DQYA 2IMEA 2GSQA 2B1LA 2XBIA 2H0GA 4K7OA 4WXTA 3WGXA 2H6YA 3F6DA 5IO2A 2BTOT 5ABRA 4F0CA 1R26A 3C71A 2R3XA 2YNXA 1VF3A 4LMWA 3F0IA 5DJMA 2VL3A 5EY6A 4ZL8A 1G6YA 1XWCA 4OMVA 3FZ5A 1F6MC 2GSTA 3GIXA 2YOIA 2C3QA 3IA1A 1TK0B 3M8NA 1SK0A 2CA8A 1R4WA 1MEKA 4GSNA 3KP8A 1OYJA 2VL9A 2L57A 1GNWA 4AJ6A 3IE3A 4XRAA 3DRNA 1SD8A 2WDUA 5H5QA 1X9MB 1OE8A 3LG6A 5B7CA 2P0GA 1AQXA 4GWRA 2VCZA 4JZQA 2B5YA 3EWLA 2LV3A 3HVXA 3IK7A 1ZGNA 3TKSE 4MA9A 3RHBA 3WGEA 2KP1A 4KB3A 1THOA 2FY6A 1PX7A 5GAPD 1XWBA 2DJKA 3E3EA 4MJBA 4WBRD 3APQA 3KMNA 2QKEA 1U6TA 4GXZA 3V1WA 3O76A
chains in the Genus database with same CATH superfamily
1F3BA 4ICYA 4L5OA 4YAVA 3VI5A 1PN9A 3PGTA 5G5FA 1XBSA 19GSA 1SENA 4PX1A 1FO5A 5G5EA 2HXKA 3H93A 4H86A 2K8VA 1F3AA 4GF0A 1G6WA 2OE3A 2JU5A 4EIQA 1WWJA 2YZUA 4TVEA 3VFIA 3IXRA 3HYPA 1DE1A 3UOMA 1SL1B 3ZMKA 1GSSA 5KN0A 3TKSA 4KCEA 4BWSA 1XVQA 3PH9A 4CW9A 4EXJA 2D2ZA 2UZ8A 3UL3A 1TRSA 3GSSA 2HT9A 1TW9A 1I9DA 1OKTA 1B4QA 1SK2A 4K6XA 2O89A 4NXIA 3VURA 4X43A 3TRPA 5AIXA 2IL3A 1SJZA 6GSXA 3ERWA 5ENUA 2YV7A 3M1GA 3NIVA 4G0KA 2OBKA 3EE2A 5H5SA 4D73A 2XC2A 3FYGA 5ID2A 1X5EA 1WIKA 3GL3A 4TR1A 4K2DA 1XW6A 5HR3A 3C73A 3TKSC 5CAXA 4NHZA 3QAWA 4PXOA 1MDKA 2L5OA 4HQZA 4TRXA 4ZBDA 4YQMA 2F8FA 2I1UA 4MF5A 2B6MA 3ED3A 4CY8A 2H6XA 2K6VA 4HSCX 1F37A 2R0GA 2C0GA 2VLVA 4LLRA 4G19A 3QFAC 4MPFA 1XWGA 2FWHA 2H72A 2RIIA 2CVKA 5CYYA 4IBPA 2IMDA 5J41A 4DSRA 4Z2UA 4NHWA 2PVQA 3F8UA 20GSA 2OJLA 2VCQA 1SL2B 2GQMA 2DJ0A 4KW6A 2K9FA 4HS1A 1PKWA 1S3RA 2FWEA 3KH9A 2OBIA 4PQ1A 2C3TA 2R37A 1OC9A 22GSA 2LS5A 1J08A 2PERA 4TOPA 5B6NA 2N5AA 3TJGA 4XS6A 3IAM2 4EDYA 3P2AA 1VF4A 2AJQB 4JRRA 3ME8A 1TRVA 1S3AA 2PUKC 1JZOA 1EP8A 3VI7A 4ECBA 4MJCA 2I9HA 2IMKA 3ZYWA 2Z9SA 3ZVJD 2QC7A 4F9ZA 1A8YA 5G30A 4KGIA 3D21A 3UVTA 1YF1A 2F8AA 2DMLA 3WGDA 2OE1A 4MCUA 4KSOA 1JHBA 2R0PA 4TXVA 1EWXA 2MZCA 5D9WA 2NVLA 2C0DA 4KX4A 1GUHA 2H70A 3L4NA 1YJ6A 4LMVA 1XOAA 4ACSA 1YEPA 1RQMA 1FAAA 3MDKA 2JZSA 1GTIA 3IC4A 3HA9A 1PA3A 2JSZA 2R4VA 1THXA 5C04A 4EO3A 2H01A 3ERFA 2LKUA 3ZRDA 4YQVA 4J56E 1K0CA 4IS0A 6GSVA 4MPGA 2WFCA 3HZ8A 1AQVA 1EOHA 4N11A 3CTFA 3EURA 2P31A 2ON7A 3DVWA 4AJ8A 2MMAA 4KH7A 3DGQA 2H74A 1JZRA 2KOKA 5DCGA 1HQOA 1ZL9A 2KLXA 4TN8A 2GDRA 1M2DA 2EC4A 2G2QA 4FYUA 1QUWA 1R5PA 5HR0A 2H19A 4NWYA 4D73B 1BQ7A 5ECPB 5J9CA 2X99A 2LQOA 4USSA 1QFNA 3KTLA 4KA0A 5ID2B 3BBYA 5JWOB 1FVKA 3OR5A 1TKDB 2G0FA 3KTBA 3ZFLA 2JZTA 2ZUPA 1V98A 4L0UA 4TXOA 4I2TA 3VWVA 4WEYA 1EZKA 3GYKA 1A0FA 4HOJA 5DDLA 4IHUA 2V1MA 4O5RA 4Z2TA 1XG8A 5EPFA 1QGVA 3NOFA 3ZMLA 4AGSA 4ZXGA 3I69A 1FVJA 5G1LA 1WE0A 2LJKA 1ON4A 4V2LA 1A23A 2L59A 1Z5YE 2C0EA 2E2GA 4OCEA 4MP4A 3KJYA 1PX6A 4O92A 2F9SA 4RI7A 4ZB8A 5DVBA 3LW9A 3QCPA 4RQRA 2EIRA 4JEDA 1SYRA 1FOVA 3I43A 4V1Ap 1OC9B 5IMZA 4P3YB 3SBCA 1XCCA 2HSMA 4KE3A 4BVXB 2LNSA 1GRXA 3D0ZA 5B8BA 2O87A 2OE0A 3ERGA 2CAIA 4POLA 4Q5RA 4FIWA 4MNNA 4PNFA 1GUMA 2VM1A 3J7Yb 2HRAA 2A4VA 1SL0B 2YJ7A 1QXHA 2FGXA 2PGTA 2HE3A 3L9UA 3FEUA 2CVBA 4GQCA 2PVOC 2LTKA 5EL8A 3RHCA 2WZ9A 3MYDA 1A2MA 2QA2A 1JZDA 1GSEA 1GTBA 2TIRA 4HJ2A 2H30A 3ME7A 2E7PA 4JE1A 4DVCA 1ML6A 3WD6A 2YN1A 4MJEA 3CRUA 2RLIA 3L0HA 1GTAA 2M46A 5KEJA 4KDUA 2WCIA 1BX9A 1J9BA 2X4AA 3CRTA 4I97A 1VF2A 2B5EA 5LNKe 4X4JA 3QPMA 2FWFA 1PSQA 2X8CA 5G1KA 3TOTA 1TI1A 3F4SA 1A2JA 5BMUA 6GSYA 2QGVA 4ZB9A 5FWGA 5ECQB 4I2UA 3ZL5A 4LA1A 3VWWA 3H4KA 4OFMA 4OFTA 5COHA 4RUVA 1M0UA 5H5RA 1AAZA 2JL4A 4NV5A 4TW5A 3FR9A 1N2AA 3C7MA 3KXOA 2CV4A 3H79A 2XBQA 2A2RA 4K2XA 1V40A 4WR4A 3ZFBA 2H0IA 3I9V2 4XTSA 2H73A 3BCKA 4WKWA 2GQKA 5HFKA 1EGOA 2L6CA 5CRDA 4BL7A 1YEXA 3W8SA 1O7UA 4PUAA 5D9XA 1TU8A 4G10A 2LRTA 3D4TA 1T7PB 4FYBA 1S3DA 4TXOB 4Q5NA 3UARA 5DQSA 5ECNB 2X8HA 2X49A 1ZZYA 5F06A 5HQPA 2XPEA 5HR1A 4MH2A 3TKRA 1GP1A 4QL9A 1T8EB 4MK3A 2GSRA 5JWQB 3DMLA 2HSYA 5DAKA 5HR2A 2CVDA 4Q5FA 2OADA 3A2VA 4KCAA 1NSWA 1K3YA 1WMJA 2WS2A 2YJHA 5GSTA 2E2MA 1GULA 3EVIA 4XIHA 1X5DA 2VOCA 8GSSA 5F8BA 4EVMA 3LJRA 1R5AA 2M80A 4E8HA 4ECCA 3F4TA 3FRCA 4TR3A 2FWGA 1WPIA 2R0CA 3PR8A 3LWAA 2EIQA 2REMA 4NMUA 1ERVA 4ZB6A 1SJ6A 2GT5A 3HZ4A 3Q19A 1CQHA 2DMMA 1TP9A 3AY8A 2AAWA 1EV4A 2IMIA 2HRKA 2GZPA 2HNLA 2MYGA 2PN8A 3DWVA 1RW1A 3F3RA 2DSAA 2C0FA 3QDNA 3SWLA 10GSA 3U5RE 1FW1A 2AUVA 1USBA 2AYTA 2C4JA 5BRTA 1A8LA 3EYTA 2HI7A 2VL2A 2KHPA 1QK8A 4WR5A 4GRFA 2PU9C 1ZMAA 4IKHA 4ID0A 1ABAA 4L8EA 4HDEA 2M72A 1V2AA 3GFKA 18GSA 2H66A 1GL8A 3APOA 4G0LA 4JBBA 2YP6A 1V58A 1T3BA 4HJMA 3A5WA 5ECSA 1O6JA 1XZOA 3IV4A 4HEA2 3A3TA 4EUYA 4K7IA 2LRCA 4BVYA 2LSTA 2RM5A 4OFNA 3CXGA 2H0HA 3A5IA 1MDJA 5DJLA 3QAGA 1XIYA 3O3TA 3ZTLA 2QSIA 3GH9A 3C1RA 1NM3A 3BD2A 2VL2C 3FHKA 3VLNA 1G7EA 3Q18A 5E4WA 4N0VA 2IWTA 3MWHA 4K5RA 5D9TA 5D96A 5A4WA 2PMTA 1T1VA 2ALBA 1X0RA 5KN3A 4K7NA 2J9HA 3CBUA 1TJDA 2CT6A 2A2SA 1XWKA 5J9BA 2I3YA 2X8GA 2TRXA 3R2QA 3TJKA 4G9HA 3CSIA 1ERUA 2KP2A 2H75A 4X1UA 9GSSA 4BL7B 2VD1A 2WRTA 3G7JA 3FZ9A 4DEJA 1SKSB 4BVXA 1ZCPA 3F9UA 4NPBA 3UJ1A 1B9YC 4J2FA 2NPBA 5F0GA 1X5CA 4BWQA 4ZBBA 1URMA 1TK8B 3KMOA 2GT6A 3UAPA 4POBA 1CQGA 4EF0A 2QA1A 1SK1A 3GA4A 1EEMA 4GSSA 4OO4A 5C00A 2DJ2A 2C3NA 5DAKB 1OKDA 7GSSA 1A0RP 2I81A 5IPGA 1GLPA 2VLUA 3US3A 5IO0A 1M2BA 3FZ4A 1IYHA 4GTUA 1B8XA 2GSSA 2HRNA 1QQ2A 3GN3A 3ZVJA 2FA8A 2R6KA 4O5QA 4MMMA 2LJRA 1B9XC 1Q98A 3D4MA 4FO5A 2LUSA 3L78A 1M2AA 2LJAA 1Z7PA 1LBKA 4L0WA 3RAZA 1XXUA 3TDGA 2CAQA 2HZEB 1DUGA 2K8SA 4IELA 3GNJA 12GSA 4WBJA 2WJUA 2E0QA 5IOXA 1F9MA 2GQLA 2H71A 1DE2A 1M3JA 5GAND 4TR4A 2AHEA 4ZIJA 2V41A 1MDIA 4HUAA 5CRGA 4BIKA 4JU5A 3KP9A 1EV9A 3IHGA 3KD0A 5J3RA 4O5UA 2LNTA 1UVZA 4F82A 4EL1A 4LL4B 4EIPA 3ZREA 1Z6NA 2VCTA 4GCIA 2DKIA 4IP1A 1KEBA 3FMWA 3ZIVA 5ELAA 4JR4A 1SKWB 1HNAA 4IN0A 2JZRA 5ECKB 1JLWA 3IPZA 4RQXA 1O73A 4QL7A 3IOSA 3W8JA 2DIYA 3ZITA 4IQAA 4BPYA 1KNGA 2JSYA 3RBTA 1ILOA 4IJIA 1YZXA 2JADA 3C1SA 2CZ3A 3Q74A 3GV1A 2DKHA 4YAPA 3WYWA 2NDOA 1OVNA 3JCML 3DXBA 3DKSA 1V9WA 2VCWA 3GH6A 4ZL7A 1AXDA 3H8QA 2O85A 3G7YA 2H8LA 4HZ4A 3EMXA 1M99A 2OACA 1ST9A 5AN1A 4EKZA 2YPMA 3K8NA 4BVYB 4ECIA 3LGCA 3DEXA 2DJJA 1RK4A 5DCHA 3MSZA 3HVSA 1GUKA 1G0TA 2V2GA 4V1Ag 3DYRA 3FKFA 5KOXA 3WT2A 1AC1A 3ZIJA 2F51A 5A4UA 1PRXA 2N5FA 2VCVA 1U3AA 2FCHA 1AIUA 3GKXA 5IPHA 5L71A 1TXXA 3CSHA 1XWAA 2V6KA 4OD7A 5ECMB 4NAXA 1UN2A 3F3QA 3G9BA 5LCZA 1OC3A 4Q5QA 2L6DA 1YF0A 1ZYPA 3LXTA 1A24A 3BJ5A 1BEDA 3MIXA 2B7KA 4YQUA 5ELGA 4ILFA 4JR6A 1ZYQB 3IHQA 4PURA 4RI6A 4HZ2A 3ISOA 5IOWA 1M9AA 3LFLA 1NHYA 4XS4B 5G31A 3N5OA 4PQIA 4EE0A 5KOWA 2FA4A 2R5GA 5ECIB 3HXSA 1MTCA 1FB0A 1GSFA 3GKKA 3A2WA 3UIWA 3HY2A 1K0MA 4MDCA 3APSA 5IMVA 4MABA 4I8BA 2L4QA 2J23A 2RM6A 4I5QA 3KEBA 1OE7A 4ECJA 1O8XA 2HRFA 2X64A 3GKNA 2PPTA 2FLSA 3EU3A 2MMOA 4FYCA 2H6ZA 3KM6A 1LJRA 1Z6MA 3F4RA 2I4AA 4OO5A 4MLYA 1K0DA 4KDYA 5D93A 4ZBAA 2LEGA 1LU4A 3GL5A 3E0UA 3KH7A 3M0FA 1IYIA 4YH2A 4HI7A 3IK9A 1YQ1A 4YKGA 1GSQA 2JACA 3TRXA 4ML1A 3QAVA 4NV2A 1Y6EA 1AUCA 4L5LA 4MZBA 1T4ZA 5JCWA 1GSUA 1Z9HA 5F07A 3UBLA 5JWRB 1HNCA 3LORA 5J4UA 4CY6A 3GX8A 4F03A 1U3IA 3UMAA 5AGYA 1AQWA 4GLTA 1NW2A 3CQFA 4EDZA 1TK5B 3FK8A 3UVHA 1SU9A 14GSA 3TB2A 4X0XA 1X9WB 4KUNA 1OAZA 2B3SA 2IFQA 2IPAA 1HYUA 3P8WA 4PNGA 1B48A 6GSTA 1Z7RA 1UA5A 3KCMA 4IP6A 3HD5A 3F6FA 1WP0A 5CREA 4ISDA 4DSSB 3QD9A 3UBKA 1TI3A 4I6XA 2GGTA 3P7XA 2DLXA 1ZYEA 2AB6A 3ZZXA 5EVOA 4O32A 2VM2A 5F05A 2DJ3A 2MMZA 2HLSA 5A5KA 3EMPA 2IMFA 5ECLB 4AJ7A 2YWIA 1T00A 5DALB 3RPPA 4HU9A 4YKFA 5CRWA 5D9VA 1YDKA 3TOUA 5ECRB 1G7OA 5CRHA 2YV9A 1B4PA 2EIOA 2O7KA 3IR4A 1FG4A 4MZWA 1TRUA 4BA7A 2HZEA 4PGTA 1XPVA 4OCFA 5IMDA 4KNDA 1O85A 1XW5A 1EP7A 3HJOA 5KN2A 4G0IA 3U6VA 2CZ2A 2ES7A 1K0AA 3IRAA 1BJXA 2CQ9A 1GTUA 2YWOA 5J5NA 4TR0A 3KZQA 3S9FA 2MBSA 2HFDA 2H1BA 3UEMA 1TRWA 4PUFC 3DD3A 1A2LA 1TTZA 3Q6OA 4J57E 4ML6A 4TKYA 2IIYA 2ZNMA 1TU7A 5AIVA 4IGJA 4E8EA 4MJAA 1K3OA 1UC7A 5IIZA 4MF6A 3GHAA 2VCXA 2YZHA 1C72A 1R7HA 3DVXA 2FNOA 2N5BA 5E59A 1EOGA 1VGLA 3KGKA 1SJIA 3TJFA 2ON5A 3TCOA 3DIEA 4Z2RA 2MMNA 3RDWA 3BCIA 3M9JA 1JLVA 4QQ7A 3E9JB 1MD3A 2V32A 1DSBA 3QOUA 5GSSA 3GKMA 3HKRA 1U87A 17GSA 5ECHB 5A4VA 2BJXA 2CX3A 3IBHA 2FUG2 2C80A 2H1GA 1XFLA 1K0BA 2VIMA 4CDOA 4K0GA 2GVPA 2NTOA 5INYA 5IMAA 3GSTA 1N8JA 1WOUA 2DIZA 4XS1A 3RPNA 3L9SA 1PFOA 2L4CA 2DJ1A 3TKQA 3GTUA 3W6GA 