2JADA

Yellow fluorescent protein - glutaredoxin fusion protein
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
351
structure length
346
Chain Sequence
SKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFIVTTGKLPVPWPTLVTTFLQCFARYPDHMKRHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHCVYIVADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLCYQSALSKDPNEKRDHMVLLEFVTAAGITHGMHELYKSGSGMVSQETIKHVKDLIAENEIFVASKTYCPYSHAALNTLFEKLKVPRSKVLVLQLNDMKEGADIQAALYEINGQRTVPNIYINGKHIGGNDDLQELRETGELEELLEPIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords YELLOW FLUORESCENT PROTEIN GLUTAREDOXIN FUSION PROTEIN
publication title Structure of Glutaredoxin Grx1P C30S Mutant from Yeast.
pubmed doi rcsb
source organism Aequorea victoria
molecule tags Electron transport
total genus 98
structure length 346
sequence length 351
ec nomenclature
pdb deposition date 2006-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00462 Glutaredoxin Glutaredoxin
A PF01353 GFP Green fluorescent protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 2jadA01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2jadA02
2B7JA 2G5ZB 5J2OA 4W6KA 1O81A 5JCUA 5J9CA 2XBQA 1EMBA 3AI5A 2IIYA 4TR4A 4IP1A 2H6VA 2XC2A 10GSA 3Q6OA 2L5OA 5IM9A 3F8UA 5AIVA 3EK4A 3KTBA 4ZBBA 1ZZYA 2G0FA 4WBRD 3HA9A 1I9DA 1ZMAA 1YEPA 2LJAA 9GSSA 4EUYA 2O85A 3GB3A 2DUHA 2LRTA 1RK4A 2IFQA 1GTIA 1NM3A 2K8VA 20GSA 4JU5A 3SG2A 3I69A 2H75A 1OC3A 2AHEA 5DBQA 1K0NA 4QQ7A 1RMMA 1SKWB 4GWRA 2HPWA 3GFKA 3GH9A 2H5PA 2X8GA 1ABAA 1CQGA 4DSSB 4IK5A 4K6XA 4NXIA 2OTEA 2A53B 1WIKA 2WDUA 3EKHA 3FR3A 2CA8A 5A4WA 1KYRA 1ILOA 1QFNA 3GMFA 1GNEA 3CRTA 4F0BA 1SYXA 4K7NA 3EU4A 5DJLA 5HQPA 2F9SA 2VLUA 1EP7A 4BWQA 1OC9A 3CB9A 1XFLA 1XW9A 4TR1B 1AQWA 2OE0A 3DD3A 2H76A 4V1Ap 3ZVJD 4HQSA 8GSSA 4GQCA 4MF5A 3MDKA 2G3DB 4W75A 5EXCI 2MMZA 2P5QA 2EIOA 3L4NA 3JCML 3APSA 1MEKA 3WYWA 1W7UA 1ERTA 1WE0A 3CXGA 3LEFA 1URMA 4L5OA 3NOFA 1K3OA 1Q4JA 2K6VA 4V2NA 5HR2A 2V4EA 1U87A 1YHHA 5EXBA 4EC0A 3SV5A 1GSSA 3Q74A 2FHEA 2HT9A 3WD6A 2WHSA 4P3YB 3GEXA 4LJBA 1TK0B 5CRWA 4W72A 2KUCA 2O8VB 2X99A 1HCJA 4K2DA 2CVKA 4Q5QA 4TZGA 4POKA 3L9SA 3SG7A 3WLCA 2LUSA 2LSTA 1K0BA 3QFAC 2VZXA 4ECBA 3ZYWA 2YZHA 4F03A 1A23A 1OC8A 5DRGA 2L57A 2VCXA 1OXEA 2VM1A 2C3NA 2RLIA 2AWMA 1A2LA 2WS2A 1YKAA 4WBJA 1Q73A 2YFPA 1HUYA 5HZTA 2E2GA 3DQ3A 3I9V2 3L9UA 1GFLA 1K0AA 4WEYA 1JZOA 2VCZA 5LTPA 5ECRB 2CQ9A 3ST3A 3CD9A 4XRAA 4ML6A 4I2YA 4P1QA 2GSRA 3LVCA 1YF0A 2IB5A 4MH3A 2MYGA 2GTUA 3E5VA 2AWJA 3TJFA 1FB0A 1U6TA 3TUEA 5LTQA 1XWGA 4ZBDA 1C4FA 4LMVA 2V6KA 2GVPA 5F06A 4J2FA 2CV4A 3QAWA 1R26A 3ME7A 4RYSA 1UA5A 5FHIA 2ZMUA 1V58A 4JBBA 3Q18A 5FWGA 3FW2A 4MA9A 3L78A 3QCPA 2R3XA 1GRXA 1T3BA 6GSTA 2RM6A 4ZL9A 2VD0A 4JEOA 1GTBA 2IOVA 5ECLB 1ZCPA 2LTKA 2HI7A 3C1SA 3TKSE 2L4CA 4I5QA 1MOUA 1ML6A 2HQZA 4K7OA 4NV5A 4ZF5A 2AV4A 5DQBA 5JWQB 4ML1A 2G6YA 5EJUA 5IIZA 3ZMLA 4RTCA 3KCSA 3GHAA 4OY4A 2YE0A 1M0UA 2NPBA 1ZGPA 1EGOA 1JBYA 5AIXA 1SJ6A 1TRUA 5DTXA 18GSA 4AJ7A 5D9WA 1PMTA 4TRXA 2YNXA 1XXUA 2QLIA 5EB7A 2FA4A 5CREA 5EL8A 1WRYA 2WHTA 5CAXA 1DE2A 4KX4A 2GSQA 3F6DA 2CZ2A 1MDKA 2CT6A 4KSOA 3KM6A 4ZB8A 2JZTA 4HDEA 1PSQA 3DQDA 3U0LA 2OKYA 4ZIOA 2HE3A 1Q4AA 5DALB 1HNAA 1PD21 2QU1A 4XRDA 5DJMA 2XPDA 5DAKA 2HQKA 4Q9WA 1VF1A 4GXZA 2WZ9A 3QMXA 2E0QA 1G6WA 4ECJA 4QL9A 2GDRA 1JHBA 5LNKe 2GLRA 3LSZA 2L59A 2VVIA 2BTOT 1FB6A 2BMXA 5GAND 3LG6A 4JRBA 3CSIA 3LVAA 1YJ6A 3IPZA 2A2SA 4PURA 4GSSA 2IMIA 4ILFA 2H8LA 5D93A 5ELGA 3PR8A 5DPHA 3C71A 4POLA 2PMTA 1HNCA 1GULA 3NEDA 3MSZA 4HJMA 4OGSA 3U8PA 2LNTA 3F6FA 2VADA 2WIQA 2IFQB 3F4SA 1TI1A 3ZZXA 3P8UA 4IELA 3BCKA 2HRFA 2H8QA 2DDCA 5IMZA 2VL2A 5CP1A 4FO5A 1SK1A 5CRHA 3ZL5A 1XQMA 2YWIA 4KAEA 4E8EA 1JZWA 4XS1A 2DJJA 4ZFSA 3C1RA 4B30A 3TKSA 2FLSA 2V41A 2GT5A 2VD1A 4WKWA 4IK3A 3KGKA 3QD9A 3DQ5A 1XWBA 1TP9A 3APQA 1A2JA 5IMFA 4TR0A 4D73B 1Z7RA 2YWOA 4AS8A 1F2EA 1ZGOA 1GWCA 3Q19A 3HY2A 4DVCA 1F6MC 3DQ4A 2M72A 1K0CA 3A2VA 1GGXA 4W6RA 1V9WA 1QMVA 3RPPA 2H01A 1QXTA 3SVNA 3FY7A 2GZZA 4W6SA 5ID2A 4J56E 4EF0A 5B6MA 3VWWA 2EMOA 1X5EA 2FWQA 2V32A 1SD9A 1YZXA 2V4EB 4N0VA 3LQ7A 3AKOA 4MPGA 4EKZA 5EBJA 4KA0A 6GSSA 3DPXA 1K3LA 2YWNA 3IAM2 4L13A 3GJ2A 2A50B 4HU9A 1GTUA 4EO3A 1T4ZA 2HSYA 1PRXA 3W6GA 1X0RA 2AYTA 4IP6A 2RUEA 1THXA 2HFDA 1EGRA 2GQKA 3U8AA 2WRTA 5D73A 3N9JA 3WLDA 3SSVA 1OVNA 2Q57A 3MNGA 4EL1A 1RM9A 1XZOA 3GH6A 5F8BA 3VI5A 3FYGA 3RHCA 5DPJA 4PQ1A 3DQOA 2H73A 4JR6A 5FVFA 3QAGA 1OAZA 2Q6PA 3PJ7A 3V3DA 1K0DA 4W6NA 4ULXA 4KGEA 3GRXA 5IMAA 3CFFA 5F07A 1G7OA 2GX0A 3D21A 2H6YA 1WMJA 2Y0GA 4Q7UA 5DPGA 4XHMA 1BYEA 3FRCA 5G5FA 4KA9A 3RWAA 4L1IA 2HZEB 3LF4B 2J23A 1PKWA 1M2BA 5HZUA 2VOCA 3SBCA 5IOWA 2DD7A 3IP2A 2CX4A 3H4KA 4TKYA 2OTBA 4Q7RA 1PX7A 4KAGA 4XGYA 3LYKA 3IE3A 2C0EA 3BXBA 1SU9A 3TGZA 7GSSA 3FZAA 2MZCA 3DQLA 1S3CA 5INYA 2LRCA 17GSA 4HUAA 4MCUA 3EVPA 5E59A 4GSTA 4W76A 4OFMA 2VLTA 4HU7A 4EDSA 1PQNA 1HNBA 5H5RA 4ID0A 1WPIA 4X43A 3W8JA 1XWKA 4OCEA 3DQIA 1T7PB 4K0NA 1GSUA 1TU8A 4IQ1A 1T4YA 4YQMA 2PN8A 2JZSA 3LYPA 3TDGA 3HCZA 3SVRA 5GSSA 1F0BA 2QZ0A 1X5CA 3UL3A 5COHA 2VM2A 1V98A 4JC2A 4HOJA 1NW2A 2H9WA 4XIHA 5IO0A 1YKCA 3C73A 2FWFA 3UVHA 2WGRA 5KEJA 4ZBLA 1XBSA 2IMDA 2I9HA 1M99A 2DJ0A 5EPFA 5G30A 1IYHA 3SSHA 2C9IA 3DEXA 1TK5B 2H1GA 3GL4A 1W4VA 1SKSB 4CW9A 3EU3A 4PPLA 5BTTA 1R5AA 1N8JA 4AJ8A 4YQUA 4IHUA 3G7YA 4LJDA 2B3SA 2O24A 3DQ8A 2H5OA 4FYCA 4QL7A 2V4EC 3SWLA 