2JADA

Yellow fluorescent protein - glutaredoxin fusion protein
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
351
structure length
346
Chain Sequence
b'SKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFIVTTGKLPVPWPTLVTTFLQCFARYPDHMKRHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHCVYIVADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLCYQSALSKDPNEKRDHMVLLEFVTAAGITHGMHELYKSGSGMVSQETIKHVKDLIAENEIFVASKTYCPYSHAALNTLFEKLKVPRSKVLVLQLNDMKEGADIQAALYEINGQRTVPNIYINGKHIGGNDDLQELRETGELEELLEPIL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords YELLOW FLUORESCENT PROTEIN GLUTAREDOXIN FUSION PROTEIN
publication title Structure of Glutaredoxin Grx1P C30S Mutant from Yeast.
pubmed doi rcsb
source organism Aequorea victoria
molecule tags Electron transport
total genus 98
structure length 346
sequence length 351
ec nomenclature
pdb deposition date 2006-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00462 Glutaredoxin Glutaredoxin
A PF01353 GFP Green fluorescent protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 2jadA01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2jadA02
4PNFA 4HUAA 1BJXA 2JL4A 1QYOA 1FG4A 2LV3A 3G7IA 1S3AA 5DU0A 5DQMA 1YEPA 3TJBA 3F9UA 1JLWA 4RTCA 2ZNMA 3A5WA 3LGCA 3FR6A 3TKQA 4BL7A 1TRUA 4ZIOA 4OQWA 1GTUA 2V4EA 1XOBA 2K8VA 3KXOA 1T1VA 18GSA 3NEDA 5HQPA 2IFQA 3EMXA 5ECSA 2NTOA 3LYKA 4QL7A 1RM9A 2QT2A 4NPBA 4MZWA 5FWGA 4PUFC 2GX2A 3WCKA 1G7KA 3SG2A 1V58A 3TRPA 3V3DA 2F8AA 5DCGA 3J7Yk 1DSBA 3TB2A 2AAWA 2Y0GA 2RM6A 2RM5A 1YHGA 1XWKA 3OGOA 5ABRA 5CRGA 4CW9A 3N9JA 4W7AA 3CSJA 2IIYA 4ZB9A 4KUNA 4L12A 5AISA 3KCMA 2AV4A 3SVEA 1H4UA 2FCHA 4TXOA 5LCZA 2WGRA 5DJLA 2Z6YA 16GSA 4NXIA 3SV5A 4B5YA 3ZVJA 1FOVA 3LVDA 1SK1A 1SJIA 2KP1A 1R4WA 3KGKA 4JGEA 4HS1A 2AJQB 1V98A 1PSQA 1OAZA 4ID0A 2P5QA 3A2WA 1EMKA 3TCOA 3F4RA 3TKSE 3SBCA 4W6AA 3HZ8A 4MJAA 2O2BA 4I5QA 4HQZA 4WBJA 5A5KA 3FR9A 4W6CA 4KW9A 4POMA 2VLUA 3MWHA 4Z7XA 4MLYA 2JU5A 1KTEA 1YJ2A 2H76A 3DQMA 3DQ8A 2PERA 1SD8A 3L4NA 5DTYA 4IHUA 2VL9A 3SVUA 4NHZA 4LMVA 2LTKA 4LJCA 1Q4EA 3RBTA 3DQ4A 2RUFA 5ECHB 4LJDA 3NT9A 2FWEA 2CVBA 4BWSA 2HQZA 2HSYA 5ELGA 3DPXA 2O24A 1R7HA 4DXQA 3LVAA 3SWLA 4TOPA 5HFKA 1O8XA 2CV4A 1Z6MA 5EHUA 3VI7A 5HW9A 4EDOA 2H5PA 3UBLA 5JCGA 2DDDA 2G3OA 1WE0A 3Q74A 3VK1A 2P31A 4ZBBA 2L4CA 5JWOB 3E9JB 1BFPA 2B6MA 4IK4A 2GZYA 1F3BA 4HVFA 4TXVA 4W6OA 1XW5A 2H5QA 3UMAA 3WGXA 5IPHA 3LORA 2WRTA 1G6YA 3G9BA 3ED3A 2FWGA 4Q9WA 4F9ZA 1H6RA 3IXRA 3GL5A 1UA5A 2IE2A 4P76A 2PVOC 4OCFA 5CNWA 3ZYWA 1SYRA 3U0NA 1ERTA 4I97A 2M72A 4TKYA 1XXUA 4MP4A 2HNLA 3QD9A 1I5GA 4O32A 3S9FA 3EC3A 5IIZA 4GF6B 4KNDA 5IPGA 5F0GA 1Q4AA 2DUHA 5LTRA 3DQ1A 4TW5A 4JRBA 2VCTA 2YWMA 2H74A 5A4WA 4ZF5A 2DUIA 3DKSA 2AWMA 3L9VA 1YF0A 1M2BA 3ZFLA 5DPGA 1ZGQA 3H1NA 3WT2A 1KYPA 1CV7A 1O8WA 2GDRA 4KDUA 4CDOA 3LF4B 4PPKA 4H3LA 1T4YA 5IMVA 5J41A 4KGEA 1ABAA 1XWBA 3APSA 3IR4A 1YEXA 20GSA 3EKHA 4XRDA 1JHBA 1YHIA 3D4MA 5J9CA 1THOA 3QAVA 2IPAA 2FWFA 3F6FA 2YJHA 2XBQA 2B3QA 3ZTFA 2DDCA 2VL2A 4EO3A 2HPWA 5D93A 3H4KA 5A4UA 2C3QA 1Y25A 3QR6A 2JACA 1CQGA 1YQ1A 2VD1A 3N5OA 4JEDA 5DPJA 1Q4DA 2A53B 5H89A 1H75A 4JR4A 1YKCA 2R2JA 3ME7A 5JCWA 1JC0A 4GESB 3A2XA 1GH2A 1Y6EA 2OJLA 1RRXA 1R26A 3ZUFA 4HU9A 2LSTA 3DQOA 4JEOA 4KA9A 3TUEA 2LUSA 2QKEA 3F4TA 1C4FA 4HE4A 1JZWA 2A2RA 5G2ZA 3CRTA 1XVQA 1ZGNA 5EXCI 4Q5FA 2O85A 2ZO6A 3EKJA 1XCCA 1YZXA 3SS0A 1FB0A 1SL2B 2DC5A 1Z9HA 5B7CA 4XHMA 2OACA 4IP1A 3IE3A 3M9JA 1Q4BA 2DSAA 4AJ6A 5HZOA 5BTTB 2DUGA 1GSDA 2CVDA 2VO4A 3IA1A 2G6EA 3KCSA 1KNGA 1OKDA 1A24A 3NF0A 3SG6A 1A23A 2EC4A 4W6NA 4K6XA 1BG5A 4AJ7A 5LNKe 2V32A 3F0IA 5DQBA 4KW4A 5B6MA 1BQ7A 3CSIA 3LWAA 2B5YA 2B5EA 2E0QA 5G5EA 1OC9A 4L5OA 4DKMA 3BCKA 10GSA 1X5DA 3DQFA 1GFLA 4WR4A 3GJ2A 2DJ2A 4W7FA 1M2DA 3WT1A 3DXBA 3GX8A 2HZEA 2YE1A 3SVRA 2GW4B 5ECLB 5B8BA 4AJ8A 3F3RA 5CP1A 5DAKA 5COHA 4W6PA 1EP8A 2Z6ZA 3FZ9A 2QGVA 3EE2A 3Q6OA 2AHEA 4E8EA 4EULA 4W6RA 4V2LA 3HHVA 5IM9A 5IQYA 3DQNA 4IK3A 3RPPA 1ZZYA 2FUG2 2O29A 2PWJA 4K2DA 4EDSA 3ZULA 1A8YA 1HNCA 4DXMA 2PUKC 2YWOA 2FA8A 3ED8A 4DSRA 3V1WA 4WR5A 5INYA 5AIXA 1VF2A 2YZHA 2F8FA 1XZOA 1ZUXA 4FO5A 5D9XA 2FD3A 3VK9A 2HI7A 1BAYA 3G7JA 4YAVA 3KTBA 5DALB 4PQHA 5ID2B 4NMUA 3ST3A 3KMOA 3K1KA 1URMA 2TRCP 5LK4A 8GSSA 3GHAA 4YQUA 3ZIJA 5GAPD 4HQSA 4W6KA 2HFDA 2H1DA 2MZCA 2YP6A 3GTUA 3IK7A 1HQOA 2WIQA 2C4JA 1EZKA 3GURA 1GL4A 2I9HA 3PR8A 5AGYA 1RMMA 1X9MB 5AN1A 3C73A 2A4VA 3ZIVA 5J3RA 3HJPA 2ARLA 3DQKA 3GJ1A 1M7TA 2H9WA 3M24A 3UL3A 1XWGA 1TI1A 2YV7A 3DYRA 2H8LA 1Z1QA 1TTZA 1M9AA 3ST4A 1EEJA 4TN8A 3HVVA 3SVBA 1K3LA 3IAS2 5FHIA 1MDIA 3SG7A 4GRFA 5DBQA 1SKWB 2CT6A 3WLDA 2AUVA 1B9YC 3H8QA 4XS4B 4WF5A 4N0ZA 5JWRB 5HBDA 4TVEA 2TIRA 1K0MA 1ZGOA 5CRWA 1WIKA 5HR1A 4OY4A 2LQOA 5AQBB 5KTGA 2Q57A 4ECCA 1QGVA 2FY6A 1MD3A 2Z9SA 4WXTA 3DQAA 2WCIA 3P8WA 1O73A 2YANA 2R4VA 2LJAA 4MABA 1K0AA 1JFUA 2G16B 3DQ2A 5H5QA 4J57E 3O77A 2M46A 4B30B 5DJMA 4IJ3A 5ECIB 3M1GA 1YHHA 4HZ2A 3UVHA 3SVCA 1FVKA 4LLRA 4JRRA 1O6JA 1ZCPA 5GZZB 3L9UA 5D96A 5IOXA 3LVCA 14GSA 2LNSA 2R6KA 2I81A 1XQMA 4K7IA 3VWVA 3A3TA 3GH6A 3O6TA 1FO5A 3MGFA 5IO0A 2WJUA 2OKAA 2EIOA 4ZINA 4V1Ag 2RLIA 2H6YA 2YDZA 1X5EA 2GW3A 3R2QA 2HCGA 2IN3A 4EUYA 1W7UA 17GSA 2I1UA 5DVBA 1PL1A 3DQUA 5G1LA 3FZ5A 1SENA 4BVXA 3IAM2 1B9XC 5ENUA 1E2YA 4RYWA 4O5RA 1B9CA 1J08A 2M80A 3KP8A 1MYWA 3IRAA 4IS0A 1ZL9A 2PXWA 4IKHA 5IMAA 3K8NA 3WGEA 1YY7A 3GL3A 2GSQA 2ON7A 