2JAOA

Crystal structure of d12n variant of mouse cytosolic 5'(3')- deoxyribonucleotidase (cdn) in complex with deoxyguanosine 5'- monophosphate
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
196
structure length
196
Chain Sequence
KRPVRVLVNMDGVLADFESGLLQGFRRRFPEEPHVPLEQRRGFLANEQYGALRPDLAEKVASVYESPGFFLNLEPIPGALDALREMNDMKDTEVFICTTPLLKYDHCVGEKYRWVEQNLGPEFVERIILTRDKTVVMGDLLIDDKDNIQGLEETPSWEHILFTCCHNQHLALPPTRRRLLSWSDNWRGIIESKRAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'(3')-DEOXYRIBONUCLEOTIDASE
publication title Crystal Structures of Human and Murine Deoxyribonucleotidases: Insights Into Recognition of Substrates and Nucleotide Analogues.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
total genus 72
structure length 196
sequence length 196
ec nomenclature ec 3.1.3.-:
pdb deposition date 2006-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06941 NT5C 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.40 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Deoxyribonucleotidase; domain 2 2jaoA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2jaoA01
2EARA 5AKKA 2YFYA 4DFDA 5AI8A 4EZEA 2AMYA 2IOHA 1S2OA 4C4SA 4HGQA 1RMQA 5AW7A 3FPSA 1ZD2P 3ET4A 3AR6A 3AR3A 2OBBA 4Y2YA 2I6XA 5AW2A 5ALGA 3SD7A 3TLMA 1J97A 5AM1A 2P27A 5AK4A 4EX6A 3AR4A 4G9BA 5ALVA 4JB3A 3I28A 2G06A 5JJBA 5AKYA 1QQ7A 5A3QA 5IT0A 3I1YA 1Z4PX 1JUDA 3EF0A 2CFTA 3QLEA 3A1DA 3MPOA 3N1UA 5ALIA 1XP5A 2OA0A 2FPRA 2FPUA 3NIWA 1RMYA 5AKIA 1YDFA 4UMFA 3QXGA 3QNMA 1RMTA 2G07A 3OTQA 1RQLA 4EENA 1SU4A 4G63A 2C8LA 4QJBA 5ALTA 4HGNA 3NRJA 3QUTA 4C4RA 4UW9A 2YJ5A 4Y2VA 5ALNA 5A3RA 3AR2A 5ALXA 4KYTA 3W5CA 3QU9A 5AVUA 4YIKA 2R8XA 4KNVA 2HEGA 1RLOA 4GXTA 3U7HB 5AVYA 1XPJA 5AW4A 2B8EA 1ZOLA 2VKQA 3R4CA 1CR6A 1RQNA 4DWOA 1S8OA 3KC2A 4Y2QA 4UU0A 3HLTA 3KD3A 4YIHA 2IOFK 3UMGA 5ALQA 4CF4A 4DW8A 2GFHA 1RKVA 4NV0A 