2JAOA

Crystal structure of d12n variant of mouse cytosolic 5'(3')- deoxyribonucleotidase (cdn) in complex with deoxyguanosine 5'- monophosphate
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
196
structure length
196
Chain Sequence
KRPVRVLVNMDGVLADFESGLLQGFRRRFPEEPHVPLEQRRGFLANEQYGALRPDLAEKVASVYESPGFFLNLEPIPGALDALREMNDMKDTEVFICTTPLLKYDHCVGEKYRWVEQNLGPEFVERIILTRDKTVVMGDLLIDDKDNIQGLEETPSWEHILFTCCHNQHLALPPTRRRLLSWSDNWRGIIESKRAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'(3')-DEOXYRIBONUCLEOTIDASE
publication title Crystal Structures of Human and Murine Deoxyribonucleotidases: Insights Into Recognition of Substrates and Nucleotide Analogues.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
total genus 72
structure length 196
sequence length 196
ec nomenclature ec 3.1.3.-:
pdb deposition date 2006-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06941 NT5C 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.40 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Deoxyribonucleotidase; domain 2 2jaoA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2jaoA01
5ALXA 1FEZA 3QLEA 2HDOA 4KNWA 4BBJA 3B8EA 2I54A 2CFRA 4YGYA 1WZCA 3SD7A 4L57A 3HLTA 2G09A 2NYVA 5ALOA 3ZTWA 4FFDA 4NV0A 4FE3A 5ALQA 2IOFK 3QU5A 3AR5A 4KX3A 5AI5A 4F71A 4ZEVA 5ALYA 5AW8A 3L8FA 4EELA 5ALUA 5ALTA 2I34A 4RETA 1ZS9A 4AS3A 2PKEA 1YJ5A 4AS2A 5AW3A 2C4NA 1CQZA 5ALDA 4L6AA 3AR9A 4FYPA 4UASA 3L0BA 5IT0A 5AW0A 5ALRA 2YBDA 3L0YA 3QGMA 1L7OA 1RDFA 4EENA 3BWVA 5AVQA 3WKBA 1L7NA 2YMPA 3ZVNA 3PDWA 3A1EA 3ET5A 3W5CA 2FDRA 2WF8A 2YJ6A 5ALMA 1AQ6A 1ZRMA 3N07A 3FGOA 3MMZA 3N28A 1Z4KA 3NIWA 5AW2A 4YCNA 3I1YA 3L8EA 1L6RA 1T5SA 3FVVA 4JB3A 3QUCA 2AUTA 1Z4JA 3M1YA 1RMTA 3UMBA 3WGUA 5AIAA 4BNDA 2HF2A 4MUMA 2FPXA 4Y2JA 1U7OA 2Q5EA 4I9FA 2FPUA 4NAVA 4BKMA 2HSZA 2YJ4A 4YIKA 2HO4A 1QQ5A 1Z4NA 4UM5A 1MH9A 2GMWA 2WF6A 2X4DA 4Y2QA 2R8YA 5ALEA 3CZ4A 1F5SA 2WFAA 2HOQA 4BYGA 3PCTA 3OCYA 3QU4A 2ZBGA 4EX7A 4UMFA 4OD0A 1L7MA 4CNQA 4YCMA 4HYTA 2CFSA 1Q92A 5AKKA 4UARA 3VAYA 3ZWDA 4UM7A 3A3YA 3ZUPA 1RPZA 4KN8A 3WK9A 5AK4A 1RKQA 2Q4RA 2JAOA 3ZTYA 4Y2VA 2WF7A 3R9KA 3U13A 3DAOA 2WF5A 3OCXA 5AW6A 5A3SA 4BX0A 1L8OA 1RMYA 2I6XA 4QJBA 2QLTA 4DFDA 4UMDA 1ZD3A 5AM2A 3QUBA 2ZOSA 1YV9A 1O03A 2GHQA 3ESQA 3ZI4A 4UMEA 5AM1A 4Y2YA 4Y2SA 4HAIA 3KOOA 1Z4PX 2IOFA 1ZRNA 3AR2A 3QU2A 2WF9A 5AKHA 4Y2XA 1EK2A 1SWVA 2YMLA 3HYCA 2FPRA 3E58A 2MSNA 4XPZA 3ZVLA 4BEVA 1Z88A 1YDFA 4OFZA 5JJBA 2AGVA 5E0OA 3AR6A 4UMVA 1T9ZA 2P69A 2IOHA 3ZW7A 3U26A 3B9BA 4UU0A 5AW9A 4QQFA 4EZEA 3ZWKA 1L8LA 4BX3A 1JUDA 5AK3A 2FI1A 3P96A 4KYTA 2EARA 4XOUA 2B0CA 1YS9A 4G63A 2G80A 2NO5A 3MN1A 3I28A 5ALHA 1KYTA 1QH9A 5AVTA 1L7PA 2C8KA 3KD3A 3KDPA 5AKZA 4C4TA 5AI8A 3U19A 2RBKA 3WKEA 3NALA 4J2TA 1RC8A 1K1EA 4HGRA 3KBBA 2C9MA 4J03A 3U7FB 5AVRA 5A3QA 1N9KA 2EATA 3E8MA 2HHLA 4UU1A 3ZU6A 1YNSA 1O08A 2I33A 3NUQA 2YY6A 2O2XA 2PQ0A 4HGQA 1J97A 3OCUA 3ED5A 1Z4QA 1SU4A 4IG4A 4CE6A 1NF2A 1WR8A 2QYHA 3QX7A 4KNVA 3L8GA 4YH1A 2BY4A 4Y2RA 2FPSA 5AVXA 2GHTA 2G0AA 1X42A 5AKEA 5AKIA 4ZEXA 1QQ6A 2P9JA 3W5AA 2VKQA 1QQ7A 5AVSA 3ZX4A 2B82A 1RLMA 4DW8A 2MU1A 3BA6A 2WM8A 5AW5A 3NAMA 1IWOA 4CF5A 5AKYA 3UMGA 3L7YA 5AI9A 5ALFA 1XVIA 1CR6A 1RLTA 1RRCA 2C88A 2GO7A 4UW9A 2W4MA 3WK4A 1Z4MA 5AESA 1RKVA 3DDHA 4H1WA 2RARA 4UAVA 3PGVA 5AM4A 1LTQA 2JGAA 3NASA 3R4CA 5AI6A 2G07A 1J8DA 3KZXA 3SMVA 4OHFA 5AM0A 2FUCA 3W5DA 3UMCA 2OM6A 3SF0A 3K1ZA 3OCVA 5ALLA 3OCWA 1WPGA 2FPWA 3MPOA 3J7TA 1NRWA 2R8ZA 3N8GA 5AKJA 2IYEA 4MWOA 3QYPA 4OCZA 1S2OA 1XP5A 2HI0A 3SKYA 3EF0A 5IS2A 4E88A 4G9BA 1U7PA 5ALNA 3L1VA 3FZQA 3WK7A 1RQNA 3AR7A 2BDUA 2FUEA 2JARA 5ALJA 4BEWA 3D6JA 1Z4OA 3OTQA 3EWIA 3OCZA 5AK6A 3RFUA 2C8LA 2YN4A 5ALWA 2CFTA 4HGOA 4C4RA 2OBBA 2AMYA 5AI4A 4BNDB 3AR3A 1XPJA 3WK8A 5AK5A 2R8EA 1Z4LA 2JAWA 5ALSA 3WK5A 2YMMA 5AICA 2DQSA 2PR7A 2O9JA 2HF7A 2R8XA 3WKDA 3NRJA 2GFHA 5ALVA 3S6JA 4CF4A 4YCLA 4HGPA 4DWOA 1VJRA 2CN1A 2ZBDA 3QU9A 2YJ3A 2G1AA 1TA0A 4GXTA 4KX5A 4I9GA 3A1DA 3WKAA 3L8HA 5AKXA 3U7EB 3U7HB 3N1UA 2I7DA 2B8JA 1Y8AA 2ZG6A 5ALGA 3I6BA 1Z5GA 2RAVA 3FPSA 3ESRA 3SHQA 4F72A 5AM3A 5T41A 1NNLA 3WK6A 1ZJJA 5AKGA 4B6JA 3DNPA 1RMQA 1U2SA 2ODAA 3KC2A 1ZOLA 4NABA 3GYGA 3QNMA 5AW1A 3W5BA 3A1CA 4JDPA 2B30A 4Y2UA 1VJ5A 4UATA 1ZD2P 2OYCA 5FP0A 5AVZA 3EF1A 3FM9A 4AP9A 2HCFA 3E81A 2P27A 1U02A 1LVHA 2EAUA 4Y2TA 2HEGA 4CF3A 2AH5A 1Z5UA 2HX1A 3L1UA 3RF6A 3ET4A 3F9RA 2YFYA 2OA0A 4BX2A 4NFLA 1EK1A 2RB5A 1PW5A 2B8EA 5ALKA 3WGVA 2B1QA 5AW7A 5AVWA 1TJ3A 5AVYA 4GIBA 5AW4A 3CNHA 4C4SA 5ALZA 2JAUA 3L5KA 1YMQA 2NO4A 5AI0A 3QXGA 3B9RA 3QUQA 2B1RA 3NANA 3QUTA 3WKCA 5AVUA 1S8OA 2YJ5A 4L6CA 1RKUA 4EX6A 3FPBA 4PNHA 3AR8A 1Z4IA 4YIHA 2G06A 2FEAA 4DCCA 3IJ5A 1VFPA 1ZD5A 2P11A 4UAUA 4XE5A 3IRUA 3ONNA 1U2TA 2D2VA 5AHXA 4XQ0A 2I55A 3PGLA 1TJ4A 2WHEA 3OPXA 1RQLA 3U7GA 1RLOA 4EEKA 3DV9A 2ZXEA 1WVIA 1Q91A 5ALPA 3UM9A 1TE2A 5AKLA 4Y2PA 3E84A 3IB6A 1ZD4A 3AR4A 1TJ5A 3EPRA 5A3RA 3N5KA 3QU7A 3I76A 4IFTA 3TLMA 5AIBA 3R09A 2Q4TA 2W11A 2YMQA 4Y3UA 5ALIA 3ZVMA 2G08A 5AM5A 3SLRA 1N8NA 3M9LA 3MC1A 1SWWA 5AVVA 2BDEA 3ZX5A 4ZEWA 2W43A 1T5TA 2ZBEA 3L0CA 2ZBFA 2IA5A 4NWIA 4O8CA 4RESA 3SKXA 5IT4A 4HGNA 1QYIA