3QR6A 1GSYA 1FHEA 3C8EA 1XVWA 3CMIA 1PQNA 4KAEA 3PINA 2IFQB 5CP1A 1H75A 1BYEA 5IM9A 2VAFA 3P90A 2RUFA 3HDCA 3BOAA 3M9KA 3R3EA 2PBJA 1O8WA 3IDVA 2WGRA 2K18A 3LSZA 1PL2A 4LL1B 1Y25A 1W4VA 4XS4A 4AF2A 3LXZA 1E2YA 1K0NA 4N10A 5JCUA 4XCSA 2GZYA 4F2IA 4OWYA 2WULA 4HQSA 1PMTA 4IJ3A 4K1FA 5JCGA 1YKAA 2AV4A 2OKAA 3TGZA 4IVFA 2DBCA 5D73A 3VPQA 2LRNA 1SYXA 1GSDA 2PWJA 3ZLPA 3EINA 3CTGA 1VF1A 3PPUA 2A2PA 5D8IA 3VWUA 1EGRA 3LQ7A 3VWXA 2HSHA 2LQQA 1X9SB 4Z7XA 4KSMA 2MBTA 2KUCA 1KTEA 1M3IA 1SD9A 3HVNA 5IMFA 2H1DA 3N9JA 1OC8A 3F63A 4K0NA 4ZL9A 1NHOA 5FT3A 5CO3A 2H1AA 1WJKA 1M7TA 3MAKA 2VUPA 5LD0A 4WETA 1PGTA 1GNEA 2VD0A 3LEFA 1S3CA 4KDXA 2IJYA 1GLQA 3VPTA 3M3MA 1WRYA 3TJJA 5FHIA 4KF9A 2V6OA 1ACVA 2HYXA 5G2ZA 4N30A 2FHEA 4GSTA 4POKA 1ZYNA 4DSQA 4IQ1A 11GSA 3D5JA 6GSWA 1KBNA 2GLRA 1FB6A 4O7HA 4V2MA 1HNBA 5CNWA 2YCDA 3FR6A 2RUEA 2BMXA 2H76A 4K9ZA 1QMVA 2YWMA 3O6TA 3CSJA 2XPDA 3LYKA 1DBYA 4FQUA 3NZNA 1M9BA 2R2JA 3GRXA 1YY7A 4DSSA 1W89A 1SKRB 2YANA 4GQFA 2VLTA 3HCZA 2CX4A 3WT1A 2XHFA 1XOBA 3LYPA 4XRDA 2FD3A 4V2NA 3CYNA 3J7Yk 4TR1B 3HHVA 1AW9A 1V57A 1GWCA 1YKCA 3D22A 5AISA 1BG5A 2B7JA 1ZOFA 3IC8A 5HFGA 5DALA 3VK9A 3EPTA 2GZZA 2DC5A 3G7IA 3GMFA 1O81A 1MD4A 1VRSD 3FY7A 6GSUA 1ERWA 2C1YA 3GTUB 3TJBA 4MZCA 2P5QA 4CHSA 5B6MA 4PTSA 1K0OA 1TDIA 4PQHA 2NBSA 2P5RA 2ZCTA 3EU4A 4MH3A 1ERTA 5ECOB 5IMCA 2YWNA 3QFBC 3FR3A 3GX0A 4MF7A 3IAS2 3L9VA 2GTUA 3TRQA 1F2EA 2OA7A 5HFIA 2HZFA 1JFUA 4F0BA 2GS3A 3D6IA 1GH2A 2B1KA 4EC0A 1H4OA 1PD21 5GZZB 3HJMA 4K8MA 3KIJA 2TRCP 2VO4A 4POMA 1PL1A 1Z3EA 5DBQA 4G2EA 4XHMA 4WF5A 3TUEA 1EEJA 4N0ZA 1J0FA 4ULXA 5KN1A 3FW2A 3I6AA 3HVVA 3QMXA 2O8VB 3GUSA 1HD2A 3H1NA 1TOFA 3TKPA 6GSSA 4WF4A 1K3LA 2C8UA 1E6BA 4FH8A 4K5SA 3HJPA 1XW9A 3MNGA 3A2XA 1PN0A 3FZAA 1PKZA 4HU7A 13GSA 1BAYA 4IW9A 4ZILA 3GURA 2F3MA 1T4YA 2WB9A 4A5PA 2L5LA 2B5XA 3EC3A 5B8AA 1JZWA 1I5GA 5IQYA 16GSA 1U88A 1Q4JA 2IN3A 5DQYA 2IMEA 2GSQA 2B1LA 2XBIA 1FOHA 2H0GA 4K7OA 4WXTA 3WGXA 2H6YA 3F6DA 5IO2A 2BTOT 5ABRA 4F0CA 1R26A 3C71A 2R3XA 2YNXA 1VF3A 4LMWA 3F0IA 5DJMA 2VL3A 5EY6A 4ZL8A 1G6YA 1XWCA 4OMVA 3FZ5A 1F6MC 2GSTA 3GIXA 2YOIA 2C3QA 3IA1A 1TK0B 3M8NA 1SK0A 2CA8A 1R4WA 1MEKA 4GSNA 3KP8A 1OYJA 2VL9A 2A4HA 2L57A 1GNWA 4AJ6A 3IE3A 4XRAA 3DRNA 1SD8A 2WDUA 5H5QA 1X9MB 1OE8A 3LG6A 5B7CA 2P0GA 1AQXA 4GWRA 2VCZA 4JZQA 2B5YA 3EWLA 2LV3A 3HVXA 3IK7A 1ZGNA 3TKSE 4MA9A 3RHBA 3WGEA 2KP1A 4KB3A 1THOA 2FY6A 1PX7A 5GAPD 1XWBA 2DJKA 3E3EA 4MJBA 4WBRD 3APQA 3KMNA 2QKEA 1U6TA 4GXZA 3V1WA 3O76A
chains in the Genus database with same CATH topology
1F3BA 4ICYA 4L5OA 4YAVA 3VI5A 1PN9A 3PGTA 5G5FA 1XBSA 19GSA 1SENA 4PX1A 1FO5A 5G5EA 2HXKA 3H93A 4H86A 2K8VA 1F3AA 4GF0A 1G6WA 2OE3A 2JU5A 4EIQA 1WWJA 2YZUA 4TVEA 3VFIA 3IXRA 3HYPA 1DE1A 3UOMA 1SL1B 3ZMKA 1GSSA 5KN0A 3TKSA 4KCEA 4BWSA 1XVQA 3PH9A 4CW9A 4EXJA 2D2ZA 2UZ8A 3UL3A 1TRSA 3GSSA 2HT9A 1TW9A 1I9DA 1OKTA 1B4QA 1SK2A 4K6XA 2O89A 4NXIA 3VURA 4X43A 3TRPA 5AIXA 2IL3A 1SJZA 6GSXA 3ERWA 5ENUA 2YV7A 3M1GA 3NIVA 4G0KA 2OBKA 3EE2A 5H5SA 4D73A 2XC2A 3FYGA 5ID2A 1X5EA 1WIKA 3GL3A 4TR1A 4K2DA 1XW6A 5HR3A 3C73A 3TKSC 5CAXA 4NHZA 3QAWA 4PXOA 1MDKA 2L5OA 4HQZA 4TRXA 4ZBDA 4YQMA 2F8FA 2I1UA 4MF5A 2B6MA 3ED3A 4CY8A 2H6XA 2K6VA 1F37A 2R0GA 2C0GA 2VLVA 4LLRA 4G19A 3QFAC 4MPFA 1XWGA 2FWHA 2H72A 2RIIA 2CVKA 5CYYA 4IBPA 2IMDA 5J41A 4DSRA 4Z2UA 4NHWA 2PVQA 3F8UA 20GSA 2OJLA 2VCQA 1SL2B 2GQMA 2DJ0A 4KW6A 2K9FA 4HS1A 1PKWA 2FWEA 3KH9A 2OBIA 4PQ1A 2C3TA 2R37A 1OC9A 22GSA 2LS5A 1J08A 2PERA 4TOPA 5B6NA 2N5AA 3TJGA 4XS6A 3IAM2 4EDYA 3P2AA 1VF4A 2AJQB 4JRRA 3ME8A 1TRVA 1S3AA 2PUKC 1JZOA 1EP8A 3VI7A 4ECBA 4MJCA 2I9HA 2IMKA 3ZYWA 2Z9SA 3ZVJD 2QC7A 4F9ZA 1A8YA 5G30A 4KGIA 3D21A 3UVTA 1YF1A 2F8AA 2DMLA 3WGDA 2OE1A 4MCUA 4KSOA 1JHBA 2R0PA 4TXVA 1EWXA 2MZCA 5D9WA 2NVLA 2C0DA 4KX4A 1GUHA 2H70A 3L4NA 1YJ6A 4LMVA 1XOAA 4ACSA 1YEPA 1RQMA 1FAAA 3MDKA 2JZSA 1GTIA 3IC4A 3HA9A 1PA3A 2JSZA 2R4VA 1THXA 5C04A 4EO3A 2H01A 3ERFA 2LKUA 3ZRDA 4YQVA 4J56E 1K0CA 4IS0A 6GSVA 4MPGA 2WFCA 3HZ8A 1AQVA 1EOHA 4N11A 3CTFA 3EURA 2P31A 2ON7A 3DVWA 4AJ8A 2MMAA 4KH7A 3DGQA 2H74A 1JZRA 2KOKA 5DCGA 1HQOA 1ZL9A 2KLXA 4TN8A 2GDRA 1M2DA 2EC4A 2G2QA 4FYUA 1QUWA 1R5PA 5HR0A 2H19A 4NWYA 4D73B 1BQ7A 5ECPB 5J9CA 2X99A 2LQOA 4USSA 1QFNA 3KTLA 4KA0A 5ID2B 3BBYA 5JWOB 1FVKA 3OR5A 1TKDB 2G0FA 3KTBA 3ZFLA 2JZTA 2ZUPA 1V98A 4L0UA 4TXOA 4I2TA 3VWVA 4WEYA 1EZKA 3GYKA 1A0FA 4HOJA 5DDLA 4IHUA 2V1MA 4O5RA 4Z2TA 5EPFA 1QGVA 3NOFA 3ZMLA 4AGSA 4ZXGA 3I69A 1FVJA 5G1LA 1WE0A 2LJKA 1ON4A 4V2LA 1A23A 2L59A 1Z5YE 2C0EA 2E2GA 4OCEA 4MP4A 3KJYA 1PX6A 4O92A 2F9SA 4RI7A 4ZB8A 5DVBA 3LW9A 3QCPA 4RQRA 2EIRA 4JEDA 1SYRA 1FOVA 3I43A 4V1Ap 1OC9B 5IMZA 4P3YB 3SBCA 1XCCA 2HSMA 4KE3A 4BVXB 2LNSA 1GRXA 3D0ZA 5B8BA 2O87A 2OE0A 3ERGA 2CAIA 4POLA 4Q5RA 4FIWA 4MNNA 4PNFA 1GUMA 2VM1A 3J7Yb 2HRAA 2A4VA 1SL0B 2YJ7A 1QXHA 2FGXA 2PGTA 2HE3A 3L9UA 3FEUA 2CVBA 4GQCA 2PVOC 2LTKA 5EL8A 3RHCA 2WZ9A 3MYDA 1A2MA 2QA2A 1JZDA 1GSEA 1GTBA 2TIRA 4HJ2A 2H30A 3ME7A 2E7PA 4JE1A 4DVCA 1ML6A 3WD6A 2YN1A 4MJEA 3CRUA 2RLIA 3L0HA 1GTAA 2M46A 5KEJA 4KDUA 2WCIA 1BX9A 1J9BA 2X4AA 3CRTA 4I97A 1VF2A 2B5EA 5LNKe 4X4JA 3QPMA 2FWFA 1PSQA 2X8CA 5G1KA 3TOTA 1TI1A 3F4SA 1A2JA 5BMUA 6GSYA 2QGVA 4ZB9A 5FWGA 5ECQB 4I2UA 3ZL5A 4LA1A 3VWWA 3H4KA 4OFMA 4OFTA 5COHA 4RUVA 1M0UA 5H5RA 1AAZA 2JL4A 4NV5A 4TW5A 3FR9A 1N2AA 3C7MA 3KXOA 2CV4A 3H79A 2XBQA 2A2RA 4K2XA 1V40A 4WR4A 3ZFBA 2H0IA 3I9V2 4XTSA 2H73A 3BCKA 4WKWA 2GQKA 5HFKA 1EGOA 2L6CA 5CRDA 4BL7A 1YEXA 3W8SA 1O7UA 4PUAA 5D9XA 1TU8A 4G10A 2LRTA 3D4TA 1T7PB 4FYBA 1S3DA 4TXOB 4Q5NA 3UARA 5DQSA 5ECNB 2X8HA 2X49A 1ZZYA 5F06A 5HQPA 2XPEA 5HR1A 4MH2A 3TKRA 1GP1A 4QL9A 1T8EB 4MK3A 2GSRA 5JWQB 3DMLA 2HSYA 5DAKA 5HR2A 2CVDA 4Q5FA 2OADA 3A2VA 4KCAA 1NSWA 1K3YA 1WMJA 2WS2A 2YJHA 5GSTA 2E2MA 1GULA 3EVIA 4XIHA 1X5DA 2VOCA 8GSSA 5F8BA 4EVMA 3LJRA 1R5AA 2M80A 4E8HA 4ECCA 3F4TA 3FRCA 4TR3A 2FWGA 1WPIA 2R0CA 3PR8A 3LWAA 2EIQA 2REMA 4NMUA 1ERVA 4ZB6A 1SJ6A 2GT5A 3HZ4A 3Q19A 1CQHA 2DMMA 1TP9A 3AY8A 2AAWA 1EV4A 2IMIA 2HRKA 2GZPA 2HNLA 2MYGA 2PN8A 3DWVA 1RW1A 3F3RA 2DSAA 2C0FA 3QDNA 3SWLA 10GSA 3U5RE 1FW1A 2AUVA 1USBA 2AYTA 2C4JA 5BRTA 1A8LA 3EYTA 2HI7A 2VL2A 2KHPA 1QK8A 4WR5A 4GRFA 2PU9C 1ZMAA 4IKHA 4ID0A 1ABAA 4L8EA 4HDEA 2M72A 1V2AA 3GFKA 18GSA 2H66A 1GL8A 3APOA 4G0LA 4JBBA 2YP6A 1V58A 1T3BA 4HJMA 3A5WA 5ECSA 1O6JA 1XZOA 3IV4A 4HEA2 3A3TA 4EUYA 4K7IA 2LRCA 4BVYA 2LSTA 2RM5A 4OFNA 3CXGA 2H0HA 3A5IA 1MDJA 5DJLA 3QAGA 1XIYA 3O3TA 3ZTLA 2QSIA 3GH9A 3C1RA 1NM3A 3BD2A 2VL2C 3FHKA 3VLNA 1G7EA 3Q18A 5E4WA 4N0VA 2IWTA 3MWHA 4K5RA 5D9TA 5D96A 5A4WA 2PMTA 1T1VA 2ALBA 1X0RA 5KN3A 4K7NA 2J9HA 3CBUA 1TJDA 2CT6A 2A2SA 1XWKA 5J9BA 2I3YA 2X8GA 2TRXA 3R2QA 3TJKA 4G9HA 3CSIA 1ERUA 2KP2A 2H75A 4X1UA 9GSSA 4BL7B 2VD1A 2WRTA 3G7JA 3FZ9A 4DEJA 1SKSB 4BVXA 1ZCPA 3F9UA 4NPBA 3UJ1A 1B9YC 4J2FA 2NPBA 5F0GA 1X5CA 4BWQA 4ZBBA 1URMA 1TK8B 3KMOA 2GT6A 3UAPA 4POBA 1CQGA 4EF0A 2QA1A 1SK1A 3GA4A 1EEMA 4GSSA 4OO4A 5C00A 2DJ2A 2C3NA 5DAKB 1OKDA 7GSSA 1A0RP 2I81A 5IPGA 1GLPA 2VLUA 3US3A 5IO0A 1M2BA 3FZ4A 1IYHA 4GTUA 1B8XA 2GSSA 2HRNA 1QQ2A 3GN3A 3ZVJA 2FA8A 2R6KA 4O5QA 4MMMA 2LJRA 1B9XC 1Q98A 3D4MA 4FO5A 2LUSA 3L78A 1M2AA 2LJAA 1Z7PA 1LBKA 4L0WA 3RAZA 1XXUA 3TDGA 2CAQA 2HZEB 1DUGA 2K8SA 4IELA 3GNJA 12GSA 4WBJA 2WJUA 2E0QA 5IOXA 1F9MA 2GQLA 2H71A 1DE2A 5GAND 4TR4A 2AHEA 4ZIJA 2V41A 1MDIA 4HUAA 5CRGA 4JU5A 3KP9A 1EV9A 3IHGA 3KD0A 5J3RA 4O5UA 2LNTA 1UVZA 4F82A 4EL1A 4LL4B 4EIPA 3ZREA 1Z6NA 2VCTA 4GCIA 2DKIA 4IP1A 1KEBA 3FMWA 3ZIVA 5ELAA 4JR4A 1SKWB 1HNAA 4IN0A 2JZRA 5ECKB 1JLWA 3IPZA 4RQXA 1O73A 4QL7A 3IOSA 3W8JA 2DIYA 3ZITA 4IQAA 4BPYA 1KNGA 2JSYA 3RBTA 1ILOA 4IJIA 1YZXA 2JADA 3C1SA 2CZ3A 3Q74A 3GV1A 2DKHA 4YAPA 3WYWA 2NDOA 1OVNA 3JCML 3DXBA 3DKSA 1V9WA 2VCWA 3GH6A 4ZL7A 1AXDA 3H8QA 2O85A 3G7YA 2H8LA 4HZ4A 3EMXA 1M99A 2OACA 1ST9A 5AN1A 4EKZA 2YPMA 3K8NA 4BVYB 4ECIA 3LGCA 3DEXA 2DJJA 1RK4A 5DCHA 3MSZA 3HVSA 1GUKA 1G0TA 2V2GA 4V1Ag 3DYRA 3FKFA 5KOXA 3WT2A 1AC1A 3ZIJA 2F51A 5A4UA 1PRXA 2N5FA 2VCVA 1U3AA 2FCHA 1AIUA 3GKXA 5IPHA 5L71A 1TXXA 3CSHA 1XWAA 2V6KA 4OD7A 5ECMB 4NAXA 1UN2A 3F3QA 3G9BA 5LCZA 1OC3A 4Q5QA 2L6DA 1YF0A 1ZYPA 3LXTA 1A24A 