2HYXA 4W6JA 3CFAA 2H1BA 5G1KA 3PGTA 3H1OA 3PJ5A 4ORNA 1FAAA 2OKYA 2FL1A 1F9MA 4HQCA 4OD7A 3SSLA 3FK8A 1XBSA 3MNGA 1GUMA 1F37A 3F63A 3UARA 2LRTA 3PIBA 3FW2A 3GSSA 1YFPA 4IK9A 1ERWA 5DTLA 2OTBA 2G6XA 1VF1A 4RUVA 4GCIA 3E5WA 2WDUA 5IMZA 3UOMA 4KW6A 3I69A 2JZTA 3U8CA 1TI3A 5D9VA 3CTFA 1EGOA 1GULA 2VAEA 4W7XA 2VCQA 5ECNB 1BEDA 1S3CA 4MH2A 5HZSA 3RWTA 3RPNA 2EMNA 3DQ3A 2A54B 1XWAA 1K0BA 3MDKA 4W6IA 2RIIA 1PRXA 1UN2A 5F05A 2H1AA 2L6CA 4V2MA 3P2AA 1RK4A 3SVNA 1AC1A 3FYGA 1K3YA 4UTSA 1EOGA 2F3MA 3W8SA 3DQ9A 2F9SA 4DXNA 2CZ2A 2XPDA 1K0DA 4ANJA 2GTUA 2TRXA 1JZDA 1ON4A 3AI4A 3ZFBA 3C1SA 3HJMA 4I6XA 4CHSA 3DQEA 1HCJA 4KGFA 4KE3A 4V2NA 3VLNA 5ECQB 2K18A 2DJ1A 2CZ3A 2LS5A 3DMLA 1GSFA 1M9BA 1XOAA 2WHSA 1GL8A 2GQMA 1JBZA 5KEJA 4EXJA 1T00A 2GSRA 4XS6A 1XW6A 2ZO7A 3UIWA 19GSA 2OTEA 2J23A 4NWSA 2GX0A 2YNXA 1OC3A 4YQVA 4F82A 2IMKA 4GXZA 4POBA 2A47A 4EDZA 1K3OA 2HRFA 3GUSA 4JBBA 4DXOA 1EP7A 5H88A 2FLSA 3M22A 3CBUA 4QQ7A 3KP9A 1GLPA 3HY2A 3GYKA 4IGJA 1QXHA 3CFFA 4IP6A 1M99A 3NT3A 4KCAA 4OHSA 3ZVJD 2VCZA 2FA4A 2WISA 3DPZA 5B8AA 5CRDA 2X99A 3KH7A 1U3AA 1UVZA 4KEXA 5JWQB 5EB6A 1TU7A 3I19A 1VF4A 1EEMA 3VWXA 4MMMA 3CFHA 3TOTA 1OYJA 2FGXA 1HNAA 1W7SA 4TR3A 1GGXA 2V6OA 4IZNA 4DEJA 4GTUA 3ERGA 1ZGPA 5DQSA 2VADA 3DQ6A 5EB7A 2QU1A 2C0GA 4OGSA 2MYGA 1QMVA 3SG5A 1XFLA 1X9SB 3FR3A 1V40A 1TK0B 2HQKA 2H6ZA 1OE7A 1EGRA 3D22A 3W6GA 3GL4A 1JZRA 3SRYA 2ALBA 1XSSA 4LL1B 5DPIA 1PD21 2O87A 2P0GA 2I4AA 5HFGA 2XC2A 2HE3A 3EYTA 2H01A 2HLSA 3G7YA 5EY6A 5IO2A 3GA4A 1IYHA 9GSSA 1E6BA 2BTOT 4ECIA 1EMMA 2PU9C 4W6FA 2KLXA 1EOHA 5BTTA 2VVHA 4HQ9A 3UVTA 3QCPA 5GSTA 3GX0A 3Q18A 3P90A 2AYTA 3EK4A 2GQLA 4IQ1A 1TOFA 4LQTA 2V41A 2WFCA 1THXA 2GSTA 4W6SA 4YQMA 4X0XA 2O89A 1ZYQB 3DQHA 1OKTA 2LJKA 1XPVA 3IP2A 4N3DA 3WGDA 3P7XA 1WP0A 1EWXA 4XL5A 2B5XA 2AWLA 4W74A 3AY8A 2GVPA 4MJEA 4PURA 4ZILA 1GSSA 2D2ZA 3DEXA 2B7JA 3L9SA 1RQMA 1B8XA 4MPGA 2CAQA 3U0MA 2PMTA 4W6BA 1XWCA 4ML1A 4TRXA 2RUEA 2G5ZB 3GSTA 1LBKA 2LRNA 3IOSA 1Z5YE 4DSSB 2WSNA 2YV9A 5HR3A 2NPBA 2DJ0A 3GMFA 4Z4MA 4LW5A 2F51A 4Q5QA 5H5SA 3WD6A 2R37A 1TRVA 3GEXA 3HDCA 2VZXA 4L1IA 2H71A 4JC2A 3KJYA 5AIVA 3M8NA 3D4TA 5H5RA 1ILOA 4PNGA 2AWKA 2YJ7A 3HKRA 4L13A 6GSUA 2HRNA 1V2AA 3A8SA 3APOA 3TKRA 2K9FA 3GB3A 1XW9A 2L4QA 2P4MA 2DBCA 3F3QA 2H19A 2REMA 5DALA 2H6XA 4MF7A 2GQKA 3ZTLA 4ACSA 4EKZA 2WHTA 3KMNA 1F0BA 2KUCA 1NSWA 5IMDA 2O7KA 3UG0A 4MZCA 3F8UA 4LL4B 1X0RA 4MCUA 4HOJA 3TGZA 5FT3A 2A2SA 3U6VA 3O76A 5LD0A 5E4WA 4Q7UA 2FHEA 3WYWA 2H0GA 4K7OA 1GSYA 3H93A 5FVFA 2B1LA 4G10A 4JU5A 4KA0A 1OVNA 1J0FA 1WMJA 2QLHA 2A50B 1GSUA 5D9TA 3CTGA 1EMLA 4TR0A 1U88A 1QY3A 3IHQA 1PQNA 2E2GA 5ECMB 3FEUA 2ZUPA 4PX1A 1SD9A 2Z6XA 1QQ2A 1Z3EA 1EMFA 3GKKA 2B1KA 4EC0A 1EV4A 2GZZA 2HZFA 4KB3A 3ADFA 2Z1OA 4OFTA 1K0NA 4LJBA 5CREA 1WRYA 4XS4A 4EMQA 4EVMA 4WKWA 4J56E 4ISDA 3KH9A 1KBNA 4EL1A 2C3NA 1Q73A 1TRWA 4GOBA 1R5AA 4HDEA 3J7Yb 1ST9A 3TJKA 4TZGA 1HYUA 3CBEA 2MMZA 2A52B 5ECPB 2ZMUA 1MDKA 2IOVA 1SJZA 3TJFA 3ZREA 1GSEA 2IB6A 2FWQA 4XIHA 4W6LA 1HUYA 2IMIA 1YJ6A 4ULXA 4YAPA 1QYQA 2B3SA 3IK9A 4EE0A 5KN2A 4PPJA 22GSA 2H73A 4MF6A 1U87A 3BX9A 1OXDA 2G2SB 1NHOA 4N11A 3W1DA 1W7TA 5F8BA 2QLEA 5BQLA 3QFBC 1CQHA 3RDWA 2DMMA 2X8HA 1GP1A 4ZBAA 2KOKA 4GLTA 3KEBA 4RI7A 4IW9A 1AQWA 3E3EA 2DJ3A 3TJJA 3FRCA 2H8QA 1AUCA 3HYPA 4FH8A 1U6TA 4L0UA 5EJUA 1GNEA 1XVWA 4MA9A 1T7PB 2CVKA 3FKFA 2X8GA 1MOUA 4FIWA 2DMLA 2V1MA 3KZQA 3UBKA 1X9WB 3LA1A 2LJRA 3ERFA 5CAXA 4Z4KA 1A2MA 3LFLA 3EU4A 3BCIA 3TKSC 5DCHA 2QLGB 2H5RA 4IK1A 4J8AA 5HGEA 3SSTA 5F06A 4KF5C 3DQCA 3AI5A 4P1QA 3SVDA 1QFNA 2POXA 3FZAA 1VGLA 1NHYA 2B3PA 3VPQA 3F4SA 3AKOA 3LXTA 1SU9A 5F07A 2LKUA 2OKWA 2VAFA 1AQXA 3LG6A 3JCML 2ON5A 2IWTA 3P28A 1DUGA 2GT6A 2H75A 1K0OA 3I43A 2YE0A 1KEBA 2IMDA 2E7PA 4MK3A 1ERVA 2GT5A 4H3NA 5ECRB 4IBPA 2CQ9A 1OC8A 1YZWA 5KN3A 2GGTA 3ERWA 2AB6A 3DQJA 4AR7A 1A2LA 2DIYA 3TMRA 3PINA 4W73A 1G6WA 4ZB1A 1KP5A 1XIYA 2VM1A 3US3A 5DY6A 1VF3A 3LEFA 2VM2A 4RI6A 1XMZA 1SKSB 4P3YB 3TRXA 2K8SA 1ZOFA 2HGDA 4W76A 3SSVA 3F6DA 3TMTA 2YN1A 3CRUA 4POKA 5D8IA 2YWIA 1TKDB 3ST0A 4HEA2 2KHPA 3S05A 1B48A 3D0ZA 3BOAA 4FYCA 3PJBA 4OO4A 2I3YA 3DQDA 4DVCA 2WB9A 2HT9A 3HZ4A 2HFCA 3IDVA 2QC7A 3CB9A 4WETA 2NBSA 5FVGA 5A4VA 5G30A 5HR2A 2PXSA 1XA9A 3CMIA 3A2VA 3DRNA 4W7CA 5D9WA 3IC4A 3ZITA 1W89A 2QLIA 5HFIA 3KTLA 3U0LA 1YDKA 3VWWA 3EU3A 2YZUA 1TK8B 4MPFA 1V9WA 2H6VA 2NDOA 3GTUB 2ZMWA 1SL0B 5EBJA 2VD0A 3DQIA 3QOUA 1JLVA 4D73B 5IMCA 2IMEA 4W77A 3U8AA 4FYBA 2X64A 5DDLA 2DJJA 2VCWA 1GWCA 4IN0A 1Q4JA 4TR1B 2AWJA 3LF3A 4QL9A 5DTXA 1QUWA 4IQAA 5HR0A 4AS8A 3QDNA 3TKPA 4XRAA 5DTZA 2C3TA 1J9BA 1TXXA 3SG3A 5L71A 5ECOB 4EF0A 1OXFA 1G7OA 3ZLPA 3GH9A 6GSVA 3DQ5A 3DPWA 3DVXA 3ME8A 5EPFA 5KN1A 1GSQA 2CA8A 2GLRA 5J9BA 1NM3A 4K9ZA 4ZFSA 3VHTB 1AIUA 2HGYA 12GSA 2ZCTA 3HD5A 4GQCA 3CYNA 3EK8A 2JZRA 2DIZA 2EIRA 2XHFA 4K0GA 4ZL9A 6GSSA 1NW2A 1JZOA 4ZL7A 3C7MA 1IYIA 4L8EA 3VPTA 3OR5A 3IPZA 2NVLA 2P5RA 1HNBA 4KSOA 3W8JA 3IR8A 1PMTA 3DWVA 1AXDA 3M3MA 4KDXA 3H79A 1JC1A 1C72A 3CXGA 3SVSA 4N30A 3BBYA 3SSYA 4MDCA 3SG4A 2L5LA 4LA1A 4XS1A 4W6HA 1F6MC 4IK5A 1GLQA 2DUEA 4X1UA 3RAZA 4NAXA 1RW1A 6GSXA 4XCSA 3EK7A 1FVJA 4KSMA 3LS3A 4ML6A 4BPYA 1WOUA 3I9V2 2H1GA 1B4QA 4O7HA 3LQ7A 5D73A 4KF4A 2OADA 2VLTA 6GSTA 3ISOA 4OJ0A 4L5LA 4PUAA 2PPTA 1XAEA 4OFNA 2C8UA 3O78A 2OBKA 3EURA 4PGTA 3C8EA 3SSHA 3PH9A 4GWRA 4V1Ap 4ZXGA 4K0NA 2QRFA 3O3TA 4OWYA 2C80A 2C9IA 5C00A 4ZF4A 4HJMA 1PKWA 3CGLA 