4HQZA 4IKHA 5B7CA 3ZUJA 4XL5A 3HKRA 1XW6A 2FCHA 3AI4A 5ECSA 4Q7TA 4DEJA 3TKRA 2IN3A 2YPMA 4V2LA 5DAKB 4MF7A 2MMAA 3NEZA 3FZ9A 4PX1A 2ZO6A 3KIJA 2VO4A 3DMLA 2B5XA 3VPQA 5G1LA 3HYPA 1HD2A 1LJRA 4XS6A 3TKPA 1U88A 3M22A 4W6GA 4PNFA 1W89A 2QLGB 1O8WA 4W6AA 4PGTA 4N3DA 2V6OA 4P76A 3SVBA 3DQ9A 4MH2A 3AY8A 3MAKA 3TJKA 5F05A 4DKNA 1M2DA 4W6DA 2C8UA 2REMA 2AWLA 4NWSA 2AB6A 3KTLA 5B6NA 1G7EA 1ON4A 3M24A 1YHIA 5DQYA 5GAPD 1Q4BA 2YV9A 4W6BA 4OWYA 4J57E 4RYWA 3ERFA 4PUFC 5DQMA 1TI3A 4JR4A 3K1KA 3M8NA 4I6XA 2IWTA 5IO2A 3SSYA 1SENA 4PPJA 3ZRDA 3DYRA 1BG5A 4B30B 2FWGA 3EK7A 2H66A 4O7HA 3QDNA 5HR3A 3ZFBA 4OFNA 4WF5A 5EY6A 1XIYA 2KP1A 5D8IA 2HFCA 3UIWA 3ZITA 3LWAA 1B9YC 2B1KA 4GF0A 4BA7A 1GSFA 4EN1A 3A8SA 3SVCA 5EVOA 3GIXA 2H5QA 3H1RA 1K3YA 2P5RA 5C00A 5ID2B 2C9JA 3ZMKA 3GV1A 1SJZA 1TRVA 3LXZA 2C80A 3NT3A 3RAZA 5D96A 3KH9A 1EWXA 4W6IA 1PL2A 2OE3A 1F37A 4K0GA 4MJCA 1F3BA 2LQOA 4RQXA 4MJAA 4IK9A 6GSUA 3WGEA 4KCEA 1A0FA 2RM5A 3SSPA 3GUSA 2OA7A 1KYPA 1OE8A 4MP4A 1U3IA 4PPKA 1EV4A 1KP5A 4L0UA 3SS0A 1THOA 5KN0A 3FR6A 2DC5A 2H74A 1XWCA 5ECMB 2PPTA 3RDWA 3TOUA 3DQNA 3UVTA 2EIRA 4NAXA 2Z6YA 3GL3A 4JFGA 3F3RA 2OKWA 5DDLA 2PVOC 4KNDA 1FAAA 3U5RE 3UJ1A 3I6AA 1XA9A 1GH2A 3E9JB 1RRXA 4OHSA 3ZULA 5ECOB 4RI6A 3DQCA 2YANA 5DY6A 1MDJA 3NZNA 4MJBA 4L12A 2A48A 2GW4B 2LRNA 1SKRB 3P8WA 2R2JA 3H8QA 3U0MA 4RQRA 2LV3A 1SK2A 5A4VA 4XS4A 4H47A 5IQYA 5F0GA 3CSHA 2H71A 1RMOA 2DBCA 4MLYA 1ST9A 4Z4MA 4GLTA 3VLNA 1Q4EA 4EE0A 3GL5A 3IAS2 1OXFA 3KD0A 4JF9A 3M1GA 3U0KA 4V1Ag 1ZGQA 5DU0A 1ZUXA 3LJRA 2GW3A 3TJJA 3CFAA 3HJPA 3D4MA 1AC1A 2DJ3A 2VL2C 1B4QA 3PJBA 5D9TA 2LS5A 4LQTA 6GSXA 1S6ZA 2L4QA 2F8AA 4JRRA 1SJIA 4W69A 3TKSC 3IOSA 2B3PA 4W6PA 1SYRA 2VL9A 4R6BA 3EURA 4H3LA 1K0OA 5IPHA 5ECNB 1MYWA 5HW9A 5LK4A 1LU4A 2R37A 4TR3A 2A46A 3UFZA 3O6TA 4W6HA 3NF0A 2VCWA 3GKNA 5EB6A 4W6CA 1HYUA 3UEMA 1QUWA 3EVIA 3QPMA 1YF1A 1OKTA 4N30A 3A5WA 3QFBC 1EZKA 2PXSA 1FW1A 5BTTB 4AGSA 5J9BA 4K1FA 1BEDA 3VURA 5AGYA 3MGFA 4W6MA 2AAWA 2VAEA 1JC1A 5HFIA 5B8BA 2YJ7A 3N5OA 4O92A 2GX2A 2O87A 3DRNA 1M2AA 2L5LA 1OKDA 2B7KA 1R4WA 2JL4A 3IHQA 4E8HA 3SVOA 2N5FA 3ZTFA 3IDVA 1NHYA 4ZB9A 3HXSA 5A5KA 1PKZA 4W6OA 3GSTA 3W8SA 3KCMA 5ELAA 1B4PA 3U6VA 4W6UA 2H70A 2AJQB 4LLRA 1GLQA 5DPIA 2K9FA 2Z6ZA 1X9WB 1Z5YE 3ERGA 3APOA 4MABA 1Z6NA 2OJKA 3ADFA 3E3EA 1QYQA 3U8CA 3IA1A 2JU5A 2J9HA 3LXTA 2X64A 1RMPA 4YQVA 1PN9A 3MWHA 2I81A 2OACA 1AIUA 3CYNA 5CO3A 4YH2A 4L5LA 4MJEA 1V40A 2FZUA 3BXAA 1KTEA 2YV7A 4DXOA 5ECPB 2OE1A 4N10A 1TTZA 1C72A 4NWYA 2H6ZA 2H19A 1XMZA 4OMVA 4ECIA 2QRFA 4W6TA 1O8XA 1JLVA 4WR5A 1VRSD 1YEXA 4KDXA 3FEUA 4FH8A 4O32A 1K0MA 3U0NA 4ISDA 4N0ZA 3ZTLA 3KJYA 1FOVA 3WT2A 1ZYEA 3D5JA 3W1DA 1M9AA 3DQUA 1E2YA 1G0TA 2O89A 1ZOFA 3FK8A 1WOUA 3TJGA 1Q98A 3EMXA 4IGJA 1TOFA 5HFGA 4DSSA 1FO5A 1JBZA 1OC9B 1S3AA 1XSSA 14GSA 2C0GA 3HJOA 2EMNA 2FL1A 2IPAA 5J3RA 5FVIA 2H1BA 3TRXA 4HEA2 1USBA 3ERWA 1H4UA 4BDUA 4RI7A 5HR0A 2OBIA 1E6BA 5EXUA 3A2WA 4U2VA 3H93A 4LL4B 1TJDA 3A2XA 2CZ3A 3PINA 4NHZA 2AWKA 2D2ZA 3FHKA 5HFKA 5H89A 5ECHB 1EMKA 4W6LA 3OSQA 4V2MA 3CGLA 3ZLPA 3O77A 4Q5RA 4XCSA 2GZYA 1XVQA 1TRWA 4G10A 2DLXA 4DSQA 3PH9A 1EV9A 2Z9SA 3LA1A 5DQSA 4AF2A 4BL7A 1T8EB 2PGTA 3LF3A 1BAYA 4IZNA 2ZNMA 4BVYA 4EULA 3GYKA 3BBYA 4IBPA 5JCWA 4DXPA 2JZRA 2V2GA 4J89A 4Z4KA 1ZL9A 4LMWA 4LJDC 3C8EA 5IOXA 1MD3A 2YCDA 2GGTA 4I2UA 4I2TA 4KF4A 2VVJA 1KYSA 1O73A 1W7SA 1H75A 4CHSA 5KN3A 1MOVA 2EC4A 4F0CA 4I8BA 4EVMA 1TW9A 2F3MA 2G6EA 4L0WA 1UC7A 3D6IA 4KDUA 3G9AA 3EMPA 4TXVA 5EHUA 4BPYA 1AQVA 1PGTA 1LBKA 3F4RA 1J0FA 1J08A 4F2IA 3ST0A 1KEBA 2GZPA 3ZUFA 3VICA 4KSMA 4GF6B 3VWUA 1QQ2A 1BQ7A 5IMCA 2MBSA 1S3DA 5CRDA 3DQFA 1XW5A 3EC3A 1PX6A 1AQXA 4IK8A 3ZREA 4I97A 2P31A 3FR9A 1EOGA 3ED8A 3KMOA 5LD0A 4PQHA 1WWJA 1A8YA 5AISA 4N11A 3KZQA 2IJYA 1FHEA 3WGDA 1SL0B 4KF5A 3DVXA 2DUFA 1MD4A 4B5YA 4KGFA 5H87A 3R2QA 4DSRA 3L9VA 4POMA 1Q4DA 3RBTA 3KH7A 3S9FA 3J7Yb 3SRYA 2YDZA 5DCHA 2KP2A 1YZWA 1BJXA 1TDIA 2H5RA 3HVSA 4K9ZA 1DSBA 5FT3A 5CRGA 1YFPA 4ZL8A 2ICRA 4PNGA 1XCCA 1J9BA 4PFEA 3VWXA 1GL8A 1T1VA 5LTRA 2B5YA 5E4WA 3GSSA 5KN2A 4HE4A 2B3QA 2DJ2A 2FNOA 1A0RP 1RW1A 1WP0A 1CQHA 3SSTA 1Z3EA 1AAZA 5HZSA 4POBA 2DIYA 2ZUPA 1UISA 1ERVA 4JEDA 1TXXA 1GSEA 3TB2A 4LA1A 1OYJA 3UBLA 5H5QA 4GOBA 4XVPA 5KN1A 2DUEA 1OE7A 3DQ2A 1B48A 4KH7A 1UN2A 4W6FA 2H1DA 4GCIA 2WISA 1H4OA 1O7UA 2DJKA 2QC7A 4IN0A 2O7KA 2QT2A 5ECIB 2P4MA 1Z9HA 3G7JA 5CNWA 1GTAA 2Z1OA 3LFLA 3P7XA 2DUGA 4G2EA 3P28A 4PQIA 3BX9A 1Y6EA 2E7PA 2H6XA 5BQLA 1RQMA 3C7MA 2I4AA 4OQWA 2DUIA 3H1OA 3FZ5A 2GQMA 3KP9A 5H5SA 5A4UA 5DTYA 3LSAA 1ACVA 2P0GA 2CX3A 3DQKA 1TRSA 2OADA 3FKFA 2EIQA 4ZB1A 2BTJA 1GUHA 4EDOA 2NVLA 2C1YA 1YJ2A 2DMLA 1QY3A 1X9MB 3TMRA 1B9XC 3V1WA 3EK8A 5HR1A 4OO4A 3KMNA 4H3NA 1YJFA 3E0UA 3HVXA 4TW5A 3HVVA 4UTSA 2QLHA 3CMIA 3KP8A 4W7XA 2YOIA 5JCGA 4PXOA 3PJ5A 1F3AA 2DD9A 4KGIA 1O6JA 3ISOA 2A56B 4DXIA 2QKEA 5T3IA 4L8EA 2LEGA 1GSQA 1XPVA 13GSA 3ST2A 2YWMA 2PBJA 2BJXA 2ALBA 2G6XA 4D73A 2H0GA 2N5BA 4IK4A 3DKSA 4KE3A 2M80A 4ZILA 3D0ZA 1MDIA 3HD5A 3VFIA 2Z6XA 2B1LA 4KCAA 1SL1B 2PUKC 1V57A 3CRUA 4GSNA 2NTOA 4JE1A 22GSA 3PGTA 4LL1B 3I19A 2VCVA 1GUKA 5J5NA 2G2QA 4IK1A 4WR4A 2I3YA 3A3TA 2I1UA 2LJRA 3LVDA 4KEXA 2NDOA 1OXDA 5G1KA 2TRCP 2H1AA 2WB9A 2LNSA 3IR4A 3IBHA 2QGVA 3LORA 5LCZA 1W7TA 3DQHA 2VLVA 2F51A 3F63A 3DPWA 3BD2A 4WF4A 4YAVA 5H88A 3GX8A 1T00A 12GSA 1XWAA 3G9BA 1R5PA 2IL3A 5DCGA 4MMMA 4W73A 1YHGA 1EP8A 2PVQA 2JSYA 2E2MA 3GKMA 