3BJ5A 1BEDA 3MIXA 2B7KA 4YQUA 5ELGA 4ILFA 4JR6A 1ZYQB 3IHQA 4PURA 4RI6A 4HZ2A 3ISOA 5IOWA 1M9AA 3LFLA 1NHYA 4XS4B 5G31A 3N5OA 4PQIA 4EE0A 5KOWA 2FA4A 2R5GA 5ECIB 3HXSA 1MTCA 1FB0A 1GSFA 3GKKA 3A2WA 3UIWA 3HY2A 1K0MA 4MDCA 3APSA 5IMVA 4MABA 4I8BA 2L4QA 2J23A 2RM6A 4I5QA 3KEBA 1OE7A 4ECJA 1O8XA 2HRFA 2X64A 3GKNA 2PPTA 2FLSA 3EU3A 2MMOA 4FYCA 2H6ZA 3KM6A 1LJRA 1Z6MA 3F4RA 2I4AA 4OO5A 4MLYA 1K0DA 4KDYA 5D93A 4ZBAA 2LEGA 1LU4A 3GL5A 3E0UA 3KH7A 3M0FA 1IYIA 4YH2A 4HI7A 3IK9A 1YQ1A 4YKGA 1GSQA 2JACA 3TRXA 4ML1A 3QAVA 4NV2A 1Y6EA 1AUCA 4L5LA 4MZBA 1T4ZA 5JCWA 1GSUA 1Z9HA 5F07A 3UBLA 5JWRB 1HNCA 3LORA 5J4UA 4CY6A 3GX8A 4F03A 1U3IA 3UMAA 5AGYA 1AQWA 4GLTA 1NW2A 4EDZA 1TK5B 3FK8A 3UVHA 1SU9A 14GSA 3TB2A 4X0XA 1X9WB 4KUNA 1OAZA 2B3SA 2IFQA 2IPAA 1HYUA 3P8WA 4PNGA 1B48A 6GSTA 1Z7RA 1UA5A 3KCMA 4IP6A 3HD5A 3F6FA 1WP0A 5CREA 4ISDA 4DSSB 3QD9A 3UBKA 1TI3A 4I6XA 2GGTA 3P7XA 2DLXA 1ZYEA 2AB6A 3ZZXA 5EVOA 4O32A 2VM2A 5F05A 2DJ3A 2MMZA 2HLSA 5A5KA 3EMPA 2IMFA 5ECLB 4AJ7A 2YWIA 1T00A 5DALB 3RPPA 4HU9A 4YKFA 5CRWA 5D9VA 1YDKA 3TOUA 5ECRB 1G7OA 5CRHA 2YV9A 1B4PA 2EIOA 2O7KA 3IR4A 1FG4A 4MZWA 1TRUA 4BA7A 2HZEA 4PGTA 1XPVA 4OCFA 5IMDA 4KNDA 1O85A 1XW5A 1EP7A 3HJOA 5KN2A 4G0IA 3U6VA 2CZ2A 2ES7A 1K0AA 3IRAA 1BJXA 2CQ9A 1GTUA 2YWOA 5J5NA 4TR0A 3KZQA 3S9FA 2MBSA 2HFDA 2H1BA 3UEMA 1TRWA 4PUFC 3DD3A 1A2LA 1TTZA 3Q6OA 4J57E 4ML6A 4TKYA 2IIYA 2ZNMA 1TU7A 5AIVA 4IGJA 4E8EA 4MJAA 1K3OA 1UC7A 5IIZA 4MF6A 3GHAA 2VCXA 2YZHA 1C72A 1R7HA 3DVXA 2FNOA 2N5BA 5E59A 1EOGA 1VGLA 3KGKA 1SJIA 3TJFA 2ON5A 3TCOA 3DIEA 4Z2RA 2MMNA 3RDWA 3BCIA 3M9JA 1JLVA 4QQ7A 3E9JB 1MD3A 2V32A 1DSBA 3QOUA 5GSSA 3GKMA 3HKRA 1U87A 17GSA 5ECHB 5A4VA 2BJXA 2CX3A 3IBHA 2FUG2 2C80A 2H1GA 1XFLA 1K0BA 2VIMA 4CDOA 4K0GA 2GVPA 2NTOA 5INYA 5IMAA 3GSTA 1N8JA 1WOUA 2DIZA 4XS1A 3RPNA 3L9SA 2L4CA 2DJ1A 3TKQA 3GTUA 3W6GA 3QR6A 1GSYA 1FHEA 3C8EA 1XVWA 3CMIA 1PQNA 4KAEA 3PINA 2IFQB 5CP1A 1H75A 1BYEA 5IM9A 2VAFA 3P90A 2RUFA 3HDCA 3BOAA 3M9KA 3R3EA 2PBJA 1O8WA 3IDVA 2WGRA 2K18A 3LSZA 1PL2A 4LL1B 1Y25A 1W4VA 4XS4A 4AF2A 3LXZA 1E2YA 1K0NA 4N10A 5JCUA 4XCSA 2GZYA 4F2IA 4OWYA 2WULA 4HQSA 1PMTA 4IJ3A 4K1FA 5JCGA 1YKAA 2AV4A 2OKAA 3TGZA 4IVFA 2DBCA 5D73A 3VPQA 2LRNA 1SYXA 1GSDA 2PWJA 3ZLPA 3EINA 3CTGA 1VF1A 3PPUA 2A2PA 5D8IA 3VWUA 1EGRA 3LQ7A 3VWXA 2HSHA 2LQQA 1X9SB 4Z7XA 4KSMA 2MBTA 2KUCA 1KTEA 1SD9A 5IMFA 2H1DA 3N9JA 1OC8A 3F63A 4K0NA 4ZL9A 1NHOA 5FT3A 5CO3A 2H1AA 1WJKA 1M7TA 3MAKA 2VUPA 5LD0A 4WETA 1PGTA 1GNEA 2VD0A 3LEFA 1S3CA 4KDXA 2IJYA 1GLQA 3VPTA 3M3MA 1WRYA 3TJJA 5FHIA 4KF9A 2V6OA 1ACVA 2HYXA 5G2ZA 4N30A 2FHEA 4GSTA 4POKA 1ZYNA 4DSQA 4IQ1A 11GSA 3D5JA 6GSWA 1KBNA 2GLRA 1FB6A 4O7HA 4V2MA 1HNBA 5CNWA 2YCDA 3FR6A 2RUEA 2BMXA 2H76A 4K9ZA 1QMVA 2YWMA 3O6TA 3CSJA 2XPDA 3LYKA 1DBYA 4FQUA 3NZNA 1M9BA 2R2JA 3GRXA 1YY7A 4DSSA 1W89A 1SKRB 2YANA 4GQFA 2VLTA 3HCZA 2CX4A 3WT1A 2XHFA 1XOBA 3LYPA 4XRDA 2FD3A 4V2NA 3CYNA 3J7Yk 4TR1B 3HHVA 1AW9A 1V57A 1GWCA 1YKCA 3D22A 5AISA 1BG5A 2B7JA 1ZOFA 3IC8A 5HFGA 5DALA 3VK9A 3EPTA 2GZZA 2DC5A 3G7IA 3GMFA 1O81A 1MD4A 1VRSD 3FY7A 6GSUA 1ERWA 2C1YA 3GTUB 3TJBA 4MZCA 2P5QA 4CHSA 5B6MA 4PTSA 1K0OA 1TDIA 4PQHA 2NBSA 2P5RA 2ZCTA 3EU4A 4MH3A 1ERTA 5ECOB 5IMCA 2YWNA 3QFBC 3FR3A 3GX0A 4MF7A 3IAS2 3L9VA 2GTUA 3TRQA 1F2EA 2OA7A 5HFIA 2HZFA 1JFUA 4F0BA 2GS3A 3D6IA 1GH2A 2B1KA 4EC0A 1H4OA 1PD21 5GZZB 3HJMA 4K8MA 3KIJA 2TRCP 2VO4A 4POMA 1PL1A 1Z3EA 5DBQA 4G2EA 4XHMA 4WF5A 3TUEA 1EEJA 4N0ZA 1J0FA 4ULXA 5KN1A 3FW2A 3I6AA 3HVVA 3QMXA 2O8VB 3GUSA 1HD2A 3H1NA 1TOFA 3TKPA 6GSSA 4WF4A 1K3LA 2C8UA 1E6BA 4FH8A 4K5SA 3HJPA 1XW9A 3MNGA 3A2XA 1PN0A 3FZAA 1PKZA 4HU7A 13GSA 1BAYA 4IW9A 4ZILA 3GURA 2F3MA 1T4YA 2WB9A 4A5PA 2L5LA 2B5XA 3EC3A 5B8AA 1JZWA 1I5GA 5IQYA 16GSA 1U88A 1Q4JA 2IN3A 5DQYA 2IMEA 2GSQA 2B1LA 2XBIA 1FOHA 2H0GA 4K7OA 4WXTA 3WGXA 2H6YA 3F6DA 5IO2A 2BTOT 5ABRA 4F0CA 1R26A 3C71A 2R3XA 2YNXA 1VF3A 4LMWA 3F0IA 5DJMA 2VL3A 5EY6A 4ZL8A 1G6YA 1XWCA 4OMVA 3FZ5A 1F6MC 2GSTA 3GIXA 2YOIA 2C3QA 3IA1A 1TK0B 3M8NA 1SK0A 2CA8A 1R4WA 1MEKA 4GSNA 3KP8A 1OYJA 2VL9A 2A4HA 2L57A 1GNWA 4AJ6A 3IE3A 4XRAA 3DRNA 1SD8A 2WDUA 5H5QA 1X9MB 1OE8A 3LG6A 5B7CA 2P0GA 1AQXA 4GWRA 2VCZA 4JZQA 2B5YA 3EWLA 2LV3A 3HVXA 3IK7A 1ZGNA 3TKSE 4MA9A 3RHBA 3WGEA 2KP1A 4KB3A 1THOA 2FY6A 1PX7A 5GAPD 1XWBA 2DJKA 3E3EA 4MJBA 4WBRD 3APQA 3KMNA 2QKEA 1U6TA 4GXZA 3V1WA 3O76A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F3B A;  4L5O A;  4YAV A;  3VI5 A;  1PN9 A;  3PGT A;  5G5F A;  1XBS A;  19GS A;  1SEN A;  4PX1 A;  1FO5 A;  5G5E A;  2HXK A;  3H93 A;  4H86 A;  2K8V A;  1F3A A;  4GF0 A;  1G6W A;  2OE3 A;  2JU5 A;  1WWJ A;  2YZU A;  4TVE A;  3VFI A;  3IXR A;  3HYP A;  1DE1 A;  3UOM A;  1SL1 B;  3ZMK A;  1GSS A;  5KN0 A;  3TKS A;  4KCE A;  4BWS A;  1XVQ A;  3PH9 A;  4CW9 A;  4EXJ A;  2D2Z A;  3UL3 A;  1TRS A;  3GSS A;  2HT9 A;  1TW9 A;  1I9D A;  1OKT A;  1B4Q A;  1SK2 A;  4K6X A;  2O89 A;  4NXI A;  3VUR A;  4X43 A;  3TRP A;  5AIX A;  2IL3 A;  1SJZ A;  6GSX A;  3ERW A;  5ENU A;  2YV7 A;  3M1G A;  3NIV A;  2OBK A;  3EE2 A;  5H5S A;  4D73 A;  2XC2 A;  3FYG A;  5ID2 A;  1X5E A;  1WIK A;  3GL3 A;  4TR1 A;  4K2D A;  1XW6 A;  5HR3 A;  3C73 A;  3TKS C;  5CAX A;  4NHZ A;  3QAW A;  4PXO A;  1MDK A;  2L5O A;  4HQZ A;  4TRX A;  4ZBD A;  4YQM A;  2F8F A;  2I1U A;  4MF5 A;  2B6M A;  3ED3 A;  2H6X A;  2K6V A;  1F37 A;  2VLV A;  2C0G A;  4LLR A;  4G19 A;  3QFA C;  4MPF A;  1XWG A;  2FWH A;  2H72 A;  2RII A;  2CVK A;  5CYY A;  4IBP A;  2IMD A;  5J41 A;  4DSR A;  4NHW A;  2PVQ A;  3F8U A;  20GS A;  2OJL A;  2VCQ A;  1SL2 B;  2GQM A;  2DJ0 A;  4KW6 A;  2K9F A;  4HS1 A;  1PKW A;  2FWE A;  3KH9 A;  2OBI A;  4PQ1 A;  2C3T A;  2R37 A;  1OC9 A;  22GS A;  2LS5 A;  1J08 A;  2PER A;  4TOP A;  5B6N A;  2N5A A;  3TJG A;  4XS6 A;  3IAM 2;  4EDY A;  3P2A A;  1VF4 A;  2AJQ B;  4JRR A;  3ME8 A;  1TRV A;  1S3A A;  2PUK C;  1JZO A;  1EP8 A;  3VI7 A;  4ECB A;  4MJC A;  2I9H A;  2IMK A;  3ZYW A;  2Z9S A;  3ZVJ D;  2QC7 A;  4F9Z A;  1A8Y A;  5G30 A;  4KGI A;  3D21 A;  3UVT A;  1YF1 A;  2F8A A;  2DML A;  3WGD A;  2OE1 A;  4MCU A;  4KSO A;  1JHB A;  4TXV A;  1EWX A;  2MZC A;  5D9W A;  2NVL A;  2C0D A;  4KX4 A;  1GUH A;  2H70 A;  3L4N A;  1YJ6 A;  4LMV A;  1XOA A;  4ACS A;  1YEP A;  1RQM A;  1FAA A;  3MDK A;  2JZS A;  1GTI A;  3IC4 A;  3HA9 A;  1PA3 A;  2JSZ A;  2R4V A;  1THX A;  5C04 A;  4EO3 A;  2H01 A;  3ERF A;  2LKU A;  3ZRD A;  4YQV A;  4J56 E;  1K0C A;  4IS0 A;  6GSV A;  4MPG A;  2WFC A;  3HZ8 A;  1AQV A;  1EOH A;  4N11 A;  3CTF A;  3EUR A;  2P31 A;  2ON7 A;  3DVW A;  4AJ8 A;  2MMA A;  4KH7 A;  3DGQ A;  2H74 A;  1JZR A;  2KOK A;  5DCG A;  1HQO A;  1ZL9 A;  2KLX A;  4TN8 A;  2GDR A;  1M2D A;  2EC4 A;  2G2Q A;  4FYU A;  1QUW A;  1R5P A;  5HR0 A;  2H19 A;  4NWY A;  4D73 B;  1BQ7 A;  5ECP B;  5J9C A;  2X99 A;  2LQO A;  1QFN A;  3KTL A;  4KA0 A;  5ID2 B;  3BBY A;  5JWO B;  1FVK A;  3OR5 A;  1TKD B;  2G0F A;  3KTB A;  3ZFL A;  2JZT A;  2ZUP A;  1V98 A;  4L0U A;  4TXO A;  4I2T A;  3VWV A;  4WEY A;  1EZK A;  3GYK A;  1A0F A;  4HOJ A;  5DDL A;  4IHU A;  2V1M A;  4O5R A;  5EPF A;  1QGV A;  3NOF A;  3ZML A;  4AGS A;  4ZXG A;  3I69 A;  1FVJ A;  5G1L A;  1WE0 A;  2LJK A;  1ON4 A;  4V2L A;  1A23 A;  2L59 A;  1Z5Y E;  2C0E A;  2E2G A;  4OCE A;  4MP4 A;  3KJY A;  1PX6 A;  4O92 A;  2F9S A;  4RI7 A;  4ZB8 A;  5DVB A;  3QCP A;  4RQR A;  2EIR A;  4JED A;  1SYR A;  1FOV A;  3I43 A;  4V1A p;  1OC9 B;  5IMZ A;  4P3Y B;  3SBC A;  1XCC A;  4KE3 A;  2LNS A;  1GRX A;  3D0Z A;  5B8B A;  2O87 A;  2OE0 A;  3ERG A;  2CAI A;  4POL A;  4Q5R A;  4FIW A;  4PNF A;  1GUM A;  2VM1 A;  3J7Y b;  1SL0 B;  2A4V A;  2YJ7 A;  1QXH A;  2FGX A;  2PGT A;  2HE3 A;  3L9U A;  3FEU A;  2CVB A;  4GQC A;  2PVO C;  2LTK A;  5EL8 A;  3RHC A;  2WZ9 A;  1A2M A;  1JZD A;  1GSE A;  1GTB A;  2TIR A;  4HJ2 A;  2H30 A;  3ME7 A;  2E7P A;  4JE1 A;  4DVC A;  1ML6 A;  3WD6 A;  2YN1 A;  4MJE A;  3CRU A;  2RLI A;  3L0H A;  1GTA A;  2M46 A;  5KEJ A;  4KDU A;  2WCI A;  1BX9 A;  1J9B A;  3CRT A;  4I97 A;  1VF2 A;  2B5E A;  5LNK e;  3QPM A;  2FWF A;  1PSQ A;  2X8C A;  5G1K A;  3TOT