chains in the Genus database with same CATH superfamily
1YBVA 1RI3A 1R10A 2HPAA 1SMKA 3CLSC 3OHPA 4MIYA 1K7FB 2OEPA 3F9IA 3RANA 4PVDA 5TPWB 3GEHA 1EDBA 1LLFA 4I3GA 2BHTA 5DULA 1NTRA 2OP0A 5YASA 2PMFA 4GKJB 1E8DA 1P9RA 3BMXA 2W6JA 3UOWA 1A3CA 2EZ9A 1GNQA 3LY8A 2QUJA 4IQGA 4BXOA 3HJCA 3OBBA 4FE3A 4FOPA 2ADFA 2F2TA 4L6IA 3SF8B 5L3QB 1XMPA 3TV2A 1JG6A 4GZ5A 3V2IA 3FOFC 2HV9A 3ZDEA 4HATA 2H7XA 2R6GA 1BKYA 1EUQA 1XMSA 3LX8A 3W6PA 1AXGA 4DRXA 3K9FC 4OQMA 2VRCD 5FPHA 2P9HA 5FTMA 4ZQIA 4EVQA 4EVSA 5JCZA 4TMFA 4JR0A 4ZC1A 1UPBA 1IQRA 4GH5A 1I3KA 2W6CX 1NWCA 4XZ3A 4JI0B 3PRYA 2KMLA 1JJ7A 1ULSA 1R27A 4GI3A 4I4NA 1QU3A 4JLKA 2ERCA 4ID9A 3TOZA 4CL2A 3VKHA 2BZ1A 3HA2A 1BHQ1 1ZGHA 1JXAA 1ZN8A 3UK2A 5JS2A 4BMYA 4DKJA 1XCBA 3K35A 3HSKA 4X5OA 1LI4A 2D5CA 2XUHA 4NCHA 1KWGA 2Q5LA 2X0JA 2YMPA 4DR2B 2ZBQA 3OQJA 3SXUA 2EYUA 4U5QA 4K7JA 5EIXA 3W5CA 2BKUA 3PNPA 2VT7A 3LIPA 4LQDA 3FUUA 1N78A 1C0EA 3F5MA 2XYVA 4B3HA 5IANA 2BT4A 4TM8A 4A0QA 1K66A 3Q6NA 1OROA 4MW0A 1R9MA 5LQSA 1U3TA 1UPFA 2R11A 2K5UA 3D5TA 2ZUTA 1YBFA 2V3VA 3RK0A 3F7NA 3EIFA 3GLQA 3WNDA 4JLPA 3U7JA 3WGUA 3ZZ0A 3M4ZA 1DKQA 4OXXA 3RKRA 3K72B 2CV0A 1R5OA 5KHAA 1T6YA 2YS7A 3AUAA 1DAFA 4IICA 1HWYA 4OYYA 5AXAA 1HDYA 2E2WA 4DAEA 5KVVA 2J45A 3G3EA 4KVZA 3WFIA 2M9MA 4KN5A 2HHJA 2Z5VA 3LSYA 4B8YA 4C0KA 3UFXA 2RJ3A 1TTTA 5BQFA 4G0UA 3PENA 1ISSA 3A1NA 3P2EA 1LVGA 2YVKA 3QE3A 4QUEA 2QTVB 4ZT6A 1F9AA 1KI9A 1P2UA 2EG5A 2FSUA 4CDRA 3AJDA 2G5CA 4EG1A 5KOHB 4MX8A 3B3JA 1T2EA 2PUWA 5IK2A 1V1RB 2G4LA 2E6KA 1E61A 2RHWA 3OF2A 3CEHA 3HSYA 4HLUA 2XCLA 1F5SA 3VPSA 2J0QA 2QVYX 4P4NA 2J6IA 2UVPB 1XKLA 3GG9A 3Q3JB 4TMWA 4RA9A 1B2RA 4M22A 3FWNA 2ZBGA 5JYCA 2ONKA 3ADKA 1BS9A 3GK3A 1CUZA 2CL0X 1E2DA 2Y68A 3FRIA 5EZQA 1BHO1 4M1SA 2XKJE 1IHDA 4HCJA 4D4MA 2PRIA 4HD8A 3AJEA 4HNTA 1TD1A 2J8ZA 1AT1A 3VM6A 3ZWDA 2VP2A 4BX9A 2PYIA 3QSGA 3OH8A 4QPNA 1FDUA 4F56A 1IM2A 1QSGA 4INAA 4MVJA 1C7FA 3A3YA 3ITEA 3IQFA 3JYLA 4PIPA 1C4XA 1UIMA 2X14A 2RGGA 4ZYWA 1WSAA 1HLGA 4LYYA 1K7SN 2ZQZA 5HDBB 2A78A 3CB4A 3GLFE 3E5NA 2XMQA 2AN4A 2GRAA 3IBSA 3FPJA 5BRNA 2J59A 4F91B 3R7DA 4FZRA 1HLPA 2I4IA 4LPKA 3E22B 1Q7CA 3PUJA 2TRSB 1KRWA 2XLCA 3OT1A 4LOKA 4KR0A 1RHUA 1FRVA 1NKTA 1Q83A 1QKKA 4JBWA 4WLUA 3W1WA 4BKQA 1PDVA 2I4RA 2OD7A 5ADWA 1O03A 2ZJ1A 3D2LA 2NYRA 3DEHA 3LCCA 1HT0A 1RQXA 2IZ5A 2PFSA 4R8RA 1O6CA 4TV8B 4IOKA 5IC6A 2BMFA 4GFDA 4PVCA 3TZLA 4ENSA 4EO9A 3QA9A 3GRFA 3D7NA 3NORA 5EZSA 1W4CA 1YKSA 1U5CA 1I3NA 5B1EA 4QXMA 2Y1GA 2UDPA 1K8YB 4XDGA 1JU9A 4PZYA 1JJAA 1DWOA 4CG1A 3UBTA 1C29B 1KR5A 2IV3A 1KZ7B 4DY6A 3KR2A 2LZ0A 3EIWA 3KJIA 2P69A 3K9NA 1WXIA 4HYQA 3OCFA 1IG3A 2DBVO 4GX0A 4XLLA 4UU0A 2R7MA 3ENNA 5CK4A 5H80A 1WXEA 1GG5A 4HO1X 3A6GA 1C2YA 2CDCA 2NAFA 2PS9A 3H75A 3R23A 3OE1A 2Z1MA 1L8LA 2PNFA 3L0DA 1WXGA 3ZWKA 1NBME 2IY8A 3GGOA 5JSQA 1EXMA 3NB0A 4C6HA 4B3MB 1ZUHA 4ON9A 1M83A 5BV0A 1Y1LA 3EB9A 1NSFA 1VKHA 4HYEA 1ULAA 4R1OA 1BE6A 2G80A 3CS3A 4KDRA 4N0MA 1RQRA 1YQQA 4YDQA 3FI0A 4PEVA 1QYRA 4YUVA 1PJCA 4QLAA 4K3VA 3TNYA 3K94A 3UXHA 4J0IA 5E3JA 5MF6A 2NYUA 3G2OA 5C8YB 2XCTB 3U19A 3W7AA 2H1SA 1MNAA 1QDUA 2IUYA 4J2TA 1XTIA 5AXDA 2R68A 4J03A 4M9CA 3Q5GA 4IINA 2QUHA 2M6KA 5A2QA 5HUHA 2H1FA 3A1VA 4F3NA 3U0VA 3FYTA 2OYSA 4YLYA 2OZKA 4QSMA 1KXJA 3HSSA 3WRYA 5HUJA 1A8UA 1U9IA 5HKKD 2WWXA 4GOLD 3CNLA 3FBWA 5J43A 2P68A 1O87A 3EFOA 1U8YA 1G4AE 3UATA 1UAAA 3QITA 1R6XA 2X8JA 3HRKA 3PNMA 2P5TB 4RK0A 3QHAA 4XFDA 4ZAXA 3JPWA 1K0UA 4PBSA 3E18A 5D51S 5L8VA 2G0AA 2KPOA 4DV6B 2V6JA 4YT2A 2OXFA 1I9GA 4FBLA 1JQKA 2ZPTX 1IRXA 4Q9HA 3NONA 4HNAB 3SEFA 4XVHA 2ZSDA 1E0SA 4EW1A 1NW8A 2O1WA 5EKXA 3NM4A 1A7JA 1TC2A 1OT5A 1V6SA 1E2QA 2OGWA 3OPYI 3E1SA 4II2A 4C0HA 4PHCA 4NCIA 3A31A 4LE1A 2HREA 2QW8A 2XJ9A 1CHDA 3GXOA 4TX1A 3TRFA 4QSHA 4ZI5A 1SOWA 4D81A 2PAFA 3JD1A 4DNOA 1YD7A 2OORC 3IESA 4QUHA 2RAPA 4G37A 4K2AA 4ZPJA 2HIAA 3OIGA 3SYTA 3K70C 1VB3A 3NT2A 6GPBA 2HSWA 1FF9A 1GFWA 2AL7A 2GJSA 3B3FA 3FETA 3B5IA 5JAOA 1JHDA 3GQBA 3GF4A 2Y93A 4HY3A 3TDNA 4UW9A 3RVMA 3QTTA 2JBHA 3WK4A 4RTKA 1LK5A 1RRKA 2GTPA 2PKYX 3L8CA 1RKVA 1ODLA 1OX5A 3CUUA 2AF3C 4H1WA 5HW0A 2C9OA 2XYHA 4IY1A 5FKJA 1WNFA 4LC1A 5L3VA 4HFNA 1KAEA 2W7TA 1MUUA 1CKEA 3EFHA 1C3UA 1MXHA 2VHUA 2O50A 3UYLA 1XLWA 1PR4A 4EB3A 4OP3A 5JFGA 4UBNA 3EXHA 1DX9A 4CUJA 3ESBA 2EF0A 3VJRA 1TZJA 3ZOZA 2E5WA 4OFWA 3OBIA 5C32A 3VUFA 2F59A 2G71A 2KI5A 4QYXA 2QVZX 3JWGA 1Z8NA 3S27A 2O5CA 3OI7A 3DEAA 3K96A 3TTVA 1KQ7A 3WQQA 2O2JA 2EL9A 3E1KA 1BQ3A 1P5HA 4FNMA 1CIVA 4OCZA 3R3JA 5D3MB 5FBKA 3K5PA 3TPCA 2VLIA 4LOIA 2QVBA 4AY5A 5T4HA 3VR5D 4JJAA 3TD9A 3BFXA 4CTJA 3ADBA 3N8DA 4NMHA 4DRYA 3K2EA 5LB4A 4EA9A 4B85A 2YYAA 4IIEA 1P6QA 2H16A 2HMTA 1EUYA 2B8WA 3JALB 2XVYA 4LFAB 2C8VA 4LHWA 4HAOA 3EZ2A 5JASA 1TVEA 4N18A 1ZCJA 1X8XA 1LI5A 2WHQA 2P4QA 5KTPA 1VSVA 3AONB 3QUSA 4EL0A 3VU3A 3MQ4A 2QRZA 4YROA 4YVFA 1EWKA 4NH4A 1VE5A 5EJGA 2QTAA 3DBRA 4PY2A 2FG7C 2XSZD 4MGZR 1II8B 5D5PA 3RTEA 2BFBA 1YFZA 2N47A 2PR7A 2ZIEA 2XZPA 4K9KA 3TAXA 2WTUA 4BUCA 5BNIA 1FSFA 3MIZA 3ZI0A 4BFSA 3RI3A 4N0PA 1C14A 3WKDA 5C8VA 1CV2A 1N7HA 2TS1A 3B1KA 3DOHA 1AKVA 4KLRA 2GK6A 3HUEA 1SC6A 5DHQA 3WB9A 4YCLA 1A2OA 1SPXA 3KQOA 3HC7A 3MJ4A 