3IK9A 4TN8A 3CTGA 2QLEA 5GSTA 5ECKB 1GL4A 4Q9XA 3GX0A 3DQ7A 2HGDA 2GQLA 3NIVA 1X9SB 2FWEA 5B8AA 3VI7A 2RUFA 1TK8B 4MDCA 3ZVJA 3TMTA 3NT9A 4NMUA 3ZIVA 4DXMA 3UBKA 4ZF3A 4PUAA 3TKQA 3ST4A 1JZDA 3J7Yk 2R5GA 1QYFA 2PERA 4RUVA 5J4UA 2HJOA 2WFCA 4MZWA 4H86A 3ZFLA 1XOAA 4ZBAA 2ZO7A 4W7CA 2HZEA 6GSVA 1Z7PA 1GLPA 3K8NA 4MZBA 2GT6A 2R4VA 3IK7A 3WGXA 3VHTA 2R6KA 3F0IA 3SG3A 1G7KA 3G7IA 5AN1A 1EMEA 5JWRB 2VVHA 4KPIA 2H30A 1GSDA 3IR8A 4KW4A 2WCIA 4W7EA 2DSAA 2FY6A 3VPTA 3CTFA 4ORNA 1SD8A 3EE2A 1GP1A 2YZUA 4K8MA 3TJBA 2IMKA 1EMLA 3UOMA 3OSRA 3M9KA 1R7HA 3M9JA 4WETA 2JACA 4TXOA 4IS0A 4OD7A 3LGCA 2F8FA 3D22A 2DMMA 1KBNA 5L71A 1EMFA 4GESB 3D4TA 1Z1PA 3DPZA 2HXKA 2B6MA 2NBSA 4ZXGA 3DXBA 4G9HA 2OJLA 4HS1A 3FZ4A 2VIMA 3M3MA 2WULA 1G6YA 3L0HA 3SG4A 2VUPA 2VCQA 3DQ6A 2ON7A 3SVSA 2TRXA 2C3TA 5FHVA 1I5GA 6GSWA 5C04A 2KLXA 5KTGA 3SVDA 3SSLA 2O29A 4TZAA 4F9ZA 4MZCA 1ERWA 5F9GA 2DJ1A 5JWOB 2XBIA 4BWSA 3GTUA 4FYBA 1QK8A 2MMOA 1DBYA 3GA4A 2DIZA 4W77A 4X0XA 4TOPA 1MTCA 5DTLA 1Q4CA 3VK1A 4W7DA 1YDKA 1EMGA 1U3AA 3UMAA 2HSHA 4GRFA 2YJHA 2IMFA 1AUCA 1QYOA 3F9UA 4KUNA 5D9VA 2YE1A 2MMNA 3ZIJA 2OGRA 6GSYA 2OBKA 5AQBB 2VCTA 3OR5A 4G19A 4TVEA 4HI7A 4LQUA 11GSA 4OFTA 2RIIA 2G16B 1NHOA 4XOVA 2ON5A 2FD3A 1FVJA 5G31A 1CV7A 4W74A 4KW9A 5HBDA 1PA3A 5CYYA 1A2MA 4OCFA 3UARA 3I43A 1JZRA 2C0DA 4J8AA 2KOKA 4J88A 2K18A 2QLGA 3GKXA 5BT0A 3CBUA 1VGLA 2CAQA 4HVFA 2A47A 2YN1A 4ZF4A 1TU7A 4ECCA 3BOAA 2WHUA 2ZCTA 1DE1A 2CAIA 2MBTA 2V1MA 2OKAA 4ZINA 1O85A 3DVWA 3QR6A 3H79A 3HZ8A 1B8XA 3EVUA 2H72A 4HZ2A 4Z7XA 3SVEA 4Q5NA 2HLSA 2HZFA 3CD1A 4H48A 1Y25A 2WSNA 3CBEA 3GNJA 2L6DA 3DQJA 3DGQA 2A54B 3KEBA 2H0IA 3HZ4A 5J41A 3GKKA 3WCKA 4DXQA 2A4VA 1IYIA 16GSA 4NV2A 2KHPA 4LJCA 3E5WA 1F09A 2IMEA 4NHWA 4GQFA 2O2BA 1FVKA 1XVWA 1ERUA 1ZYQB 4W7RA 4X1UA 4KF5C 1QXHA 1GUMA 2C4JA 4TR1A 5IPGA 3KCTA 3HJMA 4R6DA 3P2AA 3O78A 2LKUA 2AH8A 4DKMA 1EMCA 3PIBA 3ED3A 4EDYA 1EEMA 1N2AA 4ZL7A 3VWVA 3P90A 1JC0A 3EKJA 2HNLA 1EOHA 2FWHA 3SVUA 1PL1A 4KB3A 2EMDA 3OGOA 2IE2A 4OJ0A 4HQ9A 19GSA 1ZGNA 1A8LA 2X8CA 4Q5FA 4BVXA 4FIWA 4MK3A 4AJ6A 4W6JA 2CVDA 4GTUA 2AUVA 2K8SA 5HZOA 3BCIA 4W7FA 2L6CA 4MF6A 3LS3A 5ABRA 4HQCA 5G5EA 3BJ5A 4YAPA 2HRNA 2VAFA 4ACSA 2A2RA 1VF4A 2JSZA 3TRQA 2AHAA 2B5EA 1YY7A 4EXJA 1TKDB 5GZZB 2PWJA 3EWLA 1NSWA 1FG4A 2XPEA 5IMDA 4IVFA 2LQQA 3M0FA 3S05A 4NPBA 2ES7A 3GJ1A 1XOBA 3SG6A 2WSOA 1SL2B 2IB6A 3HDCA 2A52B 1M9BA 1HQOA 5DRFA 2WJUA 3IV4A 4ZB6A 4XOWA 5IMVA 1EMAA 1Z1QA 1JFUA 4XS4B 2G3OA 2N5AA 2YP6A 4DXNA 5DVBA 3ME8A 2H0HA 3QAVA 3IC4A 2GSSA 1WJKA 3DWVA 1SK0A 2CVBA 3DQEA 3UAPA 4HQ8A 3VHTB 4ANJA 1AW9A 3TOTA 4KW6A 2ARLA 2X8HA 4ZIJA 3SG5A 4MPFA 4EMQA 3WT1A 3IXRA 4CDOA 3US3A 1EMMA 2C3QA 2G2SB 1UVZA 1VF3A 1Z6MA 5FVGA 1AXDA 3O76A 3EYTA 3EVVA 3O3TA 2TIRA 2LJKA 2FGXA 4KW8A 4TXOB 3CFHA 4JGEA 2PU9C 3F4TA 3QOUA 4KDYA 3RPNA 4IW9A 2HCGA 3DQAA 4IJ3A 5D9XA 4IQAA 5HGEA 1GSYA 1QGVA 1X5DA 1VF2A 2QSIA 3EINA 3CSJA 3VK9A 2C0FA 3F3QA 2RH7A 2ZMWA 4HJ2A 2HRSA 1V2AA 5ENUA 2WURA 3IRAA 3H1NA 4H3MA 2GS3A 3DQ1A 1DUGA 3HHVA 4FYUA 1F9MA 2JADA 3EVRA 3UG0A 1YQ1A 2GSTA 4JZQA 1KNGA 2FUG2 3BXCA 3W1CA 4IJIA 2DDDA 4LW5A 3RWTA 1A24A 3GTUB 1GNWA 4XTSA 1BFPA 1H6RA 5DTZA 4HZ4A 2FA8A 1EEJA 4OO5A 4W7AA 4F82A 2XHFA 3DIEA 1JLWA 3E5TA 5G2ZA 1BX9A 4EDZA 4AR7A 2HGYA 3SSKA 3GURA 3KXOA 3TCOA 2M46A 2POXA 3TRPA 4WXTA 3RHBA 4K7IA 1B9CA 2PXWA 4O5RA 3DQMA 5DALA 2HYXA 3GN3A 2VL3A 1XAEA 1M7TA 5ECQB
chains in the Genus database with same CATH superfamily
2B7JA 2G5ZB 5J2OA 4W6KA 1O81A 5JCUA 5J9CA 2XBQA 1FOHA 1EMBA 3AI5A 2IIYA 4TR4A 4IP1A 2H6VA 2XC2A 10GSA 3Q6OA 2L5OA 5IM9A 3F8UA 5AIVA 3EK4A 3KTBA 4ZBBA 1ZZYA 2G0FA 4WBRD 3HA9A 1I9DA 1ZMAA 1YEPA 2LJAA 9GSSA 4EUYA 2O85A 3GB3A 2DUHA 2LRTA 1RK4A 2IFQA 1GTIA 1NM3A 2K8VA 20GSA 4JU5A 3SG2A 3I69A 2H75A 1OC3A 2AHEA 5DBQA 1K0NA 4QQ7A 1RMMA 1SKWB 4GWRA 2HPWA 3GFKA 3GH9A 2H5PA 2X8GA 1ABAA 1CQGA 4DSSB 4IK5A 4K6XA 4NXIA 2OTEA 2A53B 1WIKA 2WDUA 3EKHA 3FR3A 2CA8A 5A4WA 1KYRA 1ILOA 1QFNA 3GMFA 1GNEA 3CRTA 4F0BA 1SYXA 4K7NA 3EU4A 5DJLA 5HQPA 2F9SA 2VLUA 1EP7A 4BWQA 1OC9A 3CB9A 1XFLA 1XW9A 4TR1B 1AQWA 2OE0A 3DD3A 2H76A 4V1Ap 3ZVJD 4HQSA 8GSSA 4GQCA 4MF5A 3MDKA 2G3DB 4W75A 5EXCI 2MMZA 2P5QA 2EIOA 3L4NA 3JCML 3APSA 1MEKA 3WYWA 1W7UA 1ERTA 1WE0A 3CXGA 3LEFA 1URMA 4L5OA 3NOFA 1K3OA 1Q4JA 2K6VA 4V2NA 5HR2A 2V4EA 1U87A 1YHHA 5EXBA 4EC0A 3SV5A 1GSSA 3Q74A 2FHEA 2HT9A 3WD6A 2WHSA 4BL7B 4P3YB 3GEXA 4LJBA 1TK0B 5CRWA 4W72A 2KUCA 2O8VB 2X99A 1HCJA 4BVYB 4K2DA 2CVKA 4Q5QA 4BVXB 4TZGA 4POKA 3L9SA 3SG7A 3WLCA 2LUSA 2LSTA 1K0BA 3QFAC 2VZXA 4PTSA 4ECBA 3ZYWA 2YZHA 4F03A 1A23A 1OC8A 5DRGA 2L57A 2VCXA 1OXEA 2VM1A 2C3NA 2RLIA 2AWMA 1A2LA 2WS2A 1YKAA 4WBJA 1Q73A 2YFPA 1HUYA 5HZTA 2E2GA 3DQ3A 3I9V2 3L9UA 1GFLA 1K0AA 4WEYA 1JZOA 2VCZA 4YKGA 5LTPA 5ECRB 2CQ9A 3ST3A 3CD9A 4XRAA 4ML6A 4I2YA 4P1QA 2GSRA 3LVCA 1YF0A 2IB5A 4MH3A 2MYGA 2GTUA 3E5VA 2AWJA 3TJFA 1FB0A 1U6TA 3TUEA 5LTQA 1XWGA 4ZBDA 1C4FA 4LMVA 2V6KA 2GVPA 5F06A 4J2FA 3A5IA 2CV4A 3QAWA 1R26A 3ME7A 4RYSA 1UA5A 5FHIA 2ZMUA 1V58A 4JBBA 3Q18A 5FWGA 3FW2A 4MA9A 3L78A 2X49A 3QCPA 2R3XA 1GRXA 1T3BA 6GSTA 2RM6A 4ZL9A 2VD0A 4JEOA 1GTBA 2IOVA 5ECLB 1ZCPA 2LTKA 4A5PA 2HI7A 2QA2A 3C1SA 3TKSE 2L4CA 4I5QA 1MOUA 1ML6A 2HQZA 4K7OA 4NV5A 4ZF5A 2R0CA 2AV4A 5DQBA 5JWQB 4ML1A 2G6YA 5EJUA 5IIZA 3ZMLA 4RTCA 3KCSA 3GHAA 4OY4A 2YE0A 1M0UA 2NPBA 1ZGPA 1EGOA 1JBYA 5AIXA 1SJ6A 1TRUA 5DTXA 18GSA 4AJ7A 5D9WA 1PMTA 4TRXA 2YNXA 1XXUA 