4IJIA 3I6AA 2IB5A 1WWJA 4KGIA 1WJKA 1SK0A 3M9KA 1DE2A 2RH7A 3GIXA 3TRQA 4PPLA 5DPHA 3HXSA 2V2GA 1SKRB 2DJKA 4XOWA 1TP9A 2DD7A 2B7KA 4KDYA 2WHUA 2V4EB 3LSZA 1RMOA 5BT0A 4K1FA 2H5OA 5HZUA 1F09A 2IFQB 4DSSA 3BXAA 1FB6A 2BJXA 1M2AA 3RWAA 11GSA 3SSPA 2HRSA 4Q7TA 5CO3A 4IELA 2G6YA 2XPEA 1A0RP 3BXCA 2CX4A 3UJ1A 2GS3A 1HD2A 2QZ0A 1H4OA 4KW8A 4I2TA 1GRXA 4W6MA 2YOIA 5B6NA 3GV1A 1MTCA 3FZ4A 4HJ2A 3L0HA 4HU7A 3DQ7A 1BX9A 2JZSA 4WEYA 3OSQA 4KPIA 3HJOA 4TZAA 3SVOA 2C0DA 2KP2A 5H87A 3UFZA 6GSYA 1JBYA 4TXOB 2VCXA 3GKXA 1A2JA 3U5RE 2LEGA 3APQA 4GSNA 3P8UA 2V4EC 3KM6A 4W69A 1SYXA 3RHCA 1QXTA 4F2IA 4ECJA 1MDJA 5DQYA 5F9GA 5T3IA 3GKMA 1TK5B 3IV4A 2OBIA 1FHEA 2A46A 4WBRD 4ZL8A 5C04A 1KYRA 3E5TA 5FVIA 1N8JA 5FHVA 2QSIA 3W1CA 3D6IA 1FW1A 2WURA 1G0TA 1A0FA 4G19A 2R3XA 3VICA 3UEMA 4MZBA 1QK8A 4OCEA 6GSWA 4ZB8A 1EMBA 1S3DA 2LQQA 1DE1A 4DKNA 3LJRA 3NEZA 2IJYA 1TW9A 1S6ZA 2OA7A 1TU8A 4PQIA 2WS2A 4IVFA 5EL8A 4PFEA 4Q5NA 1AAZA 2L57A 3TKSA 3QMXA 1ZYEA 2A48A 3DD3A 1TDIA 2IMFA 2H30A 3OSRA 4RQXA 2Q6PA 4KF5A 2DD9A 3MAKA 4HQ8A 1EMGA 3HVSA 1LJRA 1EMEA 1W4VA 4ECBA 3CD9A 7GSSA 1K0CA 4GSTA 1V57A 1I9DA 2IL3A 3HA9A 2BTJA 4BDUA 3IBHA 2N5AA 3CSHA 4H3MA 1R5PA 1PX7A 4W7DA 2ES7A 5ID2A 3DQLA 4O92A 4MH3A 3DGQA 1U3IA 1SL1B 4ZBDA 2N5BA 3QAGA 2CAIA 1PGTA 3LYPA 3ST2A 4H86A 4J88A 4OO5A 2N5FA 3Q19A 4XGYA 2OE1A 4KAEA 1T4ZA 1PKZA 1UISA 2OJKA 4W6GA 1USBA 1QYFA 1ZMAA 3E5VA 3RHBA 4BWQA 1T3BA 4LJDC 1LU4A 3EINA 4MJBA 1UC7A 4RYSA 3MSZA 1Q4CA 2QLGA 1MD4A 4ZIJA 3EVIA 2MBSA 4E8HA 4W6TA 2YPMA 2C0FA 4XOVA 2PBJA 2VIMA 4X43A 4Q7RA 2VL3A 2C0EA 2HSHA 4NV5A 4AF2A 2MBTA 2JSYA 3TDGA 4K8MA 1EMAA 4NHWA 4GQFA 4OFMA 2DLXA 3CD1A 1Z6NA 2EMDA 5ELAA 2YFPA 2VVIA 1X5CA 4FYUA 1KYSA 1PA3A 2YCDA 2VOCA 4XVPA 1PN9A 4J89A 1MOVA 4W7RA 13GSA 4PQ1A 5G31A 3FY7A 3NIVA 4KCEA 4GSSA 4F0BA 3LXZA 3VWUA 3WLCA 1VRSD 2EIQA 3VI5A 3ZMKA 1TJDA 4ZB6A 4Q9XA 3G9AA 2V6KA 3C71A 5DRGA 4G9HA 2R5GA 2L59A 4H48A 4HZ4A 2L6DA 2PGTA 4ZF3A 3L78A 4I2UA 4W72A 5CYYA 5CRHA 4B30A 5JCUA 1PL2A 5IOWA 5J2OA 3ZUJA 2JADA 2H66A 4TR4A 2HJOA 1GTBA 4IK8A 1Z7PA 1M0UA 2CX3A 3ZZXA 2OE3A 2K6VA 3EWLA 3TOUA 2O8VB 4J2FA 3NZNA 2VLVA 1MEKA 4POLA 3KIJA 2WULA 2G0FA 2G3DB 5ECKB 4LQUA 1YKAA 1T8EB 5J4UA 2DUFA 2C1YA 5HZTA 1ACVA 1N2AA 4R6BA 3GNJA 2OE0A 3HCZA 4DSQA 1G7EA 3NOFA 1SJ6A 2H72A 2JSZA 4JF9A 3UAPA 3KCTA 4JFGA 2H70A 2H0HA 1AW9A 2MMAA 4LMWA 3EVVA 2L5OA 3ZL5A 2FNOA 5LTQA 2YWNA 2HXKA 2MMNA 2J9HA 2VUPA 3HVXA 3C1RA 3GRXA 4NWYA 4D73A 3VFIA 4F0CA 3EVUA 4W7EA 2AH8A 3ZRDA 2VCVA 5GSSA 4ZBLA 4KH7A 3TJGA 2VL2C 4MJCA 2WZ9A 4TR1A 4K7NA 5GAND 3BD2A 3QAWA 1GUHA 4EDYA 1OC9B 2MMOA 3U8PA 3BJ5A 3GKNA 4KX4A 2G2QA 4YH2A 2C9JA 1DBYA 1OXEA 4I2YA 3H1RA 1ERUA 1PX6A 5EXUA 4W75A 2HZEB 3GFKA 4GF0A 1GTIA 4JZQA 4F03A 3VHTA 5DAKB 4I8BA 1Z7RA 4OMVA 1F2EA 4ILFA 3LSAA 4WF4A 4PXOA 3BXBA 5EXBA 5J5NA 4XTSA 3GN3A 2AHAA 3PJ7A 4BA7A 1O85A 3VURA 3U0KA 4AGSA 5KN0A 2LNTA 1YF1A 3ZMLA 3QPMA 4L0WA 5IMFA 1TRSA 5EVOA 1YJFA 2OGRA 1ML6A 1BYEA 1AQVA 4RQRA 1GTAA 4KAGA 1O7UA 3DIEA 2XBIA 2X8CA 4Q5RA 4G2EA 4R6DA 1Q98A 3M0FA 5E59A 4BVYA 2FWHA 3KD0A 2H0IA 2E2MA 2PVQA 3QFAC 1O81A 3D5JA 1GNWA 5DRFA 1WPIA 4NV2A 4DXPA 4JE1A 1SK2A 3DVWA 1B4PA 2ICRA 4N10A 1A8LA 1OE8A 5G5FA 4W6UA 4MF5A 2GSSA 1F3AA 2FZUA 1EMCA 4W6DA 1EV9A 4U2VA 3E0UA 4N0VA 2GZPA 3FHKA 1GUKA 2LRCA 3EVPA 2WSOA 2PN8A 2A56B 5LTPA 1Z1PA 3D21A 3EVRA 4DXIA 2BMXA 1RMPA 4JR6A 2EMOA 3SSKA 4H47A 4HI7A 2VVJA 4EN1A 3EMPA
chains in the Genus database with same CATH superfamily
4PNFA 4HUAA 1BJXA 2JL4A 1QYOA 1FG4A 2LV3A 3G7IA 1S3AA 5DU0A 5DQMA 1YEPA 3TJBA 3F9UA 1JLWA 4RTCA 2ZNMA 3A5WA 3LGCA 3FR6A 3TKQA 4BL7A 1TRUA 4ZIOA 4OQWA 1GTUA 2V4EA 1XOBA 2K8VA 3KXOA 1T1VA 18GSA 3NEDA 5HQPA 2IFQA 3EMXA 5ECSA 2NTOA 3LYKA 4QL7A 1RM9A 2QT2A 4NPBA 4MZWA 5FWGA 4PUFC 2GX2A 4CY8A 3WCKA 1G7KA 3SG2A 1V58A 3TRPA 3V3DA 2F8AA 5DCGA 4O5UA 3J7Yk 1DSBA 3TB2A 2AAWA 2Y0GA 2RM6A 2RM5A 1YHGA 1XWKA 3OGOA 5ABRA 5CRGA 4CW9A 3N9JA 4W7AA 3CSJA 2IIYA 4ZB9A 4KUNA 4L12A 5AISA 3KCMA 2AV4A 3SVEA 1H4UA 2FCHA 4TXOA 5LCZA 4BVXB 1XG8A 2WGRA 5DJLA 2Z6YA 16GSA 4NXIA 3SV5A 4B5YA 3ZVJA 1FOVA 3LVDA 1SK1A 1SJIA 2KP1A 1R4WA 2A4HA 3KGKA 4JGEA 4HS1A 2AJQB 1V98A 1PSQA 1OAZA 4ID0A 2P5QA 3A2WA 1EMKA 3TCOA 3F4RA 3TKSE 3SBCA 4W6AA 3HZ8A 4MJAA 2O2BA 4I5QA 4HQZA 4WBJA 5A5KA 3FR9A 4W6CA 4KW9A 4POMA 2VLUA 3MWHA 4Z7XA 4MLYA 2JU5A 1KTEA 1YJ2A 2H76A 3DQMA 3DQ8A 2PERA 1SD8A 3L4NA 5DTYA 4IHUA 2VL9A 3FMWA 3SVUA 4K5SA 4NHZA 4LMVA 2LTKA 4LJCA 1Q4EA 3RBTA 3DQ4A 2RUFA 5ECHB 4LJDA 3NT9A 2FWEA 2CVBA 4BWSA 2HQZA 2HSYA 5ELGA 3DPXA 2O24A 1R7HA 4DXQA 3LVAA 3SWLA 4TOPA 5HFKA 1O8XA 2CV4A 1Z6MA 5EHUA 4G0KA 3VI7A 5HW9A 4EDOA 2H5PA 3UBLA 5JCGA 2DDDA 2G3OA 1WE0A 3Q74A 2X4AA 3VK1A 2P31A 4ZBBA 2L4CA 5JWOB 3E9JB 1BFPA 2B6MA 4IK4A 2GZYA 1F3BA 4HVFA 4TXVA 4W6OA 1XW5A 2H5QA 3UMAA 3WGXA 5IPHA 3LORA 2WRTA 1G6YA 3G9BA 3MYDA 3ED3A 2FWGA 4Q9WA 4F9ZA 1H6RA 3IXRA 3GL5A 1UA5A 2IE2A 4P76A 2PVOC 4OCFA 5CNWA 3ZYWA 1SYRA 3U0NA 1ERTA 4G0IA 4I97A 2M72A 4TKYA 1XXUA 4MP4A 2HNLA 3QD9A 1I5GA 4O32A 3S9FA 3EC3A 5IIZA 4GF6B 4KNDA 5IPGA 5F0GA 1Q4AA 2DUHA 5LTRA 3DQ1A 4TW5A 4JRBA 2VCTA 2YWMA 2H74A 5A4WA 4ZF5A 2DUIA 3DKSA 2AWMA 3L9VA 1YF0A 5KOXA 1M2BA 3ZFLA 5DPGA 1ZGQA 3H1NA 3WT2A 1KYPA 1CV7A 1O8WA 2GDRA 4KDUA 4CDOA 3LF4B 4PPKA 4H3LA 1T4YA 5IMVA 5J41A 4KGEA 1ABAA 1XWBA 3APSA 3IR4A 1YEXA 20GSA 3EKHA 4XRDA 1JHBA 1YHIA 3D4MA 5J9CA 1THOA 3QAVA 2IPAA 2FWFA 3F6FA 2YJHA 2XBQA 2B3QA 3ZTFA 2DDCA 2VL2A 4EO3A 