3U7EB 4XQ0A 1U7PA 1Z4IA 4HGRA 1VFPA 2B8JA 1QQ5A 1Z4JA 3SKXA 3U7FB 4I9FA 3A1EA 1X42A 3WGVA 1RC8A 5AVXA 1Q92A 4L6AA 5AM5A 2B30A 4ZEWA 2GHQA 3M9LA 3ZX5A 2RARA 3ZU6A 3DV9A 5AI5A 2FUEA 5AKXA 3AR9A 5ALZA 3U26A 2AUTA 1NF2A 5ALYA 4QQFA 2HHLA 3I76A 2MSNA 4IFTA 1Z4KA 2Q4RA 4UM5A 2AH5A 2RBKA 5AM4A 2ODAA 3N5KA 3UM9A 3UMCA 3ZUPA 3N8GA 3WK4A 3N28A 1U2TA 1VJRA 2QYHA 4FFDA 5AKGA 3RFUA 3FVVA 5ALUA 3I6BA 2PQ0A 1ZD3A 4BEWA 2FPSA 3W5AA 2HOQA 3ZX4A 4BKMA 3U19A 2NYVA 4RETA 3B9RA 4UARA 1Z4NA 3SHQA 5AW6A 1TJ5A 2WHEA 1K1EA 1EK2A 4UATA 2C9MA 4KN8A 4YGYA 5AVVA 1L7PA 4BNDB 3DDHA 3WKAA 5ALDA 2R8ZA 5ALLA 3FGOA 2ZXEA 3IB6A 4NABA 3QUQA 3NUQA 4Y2RA 4OCZA 1VJ5A 3CZ4A 5AKHA 2HDOA 3OPXA 4BNDA 4GIBA 3WK6A 2YJ4A 2D2VA 5AI4A 1AQ6A 3U13A 3EF1A 2W43A 1KYTA 3F9RA 1RKQA 4CE6A 4B6JA 1RLMA 2C8KA 2W11A 2HF7A 1L6RA 4XPZA 2BDEA 5AW9A 2JAUA 5ALWA 3BWVA 2GMWA 2JAOA 2GO7A 2G08A 4Y2JA 3W5DA 2QLTA 3D6JA 2FUCA 2X4DA 4Y2SA 3OCUA 2NO4A 3A3YA 4UMEA 1TA0A 1L7MA 3E58A 3R09A 4F72A 2RAVA 3SKYA 4CF3A 1QYIA 3ESRA 4DCCA 5AKJA 4Y2UA 5ALJA 5AIBA 4UASA 5AIAA 1RKUA 2PR7A 2O2XA 3OCXA 2FI1A 3KOOA 4J2TA 5AK3A 2P9JA 2CFRA 2HCFA 5ALPA 4BEVA 1F5SA 3ZVNA 5AI0A 3ZWKA 3QU5A 1L8OA 2FDRA 4NAVA 1L8LA 2Q5EA 1U02A 2G09A 4I9GA 1TJ4A 3ZTWA 4FYPA 2ZBGA 3PDWA 4YH1A 2HX1A 3L0CA 3N07A 2I33A 1N9KA 3VAYA 5AESA 1U7OA 5AW3A 3PGLA 3OCZA 3B9BA 3HYCA 3SLRA 4ZEXA 1T9ZA 5AVTA 5FP0A 1Z4MA 3NANA 4YCNA 2YBDA 4MWOA 2I55A 4Y2PA 3KDPA 1Z4LA 4Y3UA 4ZEVA 5AVRA 2NO5A 1WR8A 2ZBFA 3L0YA 3AR5A 2IYEA 2YY6A 2WFAA 4PNHA 4BX2A 5ALEA 1J8DA 3QX7A 3PGVA 5AKZA 3UMBA 3ZVLA 2IA5A 2ZG6A 3DNPA 3PCTA 4JDPA 3ZTYA 5IT4A 3ZVMA 1T5TA 3ZI4A 3WGUA 2WF9A 1EK1A 3L5KA 1NRWA 1SWVA 2OM6A 2CN1A 3L8GA 2YMQA 1Q91A 3EPRA 1WZCA 1YV9A 1WPGA 1SWWA 1TE2A 5AICA 3J7TA 4MUMA 2I7DA 3NALA 2O9JA 4AP9A 3QGMA 3WKBA 1L7NA 2DQSA 5ALOA 2G80A 3E8MA 2WF7A 2HI0A 4F71A 5AVSA 3ED5A 5A3SA 2YJ3A 2JAWA 1LVHA 2G1AA 5AW0A 3WKCA 2B1RA 