2JAOA

Crystal structure of d12n variant of mouse cytosolic 5'(3')- deoxyribonucleotidase (cdn) in complex with deoxyguanosine 5'- monophosphate
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
196
structure length
196
Chain Sequence
b'KRPVRVLVNMDGVLADFESGLLQGFRRRFPEEPHVPLEQRRGFLANEQYGALRPDLAEKVASVYESPGFFLNLEPIPGALDALREMNDMKDTEVFICTTPLLKYDHCVGEKYRWVEQNLGPEFVERIILTRDKTVVMGDLLIDDKDNIQGLEETPSWEHILFTCCHNQHLALPPTRRRLLSWSDNWRGIIESKRAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'(3')-DEOXYRIBONUCLEOTIDASE
publication title Crystal Structures of Human and Murine Deoxyribonucleotidases: Insights Into Recognition of Substrates and Nucleotide Analogues.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
total genus 72
structure length 196
sequence length 196
ec nomenclature ec 3.1.3.-:
pdb deposition date 2006-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06941 NT5C 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.40 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Deoxyribonucleotidase; domain 2 2jaoA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2jaoA01
1F5SA 2YMQA 2VKQA 2I33A 3L8EA 3E8MA 5AVQA 3WKEA 2FI1A 5AM5A 1CR6A 2G09A 3OCZA 2RAVA 2YMPA 5AICA 4DWOA 5AESA 1KYTA 1Z5UA 3QU5A 5AKLA 3R09A 3AR6A 5AM3A 2Q5EA 4UM5A 3QU2A 1L7NA 5AKKA 4HGQA 4Y2JA 5IT4A 1ZD5A 4CF5A 4OCZA 2JAOA 2C9MA 5AK3A 5ALYA 3K1ZA 3QYPA 5A3QA 1AQ6A 1N9KA 1ZOLA 3I28A 5AVWA 3L0YA 1ZJJA 2W11A 2B0CA 2ZBGA 3QU9A 3QGMA 5ALZA 5AW5A 3F9RA 3FPSA 2EAUA 2IA5A 1RKUA 3ZUPA 3WKCA 2WF5A 3NIWA 5ALTA 3RFUA 2HEGA 3WKBA 1YV9A 4UU1A 2FPUA 2QYHA 5AIAA 3J7TA 2HX1A 2ZBDA 3IJ5A 3SMVA 5AVXA 1XP5A 3SF0A 1QQ5A 2C4NA 5AW1A 2P69A 2PQ0A 3L8GA 5AKHA 4HGNA 5ALDA 2P27A 3KC2A 3L5KA 2OM6A 4ZEWA 2HHLA 4YIKA 2BDEA 3EWIA 3QUQA 5AHXA 2JAWA 2GHQA 3HLTA 2D2VA 3WK9A 5ALWA 2FPSA 4GXTA 4JDPA 2YMLA 1RQLA 1MH9A 4F71A 4ZEXA 5AK5A 1L7PA 3S6JA 2HDOA 5AI4A 2G80A 1YS9A 5ALUA 4XOUA 3U7FB 2W43A 1QYIA 5AW3A 1L7MA 4UASA 1J8DA 1VJRA 2HI0A 1RLTA 2ODAA 4FE3A 3ZU6A 1QH9A 4OHFA 3SD7A 3IB6A 2B1RA 1ZS9A 3KBBA 2B30A 2JARA 3QXGA 5IT0A 4PNHA 4Y2QA 5AM0A 3U26A 3ONNA 1Z88A 1T9ZA 2O2XA 3KDPA 3U7HB 3FVVA 1Z5GA 1U2SA 3QUCA 2ZBEA 2AH5A 1Q92A 3WKAA 5AW6A 4MWOA 5A3SA 2HSZA 2R8YA 2AGVA 3R9KA 2PKEA 2WF7A 4JB3A 5AVUA 4UMEA 5AKEA 4NWIA 5ALJA 3N28A 1L8LA 3DV9A 4C4SA 3U19A 4O8CA 1RLOA 3I76A 2FPWA 1ZD3A 2HCFA 3WGUA 5AIBA 2R8XA 5T41A 3WK5A 2RARA 2G0AA 4J2TA 5AKYA 2JGAA 1Z4LA 1EK1A 4C4RA 3AR8A 1WR8A 1J97A 1T5SA 3I6BA 2OA0A 4Y2YA 2EATA 2RB5A 5AI9A 1TJ5A 2GHTA 4XE5A 2CFSA 4CE6A 3ED5A 3OCYA 2I34A 2ZBFA 4XQ0A 3MC1A 1QQ7A 3GYGA 1L8OA 2X4DA 4YCLA 3E81A 3N07A 4EX6A 4Y2TA 2R8ZA 2CFRA 3QX7A 4EENA 3ZVLA 1Z4MA 1TE2A 3ZWKA 4EX7A 4CF3A 4Y3UA 1RC8A 5AI6A 1X42A 1EK2A 3N8GA 4L6AA 3B9RA 3DNPA 2MSNA 2WF8A 2IOFA 3PDWA 3E84A 2C8KA 3AR5A 2MU1A 3KOOA 4UAVA 3ET4A 4BBJA 3L8HA 3TLMA 4IFTA 3ZVMA 1TA0A 1TJ4A 2RBKA 2AMYA 3AR9A 4QQFA 2WM8A 2YJ5A 4BNDA 1O08A 2G07A 5ALPA 3WK6A 1T5TA 1RDFA 1N8NA 1ZRMA 3ET5A 1RQNA 3NASA 5AM1A 4DFDA 3ESRA 3QU4A 2P9JA 2DQSA 2ZXEA 2C8LA 4MUMA 4YCNA 2P11A 1RRCA 2QLTA 4BKMA 1XPJA 5AKZA 4RESA 4AS3A 2GO7A 1CQZA 2AUTA 1JUDA 2IYEA 1YNSA 5ALFA 3BWVA 3WK8A 4YGYA 2C88A 5AK4A 3EPRA 4G9BA 4B6JA 5AKJA 5AI8A 5AI5A 2I54A 4UMVA 3KD3A 4UARA 3U7EB 2YJ3A 4IG4A 3L1UA 3M9LA 4Y2UA 1ZD4A 5AW2A 4CF4A 3UMCA 2IOFK 2WF9A 2FDRA 2HF2A 5AVTA 3NANA 1U7OA 5AKIA 2FUCA 4H1WA 2PR7A 2ZOSA 4BX2A 3MN1A 1SWWA 3OCXA 1VFPA 4NABA 2Q4TA 5AVRA 1Z4KA 2I6XA 5AI0A 1Z4IA 1Q91A 5ALNA 4J03A 5AW7A 1U2TA 3PCTA 1RMTA 4BX3A 3W5DA 4DCCA 3D6JA 5ALOA 5ALVA 3ZX5A 5AVSA 4ZEVA 3HYCA 2ZG6A 3E58A 2I7DA 2Q4RA 4Y2PA 4GIBA 3VAYA 3IRUA 2WHEA 2B82A 2YJ4A 4L6CA 4KNWA 4Y2RA 5ALQA 3SHQA 1ZD2P 3AR4A 4G63A 1YJ5A 4RETA 2JAUA 4OFZA 4NFLA 3EF0A 3WGVA 3FM9A 3W5AA 3BA6A 3FPBA 3L0BA 4UW9A 2G08A 3MMZA 2GMWA 3FGOA 1RLMA 1LTQA 4I9FA 3OCWA 4EELA 4C4TA 4FYPA 4I9GA 5ALMA 3SKYA 2I55A 3U7GA 1U02A 3CNHA 3KZXA 4DW8A 2BY4A 3A1DA 4KX5A 5ALRA 1LVHA 4EZEA 2G1AA 2EARA 4EEKA 3QLEA 4Y2XA 5AK6A 3L1VA 4YH1A 1RKQA 1S2OA 3WK4A 3SKXA 1K1EA 5ALSA 5AKGA 5IS2A 1NF2A 1IWOA 1QQ6A 3SLRA 4BX0A 3ZWDA 5AM2A 4UAUA 5ALXA 4HGOA 2HF7A 4UM7A 1FEZA 4BYGA 1RKVA 3B8EA 4NV0A 4E88A 2NO4A 4CNQA 5AKXA 2YFYA 3PGVA 2YMMA 1Z4OA 5AVVA 1Y8AA 3MPOA 5AW4A 5AM4A 1RMYA 5AVZA 5AW8A 3N1UA 3N5KA 5AVYA 3WK7A 1L6RA 2HOQA 5AW9A 3ZX4A 2WFAA 3NUQA 5ALKA 1WZCA 2B8JA 3A3YA 2B8EA 1SU4A 2WF6A 3EF1A 1TJ3A 4FFDA 2OBBA 3R4CA 5ALIA 3L0CA 1YMQA 5A3RA 4BNDB 3ZVNA 4KN8A 3RF6A 3AR7A 4UMDA 5ALEA 1SWVA 1ZRNA 2R8EA 2BDUA 3QU7A 4KNVA 3L7YA 1O03A 4UMFA 4Y2SA 3AR3A 4AP9A 3DAOA 4AS2A 2YBDA 3I1YA 4YIHA 4OD0A 5FP0A 5AW0A 3NALA 5ALHA 2B1QA 1Z4QA 1RMQA 4HGRA 4HGPA 1YDFA 2W4MA 3ZTYA 4KYTA 4YCMA 3OTQA 3AR2A 3U13A 4HAIA 4F72A 4QJBA 1WVIA 2IOHA 3UM9A 4BEVA 3B9BA 2OYCA 2FUEA 3L8FA 1NNLA 3QNMA 1NRWA 1WPGA 1XVIA 3W5CA 3QUTA 3QUBA 4HYTA 4XPZA 2FPXA 3W5BA 3M1YA 2YN4A 2O9JA 2NO5A 3ZTWA 3ZW7A 2FPRA 2CN1A 4Y2VA 2YJ6A 3NAMA 2G06A 2NYVA 4UATA 3A1CA 1PW5A 1Z4PX 1Z4JA 4NAVA 3A1EA 1RPZA 5JJBA 1Z4NA 3NRJA 4L57A 2GFHA 3UMGA 1U7PA 3PGLA 3ESQA 1S8OA 5ALLA 2CFTA 3UMBA 4BEWA 3FZQA 1VJ5A 4UU0A 3DDHA 3OCVA 2HO4A 1L7OA 3OPXA 3WKDA 2FEAA 2YY6A 3ZI4A 5E0OA 5ALGA 3P96A 3CZ4A 4KX3A 3OCUA