2QLIA 5EB7A 2FA4A 5CREA 5EL8A 1WRYA 2WHTA 5CAXA 1DE2A 4KX4A 2GSQA 3F6DA 3IC8A 2CZ2A 1MDKA 2CT6A 4KSOA 3KM6A 4ZB8A 2JZTA 4HDEA 1PSQA 3DQDA 3U0LA 2OKYA 4ZIOA 2HE3A 1Q4AA 5DALB 1HNAA 1PD21 2QU1A 4XRDA 5DJMA 2XPDA 5DAKA 2HQKA 4Q9WA 1VF1A 4GXZA 2WZ9A 3QMXA 2E0QA 1G6WA 4ECJA 4QL9A 2GDRA 5BMUA 1JHBA 5LNKe 2GLRA 3LSZA 2L59A 2VVIA 2BTOT 1FB6A 2BMXA 5GAND 3LG6A 4JRBA 3CSIA 3LVAA 1YJ6A 3IPZA 2A2SA 4PURA 4GSSA 2IMIA 4ILFA 2H8LA 5D93A 5ELGA 3PR8A 5DPHA 3C71A 4POLA 2PMTA 1HNCA 1GULA 3NEDA 3MSZA 4HJMA 4OGSA 3U8PA 2LNTA 3F6FA 2VADA 2WIQA 2IFQB 3F4SA 1TI1A 3ZZXA 3P8UA 4IELA 3BCKA 2HRFA 2H8QA 2DDCA 5IMZA 2VL2A 5CP1A 4FO5A 1SK1A 5CRHA 3ZL5A 1XQMA 2YWIA 4KAEA 4E8EA 1JZWA 4XS1A 2DJJA 4ZFSA 3C1RA 4B30A 3TKSA 2FLSA 2V41A 2VD1A 2GT5A 4WKWA 4IK3A 3KGKA 3QD9A 3DQ5A 1XWBA 1TP9A 3APQA 1A2JA 5IMFA 4TR0A 4D73B 1Z7RA 2YWOA 4AS8A 1F2EA 1ZGOA 1GWCA 3Q19A 3HY2A 4DVCA 1F6MC 3DQ4A 2M72A 1K0CA 3A2VA 1GGXA 4W6RA 1V9WA 1QMVA 3RPPA 2H01A 1QXTA 3SVNA 3FY7A 4O5UA 2GZZA 4W6SA 5ID2A 4J56E 4EF0A 5B6MA 3VWWA 2EMOA 1X5EA 2FWQA 2V32A 1SD9A 1YZXA 2V4EB 4N0VA 3LQ7A 3AKOA 4MPGA 4EKZA 5EBJA 4KA0A 6GSSA 3DPXA 1K3LA 2YWNA 3IAM2 4L13A 3GJ2A 2A50B 4HU9A 1GTUA 4EO3A 1T4ZA 2HSYA 1PRXA 3W6GA 1X0RA 2AYTA 4IP6A 2RUEA 1THXA 2HFDA 1EGRA 2GQKA 3U8AA 2WRTA 5D73A 3N9JA 3WLDA 3SSVA 1OVNA 2Q57A 3MNGA 4EL1A 1RM9A 1XZOA 1ZYPA 3GH6A 5F8BA 3FYGA 3VI5A 3RHCA 5DPJA 4PQ1A 3DQOA 2H73A 4JR6A 5FVFA 3QAGA 1OAZA 2Q6PA 3PJ7A 3V3DA 1K0DA 4W6NA 4ULXA 4KGEA 3GRXA 1M3JA 3CFFA 5F07A 5IMAA 2GX0A 1G7OA 3D21A 2H6YA 1WMJA 2Y0GA 4Q7UA 5DPGA 4XHMA 1BYEA 3FRCA 5G5FA 4KA9A 3RWAA 4L1IA 2HZEB 3LF4B 2J23A 1PKWA 1M2BA 5HZUA 2VOCA 3SBCA 5IOWA 2DD7A 4YKFA 3IP2A 2CX4A 3H4KA 4TKYA 2OTBA 4Q7RA 1PX7A 4KAGA 4XGYA 3LYKA 3IE3A 2C0EA 3BXBA 1SU9A 3TGZA 7GSSA 3FZAA 2MZCA 3DQLA 1S3CA 5INYA 2LRCA 17GSA 4HUAA 4MCUA 3EVPA 5E59A 4GSTA 4W76A 4OFMA 2VLTA 4HU7A 4EDSA 1PQNA 1HNBA 5H5RA 4ID0A 1WPIA 4X43A 3W8JA 1XWKA 4OCEA 3DQIA 1T7PB 4K0NA 1GSUA 1TU8A 2A4HA 3PPUA 4IQ1A 1T4YA 4YQMA 2PN8A 2JZSA 3LYPA 3TDGA 3HCZA 3SVRA 5GSSA 1F0BA 4EIPA 2QZ0A 1X5CA 3UL3A 5COHA 2VM2A 1V98A 4JC2A 4HOJA 1NW2A 2H9WA 4XIHA 5IO0A 1YKCA 3C73A 3LW9A 2FWFA 3UVHA 2WGRA 5KEJA 4ZBLA 1XBSA 2IMDA 2I9HA 1M99A 2DJ0A 5EPFA 5G30A 1IYHA 3SSHA 2C9IA 3DEXA 1TK5B 2H1GA 3GL4A 1W4VA 1SKSB 4CW9A 3EU3A 4PPLA 5BTTA 1R5AA 1N8JA 4AJ8A 2HRAA 4YQUA 4IHUA 3G7YA 4LJDA 2B3SA 2O24A 3DQ8A 2H5OA 4FYCA 4QL7A 2V4EC 3SWLA 4HQZA 4IKHA 5B7CA 3ZUJA 4XL5A 3HKRA 4K5RA 1XW6A 2FCHA 3AI4A 4X4JA 5ECSA 4Q7TA 4DEJA 3TKRA 2IN3A 2YPMA 4CY6A 4V2LA 5DAKB 4MF7A 2MMAA 3NEZA 3FZ9A 4PX1A 2ZO6A 3KIJA 2VO4A 3DMLA 2B5XA 3VPQA 5G1LA 3HYPA 1HD2A 1LJRA 1S3RA 4XS6A 2DKHA 3TKPA 1U88A 3M22A 4W6GA 4PNFA 1W89A 2QLGB 1O8WA 4W6AA 4PGTA 4N3DA 2V6OA 4P76A 3SVBA 3DQ9A 4MH2A 3AY8A 3MAKA 4O5QA 3TJKA 5F05A 4DKNA 1M2DA 4W6DA 2C8UA 2REMA 2AWLA 4NWSA 2AB6A 3KTLA 5B6NA 1G7EA 2A2PA 1ON4A 3M24A 1YHIA 5DQYA 5GAPD 1Q4BA 2YV9A 4W6BA 4OWYA 3MYDA 4J57E 4RYWA 3ERFA 4PUFC 5DQMA 1TI3A 4JR4A 3K1KA 3M8NA 4I6XA 2IWTA 5IO2A 3SSYA 1SENA 4PPJA 3ZRDA 3DYRA 1BG5A 4B30B 2FWGA 3EK7A 2H66A 4O7HA 3QDNA 5HR3A 3ZFBA 4OFNA 4WF5A 5EY6A 1XIYA 2KP1A 5D8IA 2HFCA 3UIWA 3ZITA 3LWAA 1B9YC 2B1KA 4GF0A 4BA7A 1GSFA 4EN1A 3A8SA 3SVCA 5EVOA 3GIXA 2H5QA 3H1RA 1K3YA 2P5RA 5C00A 5ID2B 2C9JA 3ZMKA 3GV1A 1SJZA 1TRVA 4K5SA 3LXZA 2C80A 3NT3A 3RAZA 5D96A 3KH9A 1EWXA 4W6IA 1PL2A 2OE3A 1F37A 4K0GA 4MJCA 1F3BA 2LQOA 4RQXA 4MJAA 4Z2UA 4IK9A 6GSUA 3WGEA 4KCEA 1A0FA 2RM5A 3SSPA 3GUSA 2OA7A 1KYPA 1OE8A 4MP4A 1U3IA 4PPKA 1EV4A 1KP5A 4ICYA 4L0UA 3SS0A 1THOA 5KN0A 3FR6A 2DC5A 2H74A 1XWCA 5ECMB 2PPTA 3RDWA 3TOUA 1PN0A 3DQNA 3UVTA 2EIRA 4NAXA 2Z6YA 3GL3A 4JFGA 3F3RA 2OKWA 5DDLA 2PVOC 4KNDA 1FAAA 3U5RE 3UJ1A 3I6AA 1XA9A 1GH2A 3E9JB 1RRXA 4OHSA 3ZULA 5ECOB 4RI6A 3DQCA 2YANA 5DY6A 1MDJA 3NZNA 4MJBA 4L12A 2A48A 2GW4B 2LRNA 1SKRB 3P8WA 2R2JA 3H8QA 3U0MA 4RQRA 2LV3A 1SK2A 5A4VA 4XS4A 4H47A 5IQYA 5F0GA 3CSHA 2H71A 1RMOA 2DBCA 4MLYA 1ST9A 4Z4MA 4GLTA 3VLNA 1Q4EA 4EE0A 3GL5A 3IAS2 1OXFA 3KD0A 4JF9A 3M1GA 3U0KA 4V1Ag 1ZGQA 5DU0A 1ZUXA 3LJRA 2GW3A 3TJJA 3CFAA 3HJPA 3D4MA 1AC1A 2DJ3A 2VL2C 1B4QA 3PJBA 5D9TA 2LS5A 4LQTA 6GSXA 1S6ZA 2L4QA 2F8AA 4JRRA 1SJIA 4W69A 3TKSC 3IOSA 2B3PA 4W6PA 1SYRA 2VL9A 4R6BA 3EURA 4H3LA 1K0OA 5IPHA 5ECNB 1MYWA 5HW9A 5LK4A 1LU4A 2R37A 4TR3A 2A46A 3UFZA 3O6TA 4W6HA 3NF0A 2VCWA 3GKNA 5EB6A 4W6CA 1HYUA 3UEMA 1QUWA 3EVIA 3QPMA 1YF1A 1OKTA 4N30A 3A5WA 3QFBC 1EZKA 2PXSA 1FW1A 5BTTB 4AGSA 5J9BA 4K1FA 1ZYNA 1BEDA 3VURA 4K2XA 3MGFA 4W6MA 4FQUA 5AGYA 2AAWA 2VAEA 1JC1A 5HFIA 3R3EA 5B8BA 2YJ7A 3N5OA 4O92A 2GX2A 2O87A 3DRNA 1M2AA 2L5LA 1OKDA 2B7KA 1R4WA 2JL4A 3IHQA 4E8HA 3SVOA 2N5FA 3ZTFA 3IDVA 1NHYA 4ZB9A 3HXSA 5A5KA 1PKZA 4W6OA 3GSTA 3W8SA 3KCMA 5ELAA 1B4PA 3U6VA 4W6UA 2H70A 2AJQB 4LLRA 1GLQA 5DPIA 2K9FA 3MIXA 2Z6ZA 1X9WB 1Z5YE 3ERGA 3APOA 4MABA 1Z6NA 1PFOA 2OJKA 3ADFA 3E3EA 2HSMA 1QYQA 3U8CA 3IA1A 2JU5A 2J9HA 3LXTA 2X64A 1RMPA 4YQVA 1PN9A 3MWHA 2I81A 2OACA 1AIUA 3CYNA 5CO3A 4YH2A 4L5LA 4MJEA 1V40A 2FZUA 3BXAA 1KTEA 2YV7A 4DXOA 5ECPB 2OE1A 4N10A 1TTZA 1C72A 4NWYA 2H6ZA 2H19A 1XMZA 4OMVA 4ECIA 2QRFA 4W6TA 1O8XA 1JLVA 4WR5A 1VRSD 1YEXA 4KDXA 3FEUA 4FH8A 4O32A 1K0MA 3U0NA 4ISDA 4N0ZA 3ZTLA 3KJYA 1FOVA 3WT2A 1ZYEA 3D5JA 3W1DA 1M9AA 3DQUA 1E2YA 1G0TA 2O89A 1ZOFA 3FK8A 1WOUA 3TJGA 1Q98A 3EMXA 4IGJA 1TOFA 5HFGA 4DSSA 1FO5A 1JBZA 1OC9B 1S3AA 1XSSA 14GSA 2C0GA 3HJOA 2EMNA 2FL1A 2IPAA 5J3RA 5FVIA 2H1BA 3TRXA 