A;  1TI1 A;  3F4S A;  1A2J A;  6GSY A;  2QGV A;  4ZB9 A;  5FWG A;  5ECQ B;  4I2U A;  3ZL5 A;  4LA1 A;  3VWW A;  3H4K A;  4OFM A;  4OFT A;  5COH A;  4RUV A;  1M0U A;  5H5R A;  1AAZ A;  2JL4 A;  4NV5 A;  4TW5 A;  3FR9 A;  1N2A A;  3C7M A;  3KXO A;  2CV4 A;  3H79 A;  2XBQ A;  2A2R A;  4WR4 A;  1V40 A;  3ZFB A;  2H0I A;  3I9V 2;  4XTS A;  2H73 A;  3BCK A;  4WKW A;  2GQK A;  5HFK A;  1EGO A;  2L6C A;  5CRD A;  4BL7 A;  1YEX A;  3W8S A;  1O7U A;  4PUA A;  5D9X A;  1TU8 A;  4G10 A;  2LRT A;  3D4T A;  1T7P B;  4FYB A;  1S3D A;  4TXO B;  4Q5N A;  3UAR A;  5DQS A;  5ECN B;  2X8H A;  1ZZY A;  5F06 A;  5HQP A;  2XPE A;  5HR1 A;  4MH2 A;  3TKR A;  1GP1 A;  4QL9 A;  1T8E B;  4MK3 A;  2GSR A;  5JWQ B;  3DML A;  2HSY A;  5DAK A;  5HR2 A;  2CVD A;  4Q5F A;  2OAD A;  3A2V A;  4KCA A;  1NSW A;  1K3Y A;  1WMJ A;  2WS2 A;  2YJH A;  5GST A;  2E2M A;  1GUL A;  3EVI A;  4XIH A;  1X5D A;  2VOC A;  8GSS A;  5F8B A;  4EVM A;  3LJR A;  1R5A A;  2M80 A;  4E8H A;  4ECC A;  3F4T A;  3FRC A;  4TR3 A;  2FWG A;  1WPI A;  3PR8 A;  3LWA A;  2EIQ A;  2REM A;  4NMU A;  1ERV A;  4ZB6 A;  1SJ6 A;  2GT5 A;  3HZ4 A;  3Q19 A;  1CQH A;  2DMM A;  1TP9 A;  3AY8 A;  2AAW A;  1EV4 A;  2IMI A;  2GZP A;  2HNL A;  2MYG A;  2PN8 A;  3DWV A;  1RW1 A;  3F3R A;  2DSA A;  2C0F A;  3QDN A;  3SWL A;  10GS A;  3U5R E;  1FW1 A;  2AUV A;  1USB A;  2AYT A;  2C4J A;  1A8L A;  3EYT A;  2HI7 A;  2VL2 A;  2KHP A;  1QK8 A;  4WR5 A;  4GRF A;  2PU9 C;  1ZMA A;  4IKH A;  4ID0 A;  1ABA A;  4L8E A;  4HDE A;  2M72 A;  1V2A A;  3GFK A;  18GS A;  2H66 A;  1GL8 A;  3APO A;  4JBB A;  2YP6 A;  1V58 A;  1T3B A;  4HJM A;  3A5W A;  5ECS A;  1O6J A;  1XZO A;  3IV4 A;  4HEA 2;  3A3T A;  4EUY A;  4K7I A;  2LRC A;  4BVY A;  2LST A;  2RM5 A;  4OFN A;  3CXG A;  2H0H A;  1MDJ A;  5DJL A;  3QAG A;  1XIY A;  3O3T A;  3ZTL A;  2QSI A;  3GH9 A;  3C1R A;  1NM3 A;  3BD2 A;  2VL2 C;  3FHK A;  3VLN A;  1G7E A;  3Q18 A;  5E4W A;  4N0V A;  2IWT A;  3MWH A;  5D9T A;  5D96 A;  5A4W A;  2PMT A;  1T1V A;  2ALB A;  1X0R A;  5KN3 A;  4K7N A;  2J9H A;  3CBU A;  1TJD A;  2CT6 A;  2A2S A;  1XWK A;  5J9B A;  2I3Y A;  2X8G A;  2TRX A;  3R2Q A;  3TJK A;  4G9H A;  3CSI A;  1ERU A;  2KP2 A;  2H75 A;  4X1U A;  9GSS A;  2VD1 A;  2WRT A;  3G7J A;  3FZ9 A;  4DEJ A;  1SKS B;  4BVX A;  1ZCP A;  3F9U A;  4NPB A;  3UJ1 A;  1B9Y C;  4J2F A;  2NPB A;  5F0G A;  1X5C A;  4BWQ A;  4ZBB A;  1URM A;  1TK8 B;  3KMO A;  2GT6 A;  3UAP A;  4POB A;  1CQG A;  4EF0 A;  1SK1 A;  3GA4 A;  1EEM A;  4GSS A;  4OO4 A;  5C00 A;  2DJ2 A;  2C3N A;  5DAK B;  1OKD A;  7GSS A;  1A0R P;  2I81 A;  5IPG A;  1GLP A;  2VLU A;  3US3 A;  5IO0 A;  1M2B A;  3FZ4 A;  1IYH A;  4GTU A;  1B8X A;  2GSS A;  2HRN A;  1QQ2 A;  3GN3 A;  3ZVJ A;  2FA8 A;  2R6K A;  4MMM A;  2LJR A;  1B9X C;  1Q98 A;  3D4M A;  4FO5 A;  2LUS A;  3L78 A;  1M2A A;  2LJA A;  1Z7P A;  1LBK A;  4L0W A;  3RAZ A;  1XXU A;  3TDG A;  2CAQ A;  2HZE B;  1DUG A;  2K8S A;  4IEL A;  3GNJ A;  12GS A;  4WBJ A;  2WJU A;  2E0Q A;  5IOX A;  1F9M A;  2GQL A;  2H71 A;  1DE2 A;  5GAN D;  4TR4 A;  2AHE A;  4ZIJ A;  2V41 A;  1MDI A;  4HUA A;  5CRG A;  4JU5 A;  3KP9 A;  1EV9 A;  3KD0 A;  5J3R A;  2LNT A;  1UVZ A;  4F82 A;  4EL1 A;  4LL4 B;  3ZRE A;  1Z6N A;  2VCT A;  4GCI A;  4IP1 A;  1KEB A;  3ZIV A;  5ELA A;  4JR4 A;  1SKW B;  1HNA A;  4IN0 A;  2JZR A;  5ECK B;  1JLW A;  3IPZ A;  4RQX A;  1O73 A;  4QL7 A;  3IOS A;  3W8J A;  2DIY A;  3ZIT A;  4IQA A;  4BPY A;  1KNG A;  2JSY A;  3RBT A;  1ILO A;  4IJI A;  1YZX A;  2JAD A;  3C1S A;  2CZ3 A;  3Q74 A;  3GV1 A;  3WYW A;  4YAP A;  2NDO A;  1OVN A;  3JCM L;  3DXB A;  3DKS A;  1V9W A;  2VCW A;  3GH6 A;  4ZL7 A;  1AXD A;  3H8Q A;  2O85 A;  3G7Y A;  2H8L A;  4HZ4 A;  3EMX A;  1M99 A;  2OAC A;  1ST9 A;  5AN1 A;  4EKZ A;  2YPM A;  3K8N A;  4ECI A;  3LGC A;  3DEX A;  2DJJ A;  1RK4 A;  5DCH A;  3MSZ A;  3HVS A;  1GUK A;  1G0T A;  2V2G A;  4V1A g;  3DYR A;  3FKF A;  3WT2 A;  1AC1 A;  3ZIJ A;  2F51 A;  5A4U A;  1PRX A;  2N5F A;  2VCV A;  1U3A A;  2FCH A;  1AIU A;  3GKX A;  5IPH A;  5L71 A;  1TXX A;  3CSH A;  1XWA A;  2V6K A;  4OD7 A;  5ECM B;  4NAX A;  1UN2 A;  3F3Q A;  3G9B A;  5LCZ A;  1OC3 A;  4Q5Q A;  2L6D A;  1YF0 A;  3LXT A;  1A24 A;  3BJ5 A;  1BED A;  2B7K A;  4YQU A;  5ELG A;  4ILF A;  4JR6 A;  1ZYQ B;  3IHQ A;  4PUR A;  4RI6 A;  4HZ2 A;  3ISO A;  5IOW A;  1M9A A;  3LFL A;  1NHY A;  4XS4 B;  5G31 A;  3N5O A;  4PQI A;  4EE0 A;  2FA4 A;  2R5G A;  5ECI B;  3HXS A;  1MTC A;  1FB0 A;  1GSF A;  3GKK A;  3A2W A;  3UIW A;  3HY2 A;  1K0M A;  4MDC A;  3APS A;  5IMV A;  4MAB A;  4I8B A;  2L4Q A;  2J23 A;  2RM6 A;  4I5Q A;  3KEB A;  1OE7 A;  4ECJ A;  1O8X A;  2HRF A;  2X64 A;  3GKN A;  2PPT A;  2FLS A;  3EU3 A;  2MMO A;  4FYC A;  2H6Z A;  3KM6 A;  1LJR A;  1Z6M A;  3F4R A;  2I4A A;  4OO5 A;  4MLY A;  1K0D A;  4KDY A;  5D93 A;  4ZBA A;  2LEG A;  1LU4 A;  3GL5 A;  3E0U A;  3KH7 A;  3M0F A;  1IYI A;  4YH2 A;  4HI7 A;  3IK9 A;  1YQ1 A;  1GSQ A;  2JAC A;  3TRX A;  4ML1 A;  3QAV A;  4NV2 A;  1Y6E A;  1AUC A;  4L5L A;  4MZB A;  1T4Z A;  5JCW A;  1GSU A;  1Z9H A;  5F07 A;  3UBL A;  5JWR B;  1HNC A;  3LOR A;  5J4U A;  3GX8 A;  4F03 A;  1U3I A;  3UMA A;  5AGY A;  1AQW A;  4GLT A;  1NW2 A;  4EDZ A;  1TK5 B;  3FK8 A;  3UVH A;  1SU9 A;  14GS A;  3TB2 A;  4X0X A;  1X9W B;  4KUN A;  1OAZ A;  2B3S A;  2IFQ A;  2IPA A;  1HYU A;  3P8W A;  4PNG A;  1B48 A;  6GST A;  1Z7R A;  1UA5 A;  3KCM A;  4IP6 A;  3HD5 A;  3F6F A;  1WP0 A;  5CRE A;  4ISD A;  4DSS B;  3QD9 A;  3UBK A;  1TI3 A;  4I6X A;  2GGT A;  3P7X A;  2DLX A;  1ZYE A;  2AB6 A;  3ZZX A;  5EVO A;  4O32 A;  2VM2 A;  5F05 A;  2DJ3 A;  2MMZ A;  2HLS A;  5A5K A;  3EMP A;  2IMF A;  5ECL B;  4AJ7 A;  2YWI A;  1T00 A;  5DAL B;  3RPP A;  4HU9 A;  5CRW A;  5D9V A;  1YDK A;  3TOU A;  5ECR B;  1G7O A;  5CRH A;  2YV9 A;  1B4P A;  2EIO A;  2O7K A;  3IR4 A;  1FG4 A;  4MZW A;  1TRU A;  4BA7 A;  2HZE A;  4PGT A;  1XPV A;  4OCF A;  5IMD A;  4KND A;  1O85 A;  1XW5 A;  1EP7 A;  3HJO A;  5KN2 A;  3U6V A;  2CZ2 A;  2ES7 A;  1K0A A;  3IRA A;  1BJX A;  2CQ9 A;  1GTU A;  2YWO A;  5J5N A;  4TR0 A;  3KZQ A;  3S9F A;  2MBS A;  2HFD A;  2H1B A;  3UEM A;  1TRW A;  4PUF C;  3DD3 A;  1A2L A;  1TTZ A;  3Q6O A;  4J57 E;  4ML6 A;  4TKY A;  2IIY A;  2ZNM A;  1TU7 A;  5AIV A;  4IGJ A;  4E8E A;  4MJA A;  1K3O A;  1UC7 A;  5IIZ A;  4MF6 A;  3GHA A;  2VCX A;  2YZH A;  1C72 A;  1R7H A;  3DVX A;  2FNO A;  2N5B A;  5E59 A;  1EOG A;  1VGL A;  3KGK A;  1SJI A;  3TJF A;  2ON5 A;  3TCO A;  3DIE A;  2MMN A;  3RDW A;  3BCI A;  3M9J A;  1JLV A;  4QQ7 A;  3E9J B;  1MD3 A;  2V32 A;  1DSB A;  3QOU A;  5GSS A;  3GKM A;  3HKR A;  1U87 A;  17GS A;  5ECH B;  5A4V A;  2BJX A;  2CX3 A;  3IBH A;  2FUG 2;  2C80 A;  2H1G A;  1XFL A;  1K0B A;  2VIM A;  4CDO A;  4K0G A;  2GVP A;  2NTO A;  5INY A;  5IMA A;  3GST A;  1N8J A;  1WOU A;  2DIZ A;  4XS1 A;  3RPN A;  3L9S A;  2L4C A;  2DJ1 A;  3TKQ A;  3GTU A;  3W6G A;  3QR6 A;  1GSY A;  1FHE A;  3C8E A;  1XVW A;  3CMI A;  1PQN A;  4KAE A;  3PIN A;  2IFQ B;  5CP1 A;  1H75 A;  1BYE A;  5IM9 A;  2VAF A;  3P90 A;  2RUF A;  3HDC A;  3BOA A;  3M9K A;  2PBJ A;  1O8W A;  3IDV A;  2WGR A;  2K18 A;  3LSZ A;  1PL2 A;  4LL1 B;  1Y25 A;  1W4V A;  4XS4 A;  4AF2 A;  3LXZ A;  1E2Y A;  1K0N A;  4N10 A;  5JCU A;  4XCS A;  2GZY A;  4F2I A;  4OWY A;  2WUL A;  4HQS A;  1PMT A;  4IJ3 A;  4K1F A;  5JCG A;  1YKA A;  2AV4 A;  2OKA A;  3TGZ A;  4IVF A;  2DBC A;  5D73 A;  3VPQ A;  2LRN A;  1SYX A;  1GSD A;  2PWJ A;  3ZLP A;  3EIN A;  3CTG A;  1VF1 A;  5D8I A;  3VWU A;  1EGR A;  3LQ7 A;  3VWX A;  2HSH A;  2LQQ A;  1X9S B;  4Z7X A;  4KSM A;  2MBT A;  2KUC A;  1KTE A;  1SD9 A;  5IMF A;  2H1D A;  3N9J A;  1OC8 A;  3F63 A;  4K0N A;  4ZL9 A;  1NHO A;  5FT3 A;  5CO3 A;  2H1A A;  1WJK A;  1M7T A;  3MAK A;  2VUP A;  5LD0 A;  4WET A;  1PGT A;  1GNE A;  2VD0 A;  3LEF A;  1S3C A;  4KDX A;  2IJY A;  1GLQ A;  3VPT A;  3M3M A;  1WRY A;  3TJJ A;  5FHI A;  2V6O A;  1ACV A;  2HYX A;  5G2Z A;  4N30 A;  2FHE A;  4GST A;  4POK A;  4DSQ A;  4IQ1 A;  11GS A;  3D5J A;  