chains in the Genus database with same CATH superfamily
3BF7A 5FPQA 3QY0A 2OCYC 4UTZA 4B6RA 3JQFA 3PRJA 2FSUA 4HGVA 5BN5B 4UDOA 5WRFA 3TOSA 4COKA 4YLYA 4M6WB 4CKCA 1U81A 2UXCB 1R88A 3AX6A 1R0WA 3CUVA 4D3YA 4ECAA 3IO5A 1OZHA 3LBFA 4OKNA 4DCSA 1GGNA 2WIDA 2XTAA 5JYDA 3Q3CA 1P18A 4PW0A 2XCQA 2QJOA 1PT8A 3KEQA 4NH0A 4PC1A 4RHFA 4YP7A 4UM5A 2AF3C 3NWPA 1Z9BA 1Y0BA 2BLNA 3G9UA 4JL5A 1P5JA 5B1DA 3SJUA 4BGIA 3FTFA 4RV9A 1ST2A 4F92B 5COQA 2X9VA 1NW5A 5HUQA 3FFAA 1LZLA 4LQ4A 3V3TA 4LXYA 2RIPA 1IPHA 2YOHA 2QUHA 4HP8A 2ZIXB 4V24A 4LY3A 5HTOA 3KOYA 2B8WA 4KQFA 4TTSA 3MWFA 2UVPB 3JYQA 1FUPA 5DI9A 2EZ8A 4A8JA 4RH1A 1XRMA 4PFQA 3P5BA 4MA4A 1R9GA 4FFPA 1QHYA 4RL6A 5SICE 5LYJF 1BXGB 1DJOA 3OP1A 3BN3A 1SEPA 3UHJA 5L3QA 3WKCA 2WF5A 1C9EA 2HEGA 3DCJA 3DH0A 5EE5B 3WKBA 2ZJ0A 4Q5IA 4RLSA 2QN2A 1T5IA 1FFXA 4LMBA 421PA 3I6IA 5KDOA 1C8BA 4D42A 5JARA 4DIEA 3BQMB 2ODQA 4ZJPA 5FJIA 2M2IA 1W94A 2IXEA 2YJZA 5ITSA 4ZT5A 3SMVA 4YACA 1L5MA 1AK9A 1RRKA 3ACCA 3BWDD 3IAS6 2GBFA 4PQEA 5CB4B 5CBPA 5DGHA 4K7JA 4NBLA 5A4JA 2NZ8A 1B4DA 4P0QB 4Z7JA 1KEEA 1N3YA 5CX1A 2FRDA 3PGMA 3OE4A 2X1MA 4UQOA 2GVNA 1LLUA 4HX5A 1FW8A 1KYQA 1IW7D 3STTA 3LL7A 4Z1MD 4GVLA 5REQA 1DELA 3IMKA 1QRUA 4YAGA 2O0MA 4MUFA 1Y1LA 2GZRA 5DLPA 4JI5B 3C8MA 3OM9A 2DM6A 2FOXA 2XT0A 3QPAA 4MTLA 2X0JA 1BVYF 1SHKA 5IDVA 3QLUC 1DAFA 4H08A 5GJCA 4PHHA 5KOIA 5TMEA 5JZMA 2YXEA 3DL0A 3TLGA 1DKMA 1YVDA 2G8NA 4HY3A 4IRUB 3SXJA 5KVSA 4YNBA 4GI1A 3BWYA 1PX2A 1JBKA 2DWOA 4XIFA 3SK0A 1ABFA 2X6RA 3NKLA 4RD1A 2Y1EA 5D7BA 3M3PA 2PJRA 3NVMB 3K9WA 1JKFA 3QNWA 1BROA 2GARA 1W1WA 1SUAA 3CWQA 3LMKA 3HBAA 3LA6A 4ALMA 4JX8A 4V0LA 4DR3B 1JEQB 4PCLA 1KK3A 2DR3A 2ZLBA 3WL3A 4C14A 4AYXA 3KR9A 2UYHA 4IICA 4LTDA 2Y76A 1V35A 2VLIA 3PXDA 3EFOA 4JIMA 4B3MB 3OZGA 2Q62A 4CIDA 3F4SA 5B3JC 5JBNA 3IB6A 4QPPA 3RBVA 2HIAA 3BMNB 1VKRA 1W4RA 2PKWA 4X71A 5EPOA 2PBRA 4M9SA 1SN7A 3PJFA 2FVYA 2Z8ZA 3PPYA 1XQ6A 2GTPA 4LDAA 2O1EA 5IK2A 2VR1A 3ONNA 5F51A 3D6TB 3MQFA 2UYCA 3RUIA 1GDDA 1YRHA 1E77A 3TBHA 1I6WA 1Z5GA 3AVPA 1P2SA 3PF8A 4JUCA 1UWCA 3WLOA 5KJFA 5DLDA 3VVCA 4EG5A 5AOCA 3WKAA 4D4HA 1QO0D 4LKRA 3ZK8A 1NVMB 1X39A 2MHCA 2YDYA 4LI0A 2FUG1 2G76A 3AU8A 3RTGA 3K09C 3UGKA 3W90A 1I3MA 3RAPR 3ZIAA 1Q1GA 4JQYA 2X8AA 3D3JA 1XCGB 2V7BA 1FP7A 3Q6NA 2F9LA 2OHVA 3VU1A 5DXJA 4PX3A 3U1BA 5CXXA 4AO8A 2QR2A 3PHCA 4J16C 5DCWA 3JQBC 2O2HA 4XB2A 4ZYTA 2FSPA 5B55A 5DV9A 1VBFA 1FTNA 3RVDA 4KSYA 2J5QA 1RQ7A 4EG0A 4TYPA 3GUYA 5B6PA 4G9GA 5EP1A 1EG2A 3V80A 4PV7A 1QHXA 2DULA 5HW0A 1CQJB 3UHAA 4NKRA 1SCUA 3K9BA 4DV7B 2PKXA 1F7VA 2P75A 2WAXA 4FOTA 4UTNA 1Y4DE 2TECE 4C0AC 2ONKA 4NATA 4Q05A 4R54A 2WQZA 5K3DA 4J90A 1GXSB 3SC2A 3O90A 4M4SA 1VJDA 3FCSB 1QE3A 1Q19A 3EOZA 1E66A 1IFXA 4CKBA 2OP1A 3BREA 4MEAA 4REQA 1W6RA 2OG2A 3DLHA 1XXHB 3K2IA 1KZ4A 4O5OA 4QYIA 2I22A 4YA6A 1REQB 3PYXA 3ZXUB 5A4AA 1GCIA 3V7WA 2BGNA 3A3NA 2JFGA 1XEXB 4ARUA 2Y05A 2GFQA 2D7CA 3IR5A 4B3TB 1KYIA 1Z62A 1TE2A 1RHJA 4CF3A 4AUNA 3FN4A 3KVVA 4F3RA 1SRQA 2Z83A 1O77A 1ID1A 4OQDA 1XCBA 3U39A 2C9BA 1C14A 5JNLA 3QOFA 1HEYA 3FLAA 3IE0A 4Y1FA 3B3AA 3UV6A 8GPBA 1JFVA 2QSJA 2W6CX 4UHFA 4DIOA 2EEPA 1K5DA 2DTXA 3E1SA 3FPFA 3H4TA 4AB1A 2ZJ1A 4HB0A 2CJXA 5L6MB 5HYVA 3H3JA 4W5JA 1FTSA 1Z6GA 4OBWA 3O8QB 4GQAA 4I7EA 4JVMA 4K3UA 1OFVA 2WTBA 4MB0A 2BFDA 2HK9A 1AS3A 3PUYA 4IFTA 4OMCA 4PQFA 3U31A 3UB4A 4JLSA 4D96A 4ZVMA 4GSYA 4D9IA 2WM8A 1PQYA 1ECFA 1OYOA 3L4BA 4MV3A 3SZOA 3WGMA 3X1YA 4AMGA 2UYYA 2FFRA 1DOHA 1F6BA 2OSBA 1RE1A 3SFTA 1W49A 1N9GA 2PKYX 5IMBA 1FTYA 3OM1A 4X94A 4X85A 3OJLA 4MVJH 3AUJB 4X1YB 5AJXA 5DU2A 5SYMA 1L4NA 1M2FA 3V4OA 2JA2A 5ELMA 3GHHA 1JTVA 2ZIVB 3KZKA 4M1KA 3NCTA 2DQSA 3HKEB 1X7ZB 1YIAA 4NZZA 4UDXX 8OHMA 4M8IA 4WZZA 4ZZIA 1VBMA 1U3UA 2P11A 4X8OA 2Q9BA 2HPVA 4KQIA 2YQZA 1QRRA 3UG7A 1KSHA 3GFQA 1MJNA 2C20A 4HRXA 4K8OA 4FM9A 4ZO8A 3PE4A 4DJDC 4FCCA 4NULA 4Z51A 1DO0A 2QLJA 3N76A 4TV8A 1IK6A 4DA7A 4YX9A 4V38A 4APAA 3EG9A 4YO7A 4CI9A 4RL4A 3TXXA 3WK8A 4BP8A 1CY1A 5EUMA 3BIOA 3NIBA 1G2QA 4G07A 1UBCA 1GNTA 1P33A 3OG9A 3WGJA 3N0TA 4QBKA 4EG6A 4CLOB 2I54A 3H1FA 2NAFA 5JFTA 1LNQA 4IJMA 1SBTA 1X7YB 4N12A 3X44A 4ZT2A 1ZOPA 3RKSA 4KWHA 4JVSB 3U44B 1VL1A 4H7FA 2QMQA 2DFLA 4FDLA 3ZHRA 1IXYA 2HO5A 1MOQA 3RNLA 2Q8NA 5JYEA 2OFOA 3ZJTA 3F6YA 3L92A 1Y6ZA 4WFJA 4Z1MA 1P62B 2FDRA 2D8AA 4WCFC 4RZXA 1XNRB 1JU3A 1GPAA 3LOPA 1T2DA 3T4PA 4DDVA 3F7NA 3EAGA 2QX4A 3L06A 1EFKA 2O3JA 3PG5A 3QBEA 4JXKA 4W4TA 1U0GA 4H1WA 3D4LA 2IPNA 1QDLB 1GKYA 3NATA 3AI1A 4H7PA 2A9JA 1SKYE 4Y9TA 1Z26A 2OKCA 1GSOA 1O97D 4JY7A 1P31A 1Z75A 4M7WA 3K72B 3MJCA 3OOWA 4B47A 4D4MA 4LA4A 1DKQA 3AP2A 2OV8A 5B7NA 4PX5A 4URYR 5L40A 1WUTA 4EGSA 2JGJA 3VKVA 1WCV1 1SH7A 3D6JA 5ALOA 3X2EA 4CQNA 4OQZA 2ZG6A 1KZYC 1OY1A 2R5NA 4Z4GA 4KBGA 2HA0A 1NNSA 1CZHA 2CL6X 3FVQA 2P35A 4Z8XA 1Y5RA 2RKOA 1MVLA 4HOYA 3RJMA 2CXXA 1LQTA 3CXRA 2X3YA 3KHUA 3OPYB 1DRVA 4K6HA 1LLCA 5CT9A 4IMPA 3IP3A 4NCBA 1JIIA 1RAEA 2NVBA 4N6OA 4A0QA 1R4NA 3N7AA 1IUPA 5BYBA 5GIOE 2DPMA 4G09A 4K26A 4B5LA 1U2GA 4AKIA 2EFDB 2BKUA 4IV0A 4EPXA 3TSWA 4BZPA 1H6CA 3THYA 3ASZA 2V6JA 3GEIA 4N3AA 5CK4A 4GI7A 3SIRA 4BTVA 3QBVA 1T9KA 3HVIA 3G0CA 5K0NA 1C1HA 3D2LA 4WOKA 4BVBA 