3TI9A 3QG1A 1OLSA 3X1JA 2OAQ1 2D5LA 4CU2A 3G85A 2EJWA 1GA6A 2VHJA 5KNCD 3BJIC 2EP7A 1YOBA 1TCBA 4HEA1 4A16A 5I9IA 4WNAA 3M6XA 1XUOA 4H17A 3C8MA 2WZBA 3FLMA 4ND6A 1UWVA 1E79D 4CR6A 3PHGA 3OQIB 1P7PA 3TTTA 1G5RA 4MR9B 3L6CA 1GJRA 3JQQA 2JG3A 3EUEA 4OI1A 4X1KB 5JI2E 3U7HB 3UO8B 2G1PA 3O2NA 5H7XA 4AZSA 3FCAA 2QRVB 4N47A 3VJKA 1N0IA 4Q03A 3WSWA 2YJZA 5I7WA 2UXCB 2JFHA 2PD3A 1WY5A 1THMA 2ZRQA 3GEMA 3EPLA 1Z3CA 3MMPA 4ARSA 1S2MA 5AM3A 5LDDC 5I9BA 4WZ6A 1U2RA 1YGYA 2QRPA 4P08A 5AKGA 2WJIA 2I99A 3QEJA 4EFLA 1GNVA 2LIVA 1W5FA 1MEOA 3Q9NA 5BMVA 5HM6A 4GBMA 3H04A 4ENWA 3Q2IA 5JNSA 1WW2A 4R7TA 3U4HA 5KCZA 3GYGA 1I0AA 4UE3S 3F3MA 2JGIA 1KFEB 3OJWA 4XTCS 5CLQA 2NU6A 2O14A 2OR3A 5HJ2A 4BZXA 5L45A 2VJMA 3GCZA 3L7KA 5HA5A 3GLGE 1CK4A 4D8VA 2O8FA 1QQAA 3AHEA 1UKCA 2DPLA 4PFJA 4YP5A 2YZ2A 4F4DA 5C34B 3U61B 4ZVQA 3AFNA 5JCJA 3ZWOA 2Q2QA 3ZHYA 1S3GA 3JQAD 4E3ZA 1Q5PA 3D7LA 2NO1A 1QE5A 3UW1A 4ZT4A 4XRRA 2JFGA 4ZCSA 5CFMA 3UENA 1VBNA 2V5AA 3OPYA 2WFLA 1SQ0A 2RB5A 3MTEA 3ZE2B 1PYDA 1YSCA 4CKYA 5JNLA 2VUUA 4MRMB 4XLZA 3W8DA 4B6FA 1V9SA 2H1OA 1DOFA 1OIXA 3U4QB 2REOA 2W2LA 4NHEA 2O59A 1MP0A 3BILA 3NHSA 2Y0BA 1P7YA 4EY3A 2GAIA 4BNTA 1W73A 4M9SA 2JA2A 4G9EA 3X1WA 2J1LA 5ECYA 4HQ6A 2R7AA 2ZDGA 3Q0IA 3UJHA 4LYDA 3N3AC 2JK1A 3JQFC 3EODA 3M6LA 3WXBA 3QXGA 4QXAA 2DULA 4JITA 3B9RA 3QUQA 1Z5NA 3GCDA 3NANA 3P4UA 3R3HA 1R0BA 4RXUA 4XWKA 4MI9A 1FRZA 4X8HA 1VDKA 4FWIB 1V6AA 4PCAA 3IDAA 3M4XA 3COZA 4OKSA 2W2KB 3O0TA 2MSKA 1RHJA 4HUTA 1DIOB 4NOKA 2WSLA 5DHPA 3RTAA 3AP1A 2CMFA 5KWVA 1YS2X 4XGKA 1IAQA 1IHYA 3CF0A 1IN5A 3AB3A 4LV8B 1XYYA 4ETIA 6AT1A 3GRAA 1RI4A 2FX2A 4FLEA 1EFAA 1MC1A 4P86A 3P94A 2X13A 4KMRA 5DM1A 1I30A 5EZ5A 3RIEA 2GX6A 3PCRB 4NBTA 2WJGA 4GOOD 1TEXA 5FWXB 4J07A 1GZDA 2W0SA 1X3SA 4R0VA 4XFKA 5B3JA 2MINA 5GZ3A 2NP6A 3PDJA 4PGFA 5D84A 1XCJA 1J0XO 2OILA 2Y71A 1TE2A 4L0CA 1DG9A 3LK6A 4IWYA 2C1XA 4LQCA 4ZWNA 5BT8A 5JWRA 5MN4A 3ZY2A 3KV1A 4FHFA 1PR6A 3IVMA 1J1IA 1T6XA 1Z2NX 2W2TA 3BK7A 1M2GA 4ZTBA 1AUVA 4RPCA 2CDRA 1E1KA 4YBZA 4HT3B 3TKLA 5K20A 3I76A 3BJMA 4OGWA 4P80A 1PAUA 2H8KA 2IZ6A 1XV5A 1NN5A 2DYKA 2JIPA 3IAAA 3NWJA 4IWNA 4Z0NA 1YVPA 2F17A 3ULKA 4BQIA 5FWAA 1O2DA 1Y8RA 3HXLA 3AF2A 4JBIA 5AM5A 2OBNA 2QVGA 3SLRA 4YAFA 4HWOA 4CF6A 1PSDA 1NW6A 1T9DA 4TXNA 5TVKA 2DBZA 4ZU3A 2ZBEA 3ZCPA 1GNSA 1ZVJA 3MLBA 4ZOAA 1XWFA 5EPUA 3BIWA 4O8CA 4CQMB 2WHRA 1G8MA 4KK3A 3GPDG 4U0KA 3ZLTA 3HJTA 3DLTA 1TCCA 1Z2EA 4G0XA 3LTNC 2ZJZA 5FL7D 3TXAA 2QRKA 5IF9A 2QBYB 1E1LA 2G6BA 3C3BA 1O9HA 3UK0A 4I14A 1U4SA 2YOGA 5JD5A 2B21A 3FN4A 4QA9A 3ESCA 4AW9A 1Z73A 3E0XA 3T6KA 2TMDA 2FRVA 2BYTA 2IVZA 4RD6A 1RHRA 4NV0A 2QTBA 3IA2A 3A05A 3HBNA 2BR5A 1TD9A 3AR5A 3WLOA 3ZWPA 5EJAA 5C7IO 4BP8A 1A7AA 1B0AA 2YIJA 2COEA 2FX3A 2XRMA 3GBSA 2GRUA 4EELA 1ZYUA 1ZMBA 2POQX 3IQEA 4C2UA 4P7JA 1Z25A 2R97A 4TTRA 1MAAA 4TT3D 3U3ZA 4PQGA 2IW3A 3A37A 4UTXA 4P98A 3ZJYA 4D80A 2PKEA 4AS2A 1UZMA 1Z9BA 1J9ZA 3H5VA 4PW0A 3MCAA 5EG5A 2BR3A 2W5UA 3C87A 5J23A 2WT8A 1AKWA 1ZBDA 3ETCA 4FYPA 4D0LB 1N8TA 3KYCA 4Z3KA 2E9SA 2FMFA 2GEUA 3AM3A 4EJSB 4L8LA 3ST7A 2ZJBA 4LYHA 1R6DA 5IKXA 3HU3A 4TOIA 5LQRA 3L8YA 1U94A 3R0JA 3UA3A 5BVHA 1YQEA 1XL0A 2XDQA 2J6BA 4E11A 4KZKA 4JYBA 3IKMB 3PKZA 5ALMA 1E0JA 4R1PA 1ZJWA 4HMOA 2FEPA 3VPDA 4RLHA 2ZBPA 3I1YA 3LT4A 1C50A 1GGNA 1UK6A 1WTAA 2VAXA 3ONEA 4TTQA 1PS0A 3AHGA 1YXMA 3BF8A 3D3EA 2ENWA 2VOJA 1IXYA 3OLVA 4B48A 3RB8A 3ZW8A 1MTOA 1NDUA 2DG2A 2P2CA 3BGVA 2GCNA 4MVJG 1X1RA 4QNNA 3UMBA 4CG0A 3KSBC 1U0BB 1U1DA 4BJ6A 3DKRA 1VP3A 3SHTA 1GIAA 3T5MA 3FZEA 3UTCA 1OVMA 5ICGA 2ECFA 4CCWA 1IBLB 1LWNA 4ABYA 2LUOA 4OGKA 5KTNA 1JJFA 1YHYA 3HYTA 3OESA 3LVFO 4RNCA 3N6RA 3O5AA 4YWHA 3ZWVA 3DHWC 1R8XA 2Y8EA 4OX9Y 2VJDA 4EHDA 4ZDKA 4L28A 4WBNA 1H4TA 2EFGA 2PGIA 4FN4A 2BFDA 1LX6A 2FN7A 4M1TA 3EGIA 5CH3A 4F4HA 3K73O 2YJ4A 1A5SB 4YQEA 2BONA 3HKBB 2B9VA 5TJHA 1FY2A 4CMIA 1H4QA 3PTZA 5A1JA 1AY0A 2Z6VA 4ISCA 1SR8A 1XKQA 2F8MA 3NTVA 5ALEA 2JBWA 2XMDA 3M83A 4WOCA 5KOYA 4M49A 4O3MA 1H8HD 2ZLBA 4EQ6A 3USES 4U3JA 4Y6OA 3TINA 4C5BA 1X9IA 1EFTA 4M0UA 2HOQA 3GRUA 1O5IA 1VSTA 3KPUA 4LHEA 4N4AA 4LJYA 2D0PB 3KEQA 3VOBA 2VSOA 1G7CA 2X6QA 4PO1A 4Q1DA 4KSCA 3WGLA 3ILXA 5SV2A 4B3CA 4E22A 3PKJA 4EB6A 3NCHA 4FIDA 1Y6RA 4YCMA 1P1RA 1EJBA 2AFIB 4QO8A 3V1LA 2IS4A 1MKYA 2GBGA 3VVCA 4BQPA 3FKSD 3M1LA 1XEXA 4HVTA 5K0CA 1JKJB 1RE5A 4BNJA 2XUPA 2AZ4A 3NIGB 5FLYA 3S44A 4Q7QA 3ZUPA 2DJIA 3N53A 1NVVQ 3FLEA 3JVVA 3R6GA 1RPZA 1RLUA 1SOMA 1IZ7A 4ZHSA 3ZTYA 4N7BA 3X2SA 3KWJA 2EZ8A 3LH5A 4ZZ2A 2WF7A 3ROQA 2X86A 4NMMA 4BB9A 3AVYA 1A9TA 1AKMA 1CT9A 2WYWA 2R6DA 2H52A 2ODTX 1NC1A 1Y5MA 3NEJA 5JZMA 4LBYA 2OCBA 2YZMA 1RPAA 2REBA 3GMIA 3L49A 4S1PA 1QC5B 2YYSA 3R0IA 3E5MA 1ZD3A 1ZCBA 2X0IA 2X3UA 4GICA 3WLNA 4DC1A 1I14A 2R1VB 1SOUA 3FYSA 4Z51A 2FTKE 3DDUA 3MGGA 4RZXA 1YS4A 2KX7A 3ANNA 3O75A 2ON6A 1LBEA 4X92A 2PLFA 1U16A 2BKEA 4HC4A 2I91A 4V2UA 3EIOA 3VOAA 2KS6A 4L5JA 3EVNA 3RABA 3D8HA 3HFRA 4JSRA 5DMXA 4QFCA 4GZ6A 5A0TA 2X5OA 4PS0A 2VHYA 3EUWA 1PK8A 1PLLA 1VDMA 3GLIB 2V8OA 3WDSA 5BN1A 1V25A 3BULA 1IZZA 2IDMA 2VTEA 4G0PA 1U1EA 1UFRA 1Y9DA 2HQRA 1MQ9A 2D1YA 1X14A 2LBPA 2HUPA 3HB9A 3MTQA 3AW8A 1I2BA 1P4HA 3I9V6 4WXPA 2X0DA 2GK3A 