2HPWA 5D93A 2X49A 3H4KA 5A4UA 2C3QA 1Y25A 3QR6A 2JACA 1CQGA 1YQ1A 2VD1A 3N5OA 4JEDA 5DPJA 1Q4DA 2HRKA 2A53B 5H89A 1H75A 4JR4A 1YKCA 2R2JA 3ME7A 5JCWA 1JC0A 4GESB 3A2XA 1GH2A 1Y6EA 2OJLA 1RRXA 1R26A 3ZUFA 4HU9A 2LSTA 3DQOA 4JEOA 4KA9A 3TUEA 2LUSA 2QKEA 3F4TA 1C4FA 4HE4A 1JZWA 2A2RA 5G2ZA 3CRTA 1XVQA 1ZGNA 5EXCI 4Q5FA 2O85A 2ZO6A 3EKJA 1XCCA 1YZXA 3SS0A 1FB0A 1SL2B 2DC5A 1Z9HA 5B7CA 4XHMA 2OACA 4IP1A 3IE3A 3M9JA 1Q4BA 2DSAA 4EIQA 4AJ6A 5HZOA 5BTTB 2DUGA 1GSDA 2CVDA 2VO4A 3IA1A 2G6EA 3KCSA 1KNGA 1OKDA 1A24A 3NF0A 3SG6A 1A23A 2EC4A 4W6NA 4K6XA 5BMUA 1BG5A 4AJ7A 5LNKe 2V32A 3F0IA 5DQBA 4KW4A 5B6MA 1BQ7A 3CSIA 3LWAA 2B5YA 2B5EA 2E0QA 5G5EA 1OC9A 4L5OA 4DKMA 3BCKA 10GSA 1X5DA 3DQFA 1GFLA 4WR4A 3GJ2A 4O5QA 2DJ2A 4W7FA 1M2DA 3WT1A 3DXBA 3GX8A 2HZEA 2YE1A 3SVRA 2GW4B 5ECLB 5B8BA 4AJ8A 3F3RA 5CP1A 5DAKA 5COHA 4W6PA 1EP8A 2Z6ZA 3FZ9A 2QGVA 3EE2A 3Q6OA 2AHEA 4E8EA 4EULA 4W6RA 4V2LA 3HHVA 5IM9A 5IQYA 3DQNA 1FOHA 4IK3A 3RPPA 1ZZYA 2FUG2 2O29A 2PWJA 4K2DA 4EDSA 3ZULA 1A8YA 1HNCA 4DXMA 2PUKC 2YWOA 2FA8A 3ED8A 4DSRA 3V1WA 4WR5A 5INYA 5AIXA 1VF2A 2YZHA 2F8FA 1XZOA 1ZUXA 4FO5A 5D9XA 2FD3A 3VK9A 2HI7A 1BAYA 3G7JA 4YAVA 3KTBA 5DALB 4PQHA 5ID2B 4NMUA 3ST3A 3KMOA 3K1KA 1URMA 2TRCP 5LK4A 4Z2UA 8GSSA 3GHAA 4YQUA 3ZIJA 5GAPD 4HQSA 4W6KA 2HFDA 2H1DA 2MZCA 2YP6A 3GTUA 3IK7A 1HQOA 2WIQA 2C4JA 1EZKA 3GURA 1GL4A 2I9HA 3PR8A 5AGYA 1RMMA 1X9MB 5AN1A 3C73A 2A4VA 3ZIVA 5J3RA 3HJPA 2ARLA 3DQKA 3GJ1A 1M7TA 2H9WA 3M24A 3UL3A 4CY6A 1XWGA 1TI1A 2YV7A 3DYRA 2H8LA 1Z1QA 1TTZA 1M9AA 3ST4A 1EEJA 4TN8A 3HVVA 3SVBA 1K3LA 3IAS2 5FHIA 1MDIA 3SG7A 4GRFA 5DBQA 1SKWB 2CT6A 3WLDA 2AUVA 1B9YC 3H8QA 4XS4B 4WF5A 4N0ZA 5JWRB 5HBDA 4TVEA 2TIRA 4KF9A 1K0MA 1ZGOA 5CRWA 1WIKA 5HR1A 4OY4A 2LQOA 5AQBB 5KTGA 2Q57A 4ECCA 1QGVA 2FY6A 1MD3A 2Z9SA 4WXTA 3DQAA 2WCIA 3P8WA 1O73A 2YANA 2R4VA 2LJAA 4MABA 1K0AA 1JFUA 2G16B 3DQ2A 5H5QA 4J57E 3O77A 2M46A 4B30B 5DJMA 4IJ3A 5ECIB 3M1GA 1YHHA 4HZ2A 3UVHA 3SVCA 1FVKA 4LLRA 4JRRA 1O6JA 1ZCPA 5GZZB 3L9UA 5D96A 5IOXA 3LVCA 14GSA 2LNSA 2R6KA 2I81A 1XQMA 4K7IA 3VWVA 3A3TA 3GH6A 3O6TA 1FO5A 3MGFA 5IO0A 2WJUA 2OKAA 2EIOA 4ZINA 4V1Ag 2RLIA 2H6YA 2YDZA 1X5EA 2GW3A 3R2QA 2HCGA 2IN3A 4EUYA 1W7UA 17GSA 2I1UA 5DVBA 1PL1A 3DQUA 5G1LA 3FZ5A 2QA1A 1ZYPA 1SENA 4BVXA 3IAM2 1B9XC 5ENUA 1E2YA 4RYWA 4O5RA 1B9CA 1J08A 2M80A 3KP8A 1MYWA 3IRAA 4IS0A 1ZL9A 2PXWA 4IKHA 5IMAA 3K8NA 3WGEA 1YY7A 3GL3A 2GSQA 2ON7A 2HYXA 4W6JA 3CFAA 2H1BA 5G1KA 3PGTA 3H1OA 3PJ5A 4ORNA 1FAAA 2OKYA 2FL1A 1F9MA 4HQCA 4OD7A 3SSLA 3FK8A 1XBSA 3MNGA 1GUMA 1F37A 3F63A 3UARA 2LRTA 3R3EA 1S3RA 3PIBA 3FW2A 3GSSA 1YFPA 4IK9A 1ERWA 5DTLA 2OTBA 2G6XA 1VF1A 4RUVA 4GCIA 3E5WA 2WDUA 5IMZA 3UOMA 4KW6A 3I69A 2JZTA 3U8CA 1TI3A 5D9VA 3CTFA 1EGOA 1GULA 2VAEA 4W7XA 2VCQA 5ECNB 1BEDA 1S3CA 4MH2A 5HZSA 3RWTA 3RPNA 2EMNA 3DQ3A 2A54B 1XWAA 1K0BA 3MDKA 4W6IA 2RIIA 1PRXA 1UN2A 5F05A 2H1AA 2L6CA 2A2PA 3P2AA 4V2MA 1RK4A 3SVNA 1AC1A 1PN0A 3FYGA 1K3YA 4UTSA 1EOGA 2F3MA 3W8SA 3DQ9A 2F9SA 4DXNA 2CZ2A 2XPDA 1K0DA 4ANJA 2GTUA 2TRXA 4BVYB 1JZDA 1ON4A 3AI4A 3ZFBA 3C1SA 3HJMA 4I6XA 4CHSA 3DQEA 3HVNA 1HCJA 4KGFA 4KE3A 4V2NA 3VLNA 5ECQB 2K18A 2DJ1A 2CZ3A 2LS5A 3DMLA 1GSFA 1M9BA 1XOAA 2WHSA 1GL8A 2GQMA 1JBZA 5KEJA 4EXJA 1T00A 2GSRA 4XS6A 1XW6A 2ZO7A 3UIWA 19GSA 2OTEA 2J23A 2R0GA 4NWSA 2GX0A 2YNXA 1OC3A 4YQVA 4F82A 2IMKA 4GXZA 4POBA 2A47A 4EDZA 1K3OA 2HRFA 3GUSA 1M3IA 4JBBA 4DXOA 1EP7A 5H88A 2FLSA 3M22A 3CBUA 4QQ7A 3KP9A 1GLPA 3HY2A 3GYKA 4IGJA 1QXHA 3CFFA 4IP6A 1M99A 3NT3A 4KCAA 4OHSA 3ZVJD 2VCZA 2FA4A 2WISA 3DPZA 5B8AA 5CRDA 2X99A 4ICYA 3KH7A 1U3AA 1UVZA 4KEXA 5JWQB 5EB6A 1TU7A 3I19A 1VF4A 1EEMA 3VWXA 4MMMA 3CFHA 3TOTA 1OYJA 2FGXA 1HNAA 1W7SA 4TR3A 1GGXA 2V6OA 4IZNA 4DEJA 4GTUA 3ERGA 1ZGPA 5DQSA 2VADA 3DQ6A 5EB7A 2QU1A 2C0GA 4OGSA 2MYGA 1QMVA 3SG5A 1XFLA 1X9SB 3FR3A 1V40A 1TK0B 2HQKA 2H6ZA 1OE7A 1EGRA 3D22A 3W6GA 3GL4A 1JZRA 3SRYA 2ALBA 1XSSA 4LL1B 5DPIA 1PD21 2O87A 2P0GA 2I4AA 5HFGA 2XC2A 2HE3A 3EYTA 2H01A 2HLSA 3G7YA 5EY6A 5IO2A 3GA4A 1IYHA 9GSSA 1E6BA 2BTOT 4ECIA 1EMMA 2PU9C 4W6FA 2KLXA 4G0LA 1EOHA 5BTTA 2VVHA 4HQ9A 3UVTA 3QCPA 5GSTA 3GX0A 3Q18A 3P90A 2AYTA 3EK4A 2GQLA 4IQ1A 1TOFA 4LQTA 2V41A 2WFCA 1THXA 2GSTA 4W6SA 4YQMA 4X0XA 2R0CA 2O89A 1ZYQB 3DQHA 1OKTA 2LJKA 1XPVA 3IP2A 4N3DA 3WGDA 3P7XA 1WP0A 1EWXA 4X4JA 4XL5A 2B5XA 2AWLA 4W74A 3AY8A 2GVPA 4MJEA 4PURA 4ZILA 1GSSA 2D2ZA 3DEXA 2B7JA 3L9SA 1RQMA 1B8XA 4MPGA 2CAQA 3U0MA 2PMTA 4W6BA 1XWCA 4ML1A 4TRXA 2RUEA 2G5ZB 3GSTA 1LBKA 2LRNA 3IOSA 1Z5YE 4DSSB 2WSNA 2YV9A 5HR3A 2NPBA 2DJ0A 3GMFA 4Z4MA 4LW5A 2F51A 4Q5QA 5H5SA 3WD6A 2R37A 1TRVA 3GEXA 3HDCA 2VZXA 4L1IA 2H71A 4JC2A 3KJYA 5AIVA 3M8NA 3D4TA 5H5RA 1ILOA 4PNGA 2AWKA 4PTSA 2YJ7A 3HKRA 4L13A 6GSUA 2HRNA 1V2AA 3MIXA 3A8SA 3APOA 3TKRA 2K9FA 3GB3A 1XW9A 2L4QA 2P4MA 2DBCA 3F3QA 2H19A 2REMA 5DALA 2H6XA 4MF7A 2GQKA 3ZTLA 4ACSA 4EKZA 2WHTA 3KMNA 1F0BA 2KUCA 1NSWA 5IMDA 2O7KA 4HSCX 3UG0A 4MZCA 3F8UA 4LL4B 1X0RA 4MCUA 4HOJA 3TGZA 5FT3A 2A2SA 3U6VA 3O76A 5LD0A 5E4WA 4Q7UA 2FHEA 3WYWA 2H0GA 4K7OA 1GSYA 3H93A 5FVFA 2B1LA 4G10A 4JU5A 4KA0A 1OVNA 1J0FA 1WMJA 2QLHA 2A50B 1GSUA 5D9TA 3CTGA 1EMLA 4TR0A 1U88A 1QY3A 3IHQA 1PQNA 2E2GA 5ECMB 3FEUA 2ZUPA 4PX1A 1SD9A 2Z6XA 1QQ2A 1Z3EA 1EMFA 3GKKA 2B1KA 4EC0A 1EV4A 2GZZA 2HZFA 4KB3A 3ADFA 2Z1OA 4OFTA 1K0NA 4LJBA 5CREA 1WRYA 4XS4A 4EMQA 4EVMA 4WKWA 4J56E 4ISDA 3KH9A 1KBNA 4EL1A 2C3NA 1Q73A 1TRWA 4GOBA 1R5AA 4HDEA 3J7Yb 