1B26A 1FUOA 2UUPA 1RLMA 1HOXA 3NFYA 4L4RA 4MYSA 2HMVA 4N0PA 1VKHA 1RWKA 1GNLA 4D57A 3V55A 4BAZA 4YV1A 1L7DA 3U7GA 3ND7A 3EZYA 3CG4A 1ZR2A 4V2UA 1POXA 1N36B 3R3WA 3DLBA 4PQGA 5BNTA 1YK1A 1XZFA 1UEJA 2I80A 1Y8QA 1O58A 3OX1A 5FTKA 5HPYB 4WA7A 5LP1A 4Z3OA 1HDOA 2AX4A 2GJAA 2ORED 2VK1A 3OJXA 2IHKA 2P78A 2ZIFA 4QUIA 2NU7A 2CZGA 1WWKA 1QH1A 3OZDA 5AK6A 1IG0A 1R10A 2JVIA 4JITA 2FZLA 3PRHA 3LDAA 3PSHA 2AZMA 2TRSB 1AKEA 4X6XA 5K8IA 4F5ZA 2H5IA 5KOHA 2BYTA 3M2PA 4GW3A 1N2EA 4L5CA 2XV1A 4Q6BA 5LPNA 4F85A 1S8FA 3EULA 4RDIA 3TQTA 3H5RA 4X00A 1NE7A 1C41A 4PONA 4XGIA 2BE7A 5LQNA 2BGGA 2HF7A 3UJ7A 3EIEA 3JQAD 4BYGA 5KMGB 2YBEA 1V39A 2C9DA 1G8PA 3EXFB 3OIWA 3VJKA 1XFAA 4JI2B 4L9RA 4AG3A 1I13A 4OHOA 4BTLA 5KNCA 5SZHB 1VXOA 2DTEA 3R0XA 4EJ6A 4L85A 2C4WA 2ZWVA 5AVZA 1NJ2A 3AHDA 2PTGA 5IM4F 5ADHA 3EY4A 1BE8A 3Q5EA 3RFVA 3CRVA 4XUDA 1G63A 3F9IA 5CB0A 1ZCBA 2PD4A 4OREX 2BI8A 4LXTA 1WOMA 4MV7A 2GNOA 3GMIA 2CNOA 3DZJA 3IJRA 5JPCA 2H3EA 4IP0A 1IBRA 2WFAA 3BILA 4KV7A 3OU2A 3DEKA 4QOJA 5FJJA 2XCTB 5FX2A 2B8JA 5C32A 3FYCA 1CQIA 2Y6UA 4B6GA 2QT9A 4LHEA 4UHEA 2CLHB 1V4VA 4ZDIA 5L51A 2QQEA 4N65A 1KBOA 3VC2A 1EGVB 1T2VA 2AOWA 3LY5A 1XYVA 1ELOA 2IE8A 1RI2A 2A9RA 2NNWB 4Z1OA 5I8PA 4MR8A 1WXFA 3A1VA 2OBMA 2VJPA 2EG5A 4MI9A 3SM9A 2Y68A 1K3TA 3BGDA 3QG5A 3UC5A 4IQFA 5C5CA 1U7UA 2M6RA 2V4MA 1KE1A 3RS0A 1JFFB 3A6PC 3C7CB 3LHDA 1WZ2A 3GJ7A 3V4LA 2QLLA 2WJWA 4EHIA 5ICFA 3F71A 3S1AA 4YIHA 5K51A 3KQOA 3UJAA 2G36A 3RUAA 3BH7A 1RMQA 3KWMA 4YVFA 3QEJA 4FHFA 3REFA 3L7DA 3MD9A 5FULA 3FOWA 4HNSA 1JG4A 1GUFA 3U13A 3L7NA 4QJBA 2NTYC 3F2IA 3USES 1T3TA 2QB5A 5CP8A 1QRAA 1BKDR 1G3MA 4ZVPA 1ZK3A 2IS1A 5EJ6A 1D1QA 4F12A 2J87A 2J5RA 2DU8A 3B6EA 4JDUA 4Q37A 1RWPA 3IUMA 5LCXA 2OYCA 1IK4A 2TMKA 1MAWA 3CLSC 3G8AA 2W2LA 3B38A 2C04A 2Y1WA 3P94A 1M1YE 2CXSA 2UYQA 2Z3ZA 4FKZA 2C03A 4JJGA 3R3HA 1KRWA 4MUBA 1H2AS 1K66A 3OFSA 1Q1QA 1HE1C 4OXQA 3H65A 4BIIA 4CFSA 2ZTLA 5G1OA 3NYWA 4AUKA 5DBEX 5FIUA 3DBIA 5ITZA 1PQUA 3CUYA 5EWMA 3PGKA 1GYQA 1ESZA 1VCMA 1XZBA 2CWWA 2PDAA 1MLDA 4R0VA 1UPAA 1TEHA 3R76A 1QAMA 2JAHA 4YHHB 3O9ZA 3X3HA 2DX7A 3AP1A 3CM0A 2XNHA 3K0FA 1G5FA 1ADBA 4G4IA 4ZCSA 1H6DA 1SHZA 1H2WA 2VEDA 4L3OA 4DLSA 2BCEA 3VOTA 1IHPA 3Q0IA 4B83A 2EIHA 2ZPTX 5EXEA 5F1YA 4AY5A 2GPWA 4CTMA 4QVIA 4GGPA 1R37A 2O07A 3JX9A 4YUWA 3CKKA 1TZCA 1SU7A 1YMUA 2WKRA 1KH3A 4RNDB 3K6SB 3IRVA 1NVGA 3OE7D 4UAGA 2IPAB 2QNBA 2EX0A 2D3WA 3SOZA 2AN1A 2LTAA 2ZDGA 3FVTA 1YFJA 2E4UA 2FEAA 3GEDA 3VOAA 1KSFX 4X5OA 2NXNA 1MCZA 1NBMA 3KPJA 4BL5A 4XJXA 1N5MA 4YUYA 4ISBA 4CV0A 3V7YA 4FGZA 4F11A 3QHPA 4J0HA 3U3XA 5FV4A 1WLYA 3EISA 3TUIC 1FSFA 4BLVA 3O0DA 1QOQB 4OU5A 1IZ9A 3LPDA 9LDBA 4KACA 1CR6A 5HILA 3NUZA 1WXXA 3UK0A 1UZMA 2JHPA 4PIVA 4ZVKA 2AJDA 3G5UA 5FYQA 1OAKA 5KJEA 3WLTA 5CA0B 1LPAB 2ICAA 3GT3A 1C2YA 1VIAA 2MOKA 3I2HA 2RKWA 2QE7D 1Q0SA 3PQ4A 1Y1TA 4I4TF 4N8DA 3FPGA 3CNQS 3GPBA 4RD3A 2ZE8A 1VHQA 2H1LA 3MHTA 2GILA 4JEMA 4GKAA 2CHUA 4JVLA 4A0FA 2ZVJA 5JWOA 5FOSA 3W5IA 4AG6A 5H70A 2O5VA 1NMZA 5A0FA 1KF0A 4TLBA 3RSOA 1QU3A 1RBZA 1WXDA 3OPYI 1MG5A 5AVWA 2P65A 2QJRA 1KS9A 1WCIB 4DJAA 2HQOA 5EIOA 5KKNB 5KUTA 1BDMA 1Q1ZA 4TVBA 4INAA 1XJ5A 3C98A 1LFAA 3CTPA 1EINA 1RRGA 3DVLA 5B53A 3S68A 4DV3B 1DSSG 4TQ9A 2YV2A 4FDAA 3SI7A 4ARAA 2E9FA 3EVAA 3KVOA 1U0RA 3W1WA 1FUKA 2IQIA 2C00A 5EIBC 4CUKA 5T4BA 1Z7BA 3WA6A 3HY4A 3D7NA 4DV6B 2XVAA 2VRCD 1NYQA 2ILTA 3G9ZA 3O93A 4P3NA 4C76A 1J39A 1U3TA 3JQAA 2XVZA 5DYIA 4CYMA 5JUWA 4KC0A 2YHIB 1VSQA 3L8CA 3LNTA 3QWIA 3I04M 5C8YB 1VE1A 2IYLD 4JWKA 1VLJA 1D2GA 2HMWA 2VYCA 2CBZA 4I3HA 2E7ZA 1JDBC 2DUMA 3D4OA 3FWPA 4BGEA 4N48A 2NTEA 2GM3A 5BO5A 3ONFA 3L5OA 5A05A 2J7KA 4LBYA 5BNIA 2HHLA 4M1ZA 1FIUA 5KAPA 2B1JA 2LR0A 2Q0QA 1U7TA 3JYLA 3L82B 6NULA 1Z74A 1JG1A 2BLLA 3OIUA 2GHQA 4Q9JA 1G5RA 3TQCA 1BHJA 1EX9A 1G8AA 1P3JA 3S7TA 3ZV7A 4EVIA 3GTDA 5KYUA 3F5QA 2BR4A 3PT5A 1WKVA 1U3DA 2ZSBA 1IXZA 4KLRA 5DT9A 2ZYAA 1T3HA 4R1MA 2O0LA 2EF1A 3DEZA 4H18A 1XIVA 2QHXA 3NO9A 4NC9A 4QUJA 3ZWAA 4F45A 4UXJA 5SY9A 4UQLA 3H0CA 5I8ZA 1XQWA 4ZEXA 5AK5A 3R9IA 3CN7A 1PGJA 1Y1PA 4FR5A 1R5JA 1N8TA 5L4LA 1U3GA 1XZHA 4II2A 4EKNB 4LY0A 1XV5A 2JLAA 2P6PA 3UTDA 4BFXA 4EUEA 1U0LA 2P7HA 4XOUA 2O8EA 5E4TA 1ZITA 4L76A 2ZWIA 3H83A 1T0HB 2RI0A 4FBGA 2XYVA 2OFFA 3S1LA 1LVUA 3WHPA 3ZTWA 1MC1A 1RLTA 4XJTA 5BQFA 3RNOA 3T3OA 4B7XA 1JHAA 5C8DA 2WZQA 5K1ZA 2F8MA 1KJJA 5K0FA 1VRWA 3Q9UA 3QF7A 4ZPJA 2EKZA 3K8YA 3PVZA 3VI4B 4HH4A 5F7ZA 4DXHA 5HIKA 4LRXA 1KH1A 3T9FA 1HG0A 4BMVA 2W6JD 1HFWA 1SUPA 2HA4A 3FNRA 1YDGA 4JMLA 3IEXA 3MBIA 5AUPB 1OH7A 2WHQA 1KP9A 1NUAA 2QAIA 1UXJA 2Z3WA 3B85A 3IQDB 4HUQA 4P22A 4AJIA 4AZVA 1KAGA 2WWTA 2FSGA 1ZUNB 2Z9DA 4QGSA 4WERA 1A9ZA 4UHHA 4TQAA 3T7TA 5GZ6A 4N3CA 3U4CA 4AXXA 2Y92A 2AFHA 3PKIA 4OB6A 1E32A 4MYCA 3EJWA 4M98A 5SYNA 3JQRA 3BK1A 1S2DA 2D1RA 1JLHA 4O8CA 2A94A 4WVFA 3O47A 3KUKA 4DLBA 2E55A 2FPIA 3AP3A 2H1FA 3D9QX 4FQ8A 4RCVA 5T41A 3ND9A 1XVUA 3NMUF 1HETA 1D4AA 4MUKA 4RACA 4CKEB 1SKMA 2GT1A 1VPTA 1GQSA 2R97A 3AIOA 4GOMD 3ICOA 2FETA 1RNLA 3Q4GA 2NVUA 4J2HA 4OHPA 4LFCB 3VJMA 2Q5QA 2H7CA 3NV9A 1JG2A 3IDFA 4WWHA 4Z9BA 5TS3A 4BNLA 1DRJA 3HKCB 3W06A 1CVIA 3DMTC 3S2EA 1V11A 2JKZA 1BWSA 2O2SA 1E2PA 