4HEA2 1USBA 3ERWA 1H4UA 4BDUA 4RI7A 5KOXA 5HR0A 2OBIA 1E6BA 5EXUA 3A2WA 4U2VA 3H93A 4LL4B 1TJDA 3EPTA 3A2XA 2CZ3A 3PINA 4NHZA 2AWKA 2D2ZA 3FHKA 4EIQA 5HFKA 5H89A 5ECHB 1XG8A 1EMKA 4W6LA 3OSQA 4V2MA 3CGLA 3ZLPA 3O77A 4Q5RA 4XCSA 2GZYA 1XVQA 1TRWA 4G10A 3IHGA 2DLXA 4DSQA 3PH9A 1EV9A 2Z9SA 3LA1A 5DQSA 4AF2A 4BL7A 1T8EB 2PGTA 3LF3A 1BAYA 4IZNA 2ZNMA 4BVYA 4EULA 3GYKA 3BBYA 4IBPA 5JCWA 4DXPA 2JZRA 2V2GA 4J89A 4Z4KA 1ZL9A 4LMWA 4LJDC 3C8EA 5IOXA 1MD3A 2YCDA 2GGTA 4I2UA 4I2TA 4KF4A 2VVJA 1KYSA 1O73A 1W7SA 1H75A 4CHSA 5KN3A 1MOVA 2EC4A 4F0CA 4I8BA 4EVMA 1TW9A 2F3MA 2G6EA 4L0WA 1UC7A 3D6IA 4KDUA 3G9AA 3EMPA 4TXVA 5EHUA 4BPYA 1AQVA 1PGTA 1LBKA 3F4RA 1J0FA 1J08A 4F2IA 3ST0A 1KEBA 2GZPA 3ZUFA 3VICA 4KSMA 2HRKA 4GF6B 2QA1A 3VWUA 1QQ2A 1BQ7A 5IMCA 2MBSA 1S3DA 5CRDA 3DQFA 1XW5A 3EC3A 1PX6A 1AQXA 4IK8A 3ZREA 4I97A 2P31A 3FR9A 1EOGA 3ED8A 4MNNA 3KMOA 5LD0A 4PQHA 1WWJA 1A8YA 5AISA 4KF9A 4N11A 3KZQA 2IJYA 1FHEA 3WGDA 1SL0B 4KF5A 3DVXA 2DUFA 1MD4A 4B5YA 4KGFA 5H87A 3R2QA 4DSRA 3L9VA 4POMA 1Q4DA 3RBTA 3KH7A 3S9FA 3J7Yb 3SRYA 2YDZA 5DCHA 2KP2A 1YZWA 1BJXA 1TDIA 3HVNA 2H5RA 3HVSA 4K9ZA 1DSBA 5FT3A 5CRGA 1YFPA 4ZL8A 2ICRA 4PNGA 1XCCA 1J9BA 4PFEA 3VWXA 1GL8A 1T1VA 5LTRA 2B5YA 5E4WA 3GSSA 5KN2A 4HE4A 2B3QA 2DJ2A 2FNOA 1A0RP 1RW1A 1WP0A 1CQHA 3SSTA 1Z3EA 1AAZA 5HZSA 4POBA 2DIYA 4Z2RA 2ZUPA 1UISA 1ERVA 4JEDA 1TXXA 1GSEA 3TB2A 4LA1A 1OYJA 3UBLA 5H5QA 4GOBA 4XVPA 5KN1A 2DUEA 1OE7A 3DQ2A 1B48A 4KH7A 1UN2A 4W6FA 2H1DA 4GCIA 2WISA 1H4OA 1O7UA 2DJKA 2QC7A 4IN0A 2O7KA 2QT2A 5ECIB 2P4MA 1Z9HA 3G7JA 5CNWA 1GTAA 2Z1OA 3LFLA 3P7XA 2DUGA 4G2EA 3P28A 4PQIA 3BX9A 1Y6EA 2E7PA 2H6XA 5BQLA 1RQMA 3C7MA 2I4AA 4OQWA 2DUIA 3H1OA 3FZ5A 2GQMA 3KP9A 5H5SA 5A4UA 5DTYA 3LSAA 1ACVA 2P0GA 2CX3A 3DQKA 4Z2TA 1TRSA 2OADA 3FKFA 2EIQA 4ZB1A 2BTJA 1GUHA 4EDOA 2NVLA 2C1YA 1YJ2A 2DMLA 1QY3A 2X4AA 1X9MB 3TMRA 1B9XC 3V1WA 3EK8A 5HR1A 4OO4A 3KMNA 4H3NA 1YJFA 3E0UA 3HVXA 4TW5A 3HVVA 4UTSA 2QLHA 3CMIA 3KP8A 4W7XA 2YOIA 5JCGA 2R0GA 4PXOA 3PJ5A 4USSA 1F3AA 2DD9A 4KGIA 2UZ8A 1O6JA 3ISOA 2A56B 4DXIA 2QKEA 5T3IA 4L8EA 2LEGA 1GSQA 1XPVA 13GSA 3ST2A 2YWMA 2PBJA 2BJXA 2ALBA 2G6XA 4D73A 2H0GA 2N5BA 4IK4A 3DKSA 4KE3A 2M80A 4ZILA 3D0ZA 1MDIA 3HD5A 3VFIA 2Z6XA 2B1LA 4KCAA 1SL1B 2PUKC 1V57A 3CRUA 4GSNA 2NTOA 4JE1A 22GSA 3PGTA 4LL1B 3I19A 2VCVA 1GUKA 5J5NA 2G2QA 4IK1A 4WR4A 2I3YA 3A3TA 2I1UA 2LJRA 3LVDA 4KEXA 2NDOA 1OXDA 5G1KA 2TRCP 2H1AA 2WB9A 2LNSA 3IR4A 3IBHA 2QGVA 3LORA 5LCZA 1W7TA 3DQHA 2VLVA 2F51A 3F63A 3DPWA 3BD2A 4WF4A 4YAVA 5H88A 3GX8A 1T00A 12GSA 1XWAA 3G9BA 1R5PA 2IL3A 5DCGA 4MMMA 4W73A 1YHGA 1EP8A 2PVQA 2JSYA 2E2MA 3GKMA 3IK9A 4TN8A 3CTGA 2QLEA 5GSTA 5ECKB 1GL4A 4Q9XA 3GX0A 4CY8A 3DQ7A 2HGDA 2GQLA 3NIVA 1X9SB 2FWEA 5B8AA 3VI7A 2RUFA 1TK8B 4MDCA 3ZVJA 4G0IA 3TMTA 3NT9A 4NMUA 3ZIVA 4DXMA 3UBKA 4ZF3A 4PUAA 3TKQA 3ST4A 1JZDA 3J7Yk 2R5GA 1QYFA 2PERA 4RUVA 5J4UA 2HJOA 2WFCA 4MZWA 4H86A 3ZFLA 1XOAA 4ZBAA 2ZO7A 5BRTA 4W7CA 2HZEA 6GSVA 1Z7PA 1GLPA 3K8NA 4MZBA 2GT6A 2R4VA 3IK7A 3WGXA 3VHTA 2R6KA 1M3IA 3F0IA 3SG3A 1G7KA 3G7IA 5AN1A 1EMEA 5JWRB 2VVHA 4KPIA 2H30A 1GSDA 3IR8A 4KW4A 2WCIA 4W7EA 2DSAA 2FY6A 3VPTA 3CTFA 4ORNA 1SD8A 3EE2A 1GP1A 2YZUA 4K8MA 3TJBA 2IMKA 1EMLA 3FMWA 3UOMA 3OSRA 3M9KA 1R7HA 3M9JA 4WETA 2JACA 4TXOA 4IS0A 4OD7A 3LGCA 2F8FA 3D22A 2DMMA 1KBNA 5L71A 1EMFA 4GESB 3D4TA 1Z1PA 3DPZA 2HXKA 2B6MA 2NBSA 4ZXGA 3DXBA 4G9HA 2OJLA 4HS1A 3FZ4A 2VIMA 3M3MA 2WULA 1G6YA 3L0HA 3SG4A 2VUPA 2VCQA 3DQ6A 2ON7A 3SVSA 2TRXA 2C3TA 5FHVA 1I5GA 6GSWA 5C04A 2KLXA 5KTGA 3CQFA 3SVDA 3SSLA 2O29A 4TZAA 4F9ZA 4MZCA 1ERWA 5F9GA 2DJ1A 5JWOB 2XBIA 4BWSA 3GTUA 4FYBA 1QK8A 2MMOA 1DBYA 3GA4A 2DIZA 4W77A 4X0XA 4TOPA 1MTCA 5DTLA 1Q4CA 3VK1A 4W7DA 1YDKA 1EMGA 1U3AA 3UMAA 2HSHA 4GRFA 2YJHA 2IMFA 1AUCA 1QYOA 3F9UA 4KUNA 5D9VA 2YE1A 2MMNA 3ZIJA 2OGRA 6GSYA 2OBKA 5AQBB 2VCTA 3OR5A 4G19A 4TVEA 4HI7A 4LQUA 11GSA 4OFTA 2RIIA 2G16B 1NHOA 4XOVA 2ON5A 2FD3A 1FVJA 5G31A 1CV7A 4W74A 4KW9A 5HBDA 1PA3A 5CYYA 1A2MA 4OCFA 3UARA 3I43A 1JZRA 2C0DA 4J8AA 2KOKA 4J88A 2K18A 2QLGA 3GKXA 5BT0A 3CBUA 1VGLA 2CAQA 4HVFA 2A47A 2YN1A 4ZF4A 1TU7A 4ECCA 4BIKA 3BOAA 2WHUA 2ZCTA 1DE1A 2CAIA 2MBTA 2V1MA 2OKAA 4ZINA 1O85A 3DVWA 3QR6A 3H79A 3HZ8A 1B8XA 3EVUA 2H72A 4HZ2A 4Z7XA 3SVEA 4Q5NA 2HLSA 2HZFA 3CD1A 4H48A 1Y25A 2WSNA 3CBEA 3GNJA 2L6DA 3DQJA 3DGQA 2A54B 3KEBA 2H0IA 3HZ4A 5J41A 3GKKA 3WCKA 4DXQA 2A4VA 1IYIA 16GSA 4NV2A 2KHPA 4LJCA 3E5WA 1F09A 2IMEA 4NHWA 4GQFA 2O2BA 1FVKA 1XVWA 1ERUA 1ZYQB 4W7RA 4X1UA 4HSCX 4KF5C 1QXHA 1GUMA 2C4JA 4TR1A 5IPGA 3KCTA 3HJMA 4R6DA 3P2AA 3O78A 2LKUA 2AH8A 4DKMA 1EMCA 3PIBA 3ED3A 4EDYA 1EEMA 1N2AA 4ZL7A 3VWVA 3P90A 1JC0A 3EKJA 2HNLA 1EOHA 2FWHA 3SVUA 1PL1A 4KB3A 2EMDA 3OGOA 2IE2A 4OJ0A 4HQ9A 19GSA 1ZGNA 1A8LA 2X8CA 4Q5FA 4BVXA 4FIWA 4MK3A 4AJ6A 4W6JA 2CVDA 4GTUA 2AUVA 2K8SA 5HZOA 3BCIA 4W7FA 2L6CA 4MF6A 3LS3A 5ABRA 4HQCA 5G5EA 3BJ5A 4YAPA 2HRNA 2VAFA 4ACSA 2A2RA 2R0PA 1VF4A 2JSZA 3TRQA 2AHAA 2B5EA 1YY7A 4EXJA 1TKDB 5GZZB 2PWJA 3EWLA 1NSWA 1FG4A 2XPEA 5IMDA 4IVFA 2LQQA 3M0FA 3S05A 4NPBA 2ES7A 3GJ1A 1XOBA 3SG6A 2WSOA 1SL2B 2IB6A 3HDCA 5KOWA 2A52B 1M9BA 1HQOA 5DRFA 2WJUA 3IV4A 4ZB6A 4XOWA 5IMVA 1EMAA 1Z1QA 1JFUA 4XS4B 2G3OA 2N5AA 2YP6A 4DXNA 4G0LA 5DVBA 3ME8A 2H0HA 3QAVA 3IC4A 2GSSA 1WJKA 3DWVA 1SK0A 2CVBA 3DQEA 3UAPA 4HQ8A 3VHTB 4ANJA 1AW9A 3TOTA 4KW6A 2ARLA 2X8HA 4ZIJA 3SG5A 4MPFA 4EMQA 3WT1A 3IXRA 4CDOA 3US3A 1EMMA 2C3QA 2G2SB 1UVZA 1VF3A 1Z6MA 5FVGA 1AXDA 3O76A 3EYTA 3EVVA 3O3TA 2TIRA 2LJKA 2FGXA 4KW8A 4TXOB 3CFHA 4JGEA 2PU9C 3F4TA 3QOUA 4KDYA 3RPNA 4IW9A 2HCGA 3DQAA 4IJ3A 5D9XA 4IQAA 5HGEA 1GSYA 1QGVA 1X5DA 1VF2A 2QSIA 3EINA 3CSJA 3VK9A 2C0FA 3F3QA 2RH7A 2ZMWA 4HJ2A 2HRSA 1V2AA 5ENUA 2WURA 3IRAA 3H1NA 4H3MA 2GS3A 3DQ1A 1DUGA 3HHVA 4FYUA 1F9MA 2JADA 3EVRA 3UG0A 1YQ1A 2GSTA 2DKIA 4JZQA 1KNGA 2FUG2 3BXCA 3W1CA 4IJIA 2DDDA 4LW5A 3RWTA 1A24A 3GTUB 1GNWA 4XTSA 1BFPA 1H6RA 5DTZA 4HZ4A 2FA8A 1EEJA 4OO5A 4W7AA 4F82A 2XHFA 3DIEA 1JLWA 3E5TA 5G2ZA 1BX9A 4EDZA 4AR7A 2HGYA 3SSKA 3GURA 3KXOA 3TCOA 2M46A 2POXA 3TRPA 4WXTA 3RHBA 4K7IA 1B9CA 2PXWA 4O5RA 3DQMA 5DALA 2HYXA 4G0KA 3GN3A 2VL3A 1XAEA 1M7TA 5ECQB