6GSW A;  1KBN A;  2GLR A;  1FB6 A;  4O7H A;  4V2M A;  1HNB A;  5CNW A;  2YCD A;  3FR6 A;  2RUE A;  2BMX A;  2H76 A;  4K9Z A;  1QMV A;  2YWM A;  3O6T A;  3CSJ A;  2XPD A;  3LYK A;  1DBY A;  3NZN A;  1M9B A;  2R2J A;  3GRX A;  1YY7 A;  4DSS A;  1W89 A;  1SKR B;  2YAN A;  4GQF A;  2VLT A;  3HCZ A;  2CX4 A;  3WT1 A;  2XHF A;  1XOB A;  3LYP A;  4XRD A;  2FD3 A;  4V2N A;  3CYN A;  3J7Y k;  4TR1 B;  3HHV A;  1AW9 A;  1V57 A;  1GWC A;  1YKC A;  3D22 A;  5AIS A;  1BG5 A;  2B7J A;  1ZOF A;  5HFG A;  5DAL A;  3VK9 A;  2GZZ A;  2DC5 A;  3G7I A;  3GMF A;  1O81 A;  1MD4 A;  1VRS D;  3FY7 A;  6GSU A;  1ERW A;  2C1Y A;  3GTU B;  3TJB A;  4MZC A;  2P5Q A;  4CHS A;  5B6M A;  1K0O A;  1TDI A;  4PQH A;  2NBS A;  2P5R A;  2ZCT A;  3EU4 A;  4MH3 A;  1ERT A;  5ECO B;  5IMC A;  2YWN A;  3QFB C;  3FR3 A;  3GX0 A;  4MF7 A;  3IAS 2;  3L9V A;  2GTU A;  3TRQ A;  1F2E A;  2OA7 A;  5HFI A;  2HZF A;  1JFU A;  4F0B A;  2GS3 A;  3D6I A;  1GH2 A;  2B1K A;  4EC0 A;  1H4O A;  1PD2 1;  5GZZ B;  3HJM A;  4K8M A;  3KIJ A;  2TRC P;  2VO4 A;  4POM A;  1PL1 A;  1Z3E A;  5DBQ A;  4G2E A;  4XHM A;  4WF5 A;  3TUE A;  1EEJ A;  4N0Z A;  1J0F A;  4ULX A;  5KN1 A;  3FW2 A;  3I6A A;  3HVV A;  3QMX A;  2O8V B;  3GUS A;  1HD2 A;  3H1N A;  1TOF A;  3TKP A;  6GSS A;  1K3L A;  4WF4 A;  2C8U A;  1E6B A;  4FH8 A;  3HJP A;  1XW9 A;  3MNG A;  3A2X A;  3FZA A;  1PKZ A;  4HU7 A;  13GS A;  1BAY A;  4IW9 A;  4ZIL A;  3GUR A;  2F3M A;  1T4Y A;  2WB9 A;  2L5L A;  2B5X A;  3EC3 A;  5B8A A;  1JZW A;  1I5G A;  5IQY A;  16GS A;  1U88 A;  1Q4J A;  2IN3 A;  5DQY A;  2IME A;  2GSQ A;  2B1L A;  2XBI A;  2H0G A;  4K7O A;  4WXT A;  3WGX A;  2H6Y A;  3F6D A;  5IO2 A;  2BTO T;  5ABR A;  4F0C A;  1R26 A;  3C71 A;  2R3X A;  2YNX A;  1VF3 A;  4LMW A;  3F0I A;  5DJM A;  2VL3 A;  5EY6 A;  4ZL8 A;  1G6Y A;  1XWC A;  4OMV A;  3FZ5 A;  1F6M C;  2GST A;  3GIX A;  2YOI A;  2C3Q A;  3IA1 A;  1TK0 B;  3M8N A;  1SK0 A;  2CA8 A;  1R4W A;  1MEK A;  4GSN A;  3KP8 A;  1OYJ A;  2VL9 A;  2L57 A;  1GNW A;  4AJ6 A;  3IE3 A;  4XRA A;  3DRN A;  1SD8 A;  2WDU A;  5H5Q A;  1X9M B;  1OE8 A;  3LG6 A;  5B7C A;  2P0G A;  1AQX A;  4GWR A;  2VCZ A;  4JZQ A;  2B5Y A;  3EWL A;  2LV3 A;  3HVX A;  3IK7 A;  1ZGN A;  3TKS E;  4MA9 A;  3RHB A;  3WGE A;  2KP1 A;  4KB3 A;  1THO A;  2FY6 A;  1PX7 A;  5GAP D;  1XWB A;  2DJK A;  3E3E A;  4MJB A;  4WBR D;  3APQ A;  3KMN A;  2QKE A;  1U6T A;  4GXZ A;  3V1W A;  3O76 A; 
#chains in the Genus database with same CATH topology
 1F3B A;  4ICY A;  4L5O A;  4YAV A;  3VI5 A;  1PN9 A;  3PGT A;  5G5F A;  1XBS A;  19GS A;  1SEN A;  4PX1 A;  1FO5 A;  5G5E A;  2HXK A;  3H93 A;  4H86 A;  2K8V A;  1F3A A;  4GF0 A;  1G6W A;  2OE3 A;  2JU5 A;  4EIQ A;  1WWJ A;  2YZU A;  4TVE A;  3VFI A;  3IXR A;  3HYP A;  1DE1 A;  3UOM A;  1SL1 B;  3ZMK A;  1GSS A;  5KN0 A;  3TKS A;  4KCE A;  4BWS A;  1XVQ A;  3PH9 A;  4CW9 A;  4EXJ A;  2D2Z A;  2UZ8 A;  3UL3 A;  1TRS A;  3GSS A;  2HT9 A;  1TW9 A;  1I9D A;  1OKT A;  1B4Q A;  1SK2 A;  4K6X A;  2O89 A;  4NXI A;  3VUR A;  4X43 A;  3TRP A;  5AIX A;  2IL3 A;  1SJZ A;  6GSX A;  3ERW A;  5ENU A;  2YV7 A;  3M1G A;  3NIV A;  4G0K A;  2OBK A;  3EE2 A;  5H5S A;  4D73 A;  2XC2 A;  3FYG A;  5ID2 A;  1X5E A;  1WIK A;  3GL3 A;  4TR1 A;  4K2D A;  1XW6 A;  5HR3 A;  3C73 A;  3TKS C;  5CAX A;  4NHZ A;  3QAW A;  4PXO A;  1MDK A;  2L5O A;  4HQZ A;  4TRX A;  4ZBD A;  4YQM A;  2F8F A;  2I1U A;  4MF5 A;  2B6M A;  3ED3 A;  4CY8 A;  2H6X A;  2K6V A;  4HSC X;  1F37 A;  2R0G A;  2C0G A;  2VLV A;  4LLR A;  4G19 A;  3QFA C;  4MPF A;  1XWG A;  2FWH A;  2H72 A;  2RII A;  2CVK A;  5CYY A;  4IBP A;  2IMD A;  5J41 A;  4DSR A;  4Z2U A;  4NHW A;  2PVQ A;  3F8U A;  20GS A;  2OJL A;  2VCQ A;  1SL2 B;  2GQM A;  2DJ0 A;  4KW6 A;  2K9F A;  4HS1 A;  1PKW A;  1S3R A;  2FWE A;  3KH9 A;  2OBI A;  4PQ1 A;  2C3T A;  2R37 A;  1OC9 A;  22GS A;  2LS5 A;  1J08 A;  2PER A;  4TOP A;  5B6N A;  2N5A A;  3TJG A;  4XS6 A;  3IAM 2;  4EDY A;  3P2A A;  1VF4 A;  2AJQ B;  4JRR A;  3ME8 A;  1TRV A;  1S3A A;  2PUK C;  1JZO A;  1EP8 A;  3VI7 A;  4ECB A;  4MJC A;  2I9H A;  2IMK A;  3ZYW A;  2Z9S A;  3ZVJ D;  2QC7 A;  4F9Z A;  1A8Y A;  5G30 A;  4KGI A;  3D21 A;  3UVT A;  1YF1 A;  2F8A A;  2DML A;  3WGD A;  2OE1 A;  4MCU A;  4KSO A;  1JHB A;  2R0P A;  4TXV A;  1EWX A;  2MZC A;  5D9W A;  2NVL A;  2C0D A;  4KX4 A;  1GUH A;  2H70 A;  3L4N A;  1YJ6 A;  4LMV A;  1XOA A;  4ACS A;  1YEP A;  1RQM A;  1FAA A;  3MDK A;  2JZS A;  1GTI A;  3IC4 A;  3HA9 A;  1PA3 A;  2JSZ A;  2R4V A;  1THX A;  5C04 A;  4EO3 A;  2H01 A;  3ERF A;  2LKU A;  3ZRD A;  4YQV A;  4J56 E;  1K0C A;  4IS0 A;  6GSV A;  4MPG A;  2WFC A;  3HZ8 A;  1AQV A;  1EOH A;  4N11 A;  3CTF A;  3EUR A;  2P31 A;  2ON7 A;  3DVW A;  4AJ8 A;  2MMA A;  4KH7 A;  3DGQ A;  2H74 A;  1JZR A;  2KOK A;  5DCG A;  1HQO A;  1ZL9 A;  2KLX A;  4TN8 A;  2GDR A;  1M2D A;  2EC4 A;  2G2Q A;  4FYU A;  1QUW A;  1R5P A;  5HR0 A;  2H19 A;  4NWY A;  4D73 B;  1BQ7 A;  5ECP B;  5J9C A;  2X99 A;  2LQO A;  4USS A;  1QFN A;  3KTL A;  4KA0 A;  5ID2 B;  3BBY A;  5JWO B;  1FVK A;  3OR5 A;  1TKD B;  2G0F A;  3KTB A;  3ZFL A;  2JZT A;  2ZUP A;  1V98 A;  4L0U A;  4TXO A;  4I2T A;  3VWV A;  4WEY A;  1EZK A;  3GYK A;  1A0F A;  4HOJ A;  5DDL A;  4IHU A;  2V1M A;  4O5R A;  4Z2T A;  1XG8 A;  5EPF A;  1QGV A;  3NOF A;  3ZML A;  4AGS A;  4ZXG A;  3I69 A;  1FVJ A;  5G1L A;  1WE0 A;  2LJK A;  1ON4 A;  4V2L A;  1A23 A;  2L59 A;  1Z5Y E;  2C0E A;  2E2G A;  4OCE A;  4MP4 A;  3KJY A;  1PX6 A;  4O92 A;  2F9S A;  4RI7 A;  4ZB8 A;  5DVB A;  3LW9 A;  3QCP A;  4RQR A;  2EIR A;  4JED A;  1SYR A;  1FOV A;  3I43 A;  4V1A p;  1OC9 B;  5IMZ A;  4P3Y B;  3SBC A;  1XCC A;  2HSM A;  4KE3 A;  4BVX B;  2LNS A;  1GRX A;  3D0Z A;  5B8B A;  2O87 A;  2OE0 A;  3ERG A;  2CAI A;  4POL A;  4Q5R A;  4FIW A;  4MNN A;  4PNF A;  1GUM A;  2VM1 A;  3J7Y b;  2HRA A;  2A4V A;  1SL0 B;  2YJ7 A;  1QXH A;  2FGX A;  2PGT A;  2HE3 A;  3L9U A;  3FEU A;  2CVB A;  4GQC A;  2PVO C;  2LTK A;  5EL8 A;  3RHC A;  2WZ9 A;  3MYD A;  1A2M A;  2QA2 A;  1JZD A;  1GSE A;  1GTB A;  2TIR A;  4HJ2 A;  2H30 A;  3ME7 A;  2E7P A;  4JE1 A;  4DVC A;  1ML6 A;  3WD6 A;  2YN1 A;  4MJE A;  3CRU A;  2RLI A;  3L0H A;  1GTA A;  2M46 A;  5KEJ A;  4KDU A;  2WCI A;  1BX9 A;  1J9B A;  2X4A A;  3CRT A;  4I97 A;  1VF2 A;  2B5E A;  5LNK e;  4X4J A;  3QPM A;  2FWF A;  1PSQ A;  2X8C A;  5G1K A;  3TOT A;  1TI1 A;  3F4S A;  1A2J A;  5BMU A;  6GSY A;  2QGV A;  4ZB9 A;  5FWG A;  5ECQ B;  4I2U A;  3ZL5 A;  4LA1 A;  3VWW A;  3H4K A;  4OFM A;  4OFT A;  5COH A;  4RUV A;  1M0U A;  5H5R A;  1AAZ A;  2JL4 A;  4NV5 A;  4TW5 A;  3FR9 A;  1N2A A;  3C7M A;  3KXO A;  2CV4 A;  3H79 A;  2XBQ A;  2A2R A;  4K2X A;  1V40 A;  4WR4 A;  3ZFB A;  2H0I A;  3I9V 2;  4XTS A;  2H73 A;  3BCK A;  4WKW A;  2GQK A;  5HFK A;  1EGO A;  2L6C A;  5CRD A;  4BL7 A;  1YEX A;  3W8S A;  1O7U A;  4PUA A;  5D9X A;  1TU8 A;  4G10 A;  2LRT A;  3D4T A;  1T7P B;  4FYB A;  1S3D A;  4TXO B;  4Q5N A;  3UAR A;  5DQS A;  5ECN B;  2X8H A;  2X49 A;  1ZZY A;  5F06 A;  5HQP A;  2XPE A;  5HR1 A;  4MH2 A;  3TKR A;  1GP1 A;  4QL9 A;  1T8E B;  4MK3 A;  2GSR A;  5JWQ B;  3DML A;  2HSY A;  5DAK A;  5HR2 A;  2CVD A;  4Q5F A;  2OAD A;  3A2V A;  4KCA A;  1NSW A;  1K3Y A;  1WMJ A;  2WS2 A;  2YJH A;  5GST A;  2E2M A;  1GUL A;  3EVI A;  4XIH A;  1X5D A;  2VOC A;  8GSS A;  5F8B A;  4EVM A;  3LJR A;  1R5A A;  2M80 A;  4E8H A;  4ECC A;  3F4T A;  3FRC A;  4TR3 A;  2FWG A;  1WPI A;  2R0C A;  3PR8 A;  3LWA A;  2EIQ A;  2REM A;  4NMU A;  1ERV A;  4ZB6 A;  1SJ6 A;  2GT5 A;  3HZ4 A;  3Q19 A;  1CQH A;  2DMM A;  1TP9 A;  3AY8 A;  2AAW A;  1EV4 A;  2IMI A;  2HRK A;  2GZP A;  2HNL A;  2MYG A;  2PN8 A;  3DWV A;  1RW1 A;  3F3R A;  2DSA A;  2C0F A;  3QDN A;  3SWL A;  10GS A;  3U5R E;  1FW1 A;  2AUV A;  1USB A;  2AYT A;  2C4J A;  5BRT A;  1A8L A;  3EYT A;  2HI7 A;  2VL2 A;  2KHP A;  1QK8 A;  4WR5 A;  4GRF A;  2PU9 C;  1ZMA A;  4IKH A;  4ID0 A;  1ABA A;  4L8E A;  4HDE A;  2M72 A;  1V2A A;  3GFK A;  18GS A;  2H66 A;  1GL8 A;  3APO A;  4G0L A;  