4KIFA 1Z8HA 2XCLA 1MB2A 2QI9C 3K1AA 2JASA 1IBCA 3W04A 3C14C 3DYIA 2G8LA 4JLMA 3DC7A 3EN0A 1YS6A 2CWDA 1GP2A 1YHZA 2ZYUX 4OM7A 2Z6AA 1QQ7A 1HDIA 2OZLA 4ZAFA 1IJBA 2IC5A 2HWXA 3IUNA 1YJXA 1SY7A 3D3WB 5DH9A 2PV0A 3GNSA 3N8IA 1ZGHA 2R8ZA 1IDN1 2KSQA 3EEYA 4LIPD 2PZGA 1IM5A 2ID9A 4G0OA 3M83A 2IUYA 3WRVA 5BVGB 5DYNA 1W2HA 4L6IA 3MIIA 3ENKA 1W59A 1Y5MA 2G72A 4IHAA 5M2QA 3CLRC 4QUGA 5J5VA 2JNWA 1X42A 3H3XA 4PYIA 4GKJB 3AKEA 4XGQA 2VL7A 2W90A 4Z9AA 2R8BA 3N8GA 1LTKA 3LV8A 3OZUA 4MRMB 1UODA 2XBMA 4UTXA 2YV1A 4CQLB 4AZ3A 3I5YA 2ENUA 1ECBA 2WHPB 4CTNA 4OHKA 3EE6A 3G17A 1NNEA 4DEVA 1DT3A 2DUNA 1MEJA 2G70A 4ZVLA 3F96A 4OG2A 5HTKA 4JP2A 3ET4A 3KVYA 4NYIR 4CIYA 2PXAA 4NDAA 4Q9HA 2ZIGA 3HQ4O 1H5QA 2YJ5A 1SHUX 2QE7A 4ZQGA 3CE6A 4NZYA 1G3IA 1CR2A 3ZVKA 1T10A 4DLAA 4R2HA 1YFZA 1KDPA 2I3DA 1W87A 1XKLA 2RSLA 1TZKA 1N1GA 3BFKA 4YJ3A 4R69A 3F90A 2C9CA 4F9FA 4YUAA 3ESRA 3QU4A 4EABA 3A9UA 4O4HB 2W58A 3F5MA 2FEWB 1XL0A 1DKLA 1P1JA 2FEKA 5LLTA 4EO4A 5KTNA 1MIOA 4X8LA 5U9CA 2PL5A 1H1TA 3GEGA 4HAWA 3J80A 5AJYA 1FX0B 3QX3A 2NOAA 1JDUA 1G3QA 2RHWA 2X2EA 1UMKA 4M0UA 2WG2A 3MXTA 4P5DA 1KIMA 1R16A 2WSMA 3MTJA 3IAHA 2ZUDA 2WM2A 4DAOA 1ORIA 2ISCA 2R1VB 2O06A 3H1AA 3T9DA 3TEMA 5EJ9A 2GYYA 3TGPA 2C4MA 1U5CA 4NNOA 4R6WA 2ZSFA 2R65A 5JJKA 4BQRA 3SZGA 2WU3A 1SC1A 2I4MA 1D4OA 1V1RA 4ZGWA 1VBNA 1TKCA 2NTVA 1DJNA 1WBBA 5JCJA 2FW7A 1HEUA 1ULHA 2J0UB 2NUBA 2C3MA 5THKA 4FOPA 1WEKA 5ISMA 2H9YA 2FSSA 2G88A 3DE7X 4PYQA 1EUDA 4L0MA 4M2LA 3ERCA 3CUKA 3DZDA 3WG9A 2D1FA 4XI9A 1B0PA 5ILOA 1O4WA 3BA1A 1HKUA 2GBGA 4IG9A 1ZY2A 4YO8A 2PMBA 3O4JA 5DULA 5FLEX 3EOBI 2X8WA 2YV3A 2VVTA 5HS6A 5KTTA 4S05A 2MT9A 1A5BB 1NBAA 1FUQA 4HYQA 3R7BA 4AK9A 3TLEA 4A0SA 4KH0A 3V2UA 3LBAA 1J49A 2NQTA 2GEVA 2WHYA 4L4ZA 4XWWA 3CCBA 2QRZA 4KQWA 3C3EA 3WBBA 2W7TA 3SBDA 1Z4KA 3AEXA 3CR3C 3ILVA 4AW9A 5IU6A 3Q1LA 3WGHA 5KYNA 4RBNA 3H84A 4JC8A 4AO6A 5AVJA 3TUJC 1E69A 4WKPA 4JUAA 5DT2A 1SOMA 4YXFA 2HJWA 5AW7A 1RMTA 4Q1AA 1DMRA 3ONDA 4I50A 2HZ7A 4RK4A 2FP3A 3LYAA 5HNKA 3DVSX 2FPPB 3MCAA 4P84A 2PN1A 3SXPA 1P8AA 3A70A 4BJ5A 4RE5A 4E5NA 5M34A 1RCUA 4LCEA 2IE0A 1SUDA 5D51S 1SM4A 2NU8A 4ZVUA 1TVMA 4FEGA 2VRNA 3PDIA 4LSWA 1U5BB 3CWZA 3EIUA 5L3RA 3SHQA 1FLAA 2ZR7A 3AI3A 4PYLA 4JXZA 1ISHA 1TMKA 1A04A 2PPVA 1YJ5A 1M1NA 4QT4A 3N7TA 3ILXA 4O4JB 1KIAA 2HADA 2CJFA 1NZJA 4A03A 5AVOA 2WFLB 5HCNA 3FMOB 2QTRA 2QNRA 5ADWA 3F1KA 3A2LA 1JXMA 3L0BA 4DIDA 3D1LA 1P4HA 2Y3IA 1KEVA 4DYHA 3TNDA 4ER3A 4ARBA 3AUSA 3OU6A 4YECA 3TQOA 1U9JA 3FH0A 5AO9A 4J0CA 2IYQA 4FYMA 3T0FA 3ZDYB 3AGQA 2FG7C 3IS3A 3NETA 3CFYA 5DSTA 5ERYA 5HGXA 3FHJA 5IXYA 3F6CA 3C7DB 1LS6A 5JMPA 5HRAA 4DR2B 2JLXA 2PUHA 3K70B 3AEZA 2BH9A 3Q85A 4YCSA 2BRUC 1ZCJA 4OGFA 1WB9A 3L0IB 1ZIOA 4XB1A 3X1KA 1YHYA 3B6IA 5DX8A 1I10A 3GV0A 4Y2XA 3DZHA 4C4OA 1LD3A 4QEDA 4HDSB 4M22A 4N0EA 3L4KA 1DRWA 2I9KA 2FN9A 3WK4A 1PFUA 3SKXA 2B3DA 4MYUA 3ZQKA 1XQXA 5DI3A 3ROFA 1JR4A 2Z43A 2GXUA 2OO5A 1XZJA 3ORRA 5IAEA 3KAJA 1EGAA 1U6KA 3LY7A 4L7QA 1RRPA 1PV2A 4CVNA 3LUPA 5JECA 1KFCB 3BGSA 3KT6A 4C3ZA 1Z45A 4XCVA 5KWIA 4ZXFA 4KXXA 4Y1RA 4IXMA 1JSXA 4LBVA 2P7IA 3A9WA 1A7KA 1AC5A 5EWJB 5CDFA 4BRZA 2UYGA 3S28A 4EB8A 1DAPA 3D0OA 4IIGA 4HVLA 1AF4A 3GZTB 4KXQA 3EPLA 1NJ6A 4NBRA 5KHOC 4K2HA 2BKXA 2QR5A 3PD1A 5LMUB 2O8FB 2WG1A 1IM2A 2NADA 2ZRHA 3WXMA 1RMYA 5J59A 3O3MB 4BV8A 4RQUA 2QLMA 3GH1A 1VSVA 1XZAA 4ZYWA 5JEEA 5K0GA 3N5KA 4LGVA 5E4JA 2J3DA 2BMFA 2RHHA 3L9XA 4QFBA 3E7FA 1NF9A 3DD5A 4DEYA 2V8OA 1R0RE 4XLTA 3LYUA 1ZGBA 5BYKA 5JSZA 2JJ1D 4G24A 2W5UA 2X13A 1VHJA 4C7MA 2PYIA 2QRVA 4YCDA 3ADDA 2YHBA 5HK8A 1CFZA 1UWKA 3CPSA 3LKBA 4OSEA 5DWQA 3UJ3X 1CDDA 3T3MB 4ZHQA 2VJMB 5DBOA 1XJ0A 1YFEA 5C52B 2V65A 3LZ6A 3EF1A 2W2MA 2PGIA 4LXQA 1RADA 3AUKA 3KKMA 4QAQA 3Q88A 4ZU6X 4OHUA 3PU6A 1XTIA 1M8GA 1ZM4A 2ZZKA 5BMVF 1QQBA 3ESDA 1KY4A 3UMYA 4TT3D 3CLKA 3ZQ4A 1B8UA 4H0CA 3ZXIA 1JNYA 4B40A 1CF4A 4KYVA 1LSJA 4A0RA 2RGBA 1YQ9A 4DIMA 2XE7A 2R7AA 4MARA 1W0JD 4V0ME 3M1AA 1YBFA 3MD0A 4LXIA 4DQVA 2DHDA 4UNSA 3T35A 3D8SA 1XRQA 4YJDA 2F43B 3QPCA 1SG9A 3I1FA 1LSOA 3LW7A 3FNBA 3EH1A 3BMQA 2UZIR 3P2OA 3TS1A 4BKOA 4B4KA 8ADHA 1J24A 5AW0A 1NG9A 4XWAA 4LJKA 3V9AA 1L7BA 3GLQA 4HGPA 3SXUB 4F4HA 1SQFA 1CDOA 5DXAA 4KRYA 2GHIA 2IITA 4OJKA 6Q21A 3H9GA 3CLTD 2P6MA 3D31A 4OUDB 1ZAKA 3UWMA 5BPHA 4Q1FA 2QTZA 3AI2A 4TGLA 3HI6A 5FWDA 1OXMA 1RAGA 4OUKX 1Z39A 5BXQC 4AY2A 3ZE9A 4XD7D 3IB3A 2DBRA 4KDFA 1MVOA 1YDHA 1D2RA 2JIPA 2GRUA 1D6MA 3AFGA 1N6IA 4OKSA 4PN7A 4UTPA 2ST1A 1JG7A 4YDQA 4TKMA 5CH8A 3VR5H 1Z5VA 4AWXA 3PE3A 4A2PA 2YN4A 3ZHZA 3EXHB 2JI7A 4DJFC 1MOSA 1CT9A 3N2GA 3HCEA 1KZGB 1PR0A 2ZSEA 4J76A 4ZTBA 4HLQB 1U9IC 3QEAZ 4UATA 1VPWA 1L5FA 2XCIA 5FD8A 2VP6A 3DONA 1EE2A 4FILA 4CMGA 3C1UA 4GMHA 1PNQA 1YA6A 3EDMA 4DRXA 2PWAA 3IDZA 3OLVA 3PNVA 4J3FA 4LJ4A 3LYHA 4LJ9A 2G17A 4NEGA 2QRMA 1D8AA 3PX7A 2WNHA 1PL7A 1TT5A 4KXYA 4ZT3A 2O8BA 4LRTB 2BSXA 1RWXA 4JKIA 2R3SA 4KZKA 4BEWA 3RB8A 3FB4A 3FZQA 3HUUA 1VJ5A 4UEJA 5JW6A 4ZO7A 1MB4A 4KOEC 2A35A 2V0GA 4FWBA 3M34A 4O63O 2KWIA 3PDJA 1XTSA 1Z0ZA 4P80A 4A2QA 3FDXA 1EYZA 5IAKA 1H2EA 2GAIA 4IEEA 4ZQHA 1QG4A 3EEOA 4APBA 1M34A 1KI7A 1XL1A 1ZCAA 3G23A 3R3YA 4ATNA 4AROA 3U6KA 5CT8A 2XDQB 3OICA 