2WM8A 4HAIA 3WK9A 4AS3A 1Z5UA 1TJ3A 2GHTA 4BX3A 2B82A 1YJ5A 4OFZA 4AS2A 1FEZA 4XOUA 3RF6A 1RDFA 2WF6A 3E84A 2IOFA 1ZRNA 2RB5A 2YMLA 1YMQA 3A1CA 4J03A 4OD0A 3WK5A 5AM3A 4L6CA 3AR8A 3L7YA 1ZRMA 2BY4A 3QYPA 5ALRA 3L8EA 3EWIA 2P69A 2HSZA 4NFLA 3MC1A 3QU2A 4CNQA 1ZD5A 5AW1A 2P11A 3FZQA 3WKDA 2AGVA 2ZOSA 3W5BA 4HYTA 3CNHA 5AVZA 2FEAA 1PW5A 4H1WA 4YCLA 2W4MA 4EELA 2EAUA 5ALSA 3ET5A 3ESQA 3IJ5A 4Y2XA 5AW5A 3L1VA 5ALHA 4BBJA 3OCVA 5AKLA 3BA6A 1Y8AA 1WVIA 1YS9A 3OCWA 4UAUA 5AVWA 1T5SA 3KBBA 2R8EA 2ZBEA 5T41A 1QQ6A 2ZBDA 4NWIA 1ZJJA 2YN4A 3L8HA 1Z4OA 2HO4A 2YMPA 1O08A 1IWOA 3L0BA 4E88A 1U2SA 1QH9A 2YJ6A 3M1YA 2C4NA 3NAMA 5AM0A 5E0OA 3AR7A 2MU1A 3ONNA 3L8FA 3ZWDA 3L1UA 5ALKA 4EEKA 1RLTA 4OHFA 3ZW7A 4L57A 3WK7A 1L7OA 5AHXA 2R8YA 4UU1A 3OCYA 3FM9A 2G0AA 1LTQA 1CQZA 2CFSA 1MH9A 4UMDA 1Z5GA 4BX0A 5AVQA 4UM7A 3IRUA 1Z4QA 5AK6A 3QU4A 4UMVA 4YCMA 1RPZA 5AM2A 1XVIA 4RESA 3WKEA 4XE5A 3NASA 1O03A 1YNSA 3MMZA 5AK5A 4KX3A 2YMMA 3E81A 2FPXA 3WK8A 3SMVA 5AW8A 4FE3A 3R9KA 5IS2A 1N8NA 1Z88A 3DAOA 5AI6A 2EATA 4Y2TA 2HF2A 4KX5A 1ZS9A 2I54A 2B1QA 3QUCA 4O8CA 2WF8A 5AKEA 2JARA 2OYCA 4UAVA 4EX7A 5ALFA 2Q4TA 3U7GA 4C4TA 4IG4A 3B8EA 3FPBA 2I34A 2C88A 2FPWA 3KZXA 3K1ZA 1RRCA 3S6JA 2PKEA 3GYGA 3SF0A 3P96A 4HGPA 2JGAA 2WF5A 4CF5A 1NNLA 3QU7A 4HGOA 5ALMA 5AI9A 1ZD4A 2BDUA 2B0CA 4KNWA 4BYGA 3QUBA 3MN1A
chains in the Genus database with same CATH superfamily
4I6EA 4OBWA 4D41A 5F23A 4MLDA 1G8FA 3DE4X 4JBHA 1JIQA 3MERA 3G6KA 4GOXA 2YL2A 2I65A 1H42A 3DBHB 1VL1A 1K98A 1XVAA 3KSAC 1ZIPA 4XPIB 4C43A 3UBTA 1TRKA 2AG0A 2FHSA 2IF2A 3OM9A 3TF5A 1ULHA 1QPGA 3JQAA 4YDRA 4D9JA 1PR0A 3UEOA 2CMKA 3HJNA 1P5JA 3AZPA 2N3ZA 1M6VA 3D4LA 3GXBA 1J97A 4D3XA 5IPFA 3SMQA 2YH2A 3CNLA 3CI0K 3B85A 5T4BA 3J81k 1MC1A 2HJGA 2FWAA 4KFRA 4F21A 4L8FA 2IYVA 1QAMA 4G5FA 4KFSA 3O93A 2FOXA 4KO1S 3WFZA 2HV8A 4LJ6A 1CHNA 1TK9A 4MLPA 3V7WA 4N48A 1T1JA 4CCYA 