1UKBA 1H6AA 2XR1A 4O2AB 1SKQA 5AK3A 1V4NA 3THRA 1JWLA 2H1RA 4L4ZA 4JCOA 4O5AA 1NRXA 1E1CB 2DTDA 4LHYA 3UGKA 3VAAA 3W9BA 4IP0A 1BXRB 2R6ZA 2IWHA 4KH1A 1Y3IA 2NO5A 4YJGB 3C1TA 5K9ZA 2XRZA 2DC1A 4JUDX 1NBMA 1Z18A 5ILGA 2Y0PA 2QMEA 4DMGA 3U4GA 4CKBB 1KSHA 3E3NA 3L7OA 4RIFA 4KREA 1VPWA 1EE2A 1CFZA 4ROSA 1KO7A 1USWA 3IEPA 3S29A 5INTA 2C5AA 1LRLA 3W05A 4DCJA 5IZ4A 4JL8A 4CMEA 4N3BA 2Z4SA 4TYMA 1E5VA 1XD2B 3KALA 4FOLA 1AQYA 3NEYA 5JQGB 4CTKA 1ZY2A 3B6EA 1W94A 1XLUA 5K0TA 2FHPA 5L7YA 5DNWA 2YY6A 1T35A 2VLBA 3G0IA 4MDHA 4G8CA 4QYIB 3GLVA 1J97A 4BMXA 1VMDA 1A4RA 1VYVA 3BDAA 2XYQA 3GG2A 4IMRA 4XUDA 3RVPA 4YT4A 5H4HA 3M2PA 2PM8A 3AOEA 1BE1A 4TVKA 4UUNA 1U31A 4PZ9A 3Q0TA 4NS1A 5JY1A 1E66A 1XZDA 4DMCA 4LMRA 3IOMA 4Q6WA 1RQGA 5CX1A 1QLWA 1JIKA 3FNQA 1FURA 4EPXA 3RNOA 2CK3D 1SBNE 1Z12A 4H08A 4LI0A 5AXBA 3FKQA 5KPDA 1VKJA 4B3SB 1Q77A 5DWVA 3QJGA 4IF6A 1BRMA 4ZT5A 2BP7A 2CLSA 3QKIA 4UTRA 4EJ2A 3FVQA 1E2UA 1ZISA 4PC6A 1Q14A 3D43A 3R40A 4B7UA 3EMVA 1T4BA 1SURA 3PGKA 3HEAA 5BQOA 2WZDA 4BNZA 1HH4A 4U2KA 3GFPA 3ZNPA 2B92A 3WL5A 4BTLA 5HIKA 3IDOA 1Z7GA 1C8KA 3KUDA 1J00A 2JHFA 1TXGA 3BXEA 1V3VA 4DEXA 1EHYA 1CZKA 4GL4A 4Q1AA 5TT1A 4MUBA 1NOKA 2WVHA 5CYGA 4B3RB 2YXDA 3T4EA 2OBXA 2CLHB 3GN2A 1PBTA 3AVOA 1U6IA 3HKEB 4BXOB 2IYVA 4FMDF 3DKKA 4OQZA 4PRLA 3E15A 4B2LA 2XCIA 2GEBA 3BQNB 3WR5A 1Q5NA 1GYQA 2P0EA 4ZOEA 4C03A 2JK0A 1MGPA 1SBYA 4EKNB 4B6EA 2QS9A 4WECA 1D1QA 2H3HA 3TYXA 1UXGA 3WS7A 3PQCA 4OHFA 1K92A 2VI5A 2VYND 3GZNB 4KVFA 4DRXB 4AQYB 1S4MA 1XEWY 2QLJA 1K68A 2A30A 3N2IA 4KO3S 3OJ0A 4DJFC 4KDCA 2QR2A 3CNEA 3G0DA 4Y7CA 3BSYA 1W93A 1C3JA 1NY6A 1FBNA 3N8NA 2WHPA 4DLZA 5J2TF 4I1UA 3VNAA 2Z98A 4H27A 1R0ZA 5DH9A 2L2QA 1F3OA 1UXJA 4DIOA 5HUQA 3BEOA 4P54A 2PUEA 2J09A 2PA3A 5B7GA 3UNXA 3C4VA 3R6QA 2X4GA 1D6JA 3ID6C 3LMKA 1BS1A 1T0BA 2EC5A 4NU6A 2J9YB 5IP5A 3SKYA 1JVBA 1AN0A 1NI4A 3F1KA 5DIFA 1QBGA 1JVSA 1KAGA 4CYMA 1RYNA 5J47A 4K9RA 1W5AA 3EZ6A 5CITA 2RD2A 1WETA 3ETHA 4N8EA 4MMYB 5ALJA 2YKGA 1LH0A 4IQ8A 1L5MA 1TF5A 2P91A 2QJFA 4GC9A 1SCUA 3AB7A 2YVUA 3ZCTA 2JS7A 1R8JA 3B20A 3H4IA 5CAEB 2JB9A 2F3TA 2JCGA 1SEVA 3EDQA 2B4AA 2ZS9A 2NSHA 4RU1A 4RZ3A 5CR9A 1AGPA 2NG1A 4KO4S 1MBZA 3ZY3A 1W0JD 1DG3A 1ZHFA 4PLGA 1E69A 2IXFA 4U2GA 2CLIB 3NIFB 3RYFB 3SIWA 2ZRKA 1SIBE 1FTNA 1TJNA 1YB7A 3PNVA 3RT7A 1RP7A 13PKA 4JXJA 3TSOA 5AI4A 2JFNA 2XPCA 2OAP1 4DSOA 3WFZA 3SQDA 1JHPA 5M3BA 1VMEA 4BTEA 4CUKA 5A7GA 1OXSC 5G1PA 2G9ZA 1DBVO 1UDCA 1KAHA 2EIXA 4CKCB 2PPVA 1S2LA 5EESA 4UU7A 4PAWA 4LVUA 2PUDA 2XHEA 1T15A 3S6JA 3HKCB 1CZUA 5AOBA 3GROA 2XV1A 4UDYX 2H65A 1PV1A 3JSXA 3SHVA 4ITUA 4EB8A 1NR1A 4YV1A 3IULA 1KK2A 4N9WA 2FSVA 3FUWA 1TEHA 1LRJA 4O2RA 4UVDA 5I48A 1GLNA 3AM1A 4DCTA 4GKKB 4JUBA 1J2TA 3ZQ6A 2XNJA 1DO8A 4RA9B 3KOZA 2OENG 3IR5A 4UVEA 3ANMA 2N42A 4MZXA 4D41A 3SBDA 3O90A 1FC0A 3BSSA 4Y67A 7MDHA 1BVUA 5LIPA 2QX9A 4YN3A 1YQDA 2NUAB 4CXMA 1TU0A 1TKCA 3WLAA 9LDBA 1AX9A 2F43B 4Q66C 5CCBA 2YXEA 1BD3A 4FK8A 3HFJA 3JV7A 5NULA 2B36A 4J0FA 4OL9A 1SNYA 4MRPA 1UKEA 3E48A 5FPPA 4M4SA 4L5CA 4WOJA 3AGPA 1IPFA 3KL2A 2JLRA 5HE8A 1YB5A 3OU6A 4US1R 2ODEA 2X8BA 1CY7A 3ZCXA 1MC8A 1Z0JA 2VP5A 3N2LA 1ITZA 1Z0UA 1QFXA 1T6NA 3MWEB 4HP8A 4JP1A 4WK2B 2PN1A 2WT9A 2HM7A 4G86A 4FFVA 5JALA 3M2TA 4KK4A 1HG0A 5A0FA 1VLLA 3DVSX 3HCFA 1YRLA 5KI6A 3H5OA 1YR8A 1LNSA 2RAUA 2CUKA 1OZFA 3P45A 1RKBA 2CSUA 4TT8A 3VC2A 3K31A 3ZKAA 1NW4A 2P27A 3HMQA 4LNUB 2B3DA 1K2VN 4MUIA 4Y2TA 1XDDA 1V0JA 2FOIA 2YBEA 3D4OA 4JT4A 4R1SA 2WJ6A 1ZITA 4QGFA 4YAJA 4RXTA 3VR3A 2CHQA 1DXYA 1AC5A 1UC4B 3GLGA 2XUGA 2Z9CA 4X7RA 3FSJX 1SEPA 1FCJA 1YA8A 2CF5A 4KWHA 4O63O 1T9GS 2ZE5A 2C2BA 1YHZA 4ZKEA 7ADHA 1ZJZA 3OCEA 1J70A 3Q2KA 5SICE 1GL6A 2Z6UA 3FCYA 1H4SA 1VL6A 3G2QA 5H68A 1TJ3A 5AVYA 2J3MA 1TT7A 5AHRA 1Z63A 3ZK8A 3K4QA 1PVVA 2FZVA 2M98A 2ZTMA 3HI6A 4FDMA 4HAYA 1P5ZB 4QEKA 2QA5A 1H8ED 5DN6A 3WO1A 2PLAA 4NBKA 2VJBA 4WKCA 3IE0A 4Q9NA 3BZWA 4IVRA 4OQ4A 4CEJB 4JD5A 1EP2B 1OHHA 3NDBB 2XCSB 1CUWA 3FHCB 4MW7A 2QTRA 4FHZA 4NENA 2MYPA 2B1RA 3W8NA 2SCUA 3PWTA 4L85A 1IBKB 1MC4A 1YASA 1ZG3A 1XVTA 4IG9A 2FVXA 4LYFA 4YJ3B 4IJVA 3NFRA 3CSUA 1FLVA 4WLFA 1GHTA 2AW3A 4UM9D 4YIHA 1H6CA 2G06A 2IPXA 1EWTA 4K9SA 2W22A 3HVHA 4ONEA 4R6XA 4DCCA 2FR1A 4OQPA 4F6CA 1FFXB 1F14A 1ZD5A 1FVHA 1LZKA 3LG2A 3QW2A 1I7SB 1WULS 1CBUA 3T94A 3IELA 3PGLA 5EIBC 2VT2A 4Q9LA 3GUUA 3T61A 5F5XA 5ICMA 5LN1A 1WPRA 2WU3A 3A6DA 3NHZA 2C7OA 4M8SA 1WVIA 2DKNA 4AYXA 3C6ZA 5JSHA 1YUMA 3IPCA 2J5BA 3AZPA 2HMWA 3HHEA 4A4DA 1HSZA 4TYWA 2X8LA 4R6WA 3N8IA 4DR1B 3R7NA 1WY7A 4WRRA 3MAJA 2HRRA 1MENA 4XVUA 5LMUB 2OO5C 1GTRA 2M6RA 1DQRA 4INJA 2EFYA 4DQDA 2B99A 3AM4A 4DLUA 4P7KA 4JXZA 1Z0SA 2Q3EA 3D64A 1R9GA 2PJDA 3ETJA 3KDAA 3NBZC 4G0MA 4L15A 4O0LA 3K8QA 1SKBA 3CLRC 2PTQA 5LBIA 1FMTA 1DWPA 1VI5A 3AW9A 1F8GA 1I7NA 2Q46A 3KKOA 5JS8A 5KB3A 3O3MB 3PQ2A 3SSOA 1UXOA 1N5IA 3FH0A 2ZWOA 5LZ2A 1Z8DA 1CRPA 3V6MA 4P3NA 1GSAA 2FW7A 2WD7B 1Z07A 3RSCA 4E2YA 2BIFA 2HDOA 3QE9Y 2AMJA 3GDWA 1X3LA 4BBJA 2I54A 1ZEMA 2JFPA 4FTWA 1MTZA 3C41J 4G1MB 3OZWA 1NQWA 4CT4B 3OJCA 1Z17A 5JMWA 4J8PA 1GAJA 3JWHA 5F2EA 1T4CA 1E8MA 3OTOB 1EX7A 4NG4A 3VO9A 4DYDA 1E0DA 3ZXYA 2UZAA 5KWEA 4CLXA 4NECA 5JMOA 3V4OA 1P2GA 