2GERA 2UKDA 1JHPA 1NYTA 5DN6D 3T3NA 2A33A 3H9CA 3SQOA 4E5KA 2VPWA 3PTAA 1R9JA 2IHBA 3IT0A 1VL2A 3O8RA 3GBVA 1BC5A 5JH7F 1NBHA 2QTCA 3I32A 1AK2A 4BLTA 4ZVNA 1XK6A 1W9MA 5FBLB 4A6PA 2YXBA 1FJXA 5KOJB 3RK1A 2ODPA 4QUAA 5EKDA 1OFUX 2Q3MA 3QU5A 5ICEA 4HMQA 1WHSB 3QU2A 3ZBQA 3VZPA 2Z2JA 2CZCA 3P20A 3IV6A 5EJ5A 3O74A 3QFHA 4ZVVA 5C37A 4Z4IA 2JAOA 3H2YA 3AVYA 1I6KA 2R7KA 2J9FB 4ZI2A 2C9MA 3KJZA 3D2CA 2CLLB 4MWBA 4U7PB 4ZO9A 5AK3A 3K1ZA 3LDGA 3PX2A 5LP6C 2JGKA 1JHYA 3GRPA 3SF8B 4BU1A 1T9BA 4WOCA 4KAFA 4AF7A 1IBKB 4DR4B 4JUIA 1MUUA 4FBMA 4WN3A 1KL7A 2I4OA 2IPXA 1CNFA 2OPBA 4MVJI 4EJSC 5JCOC 3GARA 2OMKA 5CT5A 3VAZA 4QTYA 2GKSA 1F6DA 3FPSA 4W1PA 1Z25A 4OI4A 1ZCFA 5ALTA 5FWYA 1DBVO 1U8ZA 1RIIA 2X9QA 3E5MA 2B8TA 3FBGA 2Q1XA 3OZCA 4KLCA 4ENRA 4ZDKA 4WLFA 5J40A 4ZTUB 5ARBA 1GADO 2PWZA 4N6NA 5HJ2A 3SU8A 3KKPA 1BAPA 1E1KA 1E9EA 4AZSA 3PNPA 3GVXA 5KYTA 3F49S 3PD0A 5J63A 1D2CA 1HURA 3EQ6A 2VWGA 2OV6A 1J0DA 1DG9A 4NIMA 2J0QA 1U90A 3QVKA 2QTTA 2ZKLA 2JFQA 2DFVA 2FWMX 3JWEA 3LD9A 4IY1A 4O4IA 2BFPA 2EKLA 4ZVQA 4YJFB 1M7HA 3L5KA 2BBWA 1E2IA 1XRNA 1G20E 1SULA 2BDEA 2O52A 3DPIA 2QEQA 3OOEA 4KTTE 4X1KA 1X1DA 5AHXA 5JS2A 2V58A 3K9GA 5F77A 3ODGA 4IMIB 4P3XA 1P6QA 4XASA 4EI8A 4D8WA 2CFIA 1J7JA 3D64A 3WK9A 1JZTA 3K0CA 2WJJA 5IYZB 2CJYA 4MVXA 5C2JB 3W6PA 1O7JA 3VHLB 1VMAA 5AHKA 6PFKA 3GLTA 3E3MA 3HYSA 5HBRA 2WSSD 1DTWA 2V1XA 1OI2A 2DF8A 1PWYE 2ZUBA 3PX3A 3U80A 1WXGA 3I3OA 4OQQA 3HP7A 1L7PA 3S6JA 2Q9CA 1K9SA 5G0SA 1NPTO 1TYZA 2JGIA 2P4HX 4L8LA 4LRUA 1V9SA 1FY2A 1BS9A 3OESA 1DLIA 4TKUB 4DV2B 4TT3A 4UHCA 2I8LA 4FKMA 3UFXA 4IGEA 3GLFE 4E51A 4Z54A 3N8HA 3OWXA 3TMKA 2QUZA 1W0JA 2FFAA 2P2GA 3K94A 4L16A 1FQKA 4LVOA 5HZHA 2B1RA 4J7UA 3S3TA 1MB9A 2AC4A 4PZYA 2JARA 3TIGA 1Q57A 3IHKA 3VNSA 3OU7A 2OK7A 3GNLA 4JQSA 1GZ4A 1UIRA 3AWIA 2EOAA 1X15A 1UWLA 2I03A 1DC4A 2FUNB 2IYFA 2ZYDA 1U8AA 5FHRA 4BWGA 3H3FA 4CL0A 5J2TF 1ESNA 1G1MA 5D5HA 1QFYA 1S4MA 1G4AE 2R1TA 5AXAA 3KO8A 1D2MA 1JRLA 3HBFA 5C1DA 4W7IA 4JASB 3NKVA 2V4ZA 1KDYA 5TT0A 1EI9A 2PKQO 1T0JB 4GL4A 4OOEA 3HI4A 3R9KA 3T9CA 5L3VA 1BDHA 2AD1A 1ONBA 2FH5B 3GLHB 1U8TA 1ZK2A 2C3UA 2YL2A 2I3BA 2VDUE 3AF1A 3N7UA 4EITA 4IFBA 2CY0A 1WL8A 5HM8A 3FF4A 1AKUA 4IJ5A 4MO2A 4RUKA 3WYFA 5AHRA 3I76A 3IOEA 4YCBA 4ZQCB 4GC9A 4HNQA 4D1YA 3I2YX 4GDFA 3BGOS 4KQEA 4FQ7A 3IIIA 3JTEA 3SYMA 1DC7A 2D2FA 5C1BA 2V7GA 3ZGZA 1SD5A 1TKBA 2EIXA 2HWYA 4F6CA 3UOAB 4HQOA 2BBSA 2WG0A 1ZP6A 2ZWOA 4QLBA 4FFNA 1I1OA 1JKIA 1X80A 3DT6A 4WESA 2YX1A 4YDRA 3FCUB 4M8LA 2OA0A 4WXEA 4A6EA 1L4LA 5K4GA 1C7QA 5A9RA 1WD5A 1F06A 2DWCA 2REXB 1TJ5A 5CGQB 1PTJC 1QHHA 5D5QA 5I4BA 3NUGA 3LS2A 1M54A 1DKUA 3DL4A 5CVEA 3F6RA 4ZCRA 4CMIB 1NXVA 1DXOA 3HN6A 3NW9A 5ENVA 2PLWA 5BN4B 3U3RA 1X6VA 3QKTA 4ZOLA 5LZ4A 2YHUA 4DR5B 4N0DA 3M8KA 4IXTA 2FZEA 2WM3A 3P0HA 4EX6A 4N5MA 2CF5A 4C7KA 3QEBZ 4HATA 3CH7A 2C0PA 2CB0A 3QX7A 4JSRA 3RLFA 3QPDA 4XLZA 1OWPA 4J1NA 4MCIA 3QV2A 4J4HA 4JEUA 4OHYA 3HXOA 3QJ5A 3ZNPA 1L5SA 2BM9A 3K6RA 2RC6A 3FMGA 1LY1A 3L43A 4CETA 5IDXA 1XTKA 1ZD9A 1PT6A 1NKSA 1TC1A 3ICPA 5DN6A 1ZZGA 2C0CA 4JT4A 2RGUA 3WLKX 821PA 4D98A 5KX5B 1XMPA 2A0YA 3BBLA 4FFLA 2I8CA 2HBYA 3NAZA 2SCUA 4JZKA 3HCCA 2DE0X 4R7TA 4DVGA 2BPOA 3W6NA 4CN8A 2PUGA 3EK2A 3E7PA 5EGSA 2CDAA 4KZPA 4CG2A 5B30A 1UFVA 2R62A 4QQFA 4TVSA 2PNJA 4JJ6A 2WYVA 5B64A 3SKVA 4O2RA 2VYQA 3BAFA 1NWHA 2WP0A 4J3JA 1NV9A 3WGZA 1B1CA 5LQKA 1E1QA 3M5DA 4HDNB 3PEVA 5F7OA 2X8LA 3EPPA 4HXYA 2JHCA 3OM0A 5AM1A 4EA8A 5LIRA 1DB3A 1JEOA 3U3MA 4QX6A 2XUGA 3JQ7A 9GPBA 1PNVA 1OW3B 4WINA 2PGNA 3I3SR 3RF7A 5B7PA 2YFQA 3EXG2 4JB2A 1GG5A 3A11A 3UMVA 2IF0A 3FRJA 1O54A 2K4MA 5FOVA 4EEXA 4F0JA 1KAOA 2OHGA 1ISIA 2QW8A 3DDNA 3WFZA 4RAOA 3ZJ4A 4OBBA 1ORTA 2RH9B 2FZWA 1B7GO 4MLPA 2FSHA 3BWVA 5IKMA 3NBFA 5EUBA 4BNVA 1A2QA 1ITZA 1GOTA 2GN6A 3TZLA 4ENQA 4ZIRA 2SICE 4RTJA 2AMJA 3FYUB 4GX0A 1GTZA 1NG1A 1R6BX 4AZ0B 1T9AA 4LJ7A 1EGQA 1I2CA 3WP0A 5M5BA 1EWVA 1RFGE 2FRXA 3EQ2A 4Q9KA 2ZJ4A 1A7JA 1W36C 2W2KA 1RQGA 1ML4A 3BK2A 3OEED 1LJLA 2GZ1A 4Y2UA 2AE2A 2ZWAA 2GX6A 1B6GA 3ESZA 3SCZA 3NIDB 2H06A 1EGMB 3PE6A 2VRBA 3HPQA 5EWLB 3RWBA 1GFWA 3SS7X 4D3FA 3BDAA 2WICA 3BHGA 1DQSA 3DQPA 1TJWA 3R3SA 5JAQA 2EFHB 1KFJB 2FX2A 4W5RA 2AA3A 4L4UA 4WZ6A 4MI6A 1H94A 1E6CA 2IUSA 2J85A 1KQOA 4ZKEA 4BVLA 1E5XA 1VP9A 1I30A 1OA1A 3IV9A 2Q1WA 1QVRA 4L8WB 4EFCA 3SZLA 4BOYA 4KK3A 4LS3A 3I2IA 4EY6A 1KKLA 3A3PA 1X7WA 2N1MA 4ZOBA 4TXHA 5AVRA 3VVMA 3DMRA 1Z4IA 3GQVA 3F5SA 3VU9A 3D4PA 1CS0B 2YY5A 4JBXA 5K3EA 1EXNA 1X3SA 5T8KA 3KG2A 2H08A 1SQ6A 1KAQA 2DUUA 2YIMA 3A6ZA 3EGXA 2X9LA 3ICCA 1ZN8A 1QP7A 4Z4FA 3VAYA 3SZ3A 3LX5A 2CNWD 3EC2A 1TO1E 5B6IA 1E98A 4X20A 1YA8A 5EY5B 1P4JA 1ABEA 2YJ4A 3VV2A 4D92A 4WBNB 4I50F 1I8TA 4UJ5A 4YMLA 4BZWA 3ZW8A 1NOKA 2D5BA 3O9VA 3QKSB 1F6WA 4B8ZA 3UAXA 2OXEA 4UXIA 3QKIA 1KVQA 4D99A 4EAQA 2CF6A 3S5UA 3TQHA 4DSZA 5BNWA 2O8DB 3A4NA 2FMXA 3LX8A 4UCXA 3F74A 4PPYA 2QSZA 1RWBA 4DXAA 1J21A 4FGKA 1L7EA 4G97A 2JATA 3E5HA 2F6RA 3SBXA 1J2RA 4NBTA 5FWXA 4A15A 3EEIA 3JQQA 3OCWA 4FIDA 2VP9A 3Q98A 1E3IA 2NZXA 2X19A 3ROKA 5LNK6 3UUGA 2VPXA 2V8BA 3T5TA 1E4EA 4N5NA 2C4VA 3WYDA 2NZJA 5EXTA 1JFRA 2AVDA 1LH0A 2D2EA 4PO9A 4KVAA 3F98A 4BAGA 4H7IA 3MLAA 3ZGNA 