1B43A 3EAQA 3F5MA 1C9NA 1NN5A 2G5TA 4AMBA 4QBTA 3S2ZA 1YVRA 1HDRA 2Z2YA 1JPVA 1UBOS 1YI0A 3ZR4B 2ISQA 5CNKA 1GSHA 1YAJA 4NPCA 5EWJA 4PAWA 4RIGA 4QELA 4C0QC 1E4EA 1DFIA 3UOGA 1IWPB 3KQWA 4HMQA 4OM7A 4KXVA 1SCDA 3FHCB 5F3DA 4XIIA 1F7VA 1SU4A 4QXRA 1NOKA 2VP9A 4RV4A 3PUHA 3S1LA 4AO6A 2CZGA 5A5DA 3W34A 1EX1A 1G63A 2QJTA 4GUDA 3ACDA 3Q1KA 5JAUA 2P68A 4B2YA 1EFCA 2BN4A 2QSUA 1C4XA 3AR2A 3DXFA 2C9OA 3AG5A 3S0JA 5CDHA 2BMFA 3OLYA 1J5PA 3G85A 3P9QA 3D0OA 3PYLA 4FFRA 4JJIA 3ZWQA 4F3NA 4V1CB 5HQ3A 3RYCA 5HQTA 4M0DA 4V0KA 4I1PA 1TO1E 3MJDA 5UKDA 3WDLA 3FI9A 4G65A 3H9CA 3I3SR 5JS6A 5DYIA 5L6MB 3HE3A 2QRHA 1CR6A 2J9FA 3G23A 3R4CA 2YYYA 3TLZA 4L0QA 3OOHA 2QMYA 5BMVF 5L7TA 2DETA 4PO3X 3HLTA 1HTWA 4QUKA 1G21B 2VHZA 2H57A 1Z7EA 1Y3BE 1FFDA 3NZEA 5CX1A 1OVMA 4Y1RA 5B12A 1LFAA 2EP7A 4FU0A 5I4KA 1NP3A 2R6AA 3R3VA 5SZIA 4RH1A 2FR8A 3EW9A 1GG9A 3BIFA 1W34A 1TM1E 1EVIA 1Z83A 1LI4A 2GUGA 3I4FA 4WJLA 1PFQA 2D1SA 2EBHX 1ADFA 1NMSA 2P62A 3GIWA 4TL9A 4NCJA 2GM3A 1LBIA 3EW7A 4FFVA 3NAGA 1GVNB 2H07A 2HT6A 4BFLA 4HNUA 2JAQA 3WL4A 1Y8QB 1K6JA 2FW8A 3KUUA 3QQPA 5KYYA 5CW1A 3S2IA 3CEHA 1ESDA 2JANA 3I9KA 3NBXX 4H17A 4IAOA 4H7IA 1ECFA 4G25A 4B0OA 2AUTA 4ZVTA 5KU7A 1QUEA 1AKYA 2PG3A 3TFWA 2VJQA 1O3YA 2XUDA 1KAQA 1WM1A 3BRWA 4GBMA 4CIVA 3SYNA 3LGXA 3FLEA 3I76A 3DVAA 1V3TA 5ECDA 5EOVA 3NIGB 1MV8A 2Q4RA 1NW7A 2E5FA 3HJUA 3VV3A 2FX2A 2RBKA 3KS9A 3LRXA 3K96A 3KQPA 5GVRA 1JHRA 4WY2A 4FGUA 1HE1C 1RXYA 2H2DA 1CK4A 2OAGA 3FVQA 1C9MA 1GM5A 4PC7A 4C2TA 3EZNA 4N54A 2IXFA 4E46A 3KYDB 4IZ6A 3SF8B 4EUNA 1GEGA 1ILEA 2XMPA 4GLBA 2EX4A 5TT0A 3RC1A 2GD6A 2JGEA 3NQ41 4FINA 1YMUA 3LPCA 3IQEA 1JKJB 4DHEA 2OGZA 3BWDD 1JDBB 9LDTA 4QXQA 2P9ZA 1X2BA 2A5DA 2WHPA 3B12A 1UBNA 3LQFA 2BUAA 4LXHA 4ZP1A 3SX0A 3H11A 4YRIA 1VPDA 2OBYA 3DD1A 3DL4A 2HK6A 1CY1A 3SU8A 2WVJA 3KKPA 1I94B 4A7PA 1E5QA 4U2FA 3BIWA 2CNBA 4Q5IA 2EW8A 1V45E 1ZW6A 2PVSA 2PYZA 