4JBB A;  2YP6 A;  1V58 A;  1T3B A;  4HJM A;  3A5W A;  5ECS A;  1O6J A;  1XZO A;  3IV4 A;  4HEA 2;  3A3T A;  4EUY A;  4K7I A;  2LRC A;  4BVY A;  2LST A;  2RM5 A;  4OFN A;  3CXG A;  2H0H A;  3A5I A;  1MDJ A;  5DJL A;  3QAG A;  1XIY A;  3O3T A;  3ZTL A;  2QSI A;  3GH9 A;  3C1R A;  1NM3 A;  3BD2 A;  2VL2 C;  3FHK A;  3VLN A;  1G7E A;  3Q18 A;  5E4W A;  4N0V A;  2IWT A;  3MWH A;  4K5R A;  5D9T A;  5D96 A;  5A4W A;  2PMT A;  1T1V A;  2ALB A;  1X0R A;  5KN3 A;  4K7N A;  2J9H A;  3CBU A;  1TJD A;  2CT6 A;  2A2S A;  1XWK A;  5J9B A;  2I3Y A;  2X8G A;  2TRX A;  3R2Q A;  3TJK A;  4G9H A;  3CSI A;  1ERU A;  2KP2 A;  2H75 A;  4X1U A;  9GSS A;  4BL7 B;  2VD1 A;  2WRT A;  3G7J A;  3FZ9 A;  4DEJ A;  1SKS B;  4BVX A;  1ZCP A;  3F9U A;  4NPB A;  3UJ1 A;  1B9Y C;  4J2F A;  2NPB A;  5F0G A;  1X5C A;  4BWQ A;  4ZBB A;  1URM A;  1TK8 B;  3KMO A;  2GT6 A;  3UAP A;  4POB A;  1CQG A;  4EF0 A;  2QA1 A;  1SK1 A;  3GA4 A;  1EEM A;  4GSS A;  4OO4 A;  5C00 A;  2DJ2 A;  2C3N A;  5DAK B;  1OKD A;  7GSS A;  1A0R P;  2I81 A;  5IPG A;  1GLP A;  2VLU A;  3US3 A;  5IO0 A;  1M2B A;  3FZ4 A;  1IYH A;  4GTU A;  1B8X A;  2GSS A;  2HRN A;  1QQ2 A;  3GN3 A;  3ZVJ A;  2FA8 A;  2R6K A;  4O5Q A;  4MMM A;  2LJR A;  1B9X C;  1Q98 A;  3D4M A;  4FO5 A;  2LUS A;  3L78 A;  1M2A A;  2LJA A;  1Z7P A;  1LBK A;  4L0W A;  3RAZ A;  1XXU A;  3TDG A;  2CAQ A;  2HZE B;  1DUG A;  2K8S A;  4IEL A;  3GNJ A;  12GS A;  4WBJ A;  2WJU A;  2E0Q A;  5IOX A;  1F9M A;  2GQL A;  2H71 A;  1DE2 A;  1M3J A;  5GAN D;  4TR4 A;  2AHE A;  4ZIJ A;  2V41 A;  1MDI A;  4HUA A;  5CRG A;  4BIK A;  4JU5 A;  3KP9 A;  1EV9 A;  3IHG A;  3KD0 A;  5J3R A;  4O5U A;  2LNT A;  1UVZ A;  4F82 A;  4EL1 A;  4LL4 B;  4EIP A;  3ZRE A;  1Z6N A;  2VCT A;  4GCI A;  2DKI A;  4IP1 A;  1KEB A;  3FMW A;  3ZIV A;  5ELA A;  4JR4 A;  1SKW B;  1HNA A;  4IN0 A;  2JZR A;  5ECK B;  1JLW A;  3IPZ A;  4RQX A;  1O73 A;  4QL7 A;  3IOS A;  3W8J A;  2DIY A;  3ZIT A;  4IQA A;  4BPY A;  1KNG A;  2JSY A;  3RBT A;  1ILO A;  4IJI A;  1YZX A;  2JAD A;  3C1S A;  2CZ3 A;  3Q74 A;  3GV1 A;  2DKH A;  4YAP A;  3WYW A;  2NDO A;  1OVN A;  3JCM L;  3DXB A;  3DKS A;  1V9W A;  2VCW A;  3GH6 A;  4ZL7 A;  1AXD A;  3H8Q A;  2O85 A;  3G7Y A;  2H8L A;  4HZ4 A;  3EMX A;  1M99 A;  2OAC A;  1ST9 A;  5AN1 A;  4EKZ A;  2YPM A;  3K8N A;  4BVY B;  4ECI A;  3LGC A;  3DEX A;  2DJJ A;  1RK4 A;  5DCH A;  3MSZ A;  3HVS A;  1GUK A;  1G0T A;  2V2G A;  4V1A g;  3DYR A;  3FKF A;  5KOX A;  3WT2 A;  1AC1 A;  3ZIJ A;  2F51 A;  5A4U A;  1PRX A;  2N5F A;  2VCV A;  1U3A A;  2FCH A;  1AIU A;  3GKX A;  5IPH A;  5L71 A;  1TXX A;  3CSH A;  1XWA A;  2V6K A;  4OD7 A;  5ECM B;  4NAX A;  1UN2 A;  3F3Q A;  3G9B A;  5LCZ A;  1OC3 A;  4Q5Q A;  2L6D A;  1YF0 A;  1ZYP A;  3LXT A;  1A24 A;  3BJ5 A;  1BED A;  3MIX A;  2B7K A;  4YQU A;  5ELG A;  4ILF A;  4JR6 A;  1ZYQ B;  3IHQ A;  4PUR A;  4RI6 A;  4HZ2 A;  3ISO A;  5IOW A;  1M9A A;  3LFL A;  1NHY A;  4XS4 B;  5G31 A;  3N5O A;  4PQI A;  4EE0 A;  5KOW A;  2FA4 A;  2R5G A;  5ECI B;  3HXS A;  1MTC A;  1FB0 A;  1GSF A;  3GKK A;  3A2W A;  3UIW A;  3HY2 A;  1K0M A;  4MDC A;  3APS A;  5IMV A;  4MAB A;  4I8B A;  2L4Q A;  2J23 A;  2RM6 A;  4I5Q A;  3KEB A;  1OE7 A;  4ECJ A;  1O8X A;  2HRF A;  2X64 A;  3GKN A;  2PPT A;  2FLS A;  3EU3 A;  2MMO A;  4FYC A;  2H6Z A;  3KM6 A;  1LJR A;  1Z6M A;  3F4R A;  2I4A A;  4OO5 A;  4MLY A;  1K0D A;  4KDY A;  5D93 A;  4ZBA A;  2LEG A;  1LU4 A;  3GL5 A;  3E0U A;  3KH7 A;  3M0F A;  1IYI A;  4YH2 A;  4HI7 A;  3IK9 A;  1YQ1 A;  4YKG A;  1GSQ A;  2JAC A;  3TRX A;  4ML1 A;  3QAV A;  4NV2 A;  1Y6E A;  1AUC A;  4L5L A;  4MZB A;  1T4Z A;  5JCW A;  1GSU A;  1Z9H A;  5F07 A;  3UBL A;  5JWR B;  1HNC A;  3LOR A;  5J4U A;  4CY6 A;  3GX8 A;  4F03 A;  1U3I A;  3UMA A;  5AGY A;  1AQW A;  4GLT A;  1NW2 A;  3CQF A;  4EDZ A;  1TK5 B;  3FK8 A;  3UVH A;  1SU9 A;  14GS A;  3TB2 A;  4X0X A;  1X9W B;  4KUN A;  1OAZ A;  2B3S A;  2IFQ A;  2IPA A;  1HYU A;  3P8W A;  4PNG A;  1B48 A;  6GST A;  1Z7R A;  1UA5 A;  3KCM A;  4IP6 A;  3HD5 A;  3F6F A;  1WP0 A;  5CRE A;  4ISD A;  4DSS B;  3QD9 A;  3UBK A;  1TI3 A;  4I6X A;  2GGT A;  3P7X A;  2DLX A;  1ZYE A;  2AB6 A;  3ZZX A;  5EVO A;  4O32 A;  2VM2 A;  5F05 A;  2DJ3 A;  2MMZ A;  2HLS A;  5A5K A;  3EMP A;  2IMF A;  5ECL B;  4AJ7 A;  2YWI A;  1T00 A;  5DAL B;  3RPP A;  4HU9 A;  4YKF A;  5CRW A;  5D9V A;  1YDK A;  3TOU A;  5ECR B;  1G7O A;  5CRH A;  2YV9 A;  1B4P A;  2EIO A;  2O7K A;  3IR4 A;  1FG4 A;  4MZW A;  1TRU A;  4BA7 A;  2HZE A;  4PGT A;  1XPV A;  4OCF A;  5IMD A;  4KND A;  1O85 A;  1XW5 A;  1EP7 A;  3HJO A;  5KN2 A;  4G0I A;  3U6V A;  2CZ2 A;  2ES7 A;  1K0A A;  3IRA A;  1BJX A;  2CQ9 A;  1GTU A;  2YWO A;  5J5N A;  4TR0 A;  3KZQ A;  3S9F A;  2MBS A;  2HFD A;  2H1B A;  3UEM A;  1TRW A;  4PUF C;  3DD3 A;  1A2L A;  1TTZ A;  3Q6O A;  4J57 E;  4ML6 A;  4TKY A;  2IIY A;  2ZNM A;  1TU7 A;  5AIV A;  4IGJ A;  4E8E A;  4MJA A;  1K3O A;  1UC7 A;  5IIZ A;  4MF6 A;  3GHA A;  2VCX A;  2YZH A;  1C72 A;  1R7H A;  3DVX A;  2FNO A;  2N5B A;  5E59 A;  1EOG A;  1VGL A;  3KGK A;  1SJI A;  3TJF A;  2ON5 A;  3TCO A;  3DIE A;  4Z2R A;  2MMN A;  3RDW A;  3BCI A;  3M9J A;  1JLV A;  4QQ7 A;  3E9J B;  1MD3 A;  2V32 A;  1DSB A;  3QOU A;  5GSS A;  3GKM A;  3HKR A;  1U87 A;  17GS A;  5ECH B;  5A4V A;  2BJX A;  2CX3 A;  3IBH A;  2FUG 2;  2C80 A;  2H1G A;  1XFL A;  1K0B A;  2VIM A;  4CDO A;  4K0G A;  2GVP A;  2NTO A;  5INY A;  5IMA A;  3GST A;  1N8J A;  1WOU A;  2DIZ A;  4XS1 A;  3RPN A;  3L9S A;  1PFO A;  2L4C A;  2DJ1 A;  3TKQ A;  3GTU A;  3W6G A;  3QR6 A;  1GSY A;  1FHE A;  3C8E A;  1XVW A;  3CMI A;  1PQN A;  4KAE A;  3PIN A;  2IFQ B;  5CP1 A;  1H75 A;  1BYE A;  5IM9 A;  2VAF A;  3P90 A;  2RUF A;  3HDC A;  3BOA A;  3M9K A;  3R3E A;  2PBJ A;  1O8W A;  3IDV A;  2WGR A;  2K18 A;  3LSZ A;  1PL2 A;  4LL1 B;  1Y25 A;  1W4V A;  4XS4 A;  4AF2 A;  3LXZ A;  1E2Y A;  1K0N A;  4N10 A;  5JCU A;  4XCS A;  2GZY A;  4F2I A;  4OWY A;  2WUL A;  4HQS A;  1PMT A;  4IJ3 A;  4K1F A;  5JCG A;  1YKA A;  2AV4 A;  2OKA A;  3TGZ A;  4IVF A;  2DBC A;  5D73 A;  3VPQ A;  2LRN A;  1SYX A;  1GSD A;  2PWJ A;  3ZLP A;  3EIN A;  3CTG A;  1VF1 A;  3PPU A;  2A2P A;  5D8I A;  3VWU A;  1EGR A;  3LQ7 A;  3VWX A;  2HSH A;  2LQQ A;  1X9S B;  4Z7X A;  4KSM A;  2MBT A;  2KUC A;  1KTE A;  1M3I A;  1SD9 A;  3HVN A;  5IMF A;  2H1D A;  3N9J A;  1OC8 A;  3F63 A;  4K0N A;  4ZL9 A;  1NHO A;  5FT3 A;  5CO3 A;  2H1A A;  1WJK A;  1M7T A;  3MAK A;  2VUP A;  5LD0 A;  4WET A;  1PGT A;  1GNE A;  2VD0 A;  3LEF A;  1S3C A;  4KDX A;  2IJY A;  1GLQ A;  3VPT A;  3M3M A;  1WRY A;  3TJJ A;  5FHI A;  4KF9 A;  2V6O A;  1ACV A;  2HYX A;  5G2Z A;  4N30 A;  2FHE A;  4GST A;  4POK A;  1ZYN A;  4DSQ A;  4IQ1 A;  11GS A;  3D5J A;  6GSW A;  1KBN A;  2GLR A;  1FB6 A;  4O7H A;  4V2M A;  1HNB A;  5CNW A;  2YCD A;  3FR6 A;  2RUE A;  2BMX A;  2H76 A;  4K9Z A;  1QMV A;  2YWM A;  3O6T A;  3CSJ A;  2XPD A;  3LYK A;  1DBY A;  4FQU A;  3NZN A;  1M9B A;  2R2J A;  3GRX A;  1YY7 A;  4DSS A;  1W89 A;  1SKR B;  2YAN A;  4GQF A;  2VLT A;  3HCZ A;  2CX4 A;  3WT1 A;  2XHF A;  1XOB A;  3LYP A;  4XRD A;  2FD3 A;  4V2N A;  3CYN A;  3J7Y k;  4TR1 B;  3HHV A;  1AW9 A;  1V57 A;  1GWC A;  1YKC A;  3D22 A;  5AIS A;  1BG5 A;  2B7J A;  1ZOF A;  3IC8 A;  5HFG A;  5DAL A;  3VK9 A;  3EPT A;  2GZZ A;  2DC5 A;  3G7I A;  3GMF A;  1O81 A;  1MD4 A;  1VRS D;  3FY7 A;  6GSU A;  1ERW A;  2C1Y A;  3GTU B;  3TJB A;  4MZC A;  2P5Q A;  4CHS A;  5B6M A;  4PTS A;  1K0O A;  1TDI A;  4PQH A;  2NBS A;  2P5R A;  2ZCT A;  3EU4 A;  4MH3 A;  1ERT A;  5ECO B;  5IMC A;  2YWN A;  3QFB C;  3FR3 A;  3GX0 A;  4MF7 A;  3IAS 2;  3L9V A;  2GTU A;  3TRQ A;  1F2E A;  2OA7 A;  5HFI A;  2HZF A;  1JFU A;  4F0B A;  2GS3 A;  3D6I A;  1GH2 A;  2B1K A;  4EC0 A;  1H4O A;  1PD2 1;  5GZZ B;  3HJM A;  4K8M A;  3KIJ A;  2TRC P;  2VO4 A;  4POM A;  1PL1 A;  1Z3E A;  5DBQ A;  4G2E A;  4XHM A;  4WF5 A;  3TUE A;  1EEJ A;  4N0Z A;  1J0F A;  4ULX A;  5KN1 A;  3FW2 A;  3I6A A;  3HVV A;  3QMX A;  2O8V B;  3GUS A;  1HD2 A;  3H1N