3DMYA 1DBIA 1P7CA 3JQAB 5FXMA 3NTUA 2PMCA 1YGPA 2I1VB 3C8HA 4N6NA 3GGCA 3PFHA 4HRAA 1YJ5A 4NR0A 3V4FA 5LUAA 1O94C 1KY3A 1F6WA 3FWPA 3FSGA 2VHXA 5ALDA 2NLOA 3ORYA 2O8EB 3CXRA 2OBYA 4BNGA 1D2MA 2OCGA 2B94A 3G6KA 3N8HA 1YTUA 2H18A 3AK4A 4RPJA 4C2BA 4YMWA 4PC3A 2Q8QA 3VYWA 4IGKA 2R9VA 1FP7A 3K30A 3P0IA 3Q4GA 2VATA 3ZHRA 3DGFC 3KZKA 3IO3A 1HTTA 3IBCA 1NUHA 3A1EA 4DMMA 3UV3A 4U2DA 3IAM6 3ZXUB 1TW2A 4J16A 5JRJA 1Y3HA 3UAOA 3INRA 2GXAA 3N07A 1EP3B 3JTEA 3WSVA 5AJTA 5AW2A 2FSIA 2ZYVX 4Y1EA 4D0RA 4KOEC 2BFFA 4MUXA 4N82A 1T2NA 1OC2A 1T5BA 4OB7A 1EVZA 2H1VA 3HXMA 4JLJA 4PLCA 5A4DA 4QE3A 1GUBA 3B9PA 1NURA 3U40A 1ADJA 1WQ1R 4H7KA 1JMVA 1YK1A 4CEIA 1P1IA 2AN3A 4I0WB 1IL0A 1WZEA 3QH4A 1P3Y1 4WDQA 3DS8A 2MSEB 3KB8A 2Y1OA 4ZI3A 1LS6A 4WEQA 5JXIA 1U7OA 2J6HA 1E4EA 1VRCA 2OAEA 3R5JA 2AJBA 1GGFA 2RGEA 1CUBA 3DDNA 4BFCA 1NPTO 1YFKA 2C2MA 2C1EA 2IHBA 2AOUB 1AOXA 4ZOQI 2AOVA 3COVA 5I9MA 4YRZA 2WWYA 5LBTA 3DO6A 2RHRA 3AKYA 3O4HA 4NESA 4TTVA 4UM5A 3RHZA 3CFYA 1QVWA 5EXEA 2OK7A 4FJ2A 3BH7A 3E9ZA 1XAIA 1EPUA 1ZN7A 2BFCB 3DBVO 4W5OA 2R7NA 2Z2YA 3LCVB 1JHYA 3VNVA 3FF1A 4M0LA 1U8ZA 1TYEB 3RFXA 1B73A 1POXA 3PD7A 5CVTA 1RZRA 4C7OB 1W2WB 5H4GA 4G1UC 4H77A 2XE7A 2ZPUA 4E12A 5LVAA 2F3SA 1NF8A 4RNDB 1AZWA 2VPQA 3UAYA 4EJSC 2GBIA 1GAEO 5CFPA 2PTSA 4BUJA 3PC8C 5FBLB 3ZQ4A 3ZHXA 1T29A 1H3NA 1U0JA 4MWZA 1NOIA 2J4FA 3N2KA 4QBHA 1H5QA 2MR6A 2AR9A 2PZJA 4G1EB 2KSQA 3H11A 2G0NA 1FYFA 1SA0A 4ZCIA 4FNOA 1QMGA 3HRIA 1P44A 4YUYA 3PR3A 2R00A 3RV3A 1BDHA 1CQIA 1TMGE 2VJNA 3C3EA 3LXUX 2W6ID 5IYZA 4BX0A 2D3WA 3KQTA 2NU6B 2IIBA 4UUBA 3EN0A 1NN1A 4MYCA 1C7IA 1KEVA 1H0HA 2MR5A 2PZAA 5AIBA 5FCDA 1FMFA 4G5OA 2V4MA 4PPNA 3U1VA 1UMKA 2E4VA 5DISB 1IY2A 5CBPA 4CWAA 5KSWB 4D5GA 3T1TA 4QPPA 4U2CA 2XXAB 1FJXA 1CUFA 1JX6A 2WJHA 3LGAA 3RYCA 3O8QB 3PXCX 5CA1A 4ZZ3A 1DX6A 3JAWA 4ZOLA 2O23A 1AK2A 3GRVA 3HV0A 1K9VF 3VR1A 1T8RA 2HBYA 5G02A 3UJ3X 3CZ9A 2QDKA 3G02A 1WSDA 4Z1OA 1AXRA 1CEXA 4BNWA 2A94A 4B47A 1W581 3UANA 5ELLA 1IB0A 4MH0R 1D0VA 4B6GA 4EKIA 1H69A 3DQQA 1L5SA 1CB0A 1L7DA 2OBLA 1ZH8A 3HXTA 3F90A 4PZAA 2DSNA 3SU8A 4CLEA 5JJBA 2QD4A 3E7DA 4DEVA 2VHCA 4Z0HO 4J9VA 5C0OE 5CB8A 2PWYA 2YVLA 1TQ4A 2GJAA 4WXRA 1U63A 2HN9A 3BGDA 1ZJ4A 4Q4JB 1SQGA 3BH0A 3I8OA 2VXCA 3QXHA 2TMKA 1KSFX 4GSLA 1X19A 4BMCA 1LI7A 1XAJA 1JWBB 2Z2ZA 5JISA 2DHCA 2VHWA 1RYFA 3IV9A 3TQSA 3GUCA 4HZUA 3HYNA 4JBGA 3EEBA 4F6LA 3PRKE 1TYCA 1XJQA 1R37A 5FA8A 2VSQA 1EFCA 5KWSA 2FWNA 2O0JA 3FPHA 3G2JA 1AS0A 3KDPA 3TW4A 5IT5A 1KVUA 1VIMA 1MU0A 4AJJA 4C3UA 2DUNA 4WN9A 1QH1A 5FYDA 3T5TA 2HDNB 1G5IA 3ZEIA 4LGVA 2I1QA 3KBBA 4BDSA 2HA6A 3CCFA 4BVGA 2EATA 4MUHA 4OJNA 4CM4A 3UWOA 3QBDA 1FUKA 2GN4A 2I33A 2Z5FA 4BWYA 4KFRA 1DPGA 4BVKA 4PV7A 3T7IA 5FI1B 2X23A 1T91A 1OU0A 3PEUA 5EKSA 5ARDA 3U31A 3ZS9A 3AVUA 1W4AA 3QX7A 4YH1A 4MMXB 1YA6A 1BW9B 4J7UA 4KXXA 2VTVA 1WDTA 3BL8A 1KTIA 4D4KA 1E94E 2ISSD 3PPWA 3GMTA 1NW9B 5BNFA 1CY6A 3H8JA 4JLAA 3E3MA 4PZDA 4ZYZA 1N3LA 1P4AA 1UFVA 1DEAA 2OUKA 2WSYB 2VKQA 1JFFA 4GBGA 4JEMA 3S8MA 6REQB 1Y8RB 1B8UA 4D57A 3RAFC 2JI8A 3DP7A 2HJVA 4K88A 4I2VA 3WGGA 1VHLA 3C8UA 2VK2A 4TQGA 1W8IA 3CCCA 4JLBA 4MWDA 3RUPA 3WYNA 4DW8A 1PV2A 1QRTA 4NMXB 5FLKA 2IY7A 1AO3A 1CVLA 5K2MA 4D4GA 1E1RA 4G0OA 1HKUA 2IYFA 1L1FA 3HB5X 1NE2A 1G64A 1N6NA 1Z5WA 1ZR4A 2PZKA 4HWRA 1NT2A 3ZWAA 3IFSA 2ZUUA 1NVKA 1IRIA 2HCRA 3M3HA 1A72A 4XGRA 4IZIA 2GO7A 1UDBA 2P2ZA 3O83A 4W5HA 1E3JA 4MWSA 1SUFA 4UTNA 5LU8A 1DHTA 1KO4A 1XJ0A 5AESA 2IXTA 2Y1EA 3FOCA 4M6WB 3RM3A 3R76A 2D7CA 1ZH4A 4GYKA 1GQQA 2CJYA 2ZI4A 2VVTA 3HBLA 4OGLA 2WIAA 1XA0A 2WUEA 3KBOA 3KTAB 1VJTA 2F3PA 3CRRA 4J90A 4C4PA 1A71A 5BYBA 3SVTA 1HZZC 2BEVA 2ZRDA 4MVCA 5AUOB 5C46F 2X5JO 2XTJA 3STXA 1I2CA 1OWMA 1E7MA 2UZ3A 2V98A 3QLVA 4KPYA 2H2DA 4A36A 3SC6A 2CE7A 1R8QA 4IQFA 4V0OA 4YHHB 3BJRA 4BLOA 3DPSA 3OCVA 1W5EA 2DP4E 4JMPA 4P34A 1M2OA 2HA5A 1O0CA 1NJ8A 4G67A 5HF5A 1UMBA 5JIBA 3TZEA 2R8ZA 3K0FA 3QF7A 4RQBA 4QDUA 5D5QA 3HDHA 4ZGBA 2WU1A 4D46A 1Y48E 3QYPA 4TWZA 1HOTA 4OA5A 2NO9A 3OOSA 3OUZA 3QYFA 3G8CA 4WW0A 5TGZA 2H7YA 3WL8A 3E7FA 4X66B 2RI6A 1H2ZA 3D6FA 3E9QA 4QBIA 1ZUWA 4ERNA 4Z4CA 3EXEB 4KGDA 2Q6KA 1ZFNA 3HABA 4W8OA 4ZO4A 3V2HA 3DDCA 1VL8A 3F1LA 2OBFA 4Z7OB 1WV0A 1IFXA 2GQ0A 4A0FA 5DYIA 2VDQB 3U49A 3IQZA 3ZWXA 1F6BA 3FAZA 4ESHA 3L6EA 5CP8A 3MG9A 4FZJA 2A4MA 1D5CA 3RFUA 5BSHA 1SAYA 1JXQA 3MWDA 3EA5A 2X4IA 1QDLB 1PJAA 3ANLA 3BF7A 1TM3E 3H2HA 2B6HA 3P0RA 4MVYA 3BDVA 3ZW9A 1EHCA 1FFEA 2WTEA 3H2JA 2B34A 3FY4A 3R8XA 3SC4A 4DSNA 1I7QB 3PI6A 4QGAA 4JCCA 1H5NA 1F3LA 1QYXA 2R8EA 2OXCA 4PX2A 5AICA 2VJLA 4TWJA 3SE7A 4HFJA 3JVEA 5A9TA 1BWQA 1P4SA 2QEQA 4L8VA 1BFDA 4WBNB 5IJWA 5HGJA 2BFDB 1K7WA 3JZFA 1SQFA 2POCA 1I2MA 1BH6A 3OJEA 1YTLA 3LHDA 3SVLA 1BE0A 2BFEB 3WRWA 2Q5OA 2QUKA 3VH1A 2H00A 3EEOA 2JCVA 4IXTA 3MJRA 4LHSA 2KW5A 4G5QA 5HFNA 1CUUA 4MYDA 2YWEA 3IKLA 4A8JA 3F2IA 1YFLA 4EQ6B 4JB8A 5KJCA 4F2WA 2YN2A 3CKMA 3NDIA 4II7A 2DCMA 1X7ZB 3C39A 4JKYA 4TN5A 2IYUA 1A8SA 3IIMA 3ZJ4A 4BBAA 2CSXA 3PXDA 5JLAA 4WVFA 1YB6A 3CVJA 3WQSB 4PBRA 1CRQA 4CIDA 4DBVO 2EWWA 5DB4A 3STTA 1TL7C 4EB6B 1F9EA 3BMOB 3H2IA 3GFGA 3GWGA 5AR1A 3N1UA 1QPBA 3MNFA 2EZUA 4HMQA 1WABA 3BQ9A 3NTXA 4GMKA 2EX0A 3FA2A 3W78A 