3AG6A 3CG0A 4DQUA 3OKCA 1KC1A 221PA 1U65A 2D5LA 4WLUA 1ZN8A 1R2QA 1B7GO 4HEHA 4O29A 4ZO8A 2ZU0C 3PQ5A 1RI1A 3HKCB 4XEUA 4Y2RA 2FP4A 1YVUA 1XZQA 3BB1A 5JI3E 1E2KA 1NQXA 2XMDA 4X84A 4XVCA 1F60A 1X9HA 2G4VA 4FSDA 1O95C 3EXIB 3CVWA 1WPXA 1BKYA 4RD2A 4NS1A 3OFJA 3RSLA 3EPHA 3D4OA 1JLSA 1QH1B 2RB4A 4CMEC 4CEJA 3M6FA 1NGSA 1PBTA 5A9RA 5IARA 4YLYA 3IPXA 4MAMA 3VYVA 1NOJA 3RJ9A 2PX6A 1E7MA 3RU9A 2D2XA 3ESAA 3AKEA 4PYLA 3WLRA 3CVOA 3HNRA 1WW3A 3KPUA 1U1DA 2P4HX 1J07A 1K88A 3I9NA 4MRVA 4N3AA 1U3TA 2AI1A 4B3XA 4DBVO 4KXUA 1XDWA 3TR5A 1N92A 1T2EA 2F1JA 2BEVA 1OLUB 2LXNA 3K0FA 3OQHA 2E4YA 4HL6A 4WZBB 1FUEA 3IMKA 3W4IA 1YIDA 2HLPA 2ZBVA 4C7JA 5K3BA 4HCJA 2WP8J 5T3YA 2F1HA 4KQFA 4U2CA 4RMNA 1MAUA 2QL7A 5IHXA 3F97A 3ESRA 3C14C 2Z95A 2YRXA 1H1LA 4Q4HB 1AXGA 3FIUA 1RKUA 2QX4A 3HA7A 3KYCA 5AK3A 4C30A 4FN5A 2ZIWB 2WHRA 1N5MA 3I53A 1PGPA 1Z0SA 1DBRA 5ERXA 3E5RA 3ZV3A 1Z74A 1JFSA 1YR1A 4QFBA 5IJAA 3OPNA 4REMA 5KYXA 3H9EO 3COJA 1GG5A 3SPXA 2QTBA 3IVRA 5JSUA 5FV7A 1JTVA 2WZBA 5BVHB 5IMSA 3KFXA 3GC6A 3IEIA 1VYUA 1I3LA 3LDFA 1ZA2A 1JSZA 2VZ9A 4AZSA 2WK1A 4TZ0A 3AVWA 1WXHA 1XZHA 1XCBA 3CCFA 3D6AA 5HIMA 1MB3A 4CM3A 1PJ4A 3H42B 4D5GA 3HXQA 1PP4A 1ZD1A 2NUTB 5CT5A 3GJ3A 4MUJA 1ZGGA 3MS2A 2CJFA 4EQ6B 3MIIA 3TCNA 2XB2A 1LEHA 3HYCA 1II8B 4OSEA 4RHTA 4WH0A 3V1YA 3C6QA 3C74A 1VHDA 1UK7A 3WIVA 1AQLA 4Q7JB 5DBIA 1E1YA 1X8KA 1VMAA 1AQJA 1O5OA 5A9TA 3KDPA 3G8BA 4BQRA 2H08A 1CUVA 2B25A 3H19A 4A5SA 4DQDA 1PFGA 2G9ZA 2FK8A 2DZDA 4XDZA 1WZ2A 3JY6A 1V4VA 5D3MB 3TEMA 1UEIA 3M3PA 4OQMA 5DLPA 3TM4A 1L7XA 3DMFA 5ITZB 2RKOA 1WHSB 2BSXA 1Z8NA 2ICAA 5KTPA 1Z2OX 1NY5A 1EGMB 1KO7A 2F8SA 2IU4A 3H9QA 3ODPA 1EXMA 1VCIA 2JHAA 2YUTA 1J3UA 1EUYA 3TSAA 1HY0A 5A9SB 3OEEA 3HSSA 1M2KA 2AEJA 2JD1A 2QPLA 1N0IA 3TNDA 1CUXA 3HO6A 1Q0LA 1P0QA 2C2KA 2F1KA 1GLVA 4KVAA 3UAVA 3U3ZA 3NOOA 1HE2A 1RRVA 1SHKA 3CT4A 2XWBF 2ZPAA 4HRAA 1JBQA 5DX8A 1EK1A 