A;  1TOF A;  3TKP A;  6GSS A;  4WF4 A;  1K3L A;  2C8U A;  1E6B A;  4FH8 A;  4K5S A;  3HJP A;  1XW9 A;  3MNG A;  3A2X A;  1PN0 A;  3FZA A;  1PKZ A;  4HU7 A;  13GS A;  1BAY A;  4IW9 A;  4ZIL A;  3GUR A;  2F3M A;  1T4Y A;  2WB9 A;  4A5P A;  2L5L A;  2B5X A;  3EC3 A;  5B8A A;  1JZW A;  1I5G A;  5IQY A;  16GS A;  1U88 A;  1Q4J A;  2IN3 A;  5DQY A;  2IME A;  2GSQ A;  2B1L A;  2XBI A;  1FOH A;  2H0G A;  4K7O A;  4WXT A;  3WGX A;  2H6Y A;  3F6D A;  5IO2 A;  2BTO T;  5ABR A;  4F0C A;  1R26 A;  3C71 A;  2R3X A;  2YNX A;  1VF3 A;  4LMW A;  3F0I A;  5DJM A;  2VL3 A;  5EY6 A;  4ZL8 A;  1G6Y A;  1XWC A;  4OMV A;  3FZ5 A;  1F6M C;  2GST A;  3GIX A;  2YOI A;  2C3Q A;  3IA1 A;  1TK0 B;  3M8N A;  1SK0 A;  2CA8 A;  1R4W A;  1MEK A;  4GSN A;  3KP8 A;  1OYJ A;  2VL9 A;  2A4H A;  2L57 A;  1GNW A;  4AJ6 A;  3IE3 A;  4XRA A;  3DRN A;  1SD8 A;  2WDU A;  5H5Q A;  1X9M B;  1OE8 A;  3LG6 A;  5B7C A;  2P0G A;  1AQX A;  4GWR A;  2VCZ A;  4JZQ A;  2B5Y A;  3EWL A;  2LV3 A;  3HVX A;  3IK7 A;  1ZGN A;  3TKS E;  4MA9 A;  3RHB A;  3WGE A;  2KP1 A;  4KB3 A;  1THO A;  2FY6 A;  1PX7 A;  5GAP D;  1XWB A;  2DJK A;  3E3E A;  4MJB A;  4WBR D;  3APQ A;  3KMN A;  2QKE A;  1U6T A;  4GXZ A;  3V1W A;  3O76 A; 
#chains in the Genus database with same CATH homology
 1F3B A;  4ICY A;  4L5O A;  4YAV A;  3VI5 A;  1PN9 A;  3PGT A;  5G5F A;  1XBS A;  19GS A;  1SEN A;  4PX1 A;  1FO5 A;  5G5E A;  2HXK A;  3H93 A;  4H86 A;  2K8V A;  1F3A A;  4GF0 A;  1G6W A;  2OE3 A;  2JU5 A;  4EIQ A;  1WWJ A;  2YZU A;  4TVE A;  3VFI A;  3IXR A;  3HYP A;  1DE1 A;  3UOM A;  1SL1 B;  3ZMK A;  1GSS A;  5KN0 A;  3TKS A;  4KCE A;  4BWS A;  1XVQ A;  3PH9 A;  4CW9 A;  4EXJ A;  2D2Z A;  2UZ8 A;  3UL3 A;  1TRS A;  3GSS A;  2HT9 A;  1TW9 A;  1I9D A;  1OKT A;  1B4Q A;  1SK2 A;  4K6X A;  2O89 A;  4NXI A;  3VUR A;  4X43 A;  3TRP A;  5AIX A;  2IL3 A;  1SJZ A;  6GSX A;  3ERW A;  5ENU A;  2YV7 A;  3M1G A;  3NIV A;  4G0K A;  2OBK A;  3EE2 A;  5H5S A;  4D73 A;  2XC2 A;  3FYG A;  5ID2 A;  1X5E A;  1WIK A;  3GL3 A;  4TR1 A;  4K2D A;  1XW6 A;  5HR3 A;  3C73 A;  3TKS C;  5CAX A;  4NHZ A;  3QAW A;  4PXO A;  1MDK A;  2L5O A;  4HQZ A;  4TRX A;  4ZBD A;  4YQM A;  2F8F A;  2I1U A;  4MF5 A;  2B6M A;  3ED3 A;  4CY8 A;  2H6X A;  2K6V A;  1F37 A;  2R0G A;  2C0G A;  2VLV A;  4LLR A;  4G19 A;  3QFA C;  4MPF A;  1XWG A;  2FWH A;  2H72 A;  2RII A;  2CVK A;  5CYY A;  4IBP A;  2IMD A;  5J41 A;  4DSR A;  4Z2U A;  4NHW A;  2PVQ A;  3F8U A;  20GS A;  2OJL A;  2VCQ A;  1SL2 B;  2GQM A;  2DJ0 A;  4KW6 A;  2K9F A;  4HS1 A;  1PKW A;  2FWE A;  3KH9 A;  2OBI A;  4PQ1 A;  2C3T A;  2R37 A;  1OC9 A;  22GS A;  2LS5 A;  1J08 A;  2PER A;  4TOP A;  5B6N A;  2N5A A;  3TJG A;  4XS6 A;  3IAM 2;  4EDY A;  3P2A A;  1VF4 A;  2AJQ B;  4JRR A;  3ME8 A;  1TRV A;  1S3A A;  2PUK C;  1JZO A;  1EP8 A;  3VI7 A;  4ECB A;  4MJC A;  2I9H A;  2IMK A;  3ZYW A;  2Z9S A;  3ZVJ D;  2QC7 A;  4F9Z A;  1A8Y A;  5G30 A;  4KGI A;  3D21 A;  3UVT A;  1YF1 A;  2F8A A;  2DML A;  3WGD A;  2OE1 A;  4MCU A;  4KSO A;  1JHB A;  2R0P A;  4TXV A;  1EWX A;  2MZC A;  5D9W A;  2NVL A;  2C0D A;  4KX4 A;  1GUH A;  2H70 A;  3L4N A;  1YJ6 A;  4LMV A;  1XOA A;  4ACS A;  1YEP A;  1RQM A;  1FAA A;  3MDK A;  2JZS A;  1GTI A;  3IC4 A;  3HA9 A;  1PA3 A;  2JSZ A;  2R4V A;  1THX A;  5C04 A;  4EO3 A;  2H01 A;  3ERF A;  2LKU A;  3ZRD A;  4YQV A;  4J56 E;  1K0C A;  4IS0 A;  6GSV A;  4MPG A;  2WFC A;  3HZ8 A;  1AQV A;  1EOH A;  4N11 A;  3CTF A;  3EUR A;  2P31 A;  2ON7 A;  3DVW A;  4AJ8 A;  2MMA A;  4KH7 A;  3DGQ A;  2H74 A;  1JZR A;  2KOK A;  5DCG A;  1HQO A;  1ZL9 A;  2KLX A;  4TN8 A;  2GDR A;  1M2D A;  2EC4 A;  2G2Q A;  4FYU A;  1QUW A;  1R5P A;  5HR0 A;  2H19 A;  4NWY A;  4D73 B;  1BQ7 A;  5ECP B;  5J9C A;  2X99 A;  2LQO A;  4USS A;  1QFN A;  3KTL A;  4KA0 A;  5ID2 B;  3BBY A;  5JWO B;  1FVK A;  3OR5 A;  1TKD B;  2G0F A;  3KTB A;  3ZFL A;  2JZT A;  2ZUP A;  1V98 A;  4L0U A;  4TXO A;  4I2T A;  3VWV A;  4WEY A;  1EZK A;  3GYK A;  1A0F A;  4HOJ A;  5DDL A;  4IHU A;  2V1M A;  4O5R A;  4Z2T A;  5EPF A;  1QGV A;  3NOF A;  3ZML A;  4AGS A;  4ZXG A;  3I69 A;  1FVJ A;  5G1L A;  1WE0 A;  2LJK A;  1ON4 A;  4V2L A;  1A23 A;  2L59 A;  1Z5Y E;  2C0E A;  2E2G A;  4OCE A;  4MP4 A;  3KJY A;  1PX6 A;  4O92 A;  2F9S A;  4RI7 A;  4ZB8 A;  5DVB A;  3LW9 A;  3QCP A;  4RQR A;  2EIR A;  4JED A;  1SYR A;  1FOV A;  3I43 A;  4V1A p;  1OC9 B;  5IMZ A;  4P3Y B;  3SBC A;  1XCC A;  2HSM A;  4KE3 A;  4BVX B;  2LNS A;  1GRX A;  3D0Z A;  5B8B A;  2O87 A;  2OE0 A;  3ERG A;  2CAI A;  4POL A;  4Q5R A;  4FIW A;  4MNN A;  4PNF A;  1GUM A;  2VM1 A;  3J7Y b;  2HRA A;  2A4V A;  1SL0 B;  2YJ7 A;  1QXH A;  2FGX A;  2PGT A;  2HE3 A;  3L9U A;  3FEU A;  2CVB A;  4GQC A;  2PVO C;  2LTK A;  5EL8 A;  3RHC A;  2WZ9 A;  3MYD A;  1A2M A;  2QA2 A;  1JZD A;  1GSE A;  1GTB A;  2TIR A;  4HJ2 A;  2H30 A;  3ME7 A;  2E7P A;  4JE1 A;  4DVC A;  1ML6 A;  3WD6 A;  2YN1 A;  4MJE A;  3CRU A;  2RLI A;  3L0H A;  1GTA A;  2M46 A;  5KEJ A;  4KDU A;  2WCI A;  1BX9 A;  1J9B A;  2X4A A;  3CRT A;  4I97 A;  1VF2 A;  2B5E A;  5LNK e;  4X4J A;  3QPM A;  2FWF A;  1PSQ A;  2X8C A;  5G1K A;  3TOT A;  1TI1 A;  3F4S A;  1A2J A;  5BMU A;  6GSY A;  2QGV A;  4ZB9 A;  5FWG A;  5ECQ B;  4I2U A;  3ZL5 A;  4LA1 A;  3VWW A;  3H4K A;  4OFM A;  4OFT A;  5COH A;  4RUV A;  1M0U A;  5H5R A;  1AAZ A;  2JL4 A;  4NV5 A;  4TW5 A;  3FR9 A;  1N2A A;  3C7M A;  3KXO A;  2CV4 A;  3H79 A;  2XBQ A;  2A2R A;  4K2X A;  1V40 A;  4WR4 A;  3ZFB A;  2H0I A;  3I9V 2;  4XTS A;  2H73 A;  3BCK A;  4WKW A;  2GQK A;  5HFK A;  1EGO A;  2L6C A;  5CRD A;  4BL7 A;  1YEX A;  3W8S A;  1O7U A;  4PUA A;  5D9X A;  1TU8 A;  4G10 A;  2LRT A;  3D4T A;  1T7P B;  4FYB A;  1S3D A;  4TXO B;  4Q5N A;  3UAR A;  5DQS A;  5ECN B;  2X8H A;  2X49 A;  1ZZY A;  5F06 A;  5HQP A;  2XPE A;  5HR1 A;  4MH2 A;  3TKR A;  1GP1 A;  4QL9 A;  1T8E B;  4MK3 A;  2GSR A;  5JWQ B;  3DML A;  2HSY A;  5DAK A;  5HR2 A;  2CVD A;  4Q5F A;  2OAD A;  3A2V A;  4KCA A;  1NSW A;  1K3Y A;  1WMJ A;  2WS2 A;  2YJH A;  5GST A;  2E2M A;  1GUL A;  3EVI A;  4XIH A;  1X5D A;  2VOC A;  8GSS A;  5F8B A;  4EVM A;  3LJR A;  1R5A A;  2M80 A;  4E8H A;  4ECC A;  3F4T A;  3FRC A;  4TR3 A;  2FWG A;  1WPI A;  2R0C A;  3PR8 A;  3LWA A;  2EIQ A;  2REM A;  4NMU A;  1ERV A;  4ZB6 A;  1SJ6 A;  2GT5 A;  3HZ4 A;  3Q19 A;  1CQH A;  2DMM A;  1TP9 A;  3AY8 A;  2AAW A;  1EV4 A;  2IMI A;  2HRK A;  2GZP A;  2HNL A;  2MYG A;  2PN8 A;  3DWV A;  1RW1 A;  3F3R A;  2DSA A;  2C0F A;  3QDN A;  3SWL A;  10GS A;  3U5R E;  1FW1 A;  2AUV A;  1USB A;  2AYT A;  2C4J A;  5BRT A;  1A8L A;  3EYT A;  2HI7 A;  2VL2 A;  2KHP A;  1QK8 A;  4WR5 A;  4GRF A;  2PU9 C;  1ZMA A;  4IKH A;  4ID0 A;  1ABA A;  4L8E A;  4HDE A;  2M72 A;  1V2A A;  3GFK A;  18GS A;  2H66 A;  1GL8 A;  3APO A;  4G0L A;  4JBB A;  2YP6 A;  1V58 A;  1T3B A;  4HJM A;  3A5W A;  5ECS A;  1O6J A;  1XZO A;  3IV4 A;  4HEA 2;  3A3T A;  4EUY A;  4K7I A;  2LRC A;  4BVY A;  2LST A;  2RM5 A;  4OFN A;  3CXG A;  2H0H A;  3A5I A;  1MDJ A;  5DJL A;  3QAG A;  1XIY A;  3O3T A;  3ZTL A;  2QSI A;  3GH9 A;  3C1R A;  1NM3 A;  3BD2 A;  2VL2 C;  3FHK A;  3VLN A;  1G7E A;  3Q18 A;  5E4W A;  4N0V A;  2IWT A;  3MWH A;  4K5R A;  5D9T A;  5D96 A;  5A4W A;  2PMT A;  1T1V A;  2ALB A;  1X0R A;  5KN3 A;  4K7N A;  2J9H A;  3CBU A;  1TJD A;  2CT6 A;  2A2S A;  1XWK A;  5J9B A;  2I3Y A;  2X8G A;  2TRX A;  3R2Q A;  3TJK A;  4G9H A;  3CSI A;  1ERU A;  2KP2 A;  2H75 A;  4X1U A;  9GSS A;  4BL7 B;  2VD1 A;  2WRT A;  3G7J A;  3FZ9 A;  4DEJ A;  1SKS B;  4BVX A;  1ZCP A;  3F9U A;  4NPB A;  3UJ1 A;  1B9Y C;  4J2F A;  2NPB A;  5F0G A;  1X5C A;  4BWQ A;  4ZBB A;  1URM A;  1TK8 B;  3KMO A;  2GT6 A;  3UAP A;  4POB A;  1CQG A;  4EF0 A;  2QA1 A;  1SK1 A;  3GA4 A;  1EEM A;  4GSS A;  4OO4 A;  5C00 A;  2DJ2 A;  2C3N A;  5DAK B;  1OKD A;  7GSS A;  1A0R P;  2I81 A;  5IPG A;  1GLP A;  2VLU A;  3US3 A;  5IO0 A;  1M2B A;  3FZ4 A;  1IYH A;  4GTU A;  1B8X A;  2GSS A;  2HRN A;  1QQ2 A;  3GN3 A;  3ZVJ A;  2FA8 A;  2R6K A;  4O5Q A;  4MMM A;  2LJR