chains in the Genus database with same CATH topology
2B7JA 2G5ZB 5J2OA 4W6KA 1O81A 5JCUA 5J9CA 2XBQA 1FOHA 1EMBA 3AI5A 2IIYA 4TR4A 4IP1A 2H6VA 2XC2A 10GSA 3Q6OA 2L5OA 5IM9A 3F8UA 5AIVA 3EK4A 3KTBA 4ZBBA 1ZZYA 2G0FA 4WBRD 3HA9A 1I9DA 1ZMAA 1YEPA 2LJAA 9GSSA 4EUYA 2O85A 3GB3A 2DUHA 2LRTA 1RK4A 2IFQA 1GTIA 1NM3A 2K8VA 20GSA 4JU5A 3SG2A 3I69A 2H75A 1OC3A 2AHEA 5DBQA 1K0NA 4QQ7A 1RMMA 1SKWB 4GWRA 2HPWA 3GFKA 3GH9A 2H5PA 2X8GA 1ABAA 1CQGA 4DSSB 4IK5A 4K6XA 4NXIA 2OTEA 2A53B 1WIKA 2WDUA 3EKHA 3FR3A 2CA8A 5A4WA 1KYRA 1ILOA 1QFNA 3GMFA 1GNEA 3CRTA 4F0BA 1SYXA 4K7NA 3EU4A 5DJLA 5HQPA 2F9SA 2VLUA 1EP7A 4BWQA 1OC9A 3CB9A 1XFLA 1XW9A 4TR1B 1AQWA 2OE0A 3DD3A 2H76A 4V1Ap 3ZVJD 4HQSA 8GSSA 4GQCA 4MF5A 3MDKA 2G3DB 4W75A 5EXCI 2MMZA 2P5QA 2EIOA 3L4NA 3JCML 3APSA 1MEKA 3WYWA 1W7UA 1ERTA 1WE0A 3CXGA 3LEFA 1URMA 4L5OA 3NOFA 1K3OA 1Q4JA 2K6VA 4V2NA 5HR2A 2V4EA 1U87A 1YHHA 5EXBA 4EC0A 3SV5A 1GSSA 3Q74A 2FHEA 2HT9A 3WD6A 2WHSA 4BL7B 4P3YB 3GEXA 4LJBA 1TK0B 5CRWA 4W72A 2KUCA 2O8VB 2X99A 1HCJA 4BVYB 4K2DA 2CVKA 4Q5QA 4BVXB 4TZGA 4POKA 3L9SA 3SG7A 3WLCA 2LUSA 2LSTA 1K0BA 3QFAC 2VZXA 4PTSA 4ECBA 3ZYWA 2YZHA 4F03A 1A23A 1OC8A 5DRGA 2L57A 2VCXA 1OXEA 2VM1A 2C3NA 2RLIA 2AWMA 1A2LA 2WS2A 1YKAA 4WBJA 1Q73A 2YFPA 1HUYA 5HZTA 2E2GA 3DQ3A 3I9V2 3L9UA 1GFLA 1K0AA 4WEYA 1JZOA 2VCZA 4YKGA 5LTPA 5ECRB 2CQ9A 3ST3A 3CD9A 4XRAA 4ML6A 4I2YA 4P1QA 2GSRA 3LVCA 1YF0A 2IB5A 4MH3A 2MYGA 2GTUA 3E5VA 2AWJA 3TJFA 1FB0A 1U6TA 3TUEA 5LTQA 1XWGA 4ZBDA 1C4FA 4LMVA 2V6KA 2GVPA 5F06A 4J2FA 3A5IA 2CV4A 3QAWA 1R26A 3ME7A 4RYSA 1UA5A 5FHIA 2ZMUA 1V58A 4JBBA 3Q18A 5FWGA 3FW2A 4MA9A 3L78A 2X49A 3QCPA 2R3XA 1GRXA 1T3BA 6GSTA 2RM6A 4ZL9A 2VD0A 4JEOA 1GTBA 2IOVA 5ECLB 1ZCPA 2LTKA 4A5PA 2HI7A 2QA2A 3C1SA 3TKSE 2L4CA 4I5QA 1MOUA 1ML6A 2HQZA 4K7OA 4NV5A 4ZF5A 2R0CA 2AV4A 5DQBA 5JWQB 4ML1A 2G6YA 5EJUA 5IIZA 3ZMLA 4RTCA 3KCSA 3GHAA 4OY4A 2YE0A 1M0UA 2NPBA 1ZGPA 1EGOA 1JBYA 5AIXA 1SJ6A 1TRUA 5DTXA 18GSA 4AJ7A 5D9WA 1PMTA 4TRXA 2YNXA 1XXUA 2QLIA 5EB7A 2FA4A 5CREA 5EL8A 1WRYA 2WHTA 5CAXA 1DE2A 4KX4A 2GSQA 3F6DA 3IC8A 2CZ2A 1MDKA 2CT6A 4KSOA 3KM6A 4ZB8A 2JZTA 4HDEA 1PSQA 3DQDA 3U0LA 2OKYA 4ZIOA 2HE3A 1Q4AA 5DALB 1HNAA 1PD21 2QU1A 4XRDA 5DJMA 2XPDA 5DAKA 2HQKA 4Q9WA 1VF1A 4GXZA 2WZ9A 3QMXA 2E0QA 1G6WA 4ECJA 4QL9A 2GDRA 5BMUA 1JHBA 5LNKe 2GLRA 3LSZA 2L59A 2VVIA 2BTOT 1FB6A 2BMXA 5GAND 3LG6A 4JRBA 3CSIA 3LVAA 1YJ6A 3IPZA 2A2SA 4PURA 4GSSA 2IMIA 4ILFA 2H8LA 5D93A 5ELGA 3PR8A 5DPHA 3C71A 4POLA 2PMTA 1HNCA 1GULA 3NEDA 3MSZA 4HJMA 4OGSA 3U8PA 2LNTA 3F6FA 2VADA 2WIQA 2IFQB 3F4SA 1TI1A 3ZZXA 3P8UA 4IELA 3BCKA 2HRFA 2H8QA 2DDCA 5IMZA 2VL2A 5CP1A 4FO5A 1SK1A 5CRHA 3ZL5A 1XQMA 2YWIA 4KAEA 4E8EA 1JZWA 4XS1A 2DJJA 4ZFSA 3C1RA 4B30A 3TKSA 2FLSA 2V41A 2VD1A 2GT5A 4WKWA 4IK3A 3KGKA 3QD9A 3DQ5A 1XWBA 1TP9A 3APQA 1A2JA 5IMFA 4TR0A 4D73B 1Z7RA 2YWOA 4AS8A 1F2EA 1ZGOA 1GWCA 3Q19A 3HY2A 4DVCA 1F6MC 3DQ4A 2M72A 1K0CA 3A2VA 1GGXA 4W6RA 1V9WA 1QMVA 3RPPA 2H01A 1QXTA 3SVNA 3FY7A 4O5UA 2GZZA 4W6SA 5ID2A 4J56E 4EF0A 5B6MA 3VWWA 2EMOA 1X5EA 2FWQA 2V32A 1SD9A 1YZXA 2V4EB 4N0VA 3LQ7A 3AKOA 4MPGA 4EKZA 5EBJA 4KA0A 6GSSA 3DPXA 1K3LA 2YWNA 3IAM2 4L13A 3GJ2A 2A50B 4HU9A 1GTUA 4EO3A 1T4ZA 2HSYA 1PRXA 3W6GA 1X0RA 2AYTA 4IP6A 2RUEA 1THXA 2HFDA 1EGRA 2GQKA 3U8AA 2WRTA 5D73A 3N9JA 3WLDA 3SSVA 1OVNA 2Q57A 3MNGA 4EL1A 1RM9A 1XZOA 1ZYPA 3GH6A 5F8BA 3FYGA 3VI5A 3RHCA 5DPJA 4PQ1A 3DQOA 2H73A 4JR6A 5FVFA 3QAGA 1OAZA 2Q6PA 3PJ7A 3V3DA 1K0DA 4W6NA 4ULXA 4KGEA 3GRXA 5IMAA 3CFFA 5F07A 1G7OA 2GX0A 3D21A 2H6YA 1WMJA 2Y0GA 4Q7UA 5DPGA 4XHMA 1BYEA 3FRCA 5G5FA 4KA9A 3RWAA 4L1IA 2HZEB 3LF4B 2J23A 1PKWA 1M2BA 5HZUA 2VOCA 3SBCA 5IOWA 2DD7A 4YKFA 3IP2A 2CX4A 3H4KA 4TKYA 2OTBA 4Q7RA 1PX7A 4KAGA 4XGYA 3LYKA 3IE3A 2C0EA 3BXBA 1SU9A 3TGZA 7GSSA 3FZAA 2MZCA 3DQLA 1S3CA 5INYA 2LRCA 17GSA 4HUAA 4MCUA 3EVPA 5E59A 4GSTA 4W76A 4OFMA 2VLTA 4HU7A 4EDSA 1PQNA 1HNBA 5H5RA 4ID0A 1WPIA 4X43A 3W8JA 1XWKA 4OCEA 3DQIA 1T7PB 4K0NA 1GSUA 1TU8A 2A4HA 3PPUA 4IQ1A 1T4YA 4YQMA 2PN8A 2JZSA 3LYPA 3TDGA 3HCZA 3SVRA 5GSSA 1F0BA 4EIPA 2QZ0A 1X5CA 3UL3A 5COHA 2VM2A 1V98A 4JC2A 4HOJA 1NW2A 2H9WA 4XIHA 5IO0A 1YKCA 3C73A 3LW9A 2FWFA 3UVHA 2WGRA 5KEJA 4ZBLA 1XBSA 2IMDA 2I9HA 1M99A 2DJ0A 5EPFA 5G30A 1IYHA 3SSHA 2C9IA 3DEXA 1TK5B 2H1GA 3GL4A 1W4VA 1SKSB 4CW9A 3EU3A 4PPLA 5BTTA 1R5AA 1N8JA 4AJ8A 2HRAA 4YQUA 4IHUA 3G7YA 4LJDA 2B3SA 2O24A 3DQ8A 2H5OA 4FYCA 4QL7A 2V4EC 3SWLA 4HQZA 4IKHA 5B7CA 3ZUJA 4XL5A 3HKRA 4K5RA 1XW6A 2FCHA 3AI4A 4X4JA 5ECSA 4Q7TA 4DEJA 3TKRA 2IN3A 2YPMA 4CY6A 4V2LA 5DAKB 4MF7A 2MMAA 3NEZA 3FZ9A 4PX1A 2ZO6A 3KIJA 2VO4A 3DMLA 2B5XA 3VPQA 5G1LA 3HYPA 1HD2A 1LJRA 4XS6A 2DKHA 3TKPA 1U88A 3M22A 4W6GA 4PNFA 1W89A 2QLGB 1O8WA 