4DYHA 3MTJA 3L5KA 1QE5A 4KMRA 2GARA 5A5EA 4MX2A 4CTJA 1Z16A 2DP4E 2J0UA 1EX7A 3O8DA 3X1XA 2FH5B 1UF9A 2QGNA 3QVUA 1BGWA 3JWGA 2J33A 1NJFA 1TE2A 2J5BA 4ZVQA 2P2GA 1VJTA 1G3IA 2H6EA 4N0DA 1C80A 1W4BA 1AGNA 1L4MA 3F71A 1KVRA 1AHNA 1PD1A 4B3JA 1AMOA 3EF3A 4NH0A 3VR5A 4P84A 3WBBA 4Q03A 2CNWA 2GM9A 3BRQA 3GLKA 1VPTA 4C0AC 5EJ2A 5KYVA 2FYTA 1FXWF 2GK6A 4L8GA 4CG1A 4KPYA 1A69A 1GZUA 3GL9A 5DHRA 1GL6A 3M6UA 4QSMA 2R6HA 1F14A 3MHTA 5A3SA 2VDLB 3THYA 3BD8A 4O4LB 4CGYA 3ZNNA 4BLRA 4KDFA 2BZ1A 4UDXX 2JGIA 5FBZA 4YRTA 4XWGA 3HHEA 4DIMA 4J1TA 3I2GA 2KQUA 1HDXA 4OBXA 2VAMA 3COVA 4ER0A 2XGOA 4LSGA 1TJ3A 1GQFA 4HDNB 4JP5A 4U2DA 3PUVA 4UFPA 1G6HA 4TXLA 4B45A 3LWNA 2VJCA 4P22A 3I0ZA 1URPA 4DGSA 3OE1A 2A1TS 4JQOA 3WV4A 5BMOA 3UT6A 4LDQA 4TV8F 2VRCD 2H63A 2VDUE 4S12A 5FLEX 1E98A 2YMLA 3GJSA 3A3NA 3NRCA 4MXDA 3K71B 3A37A 2FXVA 3R0VA 2ABWA 1JR3A 2A84A 4F8JA 1NVXQ 2XWSA 2RK3A 2V7VA 4M88A 1C29B 3DLAA 5C0OE 1XTTA 1X70A 5CT8A 3V3TA 4WDQA 1VLLA 1I32A 5E3HA 4F1JA 1IY1A 4N0EA 3KPWA 2BKXA 1R5OA 1UBRS 1GV1A 1LPNA 1S02A 4G9GA 1R16A 4BZWA 3PXBA 2HYIC 3OJLA 3QU2A 1AGPA 1AXEA 1JG3A 1NXXA 1R3UA 3FTPA 1FQOA 1Z7YA 1LW6E 2BAGA 1AHPA 5C31A 2R00C 2ZVDA 1MAVA 3BD9A 1QTNA 2OCBA 1SKYB 4YCLA 2XUHA 3O8RA 5HA5A 3VDNB 4P98A 3VNUA 4J0QA 4QVGA 4EH1A 4EGCB 3L0OA 4RULA 4PG8A 1U2RA 2JZCA 1Z5OA 2HH9A 3GFFA 2ZYTX 1R6XA 5T7BA 1A1VA 3TD2A 2JFBA 1C1XA 4C03A 4RTNA 3GLFA 2C9YA 1KDOA 3OCVA 2AC2A 2IU6A 3PNKA 1YS9A 4I50B 1RWOA 3IUMA 4ZAVA 3FOEC 1XALA 1BCRB 3ZH9B 1B8VA 3MB5A 1V4BA 1QQ6A 4E2FA 1K8RA 3I9JA 3PBKA 4IZIA 4NWIA 4Z1MA 4ESEA 3O7WA 1ETHA 3OT1A 3P0FA 5D01A 3G8AA 5KYUA 1NPTO 1RAAA 1ZNQO 3K9FC 1JHPA 1LK0A 3AVQA 2OGTA 4IJMA 5JD4A 4E88A 1U2QA 2X5OA 1SVSA 5LZ5A 2V7QA 4EUEA 3GEEA 4IM7A 5TQ2B 3T8YA 4JL5A 1GOTA 4KK3A 1A2OA 5JSZB 4A0QA 5JCPA 2OYRA 4RCVA 1GR0A 1U8TA 2Q5QA 4B2IA 2M1ZA 1JI3A 1Y42X 3AM4A 3HKBB 3NEAA 3OPYB 2VL7A 1Z2PX 3ZWDA 4TYMA 5ALKA 