A;  1B9X C;  1Q98 A;  3D4M A;  4FO5 A;  2LUS A;  3L78 A;  1M2A A;  2LJA A;  1Z7P A;  1LBK A;  4L0W A;  3RAZ A;  1XXU A;  3TDG A;  2CAQ A;  2HZE B;  1DUG A;  2K8S A;  4IEL A;  3GNJ A;  12GS A;  4WBJ A;  2WJU A;  2E0Q A;  5IOX A;  1F9M A;  2GQL A;  2H71 A;  1DE2 A;  5GAN D;  4TR4 A;  2AHE A;  4ZIJ A;  2V41 A;  1MDI A;  4HUA A;  5CRG A;  4JU5 A;  3KP9 A;  1EV9 A;  3IHG A;  3KD0 A;  5J3R A;  4O5U A;  2LNT A;  1UVZ A;  4F82 A;  4EL1 A;  4LL4 B;  4EIP A;  3ZRE A;  1Z6N A;  2VCT A;  4GCI A;  2DKI A;  4IP1 A;  1KEB A;  3FMW A;  3ZIV A;  5ELA A;  4JR4 A;  1SKW B;  1HNA A;  4IN0 A;  2JZR A;  5ECK B;  1JLW A;  3IPZ A;  4RQX A;  1O73 A;  4QL7 A;  3IOS A;  3W8J A;  2DIY A;  3ZIT A;  4IQA A;  4BPY A;  1KNG A;  2JSY A;  3RBT A;  1ILO A;  4IJI A;  1YZX A;  2JAD A;  3C1S A;  2CZ3 A;  3Q74 A;  3GV1 A;  2DKH A;  4YAP A;  3WYW A;  2NDO A;  1OVN A;  3JCM L;  3DXB A;  3DKS A;  1V9W A;  2VCW A;  3GH6 A;  4ZL7 A;  1AXD A;  3H8Q A;  2O85 A;  3G7Y A;  2H8L A;  4HZ4 A;  3EMX A;  1M99 A;  2OAC A;  1ST9 A;  5AN1 A;  4EKZ A;  2YPM A;  3K8N A;  4BVY B;  4ECI A;  3LGC A;  3DEX A;  2DJJ A;  1RK4 A;  5DCH A;  3MSZ A;  3HVS A;  1GUK A;  1G0T A;  2V2G A;  4V1A g;  3DYR A;  3FKF A;  5KOX A;  3WT2 A;  1AC1 A;  3ZIJ A;  2F51 A;  5A4U A;  1PRX A;  2N5F A;  2VCV A;  1U3A A;  2FCH A;  1AIU A;  3GKX A;  5IPH A;  5L71 A;  1TXX A;  3CSH A;  1XWA A;  2V6K A;  4OD7 A;  5ECM B;  4NAX A;  1UN2 A;  3F3Q A;  3G9B A;  5LCZ A;  1OC3 A;  4Q5Q A;  2L6D A;  1YF0 A;  1ZYP A;  3LXT A;  1A24 A;  3BJ5 A;  1BED A;  3MIX A;  2B7K A;  4YQU A;  5ELG A;  4ILF A;  4JR6 A;  1ZYQ B;  3IHQ A;  4PUR A;  4RI6 A;  4HZ2 A;  3ISO A;  5IOW A;  1M9A A;  3LFL A;  1NHY A;  4XS4 B;  5G31 A;  3N5O A;  4PQI A;  4EE0 A;  5KOW A;  2FA4 A;  2R5G A;  5ECI B;  3HXS A;  1MTC A;  1FB0 A;  1GSF A;  3GKK A;  3A2W A;  3UIW A;  3HY2 A;  1K0M A;  4MDC A;  3APS A;  5IMV A;  4MAB A;  4I8B A;  2L4Q A;  2J23 A;  2RM6 A;  4I5Q A;  3KEB A;  1OE7 A;  4ECJ A;  1O8X A;  2HRF A;  2X64 A;  3GKN A;  2PPT A;  2FLS A;  3EU3 A;  2MMO A;  4FYC A;  2H6Z A;  3KM6 A;  1LJR A;  1Z6M A;  3F4R A;  2I4A A;  4OO5 A;  4MLY A;  1K0D A;  4KDY A;  5D93 A;  4ZBA A;  2LEG A;  1LU4 A;  3GL5 A;  3E0U A;  3KH7 A;  3M0F A;  1IYI A;  4YH2 A;  4HI7 A;  3IK9 A;  1YQ1 A;  4YKG A;  1GSQ A;  2JAC A;  3TRX A;  4ML1 A;  3QAV A;  4NV2 A;  1Y6E A;  1AUC A;  4L5L A;  4MZB A;  1T4Z A;  5JCW A;  1GSU A;  1Z9H A;  5F07 A;  3UBL A;  5JWR B;  1HNC A;  3LOR A;  5J4U A;  4CY6 A;  3GX8 A;  4F03 A;  1U3I A;  3UMA A;  5AGY A;  1AQW A;  4GLT A;  1NW2 A;  4EDZ A;  1TK5 B;  3FK8 A;  3UVH A;  1SU9 A;  14GS A;  3TB2 A;  4X0X A;  1X9W B;  4KUN A;  1OAZ A;  2B3S A;  2IFQ A;  2IPA A;  1HYU A;  3P8W A;  4PNG A;  1B48 A;  6GST A;  1Z7R A;  1UA5 A;  3KCM A;  4IP6 A;  3HD5 A;  3F6F A;  1WP0 A;  5CRE A;  4ISD A;  4DSS B;  3QD9 A;  3UBK A;  1TI3 A;  4I6X A;  2GGT A;  3P7X A;  2DLX A;  1ZYE A;  2AB6 A;  3ZZX A;  5EVO A;  4O32 A;  2VM2 A;  5F05 A;  2DJ3 A;  2MMZ A;  2HLS A;  5A5K A;  3EMP A;  2IMF A;  5ECL B;  4AJ7 A;  2YWI A;  1T00 A;  5DAL B;  3RPP A;  4HU9 A;  4YKF A;  5CRW A;  5D9V A;  1YDK A;  3TOU A;  5ECR B;  1G7O A;  5CRH A;  2YV9 A;  1B4P A;  2EIO A;  2O7K A;  3IR4 A;  1FG4 A;  4MZW A;  1TRU A;  4BA7 A;  2HZE A;  4PGT A;  1XPV A;  4OCF A;  5IMD A;  4KND A;  1O85 A;  1XW5 A;  1EP7 A;  3HJO A;  5KN2 A;  4G0I A;  3U6V A;  2CZ2 A;  2ES7 A;  1K0A A;  3IRA A;  1BJX A;  2CQ9 A;  1GTU A;  2YWO A;  5J5N A;  4TR0 A;  3KZQ A;  3S9F A;  2MBS A;  2HFD A;  2H1B A;  3UEM A;  1TRW A;  4PUF C;  3DD3 A;  1A2L A;  1TTZ A;  3Q6O A;  4J57 E;  4ML6 A;  4TKY A;  2IIY A;  2ZNM A;  1TU7 A;  5AIV A;  4IGJ A;  4E8E A;  4MJA A;  1K3O A;  1UC7 A;  5IIZ A;  4MF6 A;  3GHA A;  2VCX A;  2YZH A;  1C72 A;  1R7H A;  3DVX A;  2FNO A;  2N5B A;  5E59 A;  1EOG A;  1VGL A;  3KGK A;  1SJI A;  3TJF A;  2ON5 A;  3TCO A;  3DIE A;  4Z2R A;  2MMN A;  3RDW A;  3BCI A;  3M9J A;  1JLV A;  4QQ7 A;  3E9J B;  1MD3 A;  2V32 A;  1DSB A;  3QOU A;  5GSS A;  3GKM A;  3HKR A;  1U87 A;  17GS A;  5ECH B;  5A4V A;  2BJX A;  2CX3 A;  3IBH A;  2FUG 2;  2C80 A;  2H1G A;  1XFL A;  1K0B A;  2VIM A;  4CDO A;  4K0G A;  2GVP A;  2NTO A;  5INY A;  5IMA A;  3GST A;  1N8J A;  1WOU A;  2DIZ A;  4XS1 A;  3RPN A;  3L9S A;  2L4C A;  2DJ1 A;  3TKQ A;  3GTU A;  3W6G A;  3QR6 A;  1GSY A;  1FHE A;  3C8E A;  1XVW A;  3CMI A;  1PQN A;  4KAE A;  3PIN A;  2IFQ B;  5CP1 A;  1H75 A;  1BYE A;  5IM9 A;  2VAF A;  3P90 A;  2RUF A;  3HDC A;  3BOA A;  3M9K A;  3R3E A;  2PBJ A;  1O8W A;  3IDV A;  2WGR A;  2K18 A;  3LSZ A;  1PL2 A;  4LL1 B;  1Y25 A;  1W4V A;  4XS4 A;  4AF2 A;  3LXZ A;  1E2Y A;  1K0N A;  4N10 A;  5JCU A;  4XCS A;  2GZY A;  4F2I A;  4OWY A;  2WUL A;  4HQS A;  1PMT A;  4IJ3 A;  4K1F A;  5JCG A;  1YKA A;  2AV4 A;  2OKA A;  3TGZ A;  4IVF A;  2DBC A;  5D73 A;  3VPQ A;  2LRN A;  1SYX A;  1GSD A;  2PWJ A;  3ZLP A;  3EIN A;  3CTG A;  1VF1 A;  3PPU A;  2A2P A;  5D8I A;  3VWU A;  1EGR A;  3LQ7 A;  3VWX A;  2HSH A;  2LQQ A;  1X9S B;  4Z7X A;  4KSM A;  2MBT A;  2KUC A;  1KTE A;  1SD9 A;  5IMF A;  2H1D A;  3N9J A;  1OC8 A;  3F63 A;  4K0N A;  4ZL9 A;  1NHO A;  5FT3 A;  5CO3 A;  2H1A A;  1WJK A;  1M7T A;  3MAK A;  2VUP A;  5LD0 A;  4WET A;  1PGT A;  1GNE A;  2VD0 A;  3LEF A;  1S3C A;  4KDX A;  2IJY A;  1GLQ A;  3VPT A;  3M3M A;  1WRY A;  3TJJ A;  5FHI A;  4KF9 A;  2V6O A;  1ACV A;  2HYX A;  5G2Z A;  4N30 A;  2FHE A;  4GST A;  4POK A;  1ZYN A;  4DSQ A;  4IQ1 A;  11GS A;  3D5J A;  6GSW A;  1KBN A;  2GLR A;  1FB6 A;  4O7H A;  4V2M A;  1HNB A;  5CNW A;  2YCD A;  3FR6 A;  2RUE A;  2BMX A;  2H76 A;  4K9Z A;  1QMV A;  2YWM A;  3O6T A;  3CSJ A;  2XPD A;  3LYK A;  1DBY A;  4FQU A;  3NZN A;  1M9B A;  2R2J A;  3GRX A;  1YY7 A;  4DSS A;  1W89 A;  1SKR B;  2YAN A;  4GQF A;  2VLT A;  3HCZ A;  2CX4 A;  3WT1 A;  2XHF A;  1XOB A;  3LYP A;  4XRD A;  2FD3 A;  4V2N A;  3CYN A;  3J7Y k;  4TR1 B;  3HHV A;  1AW9 A;  1V57 A;  1GWC A;  1YKC A;  3D22 A;  5AIS A;  1BG5 A;  2B7J A;  1ZOF A;  3IC8 A;  5HFG A;  5DAL A;  3VK9 A;  3EPT A;  2GZZ A;  2DC5 A;  3G7I A;  3GMF A;  1O81 A;  1MD4 A;  1VRS D;  3FY7 A;  6GSU A;  1ERW A;  2C1Y A;  3GTU B;  3TJB A;  4MZC A;  2P5Q A;  4CHS A;  5B6M A;  4PTS A;  1K0O A;  1TDI A;  4PQH A;  2NBS A;  2P5R A;  2ZCT A;  3EU4 A;  4MH3 A;  1ERT A;  5ECO B;  5IMC A;  2YWN A;  3QFB C;  3FR3 A;  3GX0 A;  4MF7 A;  3IAS 2;  3L9V A;  2GTU A;  3TRQ A;  1F2E A;  2OA7 A;  5HFI A;  2HZF A;  1JFU A;  4F0B A;  2GS3 A;  3D6I A;  1GH2 A;  2B1K A;  4EC0 A;  1H4O A;  1PD2 1;  5GZZ B;  3HJM A;  4K8M A;  3KIJ A;  2TRC P;  2VO4 A;  4POM A;  1PL1 A;  1Z3E A;  5DBQ A;  4G2E A;  4XHM A;  4WF5 A;  3TUE A;  1EEJ A;  4N0Z A;  1J0F A;  4ULX A;  5KN1 A;  3FW2 A;  3I6A A;  3HVV A;  3QMX A;  2O8V B;  3GUS A;  1HD2 A;  3H1N A;  1TOF A;  3TKP A;  6GSS A;  4WF4 A;  1K3L A;  2C8U A;  1E6B A;  4FH8 A;  4K5S A;  3HJP A;  1XW9 A;  3MNG A;  3A2X A;  1PN0 A;  3FZA A;  1PKZ A;  4HU7 A;  13GS A;  1BAY A;  4IW9 A;  4ZIL A;  3GUR A;  2F3M A;  1T4Y A;  2WB9 A;  4A5P A;  2L5L A;  2B5X A;  3EC3 A;  5B8A A;  1JZW A;  1I5G A;  5IQY A;  16GS A;  1U88 A;  1Q4J A;  2IN3 A;  5DQY A;  2IME A;  2GSQ A;  2B1L A;  2XBI A;  1FOH A;  2H0G A;  4K7O A;  4WXT A;  3WGX A;  2H6Y A;  3F6D A;  5IO2 A;  2BTO T;  5ABR A;  4F0C A;  1R26 A;  3C71 A;  2R3X A;  2YNX A;  1VF3 A;  4LMW A;  3F0I A;  5DJM A;  2VL3 A;  5EY6 A;  4ZL8 A;  1G6Y A;  1XWC A;  4OMV A;  3FZ5 A;  1F6M C;  2GST A;  3GIX A;  2YOI A;  2C3Q A;  3IA1 A;  1TK0 B;  3M8N A;  1SK0 A;  2CA8 A;  1R4W A;  1MEK A;  4GSN A;  3KP8 A;  1OYJ A;  2VL9 A;  2A4H A;  2L57 A;  1GNW A;  4AJ6 A;  3IE3 A;  4XRA A;  3DRN A;  1SD8 A;  2WDU A;  5H5Q A;  1X9M B;  1OE8 A;  3LG6 A;  5B7C A;  2P0G A;  1AQX A;  4GWR A;  2VCZ A;  4JZQ A;  2B5Y A;  3EWL A;  2LV3 A;  3HVX A;  3IK7 A;  1ZGN A;  3TKS E;  4MA9 A;  3RHB A;  3WGE A;  2KP1 A;  4KB3 A;  1THO A;  2FY6 A;  1PX7 A;  5GAP D;  1XWB A;  2DJK A;  3E3E A;  4MJB A;  4WBR D;  3APQ A;  3KMN A;  2QKE A;  1U6T A;  4GXZ A;  3V1W A;  3O76 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...