2ORVA 2ZI3A 3DGFC 4YRZA 3LUHA 3MMXA 1MT0A 3P0RA 3LLUA 3SLGA 4L8FA 4H3HB 4X7MA 1PT7A 2OV1A 1S2OA 3TRDA 1QPZA 4IR7A 4LZJA 4O33A 2O4CA 3WLHA 3ZWBA 4G1EB 5ALSA 5AKGA 3NH6A 3WWDA 1CG6A 4GZ3A 1SEVA 5FF9A 2PUBA 2A30A 5HP4A 2QAGB 4PLPA 2QD2A 1EXWA 4R81A 1W29A 2HVGA 3ZCSA 2ZTSA 3GROA 1UBTS 3PQFA 1UXKA 5IRCD 3NFRA 1BNCA 3URKA 4E11A 1U7DA 1W30A 2V7TA 1V3QE 1MMFB 4E88A 2IYSA 3EMBA 5CNIA 5C4GB 2CLMB 3T1VA 4LHYA 4QAJA 4EZIA 1EU1A 1V9CA 1XO1A 2A1IA 3LKDA 1Y8AA 1MAHA 3N59A 2CLCX 3ZOKA 3QVGA 3ULKA 2ZXFA 1JFSA 3DE0X 5U4QA 3JD4A 4C4AA 3P0IA 1J4AA 1DIGA 1NTRA 2F90A 2QQ5A 3W2EA 3QXSA 3D6UA 1VPDA 5K0CA 4GMXA 1L6RA 2EJVA 4L3WA 5AW9A 5BR8B 1M2VA 3THXA 3OZ7A 1FS6A 5L3SB 5L45A 3GLIB 1G7CA 2CVOA 3Q7QA 5I7OA 2RGNA 3KAPA 4HC4A 2EQAA 5F2EA 2I1LA 1E92A 1JLRA 2G1JA 2ZGVA 3N2YA 2B8EA 2QRUA 1DTSA 3FMVA 2KYRA 4RMNA 3B1ZA 3NBUA 5A4IS 3SR0A 3TRIA 2J4FA 3JR7A 1V1JA 1Z3CA 2PZMA 3F4KA 2JVKA 4RH3A 3GXOA 5EIHA 1Y89A 4TQUS 5KNDD 4LMRA 2JGDA 5FKJA 2BF7A 4H9GA 4TMWA 1KEZA 4G2TA 4OJQA 1LV7A 2EFYA 3HVHA 4C30A 1GPLA 2ZFUA 5E7QA 4BWYA 4J0DA 2WWIA 5F3DA 3A05A 1SWVA 2D13A 4H27A 4G0PA 4YMUA 1XQ9A 4KQ9A 1P1CA 4W5NA 1KSJA 1K7CA 2XWJI 4YAEA 3STVA 3M6MD 4ZJZA 1OIXA 3V97A 2P8JA 1U0OC 4BFSA 2UZ0A 4TTAA 2ONZA 2C97A 2B1QA 2FPOA 2YRXA 4HNRA 4XR9A 3UYKA 3AERA 3EY9A 4CNQA 1YONA 1KP3A 1JQDA 3NT2A 2JAPA 2PE5A 1E2KA 4Y9SA 4EUSA 1Z13A 4AY6A 2WAYA 4HAIA 4Y8VA 4F72A 1ISFA 1DJPA 4PWYA 3LUBA 3SP1A 2DKNA 3GA5A 4HEJA 4ZT4A 2OQ2A 5H68A 2J5BA 3L8FA 5HJ7A 1TK9A 2VWHA 1CRLA 3RTDA 5HF8A 3CXUA 2FJ0A 2IBMA 1IY2A 3KM0A 3OEEA 4YPVA 4MPJA 2C83A 3W5BA 3AESA 4DZZA 1NURA 3MJVA 3VYWA 4RPLA 2F4VB 1Z18A 2J3MA 4F86A 1OLOA 2RH4A 4IJ6A 2YS7A 4EEZA 3GP5A 2HBQA 4ZQFA 5E1BA 3WB9A 5BN5A 5IVHA 4QWWA 2OD2A 1KBZA 1QP8A 2VYND 2XE8A 3OIGA 2Q8PA 2ZRBA 1J8QA 2P3QA 1K9VF 1UXGA 4BNZA 3H9EO 2BW0A 3G2PA 4ER6A 1GPDG 3B7WA 3CG0A 3DMNA 3EHDA 1L7AA 3ICVA 3IULA 5IBRA 3ZLBA 4KO8A 4HH1A 1JVNA 1VMEA 4DA9A 2RAFA 4TZ6A 1U4NA 2B20A 5KIAA 3WMWA 3ZE6A 1SVOA 1Q77A 1TYDE 4IF6A 3A9RA 3G5AA 1O94D 4IH9A 1NI4A 2XQGA 1ZBQA 4L5IA 2NNLD 2ZTVA 1FCJA 2HYDA 4P4UA 4ZPXA 2JFUA 1J0CA 2QTHA 3QBTA 1V5EA 2BGJA 5CAEB 1D6JA 1T8TA 1O6CA 1ZSNA 4M89A 5EYPB 2X0NA 4OP3A 2ZPAA 3E53A 5CDGA 2HB6A 4OV6B 2CNWA 4AKSA 4UNQA 3AF2A 3CH4B 2H4FA 1F5SA 2YH2A 1O5IA 4MMXB 1PD0A 3HGMA 3SG0A 4D41A 2FGJA 1FZTA 1BXGA 4DL9A 1XA0A 1ECGA 1H8ED 2I33A 1CRQA 1NXWA 4D9EA 2VF5X 3AVWA 4KL8S 4XFJA 3CRMA 1FUIA 1MRNA 3B5JA 4QNRA 3H18A 4G5SA 2ZSAA 4J0IA 3I92A 5CGZA 2A4MA 1P2FA 3X1XA 3AHEA 2HF9A 4D8UA 4I1SA 3U5ZB 3G13A 1FNMA 5CB4A 5IT4A 4HGQA 4EY7A 1XT6A 3IO3A 4LZNA 2O7QA 2YYAA 3HS3A 3VX4A 1IDOA 1YTLA 1TMYA 3MLEA 3WYGA 4ZCTA 5ALYA 1WSWA 5L3ZA 3EGDA 3EVDA 1HNXB 1DJMA 4J94A 4L9SA 4BLSA 3G2JA 1Q5NA 1JHRA 2DFNA 3IEKA 2VH1A 1OKKA 3H2IA 2B0CA 1W44A 2JIDA 3QU9A 4GNRA 4LJ6A 5DHAA 3UWOA 1TA9A 2RHCA 4HLUA 3CE9A 2FQXA 1JALA 2LDBA 4WLOA 3HTXA 1ZNWA 1T2EA 3IAS1 5EIWA 3TECE 4JC4A 5BQ5A 1I0IA 1PWXA 1PEKE 2FR8C 4BZXA 1U0BB 1RBQA 3MRVA 2IU6A 4IQ4A 1A77A 4J1TA 2ZBDA 3T5CA 2QTMA 5FNVB 1SXQA 3HGTA 2E3JA 1QZXA 3AG6A 3LPCA 3D7KA 4EEIA 2TS1A 3U4DA 1EFRD 4N5HX 4C0WA 5TQ2B 1JEQA 1MV5A 3AB3A 2UVDA 5F9MA 3PR2B 3W9UA 3RVRA 3VNVA 2QP4A 4H3SA 4JUFA 5DHQA 3LXUX 3CVXA 1Q7TA 4AZWA 1MOZA 4E4TA 3VDQA 1A69A 2X76A 3RSQA 1IC6A 1LPNA 4FPXA 1HRDA 2AC7A 1LZKA 2MSEB 3KEMA 1DLJA 3OQIB 2Q2NA 4HQ0A 4Q7MB 2ERYA 3HLTA 4LPKA 2ZITA 4MINA 3SC4A 1E2MA 4U5QA 3RJ5A 3IMFA 5ALWA 2CMGA 3FIJA 1XMVA 4KBFA 4JOCA 1MA0A 4YK7A 4DWJA 1QIJA 3IQHX 3P0JA 1RM4A 4LN1A 4A2WA 1FX1A 1OI4A 3HRKA 2WB4A 2PH7A 1M5RA 1R3UA 1NC3A 2I7XA 5ED4A 4RK7A 2ZBVA 4I81A 5FUYA 1TAUA 4L72A 2WYHA 1BCRB 1RM0A 1OREA 1XVAA 2IXFA 4W7SA 4NPAA 4W9NC 1U0EA 2UUAB 2DAPA 5KNDA 3KYIB 1L7MA 3L79A 2XJ4A 3LFHA 4DCPA 1L1RA 1ZC4A 2OLEA 4XSHA 3LT5A 4FT2A 1J2JA 1DBQA 2ZJ6A 2PX0A 5HZMA 5FDFA 4J0KA 3WNVA 4ZYYA 4C3OB 5IH7A 4OOFA 2LUOA 3O38A 2ES4A 3DXXA 1G98A 1QF6A 4RXMA 1K7EB 1KEKA 5D6OA 3PF9A 4M21A 2AR7A 2VQ3A 2X6QA 3REOA 2P9CA 2R68A 3HDHA 3F8SA 4N5LA 2W6OA 4E6PA 4FB4A 3G5MA 4R31A 3FSRA 1ENOA 2E85A 1F0NA 2QTGA 1FDUA 3S2UA 3OZSA 4E5YA 2AI1A 1Q2UA 2OXFA 1GXSA 4JX9A 4I55B 1U7XA 1CBUA 3CUEF 2AW3A 1F4VA 1BTOA 1RP7A 4CIBA 3EJ6A 4D6PA 1XXHA 3GG2A 4BJ6A 3NHPA 4LJ5A 5HCUA 1KYVA 3L3BA 1IZ8A 1REQA 2BV3A 3FZEA 3MEQA 2PR2A 3MM4A 4INOA 1IMOA 1KAEA 4KHZA 4QOEA 5ABPA 1XWOA 4B3JA 3TFOA 1XEXA 4BO5A 5K6AA 3DKPA 1CULC 1YJAA 3I0ZA 1MPXA 1OYVA 1QS0B 3Q7RA 3USCS 3R4VA 4KNYA 3F46A 5JFOA 3DV9A 3CWCA 1YL5A 2YZNA 4NU0A 3U6BA 1IM8A 2WJ4A 2H1RA 4QSHA 4YROA 3P7MA 1Z0UA 2HA5A 5A6SB 5AR1A 1VPVA 3IPXA 3OEYA 4HSEA 3RIMA 1PL8A 3KQQA 1QIIA 1SCJA 2DYKA 2VHUA 3IP9A 1QFXA 1T8UA 4NICA 4FLMA 3W6OA 3E35A 1ZM2A 4G1MB 1WR8A 1XRRA 4RGVA 4BMNA 1ZXLA 3UUFA 4AU1A 4O2LA 4G23A 4DPLA 1TIPA 5AI9A 4PYNA 2JFHA 3NHFA 4CDGA 3GJ0A 3K1YA 4V3CA 3U3ZA 1XWWA 2O3QA 1ECJA 3M6WA 4G25A 3WLFA 4B7CA 1VPLA 3AJ9A 4EF4A 1JYSA 3O8LA 1U2QA 2Y66A 3D5EA 2R1UA 4YRLA 4RK0A 1N4DA 3PPWA 3JAMA 2NXCA 3C6QA 1O94A 1M8FA 2AD5A 1I3KA 3EDCA 5AFSA 2HQSA 1IQUA 2ZSUA 2ZKIA 3RFFA 3B9PA 5H3HA 3TVDA 1U28C 3U7JA 2P2CA 5JI2E 2ZSIA 3S29A 5M7EA 4WNYA 4BASA 1U6IA 3HKEA 1TCUA 1X7ZA 1P72A 2IEGA 4ZOLF 3OMXA 4UUMA 3QF4B 3VYVA 4IPTA 2XYQA 2HFKA 3MWGA 4KK4A 1E5DA 3LDFA 4OQEA 5DPMA 