4EGFA 2V9PA 4F2WA 1VGQA 2J4DA 4MV1A 5T6MA 2W6CX 5LXTF 3WADA 2D6FA 3HLKA 4GFDA 4K1XA 3M1LA 1MO4A 3TDNA 3P2OA 1QC5B 3GLGB 2JJ2D 2Q5CA 2V98A 3QV1A 5BQ3A 4JDUA 2DULA 1FRVA 3NONA 4UXHA 5IWAB 2GAAA 4ZQFA 2QN2A 2KJQA 4NOLA 4CL3A 5BWMA 4EP1A 1IAVA 2ZPTX 4E07A 1LLFA 2A92A 2NUPB 2IYOA 3HWWA 3W6ZA 3WBKA 2GT1A 2AKAB 2R6DA 3QU4A 2CWWA 3SZRA 1FDIA 1FMCA 2NTNA 4FYWA 3Q5DA 3L92A 4MWGA 4YUYA 2CLFB 1VXRA 2PQ2A 4XUDA 1MFPA 4FOTA 2G71A 1DO8A 3VVMA 3GGCA 3GMDA 3BTSA 3PNSA 1B23P 2MINA 1C4WA 3S2EA 1YVEI 3GEGA 2QTRA 5JT1A 1QHXA 3QVGB 5F4BA 1DKMA 4EDHA 2GD2A 2GA9A 2YMMA 3RE1A 5LP6B 1Z38A 3F4RA 1CJMA 5DULA 4AN4A 3PYMA 5M34A 4WCFA 1SR8A 1ISFA 2O0HA 3R9KA 1DDGA 4YAWA 1Q17A 2VDRB 1I4OA 4YLEA 1Z6TA 1YSCA 5FQOA 2P1DA 1FVFA 2L69A 1NHGA 3GVPA 4L51A 4L28A 1JKXA 4B2PA 1E4VA 4J0EA 1J21A 2B9VA 4KX5A 3GD7A 2E9SA 1GA4A 1FXWA 4K05A 3LA8A 1P7ZA 1XAHA 3IR6A 2G8LA 2HF9A 4GC9A 1JDBC 2ZPUA 1V41E 5IMBA 2V7PA 2QTTA 3OZRA 5CHEA 1SD1A 2JAXA 5FI3A 1TKCA 1JLHA 1WQ1R 2FPWA 1R8QA 2OGUA 4TGLA 3SZLA 1RBMA 4EDFA 1GN9A 5FUBA 2WYVA 2JGAA 2PY6A 2XLCA 4X54A 2P77A 4GR4A 4Q6BA 4WNAB 3TOZA 1SBTA 4KWCA 2QTLA 3O74A 1ZH8A 4MLZA 2QRNA 3QU7A 3IUNA 4OAPA 1QVVA 3PVSA 1M6VB 2OD7A 5TMEA 2VRBA 2BGTA 1S8FA 4PGGA 3I1IA 3OTIA 2EFJA 1AM4D 2HHJA 3DO5A 2WAAA 2ZUVA 2ST1A 2GLUA 1YONA 1K7YA 2A3NA 3ZZTA 4I99A 2APJA 3F8SA 2QLMA 4TV8A 4ERXA 4HDMA 4JR2A 3LP5A 1D2MA 3KJHA 2OESA 3AJDA 3QFRA 4CCYB 3AR3A 1J1IA 1ISGA 4V0RA 1KMCA 2BF7A 2PTGA 3IUYA 5MN4A 3HYNA 1O9HA 1XGKA 2B2XA 2R8OA 1ZICA 5DSXA 1P74A 4R31A 4Y8VA 5E8JA 5EWJB 2OB2A 2VJAA 1E4EB 3IHWA 3QE2A 4B3BA 1T2NA 3NTOA 3RK1A 4Z4IA 1CDZA 1X3LA 3N3AC 3ZWAA 2AQIA 3HBLA 1JIJA 1TEHA 4K9PA 4B9AA 2QPOA 1O89A 4FEYA 4R2JA 4AMGA 2R1ZA 1RNLA 3W5JA 1QF9A 1I5RA 1XPUA 2DQKA 3MPOA 1IY0A 2FEKA 1V3QE 1IW7D 2QTFA 2X5XA 4KR0A 4NPAA 3B5IA 2OA0A 3V5NA 3V97A 2ZU6A 3E9YA 1NIJA 2AJBA 4FXPA 1SVIA 1VP3A 5F5NA 3RYCB 5HQ3B 4DJ5X 4Q82A 4F60A 