1ST9A 4FQUA 3TJKA 4TZGA 1HYUA 3CBEA 2MMZA 2A52B 5ECPB 2ZMUA 1MDKA 2IOVA 1SJZA 3TJFA 3ZREA 1GSEA 2IB6A 2DKHA 2FWQA 4XIHA 4W6LA 1HUYA 2IMIA 1YJ6A 4ULXA 4YAPA 1QYQA 2B3SA 3IK9A 4EE0A 5KN2A 4PPJA 22GSA 2H73A 4MF6A 1U87A 3BX9A 1OXDA 2G2SB 1NHOA 4N11A 3W1DA 1W7TA 5F8BA 2QLEA 5BQLA 3QFBC 1CQHA 3RDWA 2DMMA 2X8HA 1GP1A 4ZBAA 2KOKA 4GLTA 3KEBA 4RI7A 4IW9A 1AQWA 3E3EA 2DJ3A 3TJJA 3FRCA 2H8QA 1AUCA 3HYPA 4FH8A 1U6TA 4L0UA 5EJUA 1GNEA 1XVWA 4MA9A 1T7PB 2CVKA 3FKFA 2X8GA 1MOUA 4FIWA 2DMLA 2V1MA 3KZQA 3UBKA 1X9WB 3LA1A 2LJRA 4YKGA 3ERFA 5CAXA 4Z4KA 1A2MA 3LFLA 3EU4A 3BCIA 3TKSC 5DCHA 2QLGB 2H5RA 4IK1A 4J8AA 5HGEA 3SSTA 5F06A 4KF5C 3DQCA 3AI5A 4P1QA 3SVDA 1QFNA 2POXA 3FZAA 1VGLA 1NHYA 4MNNA 2B3PA 3VPQA 3F4SA 3AKOA 3LXTA 1SU9A 5F07A 2LKUA 2OKWA 2VAFA 1AQXA 3LG6A 3JCML 2ON5A 2IWTA 3P28A 1DUGA 2GT6A 2H75A 1K0OA 3I43A 2YE0A 1KEBA 2IMDA 2E7PA 4MK3A 1ERVA 2GT5A 4H3NA 5ECRB 4IBPA 2CQ9A 1OC8A 1YZWA 5KN3A 2GGTA 3ERWA 2AB6A 3DQJA 4AR7A 1A2LA 2DIYA 3TMRA 3PINA 4W73A 1G6WA 4ZB1A 1KP5A 1XIYA 2VM1A 3US3A 5DY6A 1VF3A 3LEFA 2VM2A 4RI6A 1XMZA 1SKSB 4P3YB 3TRXA 2K8SA 1ZOFA 2HGDA 4W76A 3SSVA 3F6DA 3TMTA 2YN1A 3CRUA 4POKA 5D8IA 2YWIA 1TKDB 3ST0A 4HEA2 2KHPA 3S05A 1B48A 3D0ZA 3BOAA 4FYCA 3PJBA 4OO4A 2I3YA 3DQDA 4DVCA 2WB9A 2HT9A 3HZ4A 2HFCA 3IDVA 2QC7A 3CB9A 4WETA 2NBSA 5FVGA 5A4VA 5G30A 5HR2A 2PXSA 1XA9A 3CMIA 3A2VA 3DRNA 4W7CA 5D9WA 3IC4A 3ZITA 1W89A 2QLIA 5HFIA 3KTLA 3U0LA 1YDKA 3VWWA 3EU3A 5KOWA 2YZUA 1TK8B 4MPFA 1V9WA 2H6VA 2NDOA 3GTUB 2ZMWA 1SL0B 5EBJA 2R0PA 2VD0A 3DQIA 3QOUA 1JLVA 4D73B 5IMCA 2IMEA 4W77A 3U8AA 4FYBA 2X64A 5DDLA 2DJJA 2VCWA 1GWCA 4IN0A 1Q4JA 4BIKA 4TR1B 2AWJA 3LF3A 4QL9A 5DTXA 1QUWA 4IQAA 5HR0A 4AS8A 3QDNA 3TKPA 4XRAA 5DTZA 2C3TA 1J9BA 1TXXA 3SG3A 5L71A 5ECOB 4EF0A 1OXFA 1G7OA 3ZLPA 3GH9A 6GSVA 4USSA 3DQ5A 3DPWA 3DVXA 3ME8A 5EPFA 5KN1A 1GSQA 2CA8A 2GLRA 5J9BA 1NM3A 4K9ZA 4ZFSA 3VHTB 1AIUA 2HGYA 12GSA 2ZCTA 3HD5A 4GQCA 3CYNA 3EK8A 2JZRA 2DIZA 2EIRA 2XHFA 4K0GA 4ZL9A 6GSSA 3LW9A 1NW2A 1JZOA 4ZL7A 3C7MA 1IYIA 4L8EA 3VPTA 3OR5A 3IPZA 2NVLA 2P5RA 1HNBA 4KSOA 3W8JA 3IR8A 1PMTA 3DWVA 1AXDA 3M3MA 4KDXA 3H79A 1JC1A 1C72A 3CXGA 3SVSA 4N30A 3BBYA 3SSYA 4MDCA 3SG4A 2L5LA 4LA1A 4XS1A 4W6HA 1F6MC 4IK5A 1GLQA 2DUEA 4X1UA 3RAZA 4NAXA 1RW1A 6GSXA 4XCSA 3EK7A 1FVJA 4KSMA 3LS3A 4ML6A 4BPYA 1WOUA 3I9V2 2H1GA 1B4QA 4O7HA 3LQ7A 5D73A 4KF4A 2OADA 2VLTA 6GSTA 3ISOA 4OJ0A 4L5LA 4PUAA 2PPTA 1XAEA 4OFNA 2C8UA 3O78A 2OBKA 3EURA 4PGTA 3C8EA 3SSHA 3PH9A 4GWRA 4V1Ap 4ZXGA 4K0NA 2QRFA 3O3TA 4OWYA 2C80A 2C9IA 5C00A 4ZF4A 4HJMA 1PKWA 3CGLA 4IJIA 3I6AA 2IB5A 1WWJA 4KGIA 1WJKA 1SK0A 3PPUA 4Z2RA 3M9KA 1DE2A 2RH7A 3GIXA 3TRQA 4PPLA 5DPHA 3HXSA 2V2GA 1SKRB 2DJKA 4XOWA 1TP9A 2DD7A 2B7KA 4KDYA 4BL7B 2WHUA 2V4EB 3LSZA 1RMOA 5BT0A 3A5IA 4K1FA 2H5OA 5HZUA 1F09A 2IFQB 4K5RA 4DSSA 3BXAA 1FB6A 2BJXA 3IHGA 1M2AA 3RWAA 11GSA 3SSPA 2HRSA 4Q7TA 5CO3A 4IELA 2G6YA 2XPEA 1A0RP 3BXCA 2CX4A 3UJ1A 2GS3A 1HD2A 2QZ0A 1H4OA 4KW8A 4I2TA 1GRXA 4W6MA 2YOIA 5B6NA 3GV1A 1MTCA 3FZ4A 4HJ2A 3L0HA 4HU7A 3DQ7A 1BX9A 2JZSA 4WEYA 3OSQA 4KPIA 3CQFA 3HJOA 4TZAA 3SVOA 2C0DA 2KP2A 5H87A 3UFZA 6GSYA 1JBYA 4TXOB 2VCXA 3GKXA 1A2JA 3U5RE 2LEGA 3APQA 4GSNA 3P8UA 2V4EC 3KM6A 4W69A 1SYXA 3RHCA 1QXTA 4F2IA 4ECJA 1MDJA 5DQYA 5F9GA 5T3IA 3GKMA 1TK5B 3IV4A 2OBIA 1FHEA 2A46A 4EIPA 3IC8A 4WBRD 4ZL8A 4Z2TA 5C04A 1KYRA 3E5TA 5FVIA 1N8JA 5FHVA 2QSIA 3W1CA 3D6IA 1FW1A 2WURA 1G0TA 1A0FA 4G19A 2R3XA 3VICA 3UEMA 4MZBA 1QK8A 4OCEA 6GSWA 4ZB8A 1EMBA 1S3DA 2LQQA 1DE1A 4DKNA 3LJRA 3NEZA 2IJYA 1TW9A 1S6ZA 2OA7A 1TU8A 4PQIA 2WS2A 4IVFA 5EL8A 4PFEA 4Q5NA 1AAZA 2L57A 3TKSA 3QMXA 1ZYEA 2A48A 3DD3A 1TDIA 2IMFA 2H30A 3OSRA 4RQXA 2Q6PA 4KF5A 2DD9A 3MAKA 4HQ8A 1EMGA 3HVSA 1LJRA 1EMEA 1W4VA 4ECBA 3CD9A 7GSSA 1K0CA 4GSTA 1V57A 1I9DA 2IL3A 3HA9A 2HRAA 2BTJA 4BDUA 3IBHA 2N5AA 3CSHA 1M3JA 4H3MA 1R5PA 1PX7A 4W7DA 2ES7A 5ID2A 3DQLA 4O92A 4MH3A 3DGQA 1U3IA 1SL1B 4ZBDA 2N5BA 3QAGA 2CAIA 1PGTA 3LYPA 3ST2A 4H86A 4J88A 4OO5A 2N5FA 3Q19A 4XGYA 2OE1A 4KAEA 1T4ZA 1PKZA 1UISA 2OJKA 4W6GA 1USBA 1QYFA 1ZMAA 3E5VA 3RHBA 4BWQA 1T3BA 4LJDC 1LU4A 3EINA 4MJBA 1UC7A 4RYSA 3MSZA 1Q4CA 2QLGA 1MD4A 4ZIJA 3EVIA 2MBSA 4E8HA 4W6TA 2YPMA 2C0FA 4XOVA 2PBJA 2VIMA 4X43A 4Q7RA 2VL3A 2C0EA 2HSHA 4NV5A 4AF2A 2MBTA 2JSYA 3TDGA 4K8MA 1EMAA 4NHWA 4GQFA 4OFMA 2DLXA 3CD1A 1Z6NA 2EMDA 5ELAA 2YFPA 2VVIA 1X5CA 4FYUA 1KYSA 1PA3A 2YCDA 2VOCA 4XVPA 1PN9A 4J89A 1MOVA 4W7RA 13GSA 4PQ1A 5G31A 3FY7A 3NIVA 4KCEA 4GSSA 2UZ8A 4F0BA 3LXZA 3VWUA 3WLCA 1VRSD 2EIQA 3VI5A 3ZMKA 1TJDA 4ZB6A 4Q9XA 3G9AA 2V6KA 3C71A 5DRGA 4G9HA 2R5GA 2L59A 4H48A 4HZ4A 2L6DA 3EPTA 2PGTA 4ZF3A 3L78A 5BRTA 4I2UA 4W72A 5CYYA 5CRHA 4B30A 5JCUA 1PL2A 5IOWA 5J2OA 4K2XA 3ZUJA 2JADA 2H66A 4TR4A 2HJOA 1GTBA 4IK8A 1Z7PA 1M0UA 1ZYNA 2CX3A 3ZZXA 2OE3A 2K6VA 3EWLA 3TOUA 2DKIA 2O8VB 4J2FA 3NZNA 2VLVA 1MEKA 4POLA 3KIJA 2WULA 2G0FA 2G3DB 5ECKB 4LQUA 1YKAA 1T8EB 5J4UA 2DUFA 2C1YA 5HZTA 1ACVA 1N2AA 4R6BA 3GNJA 2OE0A 3HCZA 4DSQA 1G7EA 3NOFA 1SJ6A 2H72A 2JSZA 4JF9A 3UAPA 3KCTA 4JFGA 2H70A 2H0HA 1AW9A 2MMAA 4LMWA 3EVVA 2L5OA 3ZL5A 2FNOA 5LTQA 2YWNA 2HXKA 2MMNA 2J9HA 2VUPA 3HVXA 3C1RA 3GRXA 4NWYA 4D73A 3VFIA 4F0CA 3EVUA 4W7EA 2AH8A 3ZRDA 2VCVA 5GSSA 4ZBLA 4KH7A 3TJGA 2VL2C 2QA2A 4MJCA 2WZ9A 4TR1A 4K7NA 5GAND 3BD2A 3QAWA 1GUHA 4EDYA 1OC9B 2MMOA 3U8PA 3BJ5A 3GKNA 4KX4A 2G2QA 4YH2A 2C9JA 1DBYA 1OXEA 4I2YA 3H1RA 1ERUA 1PX6A 5EXUA 4W75A 2HZEB 3GFKA 4GF0A 1GTIA 4JZQA 4F03A 3VHTA 5DAKB 4I8BA 1Z7RA 4OMVA 1F2EA 4ILFA 3LSAA 4WF4A 4PXOA 3BXBA 5EXBA 5J5NA 4XTSA 3GN3A 2AHAA 4A5PA 3PJ7A 4BA7A 1O85A 2HSMA 3VURA 3U0KA 4AGSA 5KN0A 2LNTA 1YF1A 3ZMLA 3QPMA 4L0WA 5IMFA 1TRSA 5EVOA 1YJFA 2OGRA 1ML6A 1BYEA 1AQVA 4RQRA 1GTAA 4KAGA 1O7UA 3DIEA 2XBIA 2X8CA 4Q5RA 4G2EA 4R6DA 1Q98A 3M0FA 5E59A 4BVYA 2FWHA 3KD0A 2H0IA 2E2MA 2PVQA 3QFAC 1O81A 3D5JA 1GNWA 1PFOA 5DRFA 1WPIA 4NV2A 4DXPA 4JE1A 1SK2A 3DVWA 1B4PA 2ICRA 4N10A 1A8LA 1OE8A 5G5FA 4W6UA 4MF5A 2GSSA 1F3AA 2FZUA 1EMCA 4W6DA 1EV9A 4U2VA 3E0UA 4N0VA 2GZPA 3FHKA 1GUKA 2LRCA 3EVPA 2WSOA 2PN8A 2A56B 5LTPA 1Z1PA 3D21A 3EVRA 4DXIA 2BMXA 1RMPA 4JR6A 2EMOA 3SSKA 4YKFA 4H47A 4HI7A 2VVJA 4EN1A 3EMPA