4W6AA 4PGTA 4N3DA 2V6OA 4P76A 3SVBA 3DQ9A 4MH2A 3AY8A 3MAKA 4O5QA 3TJKA 5F05A 4DKNA 1M2DA 4W6DA 2C8UA 2REMA 2AWLA 4NWSA 2AB6A 3KTLA 5B6NA 1G7EA 2A2PA 1ON4A 3M24A 1YHIA 5DQYA 5GAPD 1Q4BA 2YV9A 4W6BA 4OWYA 3MYDA 4J57E 4RYWA 3ERFA 4PUFC 5DQMA 1TI3A 4JR4A 3K1KA 3M8NA 4I6XA 2IWTA 5IO2A 3SSYA 1SENA 4PPJA 3ZRDA 3DYRA 1BG5A 4B30B 2FWGA 3EK7A 2H66A 4O7HA 3QDNA 5HR3A 3ZFBA 4OFNA 4WF5A 5EY6A 1XIYA 2KP1A 5D8IA 2HFCA 3UIWA 3ZITA 3LWAA 1B9YC 2B1KA 4GF0A 4BA7A 1GSFA 4EN1A 3A8SA 3SVCA 5EVOA 3GIXA 2H5QA 3H1RA 1K3YA 2P5RA 5C00A 5ID2B 2C9JA 3ZMKA 3GV1A 1SJZA 1TRVA 4K5SA 3LXZA 2C80A 3NT3A 3RAZA 5D96A 3KH9A 1EWXA 4W6IA 1PL2A 2OE3A 1F37A 4K0GA 4MJCA 1F3BA 2LQOA 4RQXA 4MJAA 4Z2UA 4IK9A 6GSUA 3WGEA 4KCEA 1A0FA 2RM5A 3SSPA 3GUSA 2OA7A 1KYPA 1OE8A 4MP4A 1U3IA 4PPKA 1EV4A 1KP5A 4ICYA 4L0UA 3SS0A 1THOA 5KN0A 3FR6A 2DC5A 2H74A 1XWCA 5ECMB 2PPTA 3RDWA 3TOUA 1PN0A 3DQNA 3UVTA 2EIRA 4NAXA 2Z6YA 3GL3A 4JFGA 3F3RA 2OKWA 5DDLA 2PVOC 4KNDA 1FAAA 3U5RE 3UJ1A 3I6AA 1XA9A 1GH2A 3E9JB 1RRXA 4OHSA 3ZULA 5ECOB 4RI6A 3DQCA 2YANA 5DY6A 1MDJA 3NZNA 4MJBA 4L12A 2A48A 2GW4B 2LRNA 1SKRB 3P8WA 2R2JA 3H8QA 3U0MA 4RQRA 2LV3A 1SK2A 5A4VA 4XS4A 4H47A 5IQYA 5F0GA 3CSHA 2H71A 1RMOA 2DBCA 4MLYA 1ST9A 4Z4MA 4GLTA 3VLNA 1Q4EA 4EE0A 3GL5A 3IAS2 1OXFA 3KD0A 4JF9A 3M1GA 3U0KA 4V1Ag 1ZGQA 5DU0A 1ZUXA 3LJRA 2GW3A 3TJJA 3CFAA 3HJPA 3D4MA 1AC1A 2DJ3A 2VL2C 1B4QA 3PJBA 5D9TA 2LS5A 4LQTA 6GSXA 1S6ZA 2L4QA 2F8AA 4JRRA 1SJIA 4W69A 3TKSC 3IOSA 2B3PA 4W6PA 1SYRA 2VL9A 4R6BA 3EURA 4H3LA 1K0OA 5IPHA 5ECNB 1MYWA 5HW9A 5LK4A 1LU4A 2R37A 4TR3A 2A46A 3UFZA 3O6TA 4W6HA 3NF0A 2VCWA 3GKNA 5EB6A 4W6CA 1HYUA 3UEMA 1QUWA 3EVIA 3QPMA 1YF1A 1OKTA 4N30A 3A5WA 3QFBC 1EZKA 2PXSA 1FW1A 5BTTB 4AGSA 5J9BA 4K1FA 1ZYNA 1BEDA 3VURA 4K2XA 3MGFA 4W6MA 4FQUA 5AGYA 2AAWA 2VAEA 1JC1A 5HFIA 3R3EA 5B8BA 2YJ7A 3N5OA 4O92A 2GX2A 2O87A 3DRNA 1M2AA 2L5LA 1OKDA 2B7KA 1R4WA 2JL4A 3IHQA 4E8HA 3SVOA 2N5FA 3ZTFA 3IDVA 1NHYA 4ZB9A 3HXSA 5A5KA 1PKZA 4W6OA 3GSTA 3W8SA 3KCMA 5ELAA 1B4PA 3U6VA 4W6UA 2H70A 2AJQB 4LLRA 1GLQA 5DPIA 2K9FA 3MIXA 2Z6ZA 1X9WB 1Z5YE 3ERGA 3APOA 4MABA 1Z6NA 2OJKA 3ADFA 3E3EA 2HSMA 1QYQA 3U8CA 3IA1A 2JU5A 2J9HA 3LXTA 2X64A 1RMPA 4YQVA 1PN9A 3MWHA 2I81A 2OACA 1AIUA 3CYNA 5CO3A 4YH2A 4L5LA 4MJEA 1V40A 2FZUA 3BXAA 1KTEA 2YV7A 4DXOA 5ECPB 2OE1A 4N10A 1TTZA 1C72A 4NWYA 2H6ZA 2H19A 1XMZA 4OMVA 4ECIA 2QRFA 4W6TA 1O8XA 1JLVA 4WR5A 1VRSD 1YEXA 4KDXA 3FEUA 4FH8A 4O32A 1K0MA 3U0NA 4ISDA 4N0ZA 3ZTLA 3KJYA 1FOVA 3WT2A 1ZYEA 3D5JA 3W1DA 1M9AA 3DQUA 1E2YA 1G0TA 2O89A 1ZOFA 3FK8A 1WOUA 3TJGA 1Q98A 3EMXA 4IGJA 1TOFA 5HFGA 4DSSA 1FO5A 1JBZA 1OC9B 1S3AA 1XSSA 14GSA 2C0GA 3HJOA 2EMNA 2FL1A 2IPAA 5J3RA 5FVIA 2H1BA 3TRXA 4HEA2 1USBA 3ERWA 1H4UA 4BDUA 4RI7A 5KOXA 5HR0A 2OBIA 1E6BA 5EXUA 3A2WA 4U2VA 3H93A 4LL4B 1TJDA 3EPTA 3A2XA 2CZ3A 3PINA 4NHZA 2AWKA 2D2ZA 3FHKA 4EIQA 5HFKA 5H89A 5ECHB 1EMKA 4W6LA 3OSQA 4V2MA 3CGLA 3ZLPA 3O77A 4Q5RA 4XCSA 2GZYA 1XVQA 1TRWA 4G10A 3IHGA 2DLXA 4DSQA 3PH9A 1EV9A 2Z9SA 3LA1A 5DQSA 4AF2A 4BL7A 1T8EB 2PGTA 3LF3A 1BAYA 4IZNA 2ZNMA 4BVYA 4EULA 3GYKA 3BBYA 4IBPA 5JCWA 4DXPA 2JZRA 2V2GA 4J89A 4Z4KA 1ZL9A 4LMWA 4LJDC 3C8EA 5IOXA 1MD3A 2YCDA 2GGTA 4I2UA 4I2TA 4KF4A 2VVJA 1KYSA 1O73A 1W7SA 1H75A 4CHSA 5KN3A 1MOVA 2EC4A 4F0CA 4I8BA 4EVMA 1TW9A 2F3MA 2G6EA 4L0WA 1UC7A 3D6IA 4KDUA 3G9AA 3EMPA 4TXVA 5EHUA 4BPYA 1AQVA 1PGTA 1LBKA 3F4RA 1J0FA 1J08A 4F2IA 3ST0A 1KEBA 2GZPA 3ZUFA 3VICA 4KSMA 2HRKA 4GF6B 2QA1A 3VWUA 1QQ2A 1BQ7A 5IMCA 2MBSA 1S3DA 5CRDA 3DQFA 1XW5A 3EC3A 1PX6A 1AQXA 4IK8A 3ZREA 4I97A 2P31A 3FR9A 1EOGA 3ED8A 4MNNA 3KMOA 5LD0A 4PQHA 1WWJA 1A8YA 5AISA 4KF9A 4N11A 3KZQA 2IJYA 1FHEA 3WGDA 1SL0B 4KF5A 3DVXA 2DUFA 1MD4A 4B5YA 4KGFA 5H87A 3R2QA 4DSRA 3L9VA 4POMA 1Q4DA 3RBTA 3KH7A 3S9FA 3J7Yb 3SRYA 2YDZA 5DCHA 2KP2A 1YZWA 1BJXA 1TDIA 2H5RA 3HVSA 4K9ZA 1DSBA 5FT3A 5CRGA 1YFPA 4ZL8A 2ICRA 4PNGA 1XCCA 1J9BA 4PFEA 3VWXA 1GL8A 1T1VA 5LTRA 2B5YA 5E4WA 3GSSA 5KN2A 4HE4A 2B3QA 2DJ2A 2FNOA 1A0RP 1RW1A 1WP0A 1CQHA 3SSTA 1Z3EA 1AAZA 5HZSA 4POBA 2DIYA 4Z2RA 2ZUPA 1UISA 1ERVA 4JEDA 1TXXA 1GSEA 3TB2A 4LA1A 1OYJA 3UBLA 5H5QA 4GOBA 4XVPA 5KN1A 2DUEA 1OE7A 3DQ2A 1B48A 4KH7A 1UN2A 4W6FA 2H1DA 4GCIA 2WISA 1H4OA 1O7UA 2DJKA 2QC7A 4IN0A 2O7KA 2QT2A 5ECIB 2P4MA 1Z9HA 3G7JA 5CNWA 1GTAA 2Z1OA 3LFLA 3P7XA 2DUGA 4G2EA 3P28A 4PQIA 3BX9A 1Y6EA 2E7PA 2H6XA 5BQLA 1RQMA 3C7MA 2I4AA 4OQWA 2DUIA 3H1OA 3FZ5A 2GQMA 3KP9A 5H5SA 5A4UA 5DTYA 3LSAA 1ACVA 2P0GA 2CX3A 3DQKA 4Z2TA 1TRSA 2OADA 3FKFA 2EIQA 4ZB1A 2BTJA 1GUHA 4EDOA 2NVLA 2C1YA 1YJ2A 2DMLA 1QY3A 2X4AA 1X9MB 3TMRA 1B9XC 3V1WA 3EK8A 5HR1A 4OO4A 3KMNA 4H3NA 1YJFA 3E0UA 3HVXA 4TW5A 3HVVA 4UTSA 2QLHA 3CMIA 3KP8A 4W7XA 2YOIA 5JCGA 2R0GA 4PXOA 3PJ5A 4USSA 1F3AA 2DD9A 4KGIA 2UZ8A 1O6JA 3ISOA 2A56B 4DXIA 2QKEA 5T3IA 4L8EA 2LEGA 1GSQA 1XPVA 13GSA 3ST2A 2YWMA 2PBJA 2BJXA 2ALBA 2G6XA 4D73A 2H0GA 2N5BA 4IK4A 3DKSA 4KE3A 2M80A 4ZILA 3D0ZA 1MDIA 3HD5A 3VFIA 2Z6XA 2B1LA 4KCAA 1SL1B 2PUKC 1V57A 3CRUA 4GSNA 2NTOA 4JE1A 22GSA 3PGTA 4LL1B 3I19A 2VCVA 1GUKA 5J5NA 2G2QA 4IK1A 4WR4A 2I3YA 3A3TA 2I1UA 2LJRA 3LVDA 4KEXA 2NDOA 1OXDA 5G1KA 2TRCP 2H1AA 2WB9A 2LNSA 3IR4A 3IBHA 2QGVA 3LORA 5LCZA 1W7TA 3DQHA 2VLVA 2F51A 3F63A 3DPWA 3BD2A 4WF4A 4YAVA 5H88A 3GX8A 1T00A 12GSA 1XWAA 3G9BA 1R5PA 2IL3A 5DCGA 4MMMA 4W73A 1YHGA 1EP8A 2PVQA 2JSYA 2E2MA 3GKMA 3IK9A 4TN8A 3CTGA 2QLEA 5GSTA 5ECKB 1GL4A 4Q9XA 3GX0A 4CY8A 3DQ7A 2HGDA 2GQLA 3NIVA 