2C58A 1OH7A 2YH2A 1ADGA 1R6VA 4ND4A 1EIZA 4IGIA 5T3UA 3F6PA 5JE8A 1DAOA 2XUFA 4BJ3A 1XQVA 2RAVA 1HL7A 1UBUS 1HO3A 1PL6A 2C8JA 4H1VA 1E7QA 2VZ0A 3RUEA 3EAFA 4M8NE 2CF6A 3AT1A 3OWOA 1FLDA 2BH2A 1N2XA 4CVNA 2Y77A 3GJSA 5F51A 5B7PA 5LZ8A 2O5EA 2AX3A 4HADA 5JSUA 1FOEB 1WF6A 1L5FA 1L4BA 4PZEA 1II9A 1EFPB 1OI4A 3DM9B 1FRQA 1S4QA 4FSHA 4KWTA 1LJLA 1Y9AA 3K2IA 3W4KA 3W6NA 4MULA 4NABA 4ARUA 5CB4A 4D9EA 2Y0DA 1EUDA 5HK9A 4PAGA 4MWBA 3LBAA 1XK6A 4X7MA 3HM2A 5J2UB 3VZDA 5IM4A 4LDPA 1KEKA 1CJVC 1KYXA 2ZSBA 5E6RA 3UK1A 1QS0A 2V5VA 1D3AA 2XCOA 4MITA 4PX9A 2XZOA 2PS1A 4MYUA 1HY1A 4GVPA 3TCKA 1CC1S 3A3OA 4JLSA 2XD9A 3MBKA 3TR5A 8ADHA 4AS1A 4IRMA 2KQUA 1W30A 4GM4A 2BBOA 5CA0A 4ADLA 1RS0A 5KQSA 2XUKA 4FEYA 2H4HA 5DU2A 2ZE6A 3ILYA 3II6X 2AN9A 4B34A 5IC4A 1F06A 3BGSA 4B44A 3VR6H 1EK1A 4MMZB 2WE8A 3D7KA 1YUNA 2WG1A 1F2UA 3PFFA 4OQLA 1EK6A 1ETHA 2W8ZA 3HVIA 4BB0A 4QJ3A 2OG1A 3HUTA 4Q4AB 3COJA 3B5EA 3OOJA 4B1FA 4BQFA 3U17A 4HRXA 4M83A 1UXKA 4FDLA 1RQ7A 3CNHA 1C4OA 1NYRA 1QV9A 2H51A 2IYAA 2P6UA 3ETNA 1RAHA 3HQ4O 3NOQA 4FCWA 5K09A 2IS6A 4B3JA 3F4SA 4RHYA 3CRQA 4E4TA 1XNHA 3EXFA 3HM9A 5F92A 2OLKA 4K9NA 3E2IA 1DE0A 2K2WA 1J56A 4OHPA 2AI3A 1I6KA 1PW7A 3O21A 3A4YA 4DARA 2PYZA 2XEXA 5EGNA 1SXJA 4I2NA 1ONNA 4IGAA 4JENA 5L9AA 4H6XA 5CM2Z 5LXTA 1JR4A 2CVHA 3AR8A 3HA5A 2K87A 1MAVA 1UKZA 1J33A 4KFTA 4NEQA 4Z9YA 1QHXA 3QY0A 4H3SA 3CRVA 2EP8A 3HB4X 2UAGA 3QUAA 1I5OA 4R8LA 3V7WA 4B84A 4F4UA 3BCUA 4D2IA 5B58C 5KSZA 3UK7A 4D6PA 4TYQA 1JIJA 5LP6B 1FNNA 4PGHA 1E2LA 3NGXA 3BXGA 3CLHA 5GZ6A 4N5DA 3SBEA 5DGCA 3JQBC 5LQAA 3ELDA 3W5JA 2DFVA 2R8RA 4YJDA 1REQA 1ULUA 4EO7A 3KU1A 3RS8A 2CFOA 1U98A 4YYEA 2IH5A 2FRDA 4HPWA 1HEUA 5JLJA 3A6EA 1B8PA 4ZO6A 5I45A 3VR5A 4TWAA 3BAFA 3QXXA 1LPNA 3UUWA 3T1YB 4W8HA 1Y4UA 3NAQA 3RHSA 2ACKA 4QASA 3B53X 1GR1A 2R7LA 3H83A 4EGAA 1RI2A 5JJKA 4E5PA 3ITNA 5I9SA 1PO7A 2P9GA 3MCVA 4PZPA 3F6RA 2GHIA 3BRWA 4HEJA 3GUZA 4IOMA 4BO4A 1UBGA 2VZ8A 1J0BA 1IDN1 3IHWA 4PICA 4QDKA 5E8RA 5A02A 3DMPA 3AFGA 1AJEA 4IDFA 2WM3A 4NNOA 5G2OA 4DA9A 4V02A 2Z6QA 4S0XA 3R41A 3OEHD 3Q3CA 3VTFA 3X1MA 4R2IA 3NTQA 1WBBA 1N2HA 2X5XA 5ESDA 1CDEA 3SD7A 1FDWA 1AKYA 1SULA 3KR0A 1IJBA 3HN7A 5JAMA 1M10A 4FFDA 1QP7A 1VPVA 4MB6A 2ZRCA 3QU5A 1P2VA 3QEMB 1JDJA 4I9NA 4ZEVA 2XX3A 1P75A 1G59A 2GEFA 2D0OB 5D5HA 3OZCA 2GXQA 1M6WA 1P1CA 4G4SP 4LVNA 3OX1A 4TL9A 5KSPA 3F2VA 3H13A 5ER6A 4Z49A 1QVAA 1K6XA 1T1JA 1ZS9A 2HHCA 2QZSA 9ABPA 4YRQA 2JH8A 3IUSA 3JXEA 1C7JA 4L74A 1RC0A 1VA4A 1UJBA 1Z36A 3QF4A 3T0FA 2J32A 2PXHA 1Z6TA 4KU4A 5AW0A 3HY6A 3QV2A 1NI4B 5EJ6A 3QTBA 3DD5A 3TXXA 1O54A 1SUCA 1SCQA 1L7NA 5CDSA 4QDJA 3OMLA 4EHFA 4M60A 2G17A 4LK2A 4JBYA 5TX7A 1NOJA 3ACCA 4D3ZA 1UOQA 1ZINA 2CXUA 2X0KA 1N25A 2V97A 3A7DA 4R9SA 5E6UA 3U4CA 2ZAGA 3LT2A 4Q9AA 1KL7A 4YCNA 4E15A 2I8LA 2WPDA 4LX0A 3HRHA 1MOQA 4P4TA 3K6KA 3TN7A 3TRHA 1TF2A 3AI7A 4IDDA 3P9RA 3LCMA 4PE5B 5K7SA 1A76A 1VLVA 2BTQB 4LZPA 2I7XA 1JDVA 5NLLA 5JAPA 3ZI7A 1P77A 4X64B 4WESA 1HDIA 2AEFA 4TN1A 2AUTA 1A9QA 2R47A 3BX1A 3GRKA 3M1YA 4P84A 5FPSA 1ZMOA 4YRCA 4CIVA 5B64A 1XE3A 2CUNA 2WP8J 4E3WA 1M34E 4MUMA 4TSKA 2CBGA 5E38A 4EL5A 5K4HA 2QP4A 5HILA 2I62A 3RU3A 4EHAA 3ERCA 3TXYA 5HF8A 4FE4A 2GVNA 5JAQA 1M6HA 1OTXA 4RSHA 5LR6A 1O0SA 4JQCA 4QRDA 3H0EA 1HUQA 4TKZA 4RMNA 2WWTA 4H7PA 4FYJA 5ECGC 2JJ1A 3VRHA 3MBIA 1DRWA 3RD8A 2ZBVA 4P7BA 3WGOA 3CF4A 2I78A 5DBEX 4W82A 2VBFA 4W6QA 2JCYA 2PZ8A 4AKGA 3W5HA 5HTOA 1E7WA 5F91A 5KIAA 3KHKA 1NVWQ 4HGVA 2W83A 4O4IF 3KXKA 2ODQA 2IWRA 3CR3C 1DAMA 5GM1A 2XF8A 4TL8A 1AMUA 3MWGA 3QU4A 1SIOA 5CEEA 2YHUA 4JT2A 3CVWA 1GG2A 2XMPA 1CUEA 3IT0A 2H1HA 4RM2A 2CD9A 4B3BA 3C7DB 2VP3A 2FYTA 3D6MA 4QUBA 4RPLA 3DZDA 5CDUA 2PUBA 5ICCA 4HYTA 2BHRA 2ZW9A 3LC0A 1GCAA 2XDAA 2OECA 4IV8A 1EWRA 4D97A 4AN4A 1DGQA 2UUPA 3IQIX 5LIRA 4XJTA 3C3XA 1T2CA 1XXHE 3E3OA 4RY0A 4LG1A 4D8TA 2ZYIA 2Q4RA 1UQUA 3Q3GE 4TMYA 4M9UA 5TMEA 2ONJA 1MDFA 3D0KA 2WP0A 3U3XA 4C4XA 1L5RA 1OYYA 2XTAA 4EW3A 1GFIA 1QR6A 3ZG6A 4DWWA 5BR8B 2E21A 3JQ7B 3FNEA 1MN6A 2GD6A 3DHNA 4PU0A 2W98A 3LI2A 3WDLA 3EULA 2NGRA 4UMDA 3GN1A 4W5QA 1OYOA 1OSNA 3OJXA 4OKNA 1D0SA 1RM5A 1YV9A 2J07A 1GL7A 4NYMQ 1YVUA 3F5FA 1J5PA 5A2GA 5JNVA 2F3UA 3GVPA 1R0KA 3HPQA 3LUFA 3NBUA 3R0ZA 4URUR 3UMJA 1AB5A 5JW6A 3ZIAA 3CSDA 1UBHS 2YIMA 1KEEB 4N12A 4B9AA 1QFZA 4KPUB 3SZMA 3TG2A 4LJLA 1EK2A 2FPIA 3K1YA 4KQ1A 3PE3A 2AK3A 5BV8A 1CU1A 1D0IA 1TZKA 3MOIA 2GFQA 3HTXA 1QIFA 1WMBA 3AQ4A 4C0QC 5I8PA 2CJFA 3FFWA 4C21A 4DN6A 1YDFA 3I2YX 2BFOA 4RGYA 4OBXA 2R6FA 4X00A 3EGWA 1FU7A 2XXBA 1GAQA 4HDSA 4PZZA 5I7AA 5MN5A 3TZBA 4F7WA 5CD1A 2EQAA 3NETA 5JTUA 2PGNA 1NXQA 2Q28A 2DM6A 2YZNA 3OP1A 3KNZA 2PSSA 1U28C 1T8YA 1I24A 4M55A 2GAOA 3F7OA 3RH0A 4R1UA 4V0LA 1NQUA 3K0CA 2FW8A 4N41A 1BH2A 4FBMA 1FP2A 2C2GA 3ASUA 3CINA 3D6TB 3DL2A 4RA6B 4G8JA 5F2KA 3EAQA 1K5DA 4UEQA 1HEIA 3HBMA 3LKVA 3O4IA 521PA 4C4TA 4IDAA 1XU9A 3FHTA 2I66A 2F6RA 4JOBA 4H4EA 4TLBA 4PCUA 4L5BA 1FZQA 3G88A 2A8YA 1EFVA 3D6UA 1L9KA 3INTA 4HGRA 4LRTB 1TF7A 2JATA 2GM9A 3LUHA 4Y9DA 1DL5A 2HCBA 5TNXA 3W8FA 3VR6A 4UU1A 3REGA 4G0NA 3PU6A 4I8XA 1PCXA 1NMZA 1O08A 1J42A 3WL6A 1VXOA 5FBHA 1T24A 5EFOA 4V1CI 1WUKS 2GLUA 2CCJA 1COZA 5C7OO 1SUDA 2AOTA 