1KOGA 1VE5A 4RW0A 4ZAYA 1B16A 4KPGA 3Q7PA 3WLSA 4MV9A 4HAYA 3VYRB 1XLTA 1TAHA 4L6AA 2G63A 3DDCA 3GGOA 1O9BA 2MSNA 3R5XA 1P9NA 3LIIA 1OIVA 3DW3X 5KKAA 4WZBB 3ZG6A 5K6TA 1UDAA 1A4IA 3E84A 1WTCA 4H3VA 4M87A 1OH6A 4Q1CA 4XVQA 1NX9A 4RFLA 1V6AA 4ITVA 5JQGA 4CIVA 1MO2A 4CLOA 4LQCA 2AMYA 8ATCA 2XKAA 3MWEB 3SSNA 1GILA 1CRWG 3PHHA 5G02A 4UKDA 1IXSB 1ADGA 2AJCA 5D3KA 3RVNA 2OGWA 2XRYA 4KKVA 4GM1A 2ZTUA 4BRUA 3U44A 2GSWA 1DCNA 1SUIA 4KXWA 1TD1A 2VA9A 4NQZA 3W2TA 4OJTA 5E9WA 3W3ZB 2ZB2A 1DUIA 3G8DA 2X7XA 3LT1A 2G0TA 3OEHD 3CINA 2F3TA 3CY6A 1MW8X 1EBFA 3IXMA 1G3RA 3S27A 4F9GA 3HFJA 4HD8A 2P9QA 5HRUA 1UQRA 3KV1A 1X8XA 4BFTA 1QGOA 1VYTA 1B73A 3L0OA 1GL7A 1R8SA 2WUGA 4F4FA 5DEOA 3N2KB 2C3YA 4EPVA 4A36A 1FA9A 5DHTA 3R8FA 3H11B 2FSVA 4OP1A 3IX7A 4PWZA 5A7GA 1RZ3A 4Q66C 2C7OA 1ZG3A 4E12A 2UVQA 3DTYA 4I36A 4U8GA 4YGYA 5AD1A 1VG8A 2G9QA 2JD2A 1DBRA 4G0YA 4H77A 4O2AF 5EVCA 4Q4AB 2ONJA 1I4DD 5CCBA 3A37A 4FD3A 1RAFA 5T3YA 3ZHOA 1EX1A 3KELA 3NM5A 4OAPA 2GPJA 1Z83A 4M9XA 4P83A 3AOEA 3M9LA 3B2EA 2PK3A 1PL0A 1U65A 2P5SA 2H4XA 4IDFA 5G3YA 1HSZA 2PA3A 4CF4A 2G7ZA 2NM0A 4I1YA 2JJ2D 2G40A 3M6FA 2I7CA 3OPYA 4MUAA 2FQYA 3FSEA 2FQQA 2XUOA 5K3FB 5D3ZA 1QDEA 4XFDA 4U2KA 3RG2A 3FMIA 3BQ9A 4UUQA 1OHHD 2E82A 2IHVA 3KOWA 4I4CA 3DOJA 4IHJB 5FWAA 4BNXA 1UQTA 2PCJA 3FAKA 2ECKA 3TTYA 3OWHA 3TM4A 3ZCQA 2H2WA 1L5VA 4S1PA 1IVSA 1KVRA 3EQ9A 1LB1B 4JU8A 1ND6A 1VBKA 3MJSA 5TQJA 3VR2D 1I33A 1TO6A 4NVRA 3WIDA 2IGTA 3CV3A 2GJ4A 1VFPA 1YTUA 1AKQA 2PL3A 4HB3A 3PWTA 1JIQA 2RI6A 2ERCA 4I5EA 4W5OA 1I14A 2POCA 3PT9A 1Z06A 1FRFS 3L7IA 2XWPA 4MWSA 3VV3A 5JDIC 3PCTA 4DB2A 4WAUA 3T7EA 4FHDA 3DFIA 3NXKA 4IILA 3LUAA 4LBWA 4XQ9A 3ZX5A 3QTLA 4B8YA 4B73A 4Z53A 3T61A 1KMHB 4RZUA 1JG3A 4WT7A 4Z4HA 3JY6A 1X0XA 5I3ZA 3IRUA 4B32A 4UVGA 4GP9A 2B6HA 5TS2A 3OM8A 3PD7A 4WDQA 4OI2A 2XR1A 4IOMA 2I76A 4CGYA 4P33A 1FYXA 4C5CA 5I9IA 3OZAA 5ADUS 3TTSA 1HR0B 4LXXA 4FMDF 3DOCA 1OF1A 1L1EA 1NOIA 5JD6A 5A1TA 5HF5A 3K73O 4L15A 1G21B 2JIZD 2HCTA 1I5EA 2J45A 3VZBA 5BSKA 5FPYA 1HE5A 2BCGY 1U0JA 3OPMA 4L08A 3BA6A 4C4YA 4FHEA 3FPBA 3B2QA 2QXYA 1CXZA 2G08A 1Y5NA 1MQAA 1WV1A 4FYWA 4DQUA 5KMGA 3WZ2A 3AEQA 2REQB 4Q9NA 5E7IA 4JFRA 3EXFA 2IHUA 4K9KA 3FWKA 3HZOA 4CMAA 5GINE 3V9PA 3KXDA 3QFFA 4NEQA 3V4FA 3U2QA 5B2FA 2P4EA 4DG9A 3AVQA 1R6VA 1UPXA 5CT6A 3D8BA 2CSUA 2BY4A 1TUEA 1PN3A 2J59A 4Z0TA 4Q4JB 2BGMA 3I58A 3AB7A 3IODA 2YXDA 3NHZA 1KQGA 1U0FA 2VTDA 1CJTC 1AGPA 1UK9A 3NIFB 1IEXA 1TJVA 1G2IA 4QKQA 1GLNA 1T2UA 5JFGA 3KSMA 2DPGA 1IN5A 4NU5A 3GZHA 1OT3A 4OL0A 3DWFA 3UEOA 4QJIA 3WRWA 4WW0A 2B3TA 2HRDA 2OZVA 3CJQA 5CJ2A 4YT8A 5KTYA 2QTNA 1EFUA 1L4FA 2I1QA 4PG4A 3OMLA 1R4AA 3OFVA 2QE6A 3GUVA 2B4YA 2YICA 2R9VA 3AYXB 3CF4G 4RK5A 1C3UA 7MDHA 3MT7A 2ZATA 4DZTA 1OLUB 1CUDA 3WDKA 3DEJA 1N2GA 3B60A 2KLHA 3TH5A 3LQQA 2P1DA 4DWWA 2CLDX 3GJRA 3EWSA 1JAIA 2E1PA 4LRSB 3K0SA 2NO4A 1VJ1A 5D6BA 1JFFA 2OUKA 3W4KA 1JNXX 2EC5A 4H1VA 4AJ4A 2X4IA 5CNJA 4YI5A 1JJAA 4XRGA 2YWHA 1RWNA 4KO3S 2GS9A 2H5JA 2AOUA 2PCLA 2ZJYA 3H17A 3HJUA 4IXDA 3SPXA 2NO0A 2BSQA 1TUGA 4MZDA 5AVYA 4JJZA 1Y7HA 1ACMA 4WACA 2HOQA 3C3DA 3DQZA 2I65A 2P2NA 4D9GA 1U3WA 2W2OA 4JL8A 3ST7A 4BRSA 4E1BA 3JQFC 4XR4A 3ZNNA 3S0JA 3VDXA 1Y8CA 3WNQA 3TOCA 3IDQA 4QATA 4GBGA 1C29B 2GTHA 1E2GA 4AYTA 3JALB 1K7SN 2ZB8A 1VE3A 5FV7A 1MEEA 3RYTC 3VHRA 3ABIA 2PUFA 2B34A 3LGAA 2YWJA 1JJVA 3EMKA 4PEVA 3IJEB 4R68A 5AJTA 3O3OB 4JI8B 1HKHA 5ENZA 3R8XA 2DERA 2FGKA 2JIMA 2AG0A 1EK5A 4QXPA 3WLJA 1SCAA 2Q6OA 1NV8A 4C7VA 5BSWA 1HY1A 1OCEA 3GELA 1HLFA 3PSAA 1N77A 3HHEA 1BWPA 1P0QA 2WIBA 3UH0A 4ZOQI 1H2FA 1J23A 2YOFA 3S7ZA 3QU7A 2VF8A 3ZOZA 5JC8A 1Q95A 3PFFA 1CE8B 2HCRA 1UMBB 4JNKA 1W96A 3JD1A 2AG8A 1EM8A 1W34A 4J49A 1KEUA 2A9PA 3QVUA 2JFFA 1BXKA 4TUYB 1G7RA 3LL4A 3NR2A 4MCAA 5B12A 2FZKA 5LQJA 5JSHA 4G4SO 1FBNA 3MINB 3HGQA 4KYTA 1BFUA 1JPJA 2PFSA 4NFSA 3Q9NA 1GKLA 3OJCA 4EY4A 5DHPA 4RV4A 5JZOA 4WOJA 3AHHA 4Y0AA 1E3SA 4TWZA 2OOSA 1T8PA 3NO4A 3FI0A 3QWAA 3DOIA 5DX0A 5JQWA 1AKTA 1KQ7A 5EMJA 3QE9Y 1E0AA 4RO0A 4IIUA 1YZQA 4EKDA 4YQEA 3BUSA 4E14A 1HBJA 3ORYA 4JL6A 3ANLA 2DG2A 4G0ZA 3ZDAA 1RE5A 1JW9B 1L4KA 4QYTA 4RD4A 3WWPA 3ZHBA 3A36A 4ZVTA 3RWOA 1FDVA 3BE4A 4WHMA 4HAVA 5IKPA 3V8RA 1KO5A 2CCGA 3IAEA 4IVRA 1AY0A 2FRDC 2JJ2A 1U4OA 2GWRA 3PIDA 3BRCA 4LWQA 2EBFX 4M55A 1J70A 2AFVA 1CVLA 2D74A 3BH0A 3BD8A 3P9CA 4Z7QB 1UPFA 5TMBA 2X2PA 5GGXA 2Y1DA 5J2UF 1P80A 3LXXA 5ADVA 2PSSA 2JCSA 1ULSA 2QUIA 4JOQA 4XEUA 5DNUA 1IHXA 1T36B 2WUFA 4FDUA 5CA0A 3DHWC 2YZMA 2Z4TA 4FN5A 3VR2A 4KO1S 3BL8A 1VHDA 3D0RA 1ISJA 1GN8A 3FR8A 1P17A 3KHKA 4M1QA 4ZJYA 1TUIA 1BQ4A 1CVRA 2REOA 4HWOA 3HDTA 5KKCA 1YA4A 4BBPA 4ZI7B 1CQPA 3FKSD 4BFWA 5LD2C 5CLQA 1XX6A 2OLKA 2XX3A 1ZL2A 4N7MA 3SJBA 1JB9A 3HMQA 1C1XB 1VM6A 4NZNA 2AKAB 3BL5A 2HO4A 3AB8A 4ID9A 1KNQA 4LFBB 1NNUA 1WUJS 2XBLA 1TM4E 1RKXA 5DM60 1VTKA 1MDFA 1KAHA 2LP4Y 1UBGA 4QOFA 3UY4A 3BFVA 4BB0A 3P4YA 5KX5F 4JU9A 4GLFA 1A2BA 3K32A 5LMNB 2YMQA 1JS1X 4P3PA 1TAGA 3A8TA 3WQBA 5C51B 2VKQA 2J3EA 4AM8A 3LDHA 1MNQA 3KXLA 4G81A 4LC1A 4IIDA 4RE6A 4ZCIA 1UFOA 2LWIA 4WBXC 5CHEA 2JIZA 5J4VA 1T8SA 1X7DA 1D3AA 5ECGC 3EA5A 3KWJA 1JP7A 1QWSA 3OCZA 3COWA 5K3CA 2NU9B 3PNYA 2HXYA 1Z5UA 2Q1UA 