chains in the Genus database with same CATH topology
4PNFA 4HUAA 1BJXA 2JL4A 1QYOA 1FG4A 2LV3A 3G7IA 1S3AA 5DU0A 5DQMA 1YEPA 3TJBA 3F9UA 1JLWA 4RTCA 2ZNMA 3A5WA 3LGCA 3FR6A 3TKQA 4BL7A 1TRUA 4ZIOA 4OQWA 1GTUA 2V4EA 1XOBA 2K8VA 3KXOA 1T1VA 18GSA 3NEDA 5HQPA 2IFQA 3EMXA 5ECSA 2NTOA 3LYKA 4QL7A 1RM9A 2QT2A 4NPBA 4MZWA 5FWGA 4PUFC 2GX2A 4CY8A 3WCKA 1G7KA 3SG2A 1V58A 3TRPA 3V3DA 2F8AA 5DCGA 4O5UA 3J7Yk 1DSBA 3TB2A 2AAWA 2Y0GA 2RM6A 2RM5A 1YHGA 1XWKA 3OGOA 5ABRA 5CRGA 4CW9A 3N9JA 4W7AA 3CSJA 2IIYA 4ZB9A 4KUNA 4L12A 5AISA 3KCMA 2AV4A 3SVEA 1H4UA 2FCHA 4TXOA 5LCZA 4BVXB 2WGRA 5DJLA 2Z6YA 16GSA 4NXIA 3SV5A 4B5YA 3ZVJA 1FOVA 3LVDA 1SK1A 1SJIA 2KP1A 1R4WA 2A4HA 3KGKA 4JGEA 4HS1A 2AJQB 1V98A 1PSQA 1OAZA 4ID0A 2P5QA 3A2WA 1EMKA 3TCOA 3F4RA 3TKSE 3SBCA 4W6AA 3HZ8A 4MJAA 2O2BA 4I5QA 4HQZA 4WBJA 5A5KA 3FR9A 4W6CA 4KW9A 4POMA 2VLUA 3MWHA 4Z7XA 4MLYA 2JU5A 1KTEA 1YJ2A 2H76A 3DQMA 3DQ8A 2PERA 1SD8A 3L4NA 5DTYA 4IHUA 2VL9A 3FMWA 3SVUA 4K5SA 4NHZA 4LMVA 2LTKA 4LJCA 1Q4EA 3RBTA 3DQ4A 2RUFA 5ECHB 4LJDA 3NT9A 2FWEA 2CVBA 4BWSA 2HQZA 2HSYA 5ELGA 3DPXA 2O24A 1R7HA 4DXQA 3LVAA 3SWLA 4TOPA 5HFKA 1O8XA 2CV4A 1Z6MA 5EHUA 4G0KA 3VI7A 5HW9A 4EDOA 2H5PA 3UBLA 5JCGA 2DDDA 2G3OA 1WE0A 3Q74A 2X4AA 3VK1A 2P31A 4ZBBA 2L4CA 5JWOB 3E9JB 1BFPA 2B6MA 4IK4A 2GZYA 1F3BA 4HVFA 4TXVA 4W6OA 1XW5A 2H5QA 3UMAA 3WGXA 5IPHA 3LORA 2WRTA 1G6YA 3G9BA 3MYDA 3ED3A 2FWGA 4Q9WA 4F9ZA 1H6RA 3IXRA 3GL5A 1UA5A 2IE2A 4P76A 2PVOC 4OCFA 5CNWA 3ZYWA 1SYRA 3U0NA 1ERTA 4G0IA 4I97A 2M72A 4TKYA 1XXUA 4MP4A 2HNLA 3QD9A 1I5GA 4O32A 3S9FA 3EC3A 5IIZA 4GF6B 4KNDA 5IPGA 5F0GA 1Q4AA 2DUHA 5LTRA 3DQ1A 4TW5A 4JRBA 2VCTA 2YWMA 2H74A 5A4WA 4ZF5A 2DUIA 3DKSA 2AWMA 3L9VA 1YF0A 5KOXA 1M2BA 3ZFLA 5DPGA 1ZGQA 3H1NA 3WT2A 1KYPA 1CV7A 1O8WA 2GDRA 4KDUA 4CDOA 3LF4B 4PPKA 4H3LA 1T4YA 5IMVA 5J41A 4KGEA 1ABAA 1XWBA 3APSA 3IR4A 1YEXA 20GSA 3EKHA 4XRDA 1JHBA 1YHIA 3D4MA 5J9CA 1THOA 3QAVA 2IPAA 2FWFA 3F6FA 2YJHA 2XBQA 2B3QA 3ZTFA 2DDCA 2VL2A 4EO3A 2HPWA 5D93A 2X49A 3H4KA 5A4UA 2C3QA 1Y25A 3QR6A 2JACA 1CQGA 1YQ1A 2VD1A 3N5OA 4JEDA 5DPJA 1Q4DA 2HRKA 2A53B 5H89A 1H75A 4JR4A 1YKCA 2R2JA 3ME7A 5JCWA 1JC0A 4GESB 3A2XA 1GH2A 1Y6EA 2OJLA 1RRXA 1R26A 3ZUFA 4HU9A 2LSTA 3DQOA 4JEOA 4KA9A 3TUEA 2LUSA 2QKEA 3F4TA 1C4FA 4HE4A 1JZWA 2A2RA 5G2ZA 3CRTA 1XVQA 1ZGNA 5EXCI 4Q5FA 2O85A 2ZO6A 3EKJA 1XCCA 1YZXA 3SS0A 1FB0A 1SL2B 2DC5A 1Z9HA 5B7CA 4XHMA 2OACA 4IP1A 3IE3A 3M9JA 1Q4BA 2DSAA 4EIQA 4AJ6A 5HZOA 5BTTB 2DUGA 1GSDA 2CVDA 2VO4A 3IA1A 2G6EA 3KCSA 1KNGA 1OKDA 1A24A 3NF0A 3SG6A 1A23A 2EC4A 4W6NA 4K6XA 5BMUA 1BG5A 4AJ7A 5LNKe 2V32A 3F0IA 5DQBA 4KW4A 5B6MA 1BQ7A 3CSIA 3LWAA 2B5YA 2B5EA 2E0QA 5G5EA 1OC9A 4L5OA 4DKMA 3BCKA 10GSA 1X5DA 3DQFA 1GFLA 4WR4A 3GJ2A 4O5QA 2DJ2A 4W7FA 1M2DA 3WT1A 3DXBA 3GX8A 2HZEA 2YE1A 3SVRA 2GW4B 5ECLB 5B8BA 4AJ8A 3F3RA 5CP1A 5DAKA 5COHA 4W6PA 1EP8A 2Z6ZA 3FZ9A 2QGVA 3EE2A 3Q6OA 2AHEA 4E8EA 4EULA 4W6RA 4V2LA 3HHVA 5IM9A 5IQYA 3DQNA 1FOHA 4IK3A 3RPPA 1ZZYA 2FUG2 2O29A 2PWJA 4K2DA 4EDSA 3ZULA 1A8YA 1HNCA 4DXMA 2PUKC 2YWOA 2FA8A 3ED8A 4DSRA 3V1WA 4WR5A 5INYA 5AIXA 1VF2A 2YZHA 2F8FA 1XZOA 1ZUXA 4FO5A 5D9XA 2FD3A 3VK9A 2HI7A 1BAYA 3G7JA 4YAVA 3KTBA 5DALB 4PQHA 5ID2B 4NMUA 3ST3A 3KMOA 3K1KA 1URMA 2TRCP 5LK4A 4Z2UA 8GSSA 3GHAA 4YQUA 3ZIJA 5GAPD 4HQSA 4W6KA 2HFDA 2H1DA 2MZCA 2YP6A 3GTUA 3IK7A 1HQOA 2WIQA 2C4JA 1EZKA 3GURA 1GL4A 2I9HA 3PR8A 5AGYA 1RMMA 1X9MB 5AN1A 3C73A 2A4VA 3ZIVA 5J3RA 3HJPA 2ARLA 3DQKA 3GJ1A 1M7TA 2H9WA 3M24A 3UL3A 4CY6A 1XWGA 1TI1A 2YV7A 3DYRA 2H8LA 1Z1QA 1TTZA 1M9AA 3ST4A 1EEJA 4TN8A 3HVVA 3SVBA 1K3LA 3IAS2 5FHIA 1MDIA 3SG7A 4GRFA 5DBQA 1SKWB 2CT6A 3WLDA 2AUVA 1B9YC 3H8QA 4XS4B 4WF5A 4N0ZA 5JWRB 5HBDA 4TVEA 2TIRA 4KF9A 1K0MA 1ZGOA 5CRWA 1WIKA 5HR1A 4OY4A 2LQOA 5AQBB 5KTGA 2Q57A 4ECCA 1QGVA 2FY6A 1MD3A 2Z9SA 4WXTA 3DQAA 2WCIA 3P8WA 1O73A 2YANA 2R4VA 2LJAA 4MABA 1K0AA 1JFUA 2G16B 3DQ2A 5H5QA 4J57E 3O77A 2M46A 4B30B 5DJMA 4IJ3A 5ECIB 3M1GA 1YHHA 4HZ2A 3UVHA 3SVCA 1FVKA 4LLRA 4JRRA 1O6JA 1ZCPA 5GZZB 3L9UA 5D96A 5IOXA 3LVCA 14GSA 2LNSA 2R6KA 2I81A 1XQMA 4K7IA 3VWVA 3A3TA 3GH6A 3O6TA 1FO5A 3MGFA 5IO0A 2WJUA 2OKAA 2EIOA 4ZINA 4V1Ag 2RLIA 2H6YA 2YDZA 1X5EA 2GW3A 3R2QA 2HCGA 2IN3A 4EUYA 1W7UA 17GSA 2I1UA 5DVBA 1PL1A 3DQUA 5G1LA 3FZ5A 2QA1A 1ZYPA 1SENA 4BVXA 3IAM2 1B9XC 5ENUA 1E2YA 4RYWA 4O5RA 1B9CA 1J08A 2M80A 3KP8A 1MYWA 3IRAA 4IS0A 1ZL9A 2PXWA 4IKHA 5IMAA 3K8NA 3WGEA 1YY7A 3GL3A 2GSQA 2ON7A 2HYXA 4W6JA 3CFAA 2H1BA 5G1KA 3PGTA 3H1OA 3PJ5A 4ORNA 1FAAA 2OKYA 2FL1A 1F9MA 4HQCA 4OD7A 3SSLA 3FK8A 1XBSA 3MNGA 1GUMA 1F37A 3F63A 3UARA 2LRTA 3R3EA 3PIBA 3FW2A 3GSSA 1YFPA 4IK9A 1ERWA 5DTLA 2OTBA 2G6XA 1VF1A 4RUVA 4GCIA 3E5WA 2WDUA 5IMZA 3UOMA 4KW6A 