1PEAA 5DTEA 3TLBA 5IXYA 4W9MC 4GF5A 1QNLA 1WR8A 4KNVA 2L69A 4EGSA 4F4JA 3LDFA 1DCFA 3OPNA 3IALA 3ROEA 3NPMA 4OHBA 1E3SA 1EK5A 1E1NA 1G3IA 1TAHA 3CWQA 4KXVA 1QQ6A 4I8IA 3HZOA 4RSGA 2WI8A 3ZGYA 2FWMX 5DLDA 1HMYA 4K6FA 4DIBA 2HZBA 2J5XA 3OQ1A 5DASA 2DQZA 2TMGA 3C70A 2A3NA 2A0YA 4BKUA 1KFKB 2B82A 3GJ6A 1SM4A 4LOJA 4XUEA 1XLTC 5CT4A 2HB6A 1NW7A 4C89A 1OAOC 1DT5A 4JI1B 2GEJA 1HY0A 1UZAA 4A92A 1GKKA 2YJGA 1U0HC 3L5OA 2D1FA 5AJWA 3JU3A 1I1NA 2D7DA 5JEEA 1UL1X 1CR6A 2GDJA 1RLTA 2B2NA 1FFWA 2PT9A 2VDUE 2CMHA 3KO8A 3LVBA 4KXUA 5DYNA 2BGNA 5I7HA 1ZA1A 1R4NA 1UBEA 4FINA 1NQVA 3DZGA 5CT8A 5LM3A 3G68A 3N39C 1AUOA 4O02B 3WJ7A 4Q37A 5IKEA 2CBZA 1RZUA 3NXKA 5LYJA 1AIPA 2PMWB 5U4QA 4YONB 4AB1A 2DPYA 1J8FA 4P4SA 1J8DA 2P65A 5FT9A 3BZUA 3AKDA 3DF7A 2Z6AA 3KSZO 3L1JA 2V3WA 3PD1A 5F3WB 1U8EA 1NQXA 4BATA 1QORA 2VPTA 4KJZA 1AGRA 3I2HA 4L3WA 2JLBA 4IRUB 4UEKA 5B3JC 2O8VA 4HXYA 3EW9A 4O4JB 4YCCA 1WX1A 3PF9A 1SO8A 4LSZA 5BWMA 2APJA 4L3OA 3EGDA 4MWOA 1QKIA 4F9FA 2V0GA 4EY4A 3F4LA 3IPLA 2F9MA 3VPGA 1X6VA 1ZMXA 3IQXA 1NG1A 2EX1A 1E4OA 3IMCA 3IPXA 1QZXA 3QG5A 3FBGA 4XOIA 5D1NA 2HV8A 3VC3A 5IS2A 1IOVA 1BMFA 4MKRA 4DKXA 3E2PA 3NUGA 2G04A 3O1LA 5EIOA 1JNXX 3ESAA 1UDAA 3SS9X 2YWRA 2DWOA 3S8EA 3WAGA 1ADBA 1EFKA 2O2IA 2FUEA 2JARA 1N2BA 2ODBA 4RKRA 5EJFA 4JASB 4P1ZA 3GW8A 3F4RA 1PS9A 2OZLB 4U02A 2EW1A 3IAHA 1F12A 4LJ5A 5FUWA 2P5YA 2HXYA 3GT0A 3D8NA 4V38A 5EEGA 5F52A 2XA9A 1CUYA 1L4NA 4RAOA 3TE7A 3HCEA 3K4PA 2J3KA 1DEHA 4DBLE 2I2DA 4HH0A 3TQCA 3BD8A 3DHEA 4ZI7B 3OX2A 3QFRA 1Y1QA 4IVPA 3URKA 1J5EB 2RK4A 3AR3A 3W0LB 4GOXA 1GITA 3R75A 3UK6A 1AMOA 4W5TA 1XFDA 3UF0A 4Q4DA 4E94A 4MUNA 2PRSA 4B3XA 5BN5A 4EGJA 2O54A 1K86A 3E7WA 1GSHA 4MCIA 4PPGA 1XRPA 2VYFA 2Q9CA 3OWHA 3HYLA 1KY4A 4J2OA 1E6MA 4CKXA 4ZYYA 3WC4A 1C0LA 3T3OA 2NV2B 3NEAA 3K0BA 4DWOA 3GLHB 4HZIA 4KCGA 3N58A 1N3IA 1OT3A 3TE6A 2RHJA 4GLJA 2HLNA 4A5SA 4BECA 3IQHX 1LQ2A 4F2HA 5G0VA 3TFOA 4G24A 1ZOSA 2CV1A 3RWMB 5DI3A 4DR7B 2XE4A 2P6MA 2YWBA 1Q22A 1ZESA 3U80A 1JJBA 4ML3A 4LOAA 5AKXA 4MVWA 2G9RA 2R44A 1LBQA 3LF1A 4L02A 4L2IA 3GFFA 5IT9A 4NNJA 3GNSA 3AUFA 1A4UA 3AESA 1BMQA 2AW5A 4MCJA 1FFSA 2FUG1 2C82A 3OQHA 4XQEA 3P26A 3GAZA 2ZIXB 3GJ8A 5I4CA 1TJYA 2WSSA 3DJFA 1YQXA 2YC2C 3GEGA 3UAGA 3PNBA 4LBWA 2V54A 4FU0A 3RVDA 5BO5A 4CDGA 1I5EA 4K86A 1PWHA 4EVRA 2DHQA 3ND9A 5KHOC 2ZS8A 3HA7A 4CKEA 1KETA 2Z30A 4H60A 5IYZB 1VA5A 4RSRA 2D6FA 4ZQGA 3PC4A 4LCEA 4KUHA 4P35A 4ZQFA 2NWQA 2YRXA 4DF3A 4V1CA 5JWOA 4DA0A 5D2CA 4AJ1A 4HQFA 4DHEA 2WYUA 5EPOA 3A1UA 1QIDA 1BA3A 2FPGA 4TUYA 3I37X 4LZOA 4XJVA 3WBKA 3SJAA 4B40A 1OILA 1VPTA 4J29A 3RYCB 4JDUA 1RWKA 1VE6A 1K27A 2QMOA 2WG0A 1EA5A 1S3FA 3ISTA 4P3KA 3ZV3A 2B4RO 4ETNA 2ZBUA 4YAKA 4CM3A 1OV4A 4FFOA 1GADO 2Q5JA 2GHRA 4J0GA 1FX1A 4KVAA 1Z5UA 2X6TA 1HM5A 1QHHB 1GNRA 2JW5A 3FFXA 3WGNA 5LBUA 3ZZNA 1IOLA 4NCXA 3RRFA 4RM3A 3LRPA 3F9RA 3R7WA 2YFYA 4ZDIA 2CK3A 5C4IA 1G8FA 2E4AA 2VJYA 1DOHA 3AI3A 2B8EA 2C9ZA 1US8A 2R6R1 2EZ4A 3IOBA 3OY2A 4ND3A 2Z8ZA 3EW7A 4LDZA 2E55A 3PJEA 1IYZA 4OJMX 4ATNA 3LLSA 4YJFA 5FUVA 5DW0A 3ZLUA 3LKBA 2QMQA 2F62A 4MV8A 5TPZD 4BMZA 5L6LB 1TT5A 1DI0A 2KLBA 2ZYHA 4M1WA 4C4SA 2AE1A 4EUKA 1DAGA 3K0HA 5BSWA 3L5KA 4JBNA 1B6TA 1JHQA 1J0EA 3CX3A 1TM1E 3VAZA 3ZDXB 3EG5A 2Y4OA 2V0NA 5HIJA 1W9HA 3N0RA 2YJ5A 1F8FA 3CCBA 8MHTA 1L4KA 3DCJA 1PZHA 2NU7B 3PQEA 1CJCA 4PAMA 2ZJOA 5ERXA 3T3PB 4D7AA 2DOKA 5KYNA 4WN9B 1Z4IA 2Y2UA 1GCUA 2QRMA 4B6SA 1M2EA 3GMDA 2FEAA 5IPFA 5FLEX 3G23A 1A9ZA 1JDSA 1FMJA 1SH7A 4JUCA 1VG9B 2P11A 4CM4B 1Q1BA 1I3MA 2Q3DA 3AB8A 1DX4A 3CUKA 2MMGA 3OE5A 4JUAA 4RVHA 4ALMA 3DV0A 4ZFNA 2PE5A 2OFOA 3ZDFA 4OQQA 4M9XA 1FUYB 3COYA 4RY8A 2BSXA 2D5IA 2ZTHA 2ZI7A 4GNKA 3U16A 3TLGB 4MV1A 4DLWA 1D1TA 3OZIA 2B5OA 2PWZA 1Q6YA 1T6BY 1IW7D 2RMKA 3HEBA 1GTMA 2GESA 5AJXA 4ZHQB 3FLBA 1RACA 2J48A 4B3IA 3DLBA 1DT3A 2P35A 1Z38A 1JFFB 3I5MA 3KYJB 3IV6A 1E9DA 1I4EB 4YLGA 3FXAA 3X1XA 4C01A 1UBOS 3ENQA 2OV6A 3GVHA 1LXCA 1TAGA 1T3LA 2NPOA 2PGAA 1U8UA 4CCYB 2YWXA 2Y3IA 1V9LA 5K3AA 3C6QA 3H18A 2J9FB 3M9LA 4IJ6A 4DV1B 1IXSB 3CTMA 4JLMA 2BDEA 4BKPA 4QZVA 1LDYA 1E6CA 2VPXA 3DCIA 1G8PA 1N5DA 1XAGA 1VIYA 2R1ZA 5GONF 4L27A 4RHTA 5JS6A 4DUYB 3AC0A 4UAGA 3K5HA 3WQBA 4ZAGA 3CW2A 5BURA 1ZK0A 4HGNA 1CD5A 1QYIA 3AY7A 4NBWA 3ML1A 3TX2A 1LB1B 1VMAA 2V03A 3PT5A 4KNWA 1Q1QA 2CNWA 4URWR 4G25A 2OKCA 4EY5A 5KINB 1JF8A 5KKNB 2UYGA 4IUCS 5BV1A 2DX7A 5EC8A 3ABZA 3VPCA 3IE1A 4TWRA 3B1XA 4MHOA 4D43A 1SZDA 2YFQA 2JIZD 2BISA 4R8MA 1QXSA 1UIRA 1XRMA 4F38A 1BQ4A 2PGDA 3L8FA 3NS7A 2RGRA 5LQKA 2ADMA 4UPDA 4Z9FA 3J7AC 5AJZA 2DR0A 1Q0ZA 1M2OB 2B25A 5LP6C 3TJZA 1ISMA 2AKEA 1ND6A 3L6BA 1UMBB 2NN3C 1XNJA 2PL1A 2BHLA 3K0FB 2W6QA 2Y0EA 4HLNA 4QOGA 1VBKA 1QGED 2BEJA 2JKVA 3TW8A 3AOEC 4L6AA 2G4VA 3AR9A 1OFTA 3DL7A 1C41A 1PG2A 1N6OA 1XG5A 1AGNA 1W35A 1IIBA 2FRXA 3OM1A 4J76A 4DVJA 2BTEA 1VLJA 3GEPA 2RHMA 3DAHA 1YZTA 1C30B 1BSVA 1JV2B 4QBKA 5DNDA 5AT1A 4NXNB 1OCEA 5TY0A 1NBEA 3RF7A 4MGKR 1NL3A 4MIOA 2R8BA 4A0RA 1ZR2A 4XEUA 4FQ5A 1S8AA 4IMPA 2AKAB 3OJOA 4NFYA 4M7RA 4ZV9A 3QWBA 5HQTA 1C0PA 2YJ6A 4OSEA 3UMMA 1MVOA 4M3NA 4DANA 3RVJA 4MIEA 3I04A 3ROTA 3WYEA 1SB9A 3MWDB 4O2BA 3G8AA 2B9EA 1C9JA 4ZCTA 2VA8A 3IAEA 3VQTA 