3PLRA 1P2UA 4QOSA 1NDQA 2P9TA 2W6NA 2YHIA 1L7NA 1N6PA 2ZIUB 5C8YA 4OYHA 1DC8A 4JIGA 5DISB 3WVNA 2D4AA 3HM2A 3DQQA 3LBHA 5KWSA 1M6VA 1EIWA 2OK8A 1A9SA 3Q40A 3RTEA 4P3YA 4DGSA 3DA8A 4ZU1X 2GASA 1WZIA 1O6GA 3EDRA 3L18A 3VR6A 3KQWA 5CA1B 1GUDA 1NOJA 1YI0A 2O0JA 3P9KA 1GM5A 3UXEA 2EW2A 1E9BA 3JARB 5F5NA 4X1OA 2VKTA 3L0YA 1ZJJA 5MHTA 1OXUA 1NMQA 2R751 3K0KA 2XD4A 1ODCA 3CF4A 3F9RA 4E08A 3QLJA 3NI2A 2XQIA 5HIMA 5IAGA 4YRBA 2IYNA 1U63A 5CM8B 2XMGA 4F1WA 1QTIA 4ZRDA 2QENA 4YQFA 3PQDA 1MJGA 4UHBA 2ZBRA 4UU1A 5CLIA 4X8MA 3H1PA 3IOYA 5E2AA 3BXOA 1TVKB 4RTSA 1MB3A 4MROA 4MW4A 1LPMA 1CLUA 2QMEA 3I9OA 1R15A 1CEEA 3ACDA 3JQCA 1JIVA 4NE7A 1V71A 2C4NA 3ELWA 1VRCA 1C7FA 1I9GA 4RKYA 1W8DA 2DGDA 4XDHA 2PQ0A 2WJVA 2IKQA 2Z5GA 5AKHA 3NTXA 4C0QC 2EG9A 3UUWA 1IZ0A 1N2OA 2L18A 3MTDA 1SXHA 1SKQA 5EMLA 3RAFC 2IH2A 3WGIA 1FTQA 1AZSC 2VDKB 3RK0A 2AN9A 3E1GA 3PPVA 3K20A 2YN2A 1ZINA 2WDPA 4MVJD 4JLUA 3HXTA 2JAWA 5A4MS 2GXAA 4U4AA 2QP3A 1U80A 1PR6A 1X8JA 1MNAA 4QASA 3NEJA 3Q41A 5EKSA 2FPSA 2V54A 4R3WA 2ZJBA 2PKQP 5E0KB 5HKLA 3WL8A 3FUCA 3J81A 1W19A 2A86A 2AOTB 3TCKA 3SQLA 4IIVA 1TLTA 4MR7B 4MVJG 3EVEA 1NVWQ 4XYMA 1ZUNA 3DCYA 4BBZA 1WQ1R 5CFZA 2OWDA 3M4ZA 3W3AD 2FXIA 2EP8A 4EHJA 5FPPA 4P1ZA 4F5DA 3L4BC 2I78A 2VF2A 4DG8A 3U7FB 2ZU0C 5C81A 1UJ2A 2CXOA 1N34B 1ISPA 1E18A 2EEZA 4UASA 3IYLW 1O8CA 4EG7A 5BWOA 4BX9A 3G0IA 3K70D 1YB6A 1LDYA 2IF2A 1GG8A 2ODAA 3GBSA 4O3MA 1B42A 3IAM6 4AX4A 4A4DA 2OBLA 1DUVG 3HO8A 3LUKA 3I5UA 4I4LA 5E38A 2X3FA 1ORRA 3K15A 3K6KA 4QQRA 5ESWA 5H80A 5TC4A 3D6NB 3QVWA 3B7PA 4C2TA 4CM6A 3VGJA 2C1ZA 3L93A 1DWQA 3GJ6A 3BWXA 3SEQA 5B4UA 1C9JA 3ZXYA 4B2PA 1TGVA 2GCGA 1MX1A 3A6HA 3B1VA 2DHQA 2ZRPA 3TIXB 2WDZA 2XWQA 3IBTA 2V9PA 4KJZA 4TRRA 1QYWA 5FEMA 3B1JA 4MP8A 2AGVA 1DTEA 4OVKA 3PQEA 4KLNA 3T3PB 1RHUA 2ZSDA 1JLMA 1KBQA 1N1EA 3D3WA 1I4OA 3F6PA 3S4YA 4H7DA 4OXIA 5LQSA 4TZKA 3OZIA 1J20A 2PUEA 2XADA 3TZQA 4D4JA 1NR5A 5BVGA 2NP6A 4C4SA 2R87A 3MK31 2AQKA 2SKDA 2C99A 3ICWA 3UKOA 2V9ZA 4F4JA 1JSRA 2OCAA 4GOND 4D26A 1SIUA 1XXHE 1GCAA 2G0AA 2JI8A 3V1UA 2BI4A 3NOQA 4U2DA 4MRMA 1IBLB 1EX6A 1Z4LA 1QV7A 3NBQA 1SCKA 3U0BA 1CK4A 3U48A 4CQLA 2AW5A 4LDQA 3CLUD 2WHPA 1YASA 4C4RA 1Z8DA 3OF5A 3KYDB 4P7BA 3J7AC 3GMSA 3OCCA 5EIXA 3SSMA 1UL1X 3AOGA 1M9NA 1P3Y1 1E3JA 4QHYA 5I7RA 3IVAA 4OU4A 1JPUA 3NTVA 4R2KA 2VATA 4RHCA 2NT3A 3FNGA 1M5UA 1OAOC 1AQJA 5AHOA 1M10A 1ACLA 4K1XA 5FL7D 3RSGA 1ES9A 1SXJD 3QP9A 3U9LA 2Z0MA 2V6MA 4GD3Q 1VL6A 1X0VA 3GCXA 4YJ2B 3WJ1A 2PX4A 4BNFA 3DAHA 3ZY6A 2KX7A 2G5PA 1M0TA 4ZYVA 3C8DA 3KJNA 2P3OA 2C5GA 4O4HA 1OASA 2OESA 3B1FA 1DIRA 3K0EA 1RWQA 3UBMA 4JLBA 1E3DA 5L7TA 3E22B 5AI6A 5L7WA 4KR3A 2IHYA 4D4IA 1OJLA 2RK6A 5IULC 5JMTA 4G8JA 1G8KA 1TPYA 1JWBB 5I47A 4LGMA 3KT3A 2JB9A 1CP3A 1OBCA 2IPMA 4P7FA 4XQGA 2BMVA 2R1VA 4C2BA 3KQTA 5CYGA 2EWVA 2R6CA 2H85A 3U49A 1A7AA 4RVOA 1U2GC 4BBJA 2WINI 3PC8A 1XMOB 2PMDA 5LB2A 1RAAA 4HDMA 5KQLA 1YS2X 4RSMA 2QQFA 1KWKA 2FSIA 5AJVB 1U2ZA 3SYKA 1HRKA 1AKWA 1JDSA 5ALPA 3VNBA 2RGEA 1P91A 5JROA 4L50A 2J0UA 3RSLA 3VYSB 4Q3DA 5JQGF 4M8KA 4PLWA 3ROMA 3QH4A 3ECSA 1GZUA 2CUKA 1PZNA 3CN9A 2O2ZA 4TN1A 4DLZA 3BK7A 5A03A 1E2EA 1LV8A 2P2LA 2ZXEA 2V7XA 3QJGA 4WK2B 4G67A 3PA6A 1R0KA 4MDHA 1PJ2A 1CHNA 1G8GA 1WSAA 1J0AA 4IZHA 4EG4A 2OY0A 3I9V6 5AKZA 4RKFA 2QRPA 1K5HA 1GLGA 1X1SA 2GYVA 1BYIA 4B34A 2ZE7A 1GN9A 2IYEA 2Z8YA 3PIIA 4OFWA 4G5RA 3P1JA 3TZBA 5JBQA 5EZYB 1FUEA 1P75A 2ZRIA 3LKZA 1V1MB 2C88A 2FW8A 3U3KA 3B36A 4FOOA 3G59A 3O95A 3V4VB 1BEEA 4QQKA 1MXHA 4QT0A 1IJKA 2IU4A 4J0GA 2J9RA 1AZLA 2IK8A 3AILA 3L1UA 2FPPA 3TAXA 5EE1A 4HQRA 1KXZA 1L5ZA 3MAGA 4YR7A 1W48A 3HJBA 3JAKA 1CQXA 4Z6KA 2SKEA 3UCFA 1P4SA 1NW7A 4M76B 4ZK6A 1U5BA 3HA3A 3UMCA 1KAMA 1Q50A 1N5JA 2IOFK 2UZ1B 3I73A 3L77A 3LO5A 4P35A 1ZVQA 3AW9A 3FUWA 4FYJA 1ODJA 4MVJA 3AJ8A 1J06A 1N2CE 1S3SA 3H75A 2FUCA 2QN6A 4W6ZA 4ETWA 3K96A 1W5AA 2C4TA 4RVUA 2E4AA 2YWXA 2VNKA 4TMKA 4CV2A 2P4UA 4R5MA 4FOSA 2GAFA 3ELYA 2WFLA 2J6BA 4JJAA 4F97A 1LWOA 2GZ2A 2GZ3A 3KX2A 2J07A 2HXSA 1R2QA 1MENA 1PDWA 5BV2P 2PIAA 5CLFA 4QU8A 3WBKA 5GONF 4CCYB 2HW8A 5JATA 4MX8A 2HHAA 1D1SA 3W3AA 4C6SA 5B7GA 2R6ZA 3Q7TA 5I7UA 4HQNA 5DBHX 1CERA 5EMNA 5EJ4A 4LF4B 3I64A 2ZULA 4W7HA 5AHWA 2D27A 2JRCA 1AURA 4WKCA 2R4QA 1ZXXA 1NU8A 4UZSA 4AIIA 4YUXA 4YLGA 4FGUA 2HJHA 4TYQA 3ZY4A 2AJBA 1ZIDA 3IT2A 3TE6A 2I3AA 2VK8A 1ZH8A 3FFWA 3OA0A 2HJGA 4XYLA 2FUSA 2BMWA 3BIWA 3OURA 4QOIA 1VPEA 3IDAA 1FFWA 3BJZA 1QYRA 4UZFA 1BX1A 3V2HA 2VJAA 3VR4H 3UW1A 4HDSA 4HADA 3T38A 5K3SA 1OOEA 2XZTA 4CLDA 3TSCA 3AM4A 4DLKA 4BMXA 1VZ2A 3EAFA 1H0KA 4EBFA 1K63A 3PFGA 3ZN2A 1XWIA 3PXBA 1LX6A 2GVZC 3ZQ6A 1Y63A 2GRJA 2ZYTX 4EARA 3PUIA 1GGMA 4EKIA 3MAAC 3HVJA 1R1DA 5JSYA 3UAWA 1KI8A 5BW5A 4NXNB 2AI2A 2QVZX 4PU0A 4ML3A 1A7UA 4Q1BA 1Q0HA 5FBWB 2NG1A 3ZE7A 4C4TA 4ADLA 3ETLA 4R0MA 5CURA 2Q1TA 2I55A 1IU9A 2VYVD 2O8FA 3PJGA 4HQKA 1WSDA 4GX2A 1EWRA 4AJHA 3U61B 1GQRA 1EWYA 1OTXA 4L75A 1EA7A 1SMKA 3HBJA 3WMXA 3T5AA 3UFBA 4UBMA 1NULA 1ONOA 4MQUA 5LP6B 2DSTA 3H9BA 1RPTA 4LOLA 3QLEA 5JRJA 1TADA 4NPCA 3KB2A 2VIIA 2JC3A 3L1VA 1VP3A 2ZJ8A 3OT4A 2HM7A 4O4LF 2ZI7A 3HRHA 4DNOA 1X1EA 1VI2A 1G7TA 2IUTA 3PPXA 1H05A 2FW9A 1DEXA 2WIFA 3WOVA 1CP2A