1X9SB 2FWEA 5B8AA 3VI7A 2RUFA 1TK8B 4MDCA 3ZVJA 4G0IA 3TMTA 3NT9A 4NMUA 3ZIVA 4DXMA 3UBKA 4ZF3A 4PUAA 3TKQA 3ST4A 1JZDA 3J7Yk 2R5GA 1QYFA 2PERA 4RUVA 5J4UA 2HJOA 2WFCA 4MZWA 4H86A 3ZFLA 1XOAA 4ZBAA 2ZO7A 5BRTA 4W7CA 2HZEA 6GSVA 1Z7PA 1GLPA 3K8NA 4MZBA 2GT6A 2R4VA 3IK7A 3WGXA 3VHTA 2R6KA 3F0IA 3SG3A 1G7KA 3G7IA 5AN1A 1EMEA 5JWRB 2VVHA 4KPIA 2H30A 1GSDA 3IR8A 4KW4A 2WCIA 4W7EA 2DSAA 2FY6A 3VPTA 3CTFA 4ORNA 1SD8A 3EE2A 1GP1A 2YZUA 4K8MA 3TJBA 2IMKA 1EMLA 3FMWA 3UOMA 3OSRA 3M9KA 1R7HA 3M9JA 4WETA 2JACA 4TXOA 4IS0A 4OD7A 3LGCA 2F8FA 3D22A 2DMMA 1KBNA 5L71A 1EMFA 4GESB 3D4TA 1Z1PA 3DPZA 2HXKA 2B6MA 2NBSA 4ZXGA 3DXBA 4G9HA 2OJLA 4HS1A 3FZ4A 2VIMA 3M3MA 2WULA 1G6YA 3L0HA 3SG4A 2VUPA 2VCQA 3DQ6A 2ON7A 3SVSA 2TRXA 2C3TA 5FHVA 1I5GA 6GSWA 5C04A 2KLXA 5KTGA 3SVDA 3SSLA 2O29A 4TZAA 4F9ZA 4MZCA 1ERWA 5F9GA 2DJ1A 5JWOB 2XBIA 4BWSA 3GTUA 4FYBA 1QK8A 2MMOA 1DBYA 3GA4A 2DIZA 4W77A 4X0XA 4TOPA 1MTCA 5DTLA 1Q4CA 3VK1A 4W7DA 1YDKA 1EMGA 1U3AA 3UMAA 2HSHA 4GRFA 2YJHA 2IMFA 1AUCA 1QYOA 3F9UA 4KUNA 5D9VA 2YE1A 2MMNA 3ZIJA 2OGRA 6GSYA 2OBKA 5AQBB 2VCTA 3OR5A 4G19A 4TVEA 4HI7A 4LQUA 11GSA 4OFTA 2RIIA 2G16B 1NHOA 4XOVA 2ON5A 2FD3A 1FVJA 5G31A 1CV7A 4W74A 4KW9A 5HBDA 1PA3A 5CYYA 1A2MA 4OCFA 3UARA 3I43A 1JZRA 2C0DA 4J8AA 2KOKA 4J88A 2K18A 2QLGA 3GKXA 5BT0A 3CBUA 1VGLA 2CAQA 4HVFA 2A47A 2YN1A 4ZF4A 1TU7A 4ECCA 3BOAA 2WHUA 2ZCTA 1DE1A 2CAIA 2MBTA 2V1MA 2OKAA 4ZINA 1O85A 3DVWA 3QR6A 3H79A 3HZ8A 1B8XA 3EVUA 2H72A 4HZ2A 4Z7XA 3SVEA 4Q5NA 2HLSA 2HZFA 3CD1A 4H48A 1Y25A 2WSNA 3CBEA 3GNJA 2L6DA 3DQJA 3DGQA 2A54B 3KEBA 2H0IA 3HZ4A 5J41A 3GKKA 3WCKA 4DXQA 2A4VA 1IYIA 16GSA 4NV2A 2KHPA 4LJCA 3E5WA 1F09A 2IMEA 4NHWA 4GQFA 2O2BA 1FVKA 1XVWA 1ERUA 1ZYQB 4W7RA 4X1UA 4KF5C 1QXHA 1GUMA 2C4JA 4TR1A 5IPGA 3KCTA 3HJMA 4R6DA 3P2AA 3O78A 2LKUA 2AH8A 4DKMA 1EMCA 3PIBA 3ED3A 4EDYA 1EEMA 1N2AA 4ZL7A 3VWVA 3P90A 1JC0A 3EKJA 2HNLA 1EOHA 2FWHA 3SVUA 1PL1A 4KB3A 2EMDA 3OGOA 2IE2A 4OJ0A 4HQ9A 19GSA 1ZGNA 1A8LA 2X8CA 4Q5FA 4BVXA 4FIWA 4MK3A 4AJ6A 4W6JA 2CVDA 4GTUA 2AUVA 2K8SA 5HZOA 3BCIA 4W7FA 2L6CA 4MF6A 3LS3A 5ABRA 4HQCA 5G5EA 3BJ5A 4YAPA 2HRNA 2VAFA 4ACSA 2A2RA 2R0PA 1VF4A 2JSZA 3TRQA 2AHAA 2B5EA 1YY7A 4EXJA 1TKDB 5GZZB 2PWJA 3EWLA 1NSWA 1FG4A 2XPEA 5IMDA 4IVFA 2LQQA 3M0FA 3S05A 4NPBA 2ES7A 3GJ1A 1XOBA 3SG6A 2WSOA 1SL2B 2IB6A 3HDCA 5KOWA 2A52B 1M9BA 1HQOA 5DRFA 2WJUA 3IV4A 4ZB6A 4XOWA 5IMVA 1EMAA 1Z1QA 1JFUA 4XS4B 2G3OA 2N5AA 2YP6A 4DXNA 4G0LA 5DVBA 3ME8A 2H0HA 3QAVA 3IC4A 2GSSA 1WJKA 3DWVA 1SK0A 2CVBA 3DQEA 3UAPA 4HQ8A 3VHTB 4ANJA 1AW9A 3TOTA 4KW6A 2ARLA 2X8HA 4ZIJA 3SG5A 4MPFA 4EMQA 3WT1A 3IXRA 4CDOA 3US3A 1EMMA 2C3QA 2G2SB 1UVZA 1VF3A 1Z6MA 5FVGA 1AXDA 3O76A 3EYTA 3EVVA 3O3TA 2TIRA 2LJKA 2FGXA 4KW8A 4TXOB 3CFHA 4JGEA 2PU9C 3F4TA 3QOUA 4KDYA 3RPNA 4IW9A 2HCGA 3DQAA 4IJ3A 5D9XA 4IQAA 5HGEA 1GSYA 1QGVA 1X5DA 1VF2A 2QSIA 3EINA 3CSJA 3VK9A 2C0FA 3F3QA 2RH7A 2ZMWA 4HJ2A 2HRSA 1V2AA 5ENUA 2WURA 3IRAA 3H1NA 4H3MA 2GS3A 3DQ1A 1DUGA 3HHVA 4FYUA 1F9MA 2JADA 3EVRA 3UG0A 1YQ1A 2GSTA 2DKIA 4JZQA 1KNGA 2FUG2 3BXCA 3W1CA 4IJIA 2DDDA 4LW5A 3RWTA 1A24A 3GTUB 1GNWA 4XTSA 1BFPA 1H6RA 5DTZA 4HZ4A 2FA8A 1EEJA 4OO5A 4W7AA 4F82A 2XHFA 3DIEA 1JLWA 3E5TA 5G2ZA 1BX9A 4EDZA 4AR7A 2HGYA 3SSKA 3GURA 3KXOA 3TCOA 2M46A 2POXA 3TRPA 4WXTA 3RHBA 4K7IA 1B9CA 2PXWA 4O5RA 3DQMA 5DALA 2HYXA 4G0KA 3GN3A 2VL3A 1XAEA 1M7TA 5ECQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B7J A;  2G5Z B;  5J2O A;  4W6K A;  1O81 A;  5JCU A;  5J9C A;  2XBQ A;  1EMB A;  3AI5 A;  2IIY A;  4TR4 A;  4IP1 A;  2H6V A;  2XC2 A;  10GS A;  3Q6O A;  2L5O A;  5IM9 A;  3F8U A;  5AIV A;  3EK4 A;  3KTB A;  4ZBB A;  1ZZY A;  2G0F A;  4WBR D;  3HA9 A;  1I9D A;  1ZMA A;  1YEP A;  2LJA A;  9GSS A;  4EUY A;  2O85 A;  3GB3 A;  2DUH A;  2LRT A;  1RK4 A;  2IFQ A;  1GTI A;  1NM3 A;  2K8V A;  20GS A;  4JU5 A;  3SG2 A;  3I69 A;  2H75 A;  1OC3 A;  2AHE A;  5DBQ A;  1K0N A;  4QQ7 A;  1RMM A;  1SKW B;  4GWR A;  2HPW A;  3GFK A;  3GH9 A;  2H5P A;  2X8G A;  1ABA A;  1CQG A;  4DSS B;  4IK5 A;  4K6X A;  4NXI A;  2OTE A;  2A53 B;  1WIK A;  2WDU A;  3EKH A;  3FR3 A;  2CA8 A;  5A4W A;  1KYR A;  1ILO A;  1QFN A;  3GMF A;  1GNE A;  3CRT A;  4F0B A;  1SYX A;  4K7N A;  3EU4 A;  5DJL A;  5HQP A;  2F9S A;  2VLU A;  1EP7 A;  4BWQ A;  1OC9 A;  3CB9 A;  1XFL A;  1XW9 A;  4TR1 B;  1AQW A;  2OE0 A;  3DD3 A;  2H76 A;  4V1A p;  3ZVJ D;  4HQS A;  8GSS A;  4GQC A;  4MF5 A;  3MDK A;  2G3D B;  4W75 A;  5EXC I;  2MMZ A;  2P5Q A;  2EIO A;  3L4N A;  3JCM L;  3APS A;  1MEK A;  3WYW A;  1W7U A;  1ERT A;  1WE0 A;  3CXG A;  3LEF A;  1URM A;  4L5O A;  3NOF A;  1K3O A;  1Q4J A;  2K6V A;  4V2N A;  5HR2 A;  2V4E A;  1U87 A;  1YHH A;  5EXB A;  4EC0 A;  3SV5 A;  1GSS A;  3Q74 A;  2FHE A;  2HT9 A;  3WD6 A;  2WHS A;  4P3Y B;  3GEX A;  4LJB A;  1TK0 B;  5CRW A;  4W72 A;  2KUC A;  2O8V B;  2X99 A;  1HCJ A;  4K2D A;  2CVK A;  4Q5Q A;  4TZG A;  4POK A;  3L9S A;  3SG7 A;  3WLC A;  2LUS A;  2LST A;  1K0B A;  3QFA C;  2VZX A;  4ECB A;  3ZYW A;  2YZH A;  4F03 A;  1A23 A;  1OC8 A;  5DRG A;  2L57 A;  2VCX A;  1OXE A;  2VM1 A;  2C3N A;  2RLI A;  2AWM A;  1A2L A;  2WS2 A;  1YKA A;  4WBJ A;  1Q73 A;  2YFP A;  1HUY A;  5HZT A;  2E2G A;  3DQ3 A;  3I9V 2;  3L9U A;  1GFL A;  1K0A A;  4WEY A;  1JZO A;  2VCZ A;  5LTP A;  5ECR B;  2CQ9 A;  3ST3 A;  3CD9 A;  4XRA A;  4ML6 A;  4I2Y A;  4P1Q A;  2GSR A;  3LVC A;  1YF0 A;