3I69A 2JZTA 3U8CA 1TI3A 5D9VA 3CTFA 1EGOA 1GULA 2VAEA 4W7XA 2VCQA 5ECNB 1BEDA 1S3CA 4MH2A 5HZSA 3RWTA 3RPNA 2EMNA 3DQ3A 2A54B 1XWAA 1K0BA 3MDKA 4W6IA 2RIIA 1PRXA 1UN2A 5F05A 2H1AA 2L6CA 2A2PA 3P2AA 4V2MA 1RK4A 3SVNA 1AC1A 1PN0A 3FYGA 1K3YA 4UTSA 1EOGA 2F3MA 3W8SA 3DQ9A 2F9SA 4DXNA 2CZ2A 2XPDA 1K0DA 4ANJA 2GTUA 2TRXA 4BVYB 1JZDA 1ON4A 3AI4A 3ZFBA 3C1SA 3HJMA 4I6XA 4CHSA 3DQEA 1HCJA 4KGFA 4KE3A 4V2NA 3VLNA 5ECQB 2K18A 2DJ1A 2CZ3A 2LS5A 3DMLA 1GSFA 1M9BA 1XOAA 2WHSA 1GL8A 2GQMA 1JBZA 5KEJA 4EXJA 1T00A 2GSRA 4XS6A 1XW6A 2ZO7A 3UIWA 19GSA 2OTEA 2J23A 2R0GA 4NWSA 2GX0A 2YNXA 1OC3A 4YQVA 4F82A 2IMKA 4GXZA 4POBA 2A47A 4EDZA 1K3OA 2HRFA 3GUSA 4JBBA 4DXOA 1EP7A 5H88A 2FLSA 3M22A 3CBUA 4QQ7A 3KP9A 1GLPA 3HY2A 3GYKA 4IGJA 1QXHA 3CFFA 4IP6A 1M99A 3NT3A 4KCAA 4OHSA 3ZVJD 2VCZA 2FA4A 2WISA 3DPZA 5B8AA 5CRDA 2X99A 4ICYA 3KH7A 1U3AA 1UVZA 4KEXA 5JWQB 5EB6A 1TU7A 3I19A 1VF4A 1EEMA 3VWXA 4MMMA 3CFHA 3TOTA 1OYJA 2FGXA 1HNAA 1W7SA 4TR3A 1GGXA 2V6OA 4IZNA 4DEJA 4GTUA 3ERGA 1ZGPA 5DQSA 2VADA 3DQ6A 5EB7A 2QU1A 2C0GA 4OGSA 2MYGA 1QMVA 3SG5A 1XFLA 1X9SB 3FR3A 1V40A 1TK0B 2HQKA 2H6ZA 1OE7A 1EGRA 3D22A 3W6GA 3GL4A 1JZRA 3SRYA 2ALBA 1XSSA 4LL1B 5DPIA 1PD21 2O87A 2P0GA 2I4AA 5HFGA 2XC2A 2HE3A 3EYTA 2H01A 2HLSA 3G7YA 5EY6A 5IO2A 3GA4A 1IYHA 9GSSA 1E6BA 2BTOT 4ECIA 1EMMA 2PU9C 4W6FA 2KLXA 4G0LA 1EOHA 5BTTA 2VVHA 4HQ9A 3UVTA 3QCPA 5GSTA 3GX0A 3Q18A 3P90A 2AYTA 3EK4A 2GQLA 4IQ1A 1TOFA 4LQTA 2V41A 2WFCA 1THXA 2GSTA 4W6SA 4YQMA 4X0XA 2R0CA 2O89A 1ZYQB 3DQHA 1OKTA 2LJKA 1XPVA 3IP2A 4N3DA 3WGDA 3P7XA 1WP0A 1EWXA 4X4JA 4XL5A 2B5XA 2AWLA 4W74A 3AY8A 2GVPA 4MJEA 4PURA 4ZILA 1GSSA 2D2ZA 3DEXA 2B7JA 3L9SA 1RQMA 1B8XA 4MPGA 2CAQA 3U0MA 2PMTA 4W6BA 1XWCA 4ML1A 4TRXA 2RUEA 2G5ZB 3GSTA 1LBKA 2LRNA 3IOSA 1Z5YE 4DSSB 2WSNA 2YV9A 5HR3A 2NPBA 2DJ0A 3GMFA 4Z4MA 4LW5A 2F51A 4Q5QA 5H5SA 3WD6A 2R37A 1TRVA 3GEXA 3HDCA 2VZXA 4L1IA 2H71A 4JC2A 3KJYA 5AIVA 3M8NA 3D4TA 5H5RA 1ILOA 4PNGA 2AWKA 4PTSA 2YJ7A 3HKRA 4L13A 6GSUA 2HRNA 1V2AA 3MIXA 3A8SA 3APOA 3TKRA 2K9FA 3GB3A 1XW9A 2L4QA 2P4MA 2DBCA 3F3QA 2H19A 2REMA 5DALA 2H6XA 4MF7A 2GQKA 3ZTLA 4ACSA 4EKZA 2WHTA 3KMNA 1F0BA 2KUCA 1NSWA 5IMDA 2O7KA 3UG0A 4MZCA 3F8UA 4LL4B 1X0RA 4MCUA 4HOJA 3TGZA 5FT3A 2A2SA 3U6VA 3O76A 5LD0A 5E4WA 4Q7UA 2FHEA 3WYWA 2H0GA 4K7OA 1GSYA 3H93A 5FVFA 2B1LA 4G10A 4JU5A 4KA0A 1OVNA 1J0FA 1WMJA 2QLHA 2A50B 1GSUA 5D9TA 3CTGA 1EMLA 4TR0A 1U88A 1QY3A 3IHQA 1PQNA 2E2GA 5ECMB 3FEUA 2ZUPA 4PX1A 1SD9A 2Z6XA 1QQ2A 1Z3EA 1EMFA 3GKKA 2B1KA 4EC0A 1EV4A 2GZZA 2HZFA 4KB3A 3ADFA 2Z1OA 4OFTA 1K0NA 4LJBA 5CREA 1WRYA 4XS4A 4EMQA 4EVMA 4WKWA 4J56E 4ISDA 3KH9A 1KBNA 4EL1A 2C3NA 1Q73A 1TRWA 4GOBA 1R5AA 4HDEA 3J7Yb 1ST9A 4FQUA 3TJKA 4TZGA 1HYUA 3CBEA 2MMZA 2A52B 5ECPB 2ZMUA 1MDKA 2IOVA 1SJZA 3TJFA 3ZREA 1GSEA 2IB6A 2DKHA 2FWQA 4XIHA 4W6LA 1HUYA 2IMIA 1YJ6A 4ULXA 4YAPA 1QYQA 2B3SA 3IK9A 4EE0A 5KN2A 4PPJA 22GSA 2H73A 4MF6A 1U87A 3BX9A 1OXDA 2G2SB 1NHOA 4N11A 3W1DA 1W7TA 5F8BA 2QLEA 5BQLA 3QFBC 1CQHA 3RDWA 2DMMA 2X8HA 1GP1A 4ZBAA 2KOKA 4GLTA 3KEBA 4RI7A 4IW9A 1AQWA 3E3EA 2DJ3A 3TJJA 3FRCA 2H8QA 1AUCA 3HYPA 4FH8A 1U6TA 4L0UA 5EJUA 1GNEA 1XVWA 4MA9A 1T7PB 2CVKA 3FKFA 2X8GA 1MOUA 4FIWA 2DMLA 2V1MA 3KZQA 3UBKA 1X9WB 3LA1A 2LJRA 4YKGA 3ERFA 5CAXA 4Z4KA 1A2MA 3LFLA 3EU4A 3BCIA 3TKSC 5DCHA 2QLGB 2H5RA 4IK1A 4J8AA 5HGEA 3SSTA 5F06A 4KF5C 3DQCA 3AI5A 4P1QA 3SVDA 1QFNA 2POXA 3FZAA 1VGLA 1NHYA 4MNNA 2B3PA 3VPQA 3F4SA 3AKOA 3LXTA 1SU9A 5F07A 2LKUA 2OKWA 2VAFA 1AQXA 3LG6A 3JCML 2ON5A 2IWTA 3P28A 1DUGA 2GT6A 2H75A 1K0OA 3I43A 2YE0A 1KEBA 2IMDA 2E7PA 4MK3A 1ERVA 2GT5A 4H3NA 5ECRB 4IBPA 2CQ9A 1OC8A 1YZWA 5KN3A 2GGTA 3ERWA 2AB6A 3DQJA 4AR7A 1A2LA 2DIYA 3TMRA 3PINA 4W73A 1G6WA 4ZB1A 1KP5A 1XIYA 2VM1A 3US3A 5DY6A 1VF3A 3LEFA 2VM2A 4RI6A 1XMZA 1SKSB 4P3YB 3TRXA 2K8SA 1ZOFA 2HGDA 4W76A 3SSVA 3F6DA 3TMTA 2YN1A 3CRUA 4POKA 5D8IA 2YWIA 1TKDB 3ST0A 4HEA2 2KHPA 3S05A 1B48A 3D0ZA 3BOAA 4FYCA 3PJBA 4OO4A 2I3YA 3DQDA 4DVCA 2WB9A 2HT9A 3HZ4A 2HFCA 3IDVA 2QC7A 3CB9A 4WETA 2NBSA 5FVGA 5A4VA 5G30A 5HR2A 2PXSA 1XA9A 3CMIA 3A2VA 3DRNA 4W7CA 5D9WA 3IC4A 3ZITA 1W89A 2QLIA 5HFIA 3KTLA 3U0LA 1YDKA 3VWWA 3EU3A 5KOWA 2YZUA 1TK8B 4MPFA 1V9WA 2H6VA 2NDOA 3GTUB 2ZMWA 1SL0B 5EBJA 2R0PA 2VD0A 3DQIA 3QOUA 1JLVA 4D73B 5IMCA 2IMEA 4W77A 3U8AA 4FYBA 2X64A 5DDLA 2DJJA 2VCWA 1GWCA 4IN0A 1Q4JA 4TR1B 2AWJA 3LF3A 4QL9A 5DTXA 1QUWA 4IQAA 5HR0A 4AS8A 3QDNA 3TKPA 4XRAA 5DTZA 2C3TA 1J9BA 1TXXA 3SG3A 5L71A 5ECOB 4EF0A 1OXFA 1G7OA 3ZLPA 3GH9A 6GSVA 4USSA 3DQ5A 3DPWA 3DVXA 3ME8A 5EPFA 5KN1A 1GSQA 2CA8A 2GLRA 5J9BA 1NM3A 4K9ZA 4ZFSA 3VHTB 1AIUA 2HGYA 12GSA 2ZCTA 3HD5A 4GQCA 3CYNA 3EK8A 2JZRA 2DIZA 2EIRA 2XHFA 4K0GA 4ZL9A 6GSSA 3LW9A 1NW2A 1JZOA 4ZL7A 3C7MA 1IYIA 4L8EA 3VPTA 3OR5A 3IPZA 2NVLA 2P5RA 1HNBA 4KSOA 3W8JA 3IR8A 1PMTA 3DWVA 1AXDA 3M3MA 4KDXA 3H79A 1JC1A 1C72A 3CXGA 3SVSA 4N30A 3BBYA 3SSYA 4MDCA 3SG4A 2L5LA 4LA1A 4XS1A 4W6HA 1F6MC 4IK5A 1GLQA 2DUEA 4X1UA 3RAZA 4NAXA 1RW1A 6GSXA 4XCSA 3EK7A 1FVJA 4KSMA 3LS3A 4ML6A 4BPYA 1WOUA 3I9V2 2H1GA 1B4QA 4O7HA 3LQ7A 5D73A 4KF4A 2OADA 2VLTA 6GSTA 3ISOA 4OJ0A 4L5LA 4PUAA 2PPTA 1XAEA 4OFNA 2C8UA 3O78A 2OBKA 3EURA 4PGTA 3C8EA 3SSHA 3PH9A 4GWRA 4V1Ap 4ZXGA 4K0NA 2QRFA 3O3TA 4OWYA 2C80A 2C9IA 5C00A 4ZF4A 4HJMA 1PKWA 3CGLA 4IJIA 3I6AA 2IB5A 1WWJA 4KGIA 1WJKA 1SK0A 3PPUA 4Z2RA 3M9KA 1DE2A 2RH7A 3GIXA 3TRQA 4PPLA 5DPHA 3HXSA 2V2GA 1SKRB 2DJKA 4XOWA 1TP9A 2DD7A 2B7KA 