2HK9A 1NKSA 2VP6A 4B2IA 3H2YA 1WF3A 2CVFA 2WTBA 3IUEA 1IWPB 4HB2A 4LMBA 1U0EA 1SRRA 1Z0AA 5H3HA 3W4JA 2PRZA 3WYAA 2XZLA 3DMNA 2I4OA 2M1XA 3DZHA 4H31A 3W6OA 3ORRA 4MROA 4ND1A 4DRZA 2PZFA 2O0MA 4LY0A 3NT4A 2W58A 5HS4A 2FPXA 1YDEA 2JFQA 1DKPA 4E2WA 4KRYA 2WAAA 2V4ZA 5A7FA 3A06A 3LOUA 3OO1A 3H1FA 1QGAA 3TKYA 4Z7JA 2AZMA 4ZU1X 3FWZA 4FFBB 4J1TC 4DMRA 3H2GA 3PNKA 3BCRA 1UQRA 4FHEA 1QUFA 1DP4A 1LW7A 1N5RA 2E48A 2FWRA 3QPAA 5CNJA 3ROPA 5JTTA 5G0TA 1OF1A 3CX8A 4GM0A 5L4LA 1DNPA 1M6VA 4KO2S 5F9MA 2OPHA 1R6BX 5B36A 2V4UA 4HTFA 3H16A 1V16A 1Z7BA 3MUNA 3E3LA 3KJHA 4Z4FA 5HCNA 3W5VA 1XTVA 3ONVA 1DTWA 1JSRA 4MR8A 5FNZA 4AM8A 4EKEA 3HR4A 4LRXA 4Z8YA 2J85A 4BV3A 1NXPA 2C94A 2VNAA 3WADA 3LUJA 3M9XA 4XJXA 2BUCA 2C5SA 3HR7A 4AD8A 1Y3CE 1PZXA 2JVKA 3JS5A 3QI7A 1HC7A 1L7MA 4Q3KA 2OXIA 3F5QA 1XNRB 1NRJB 2JHPA 2QE7A 3HFGA 4O33A 1UM9A 1Q92A 5CK5A 1J49A 1XMXA 3LNTA 5FBWB 3VAYA 4ZP1A 4GPD1 4ITRC 1I1QB 4X8OA 1XHEA 3F73A 2YJNA 1E6LA 2O1EA 3JPYA 2F1HA 2Q5CA 1MO3A 3ENWA 2G7MC 3P4XA 3Q9SA 2DUWA 2GZAA 5SZJA 1TM2A 1ODKA 5EMLA 2BSQA 3MSXA 1IUOA 2PFMA 1MV8A 2EJBA 4D9JA 2WM9B 2R4QA 1WHSA 2YWJA 3AERA 2ZAMA 2XUDA 3BK1A 5CXSA 4MKIA 2QSUA 4EEIA 4DNFA 1XTTA 3PNOA 3GIWA 3U13A 2JHCA 2YTZA 2FFRA 2H5JA 2RGAA 3BD7A 4NV3A 5EWMA 4AJ2A 5BN3B 4JXXA 4IUYA 2UVQA 2BJHA 1CERA 2BUBA 1LC0A 1PX0A 1L8OA 3P5SA 4TSFA 4AJHA 2JCSA 4Z3DA 2BMAA 2CCKA 2CVZA 5IJXA 3RUAA 1BN6A 1FFBA 3Q8WA 4LGMA 4KXMA 5A5DA 2QLTA 5KYYB 2G67A 3FVRA 3DT8A 3H3JA 4MUEA 3QUBA 1EP1B 1QS0B 4QTUB 3W6UA 1M2VA 4AWAA 1IN1A 1OE0A 3D4LA 1W96A 3MTIA 3T99A 1K88A 3KFVA 5HX7A 1AQIA 1E9BA 1Y8QB 4JJGA 1J4AA 4UHHA 1OZAA 1VDZA 4OQNA 5KQLA 4YFYA 4RHXA 4YPOA 1KDPA 4WDRA 5EKUA 3IAS6 5G4LA 4CHTA 2WF9A 4OBEA 3CLSD 2PTGA 3CBQA 1EGAA 2XVXA 3BEDA 3H9CA 1WXQA 3LK7A 1KMHA 1XROA 3KKQA 1F2UB 2V6IA 1KS9A 5I9TA 4BGIA 4D98A 5B55A 3PUVA 4KZPA 4V24A 5HF9A 4AZ3A 1AB6A 5TMBA 3DONA 3FTDA 2PH5A 3RJMA 2AGVA 2XNDA 2O0HA 3RAJA 4G3XA 1W5SA 4KRXA 4ALIA 3I30X 2J08A 3PNSA 1LZLA 2HY7A 1KFCB 1ABEA 1TEVA 1VCMA 2PX0A 3FNGA 3KX2A 4QATA 4PSDA 2XDYA 3EXFB 3TDMA 5HZGA 5IH7A 1VRWA 1Z0IA 1VJGA 4ACBA 2AC2A 4F8YA 4ZZIA 3MFYA 2WE7A 4EF6A 1VE1A 1M9NA 4CL8A 5BSTA 4PBTA 3C3YA 5KX5F 1DBPA 1SXJB 3OQ6A 1XCGB 5L53A 1E2BA 4BN4A 1PYOA 4BQQA 2V7GA 4RTQA 2PQMA 4MIKA 3BK2A 4CI9A 3BB4A 4AC9A 2O7RA 4DG9A 5AVTA 4FS3A 1W36B 3ZBQA 2OQIA 1TCAA 1BVYF 1ZGBA 3B1WA 1GZUA 4TZKA 3BHGA 4LY9A 3KLNA 4BQRA 2J7PD 3UBMA 1K1EA 4TGLA 3RAGA 2MHCA 1ZAYA 5DX8A 4QD3A 4YP6A 1RJ9A 1ULHA 3KAPA 4GNRA 3G1TA 4XIGS 1OVGA 2XUIA 4YWJA 4DJDC 4XA8A 5A4AA 3PWZA 2JIDA 1U1GA 3NUQA 4RMJA 1JHOA 4TQAA 1BCSA 3I12A 4G0VA 1XWOA 4C0LA 5KNDD 5LU9A 3EWAA 1JLLA 1REQB 1L5HB 2H6EA 3DVAB 3EWNA 1H2AS 4E09A 1SU4A 4QHYA 3AJRA 1H3FA 3GDOA 5KTSA 2DQKA 2VXOA 1XLVA 3BBPA 3N87A 4EMUA 2X58A 5DXFA 4AX4A 5AVXA 3IX7A 3LPLA 1NW3A 5AKEA 1MQ8B 3FNFA 5AKIA 1JW9B 5B7NA 5JZSA 5B1DA 5BV7A 1N0WA 2WDZA 4J0DA 3AHCA 5CCXA 2A0UA 2D54A 4H35A 4WZBE 1QIKA 2C07A 2CXQA 1LBHA 2QAGB 1W88A 1OKKD 4OU5A 1G5FA 2ZULA 4UM8B 1V2HE 2FGJA 4X7BA 5EINA 5EIEA 1NGSA 3EIUA 1IONA 1Z06A 2ZJ0A 3WZMA 4CMHA 3ICQB 5KJ1A 4N5HX 2I3AA 2JIQA 3PUYA 1DAIA 3AFHA 5H9WA 3DE2X 2HLPA 4J0JA 3WLJA 3ND8A 1KKUA 3T15A 1WMSA 3VMMA 3BT7A 2Y67A 2JF0A 4LE2A 5KYXB 3ELWA 1VFNA 1XTZA 4Y9RA 4ASUD 1E1YA 2PHZA 2QLBA 3PGXA 5AJUA 1B0PA 4P31A 2IS2A 3MCZA 1RJWA 4LI3X 3E9CA 4WA7A 5FTLA 2WSMA 1O95D 1XVIA 4CR7A 1TU3A 3IP9A 4IOJA 3RYTC 1YDWA 2ZSJA 1RIIA 2VG8A 1AURA 4A8HA 1P0CA 4YCAA 1ML3A 4FEAA 1J8VA 3AJ9A 3S81A 1Z2PX 1Q3TA 1XU7A 5CJJA 5E4TA 3QLJA 1NVDA 1F7VA 3S2ZA 4UAVA 5TEVA 2PT7A 4O4HF 3O4JA 4QDZA 4YAGA 3LU1A 4WCFA 3NASA 4YPFA 4IKEA 2LDBA 1V1MA 2ZIZA 3CVOA 1IBSA 1O9GA 1OMOA 1Y1PA 3NM5A 3R4CA 1XX6A 4JHXA 1A8PA 3SYNA 2Q7DA 1M5TA 3NHUA 4YJ2B 2FUCA 3EG9A 4K87A 2QZZA 4M1KA 4NDNE 5CURA 4EBBA 3PFCA 3ANSA 1PUXA 4IDBA 1TKAA 2FPWA 2Q99A 3EBPA 3OLXA 3QF4B 3RODA 2BW0A 3VDRA 5JH7F 1ZNZA 2IYEA 4UUQA 3VVBA 3HBJA 1NATA 1PZFA 2TYSB 4MQBA 2JGMA 5KJEA 2F3QA 3T0GA 3OETA 1CY2A 1KC3A 3EF0A 4AG5A 1XHLA 5GWXA 1UUFA 3MF4A 4N5NA 3AR7A 5JZBA 5B53A 1B0UA 3ADPA 3LLMA 3UHJA 3G6WA 5K99A 2BV3A 2XYRA 1WP4A 3Q3IA 1TIPA 1RBZA 3EDMA 3BRSA 2NXCA 5KEIA 2XMSA 3FPAA 3VC7A 3QXCA 3KOUA 3EWIA 3OCZA 4CF7A 1JHZA 1UPXA 3LUAA 4FHGA 2E87A 3KVOA 1QHFA 2FLKA 3PZBA 3AJAA 2P0AA 5ALWA 2ZI9A 4OHYA 4C4RA 3QVXA 1QHSA 4F86A 2G1JA 5HW2A 1OTHA 1XDBA 2ZJ4A 3LDUA 5G41A 3AV0B 1XPJA 2G5GX 2I80A 4IDPA 1QH8A 3SM9A 1Q0TA 4UVIA 1CJTC 3UJ9A 2NT3A 4FKZA 4OXIA 3OF3A 2YMMA 1H1TA 3OE7D 4CLRA 3DWIA 3A6FA 2H1CA 4XKJA 1ENPA 2WIGA 1CHNA 1AGYA 2GN1A 2HIGA 2LPMA 3OEED 2XT9A 4LTDA 4EHBA 3H9GA 1ZD8A 3TRJA 3PLAE 4G5GA 1ZM3A 4P38A 4J43A 4IDCA 4DMLA 1KU0A 4F1WA 5JDCA 1QCCA 3LHFA 4PZCA 1VKRA 1KE2A 1XQ9A 1ZXLA 1KMCA 3F6YA 2VHVA 3LQYA 2VUTA 4HGPA 1KU6A 3DFKA 1T25A 4WBSA 3ITDA 1DQPA 1EIWA 2W4QA 4DJ5X 1YCHA 2RGDA 3JX9A 1Q57A 4JR1A 1U8AA 1MX1A 2DECA 2EKDA 1KI2A 2ZUBA 3M4NA 5EWJA 1T8UA 1XZLA 2UZ4A 2NM0A 4JV5B 1J9EA 1QJCA 4KX5A 3TB6A 3MGKA 1G6OA 4CM9A 5JSKA 2PD6A 3VSEA 1FVXA 2WMNB 1V8BA 4MPDA 1PJRA 2JZOA 3C24A 2QSYA 1G21A 3BMQA 4MQEA 3AH8A 4U8GA 1XZNA 3OOEA 5F4ZA 1TYBE 5K0EA 4QODA 2QD5A 2QU8A 4DA7A 2Q62A 1UZNA 3KVVA 2O19A 1CVIA 1HFWA 5CIWA 4DQLA 5J2TA 1DJMA 2XBUA 3BXHA