4KDYA 4BL7B 2WHUA 2V4EB 3LSZA 1RMOA 5BT0A 3A5IA 4K1FA 2H5OA 5HZUA 1F09A 2IFQB 4K5RA 4DSSA 3BXAA 1FB6A 2BJXA 3IHGA 1M2AA 3RWAA 11GSA 3SSPA 2HRSA 4Q7TA 5CO3A 4IELA 2G6YA 2XPEA 1A0RP 3BXCA 2CX4A 3UJ1A 2GS3A 1HD2A 2QZ0A 1H4OA 4KW8A 4I2TA 1GRXA 4W6MA 2YOIA 5B6NA 3GV1A 1MTCA 3FZ4A 4HJ2A 3L0HA 4HU7A 3DQ7A 1BX9A 2JZSA 4WEYA 3OSQA 4KPIA 3HJOA 4TZAA 3SVOA 2C0DA 2KP2A 5H87A 3UFZA 6GSYA 1JBYA 4TXOB 2VCXA 3GKXA 1A2JA 3U5RE 2LEGA 3APQA 4GSNA 3P8UA 2V4EC 3KM6A 4W69A 1SYXA 3RHCA 1QXTA 4F2IA 4ECJA 1MDJA 5DQYA 5F9GA 5T3IA 3GKMA 1TK5B 3IV4A 2OBIA 1FHEA 2A46A 4EIPA 3IC8A 4WBRD 4ZL8A 4Z2TA 5C04A 1KYRA 3E5TA 5FVIA 1N8JA 5FHVA 2QSIA 3W1CA 3D6IA 1FW1A 2WURA 1G0TA 1A0FA 4G19A 2R3XA 3VICA 3UEMA 4MZBA 1QK8A 4OCEA 6GSWA 4ZB8A 1EMBA 1S3DA 2LQQA 1DE1A 4DKNA 3LJRA 3NEZA 2IJYA 1TW9A 1S6ZA 2OA7A 1TU8A 4PQIA 2WS2A 4IVFA 5EL8A 4PFEA 4Q5NA 1AAZA 2L57A 3TKSA 3QMXA 1ZYEA 2A48A 3DD3A 1TDIA 2IMFA 2H30A 3OSRA 4RQXA 2Q6PA 4KF5A 2DD9A 3MAKA 4HQ8A 1EMGA 3HVSA 1LJRA 1EMEA 1W4VA 4ECBA 3CD9A 7GSSA 1K0CA 4GSTA 1V57A 1I9DA 2IL3A 3HA9A 2HRAA 2BTJA 4BDUA 3IBHA 2N5AA 3CSHA 4H3MA 1R5PA 1PX7A 4W7DA 2ES7A 5ID2A 3DQLA 4O92A 4MH3A 3DGQA 1U3IA 1SL1B 4ZBDA 2N5BA 3QAGA 2CAIA 1PGTA 3LYPA 3ST2A 4H86A 4J88A 4OO5A 2N5FA 3Q19A 4XGYA 2OE1A 4KAEA 1T4ZA 1PKZA 1UISA 2OJKA 4W6GA 1USBA 1QYFA 1ZMAA 3E5VA 3RHBA 4BWQA 1T3BA 4LJDC 1LU4A 3EINA 4MJBA 1UC7A 4RYSA 3MSZA 1Q4CA 2QLGA 1MD4A 4ZIJA 3EVIA 2MBSA 4E8HA 4W6TA 2YPMA 2C0FA 4XOVA 2PBJA 2VIMA 4X43A 4Q7RA 2VL3A 2C0EA 2HSHA 4NV5A 4AF2A 2MBTA 2JSYA 3TDGA 4K8MA 1EMAA 4NHWA 4GQFA 4OFMA 2DLXA 3CD1A 1Z6NA 2EMDA 5ELAA 2YFPA 2VVIA 1X5CA 4FYUA 1KYSA 1PA3A 2YCDA 2VOCA 4XVPA 1PN9A 4J89A 1MOVA 4W7RA 13GSA 4PQ1A 5G31A 3FY7A 3NIVA 4KCEA 4GSSA 2UZ8A 4F0BA 3LXZA 3VWUA 3WLCA 1VRSD 2EIQA 3VI5A 3ZMKA 1TJDA 4ZB6A 4Q9XA 3G9AA 2V6KA 3C71A 5DRGA 4G9HA 2R5GA 2L59A 4H48A 4HZ4A 2L6DA 3EPTA 2PGTA 4ZF3A 3L78A 5BRTA 4I2UA 4W72A 5CYYA 5CRHA 4B30A 5JCUA 1PL2A 5IOWA 5J2OA 4K2XA 3ZUJA 2JADA 2H66A 4TR4A 2HJOA 1GTBA 4IK8A 1Z7PA 1M0UA 1ZYNA 2CX3A 3ZZXA 2OE3A 2K6VA 3EWLA 3TOUA 2DKIA 2O8VB 4J2FA 3NZNA 2VLVA 1MEKA 4POLA 3KIJA 2WULA 2G0FA 2G3DB 5ECKB 4LQUA 1YKAA 1T8EB 5J4UA 2DUFA 2C1YA 5HZTA 1ACVA 1N2AA 4R6BA 3GNJA 2OE0A 3HCZA 4DSQA 1G7EA 3NOFA 1SJ6A 2H72A 2JSZA 4JF9A 3UAPA 3KCTA 4JFGA 2H70A 2H0HA 1AW9A 2MMAA 4LMWA 3EVVA 2L5OA 3ZL5A 2FNOA 5LTQA 2YWNA 2HXKA 2MMNA 2J9HA 2VUPA 3HVXA 3C1RA 3GRXA 4NWYA 4D73A 3VFIA 4F0CA 3EVUA 4W7EA 2AH8A 3ZRDA 2VCVA 5GSSA 4ZBLA 4KH7A 3TJGA 2VL2C 2QA2A 4MJCA 2WZ9A 4TR1A 4K7NA 5GAND 3BD2A 3QAWA 1GUHA 4EDYA 1OC9B 2MMOA 3U8PA 3BJ5A 3GKNA 4KX4A 2G2QA 4YH2A 2C9JA 1DBYA 1OXEA 4I2YA 3H1RA 1ERUA 1PX6A 5EXUA 4W75A 2HZEB 3GFKA 4GF0A 1GTIA 4JZQA 4F03A 3VHTA 5DAKB 4I8BA 1Z7RA 4OMVA 1F2EA 4ILFA 3LSAA 4WF4A 4PXOA 3BXBA 5EXBA 5J5NA 4XTSA 3GN3A 2AHAA 4A5PA 3PJ7A 4BA7A 1O85A 2HSMA 3VURA 3U0KA 4AGSA 5KN0A 2LNTA 1YF1A 3ZMLA 3QPMA 4L0WA 5IMFA 1TRSA 5EVOA 1YJFA 2OGRA 1ML6A 1BYEA 1AQVA 4RQRA 1GTAA 4KAGA 1O7UA 3DIEA 2XBIA 2X8CA 4Q5RA 4G2EA 4R6DA 1Q98A 3M0FA 5E59A 4BVYA 2FWHA 3KD0A 2H0IA 2E2MA 2PVQA 3QFAC 1O81A 3D5JA 1GNWA 5DRFA 1WPIA 4NV2A 4DXPA 4JE1A 1SK2A 3DVWA 1B4PA 2ICRA 4N10A 1A8LA 1OE8A 5G5FA 4W6UA 4MF5A 2GSSA 1F3AA 2FZUA 1EMCA 4W6DA 1EV9A 4U2VA 3E0UA 4N0VA 2GZPA 3FHKA 1GUKA 2LRCA 3EVPA 2WSOA 2PN8A 2A56B 5LTPA 1Z1PA 3D21A 3EVRA 4DXIA 2BMXA 1RMPA 4JR6A 2EMOA 3SSKA 4YKFA 4H47A 4HI7A 2VVJA 4EN1A 3EMPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PNF A;  4HUA A;  1BJX A;  2JL4 A;  1QYO A;  1FG4 A;  2LV3 A;  3G7I A;  1S3A A;  5DU0 A;  5DQM A;  1YEP A;  3TJB A;  3F9U A;  1JLW A;  4RTC A;  2ZNM A;  3A5W A;  3LGC A;  3FR6 A;  3TKQ A;  4BL7 A;  1TRU A;  4ZIO A;  4OQW A;  1GTU A;  2V4E A;  1XOB A;  2K8V A;  3KXO A;  1T1V A;  18GS A;  3NED A;  5HQP A;  2IFQ A;  3EMX A;  5ECS A;  2NTO A;  3LYK A;  4QL7 A;  1RM9 A;  2QT2 A;  4NPB A;  4MZW A;  5FWG A;  4PUF C;  2GX2 A;  3WCK A;  1G7K A;  3SG2 A;  1V58 A;  3TRP A;  3V3D A;  2F8A A;  5DCG A;  3J7Y k;  1DSB A;  3TB2 A;  2AAW A;  2Y0G A;  2RM6 A;  2RM5 A;  1YHG A;  1XWK A;  3OGO A;  5ABR A;  5CRG A;  4CW9 A;  3N9J A;  4W7A A;  3CSJ A;  2IIY A;  4ZB9 A;  4KUN A;  4L12 A;  5AIS A;  3KCM A;  2AV4 A;  3SVE A;  1H4U A;  2FCH A;  4TXO A;  5LCZ A;  2WGR A;  5DJL A;  2Z6Y A;  16GS A;  4NXI A;  3SV5 A;  4B5Y A;  3ZVJ A;  1FOV A;  3LVD A;  1SK1 A;  1SJI A;  2KP1 A;  1R4W A;  3KGK A;  4JGE A;  4HS1 A;  2AJQ B;  1V98 A;  1PSQ A;  1OAZ A;  4ID0 A;  2P5Q A;  3A2W A;  1EMK A;  3TCO A;  3F4R A;  3TKS E;  3SBC A;  4W6A A;  3HZ8 A;  4MJA A;  2O2B A;  4I5Q A;  4HQZ A;  4WBJ A;  5A5K A;  3FR9 A;  4W6C A;  4KW9 A;  4POM A;  2VLU A;  3MWH A;  4Z7X A;  4MLY A;  2JU5 A;  1KTE A;  1YJ2 A;  2H76 A;  3DQM A;  3DQ8 A;  2PER A;  1SD8 A;  3L4N A;  5DTY A;  4IHU A;  2VL9 A;  3SVU A;  4NHZ A;  4LMV A;  2LTK A;  4LJC A;  1Q4E A;  3RBT A;  3DQ4 A;  2RUF A;  5ECH B;  4LJD A;  3NT9 A;  2FWE A;  2CVB A;  4BWS A;  2HQZ A;  2HSY A;  5ELG A;  3DPX A;  2O24 A;  1R7H A;  4DXQ A;  3LVA A;  3SWL A;  4TOP A;  5HFK A;  1O8X A;  2CV4 A;  1Z6M A;  5EHU A;  3VI7 A;  5HW9 A;  4EDO A;  2H5P A;  3UBL A;  5JCG A;  2DDD A;  2G3O A;  1WE0 A;  3Q74 A;  3VK1 A;  2P31 A;  4ZBB A;  2L4C A;  5JWO B;  3E9J B;  1BFP A;  2B6M A;  4IK4 A;  2GZY A;  1F3B A;  4HVF A;  4TXV A;  4W6O A;  1XW5 A;  2H5Q A;  3UMA A;  3WGX A;  5IPH A;  3LOR A;  2WRT A;  1G6Y A;  3G9B A;  3ED3 A;  2FWG A;  4Q9W A;  4F9Z A;  1H6R A