3IXMA 1W5FA 1GGNA 1KXZA 1RQLA 1Z34A 3T7KA 1PD0A 3O82A 1GPNA 3H04A 1T0HB 3PFKA 1YZTA 2Q4BA 2J9FB 2ORWA 5DTRA 3IUQA 5EYPB 1XU9A 1HK7A 5C18A 1YXMA 3VU3A 1GQQA 3AESB 1FUIA 1VA4A 1UJ4A 1DDOA 5MF6A 1IHUA 4FQ7A 3G79A 4B3RB 5BW5A 2XZLA 5EMMA 3S7TA 4FLEA 5TNXA 2R8XA 1G8HA 1PX2A 1W4LA 5CX1B 1AD2A 2H16A 1IRXA 4BAUA 3VUFA 1P31A 1K0UA 4ZVLA 4OI2A 1IYZA 3M6VA 3OTHA 2H4FA 4FUTA 5A2GA 3T3NA 3ZCPA 9MHTA 1RYDA 3OETA 4S1PA 4Y1FA 1WPRA 3Q3VA 3SWWA 1QRTA 3LQ4A 2Z9BA 3N2IA 1M34E 4DW8A 2GFHA 2XGJA 1RKVA 2BFWA 4KTVE 3WAKA 2B0JA 5LXTA 1KZ1A 1UQRA 3DVLA 5KYYB 1HE5A 1Y5RA 2YFKA 2HZ7A 4CF6A 1VPWA 1L5RA 2G7ZA 2ZIFA 3ND9A 3U7FB 2RI6A 4U2BA 2QD2A 3R3WA 2HLNA 1ZLYA 3OQVA 3PNVA 3SI7A 1UWKA 1E4OA 2H0RA 1X74A 3BGVA 1D2EA 2PGIA 4BN4A 4D8YA 2DQYA 3DVAB 3OQNA 1FS6A 4TL8A 4BAGA 2B30A 1IXYA 5IKPA 5JH7F 3ZU3A 1SVMA 4OU5A 5DP1A 4YJGA 4GLFA 4LA4A 1P2TA 2FG7C 3DZDA 4U6QA 1CR1A 2A4KA 2YICA 3CKYA 3EVZA 3GNSA 1DWUA 1QV6A 4PRKA 1NF2A 4QSHA 1OTYA 1G5QA 4L6IA 3K20A 4TVBA 4DGQA 2K7FA 2CW5A 3T5TA 1TC1A 1Z2AA 3EEBA 5FOVA 3GP8A 3KKQA 4DE5A 4GQBA 1P18A 3UYLA 4HLUA 1F2DA 5AM4A 3RJTA 1U4SA 3O0DA 1T3SA 4MI3A 2WHPB 4PZ0A 4U8HA 3H11B 3KKNA 1Q1AA 3SIRA 1EA5A 3M4NA 3EIFA 2WG1A 4A16A 3M89A 3EDOA 2GJ9A 2OOSA 2E1RA 2AN1A 3SIXA 3OTOB 4L07A 3NBUA 4UM8B 4C1NA 1CP3A 2GK7A 2ZCVA 5D1HA 2FRDA 2HNAA 3RUAA 1QNFA 4PQEA 2J07A 2YZ2A 5CBPB 1LF5A 3DMTC 2YV3A 3SN6A 5FOWA 1HLPA 2WWWA 4D8XA 4CMJA 1VSQA 2FP4B 4X41A 3AKDA 3LA6A 4RKEA 1TJ5A 3H2SA 4PZAA 3EZYA 5KTMA 1SQ0A 2ZTUA 4ZOAA 1RHUA 1X7ZA 4G0YA 2FWBA 2C78A 2CCJA 1J06A 3AT1A 3M70A 1ZM7A 5IAOA 4LJ8A 4OQNA 5GP1A 4R8LA 4DABA 2X1MA 3VPGA 4CEJB 1LSJA 4FHFA 4J0FA 1XZMA 1LRJA 1R0WA 2GWRA 2YBEA 3A06A 3A2NA 3R5XA 2OFWA 1TVEA 4K03A 3Q41A 4KWEA 3FHJA 4H31A 2H9AA 3AF0A 3K9BA 2QVGA 3WHIA 1Y6FA 1NA5A 3DMGA 1Y9EA 2V58A 3AVOA 4P5DA 4W7HA 1IM2A 4QOIA 2E6UX 4QWWA 3NPMA 5DMHA 5LM3A 3K4QA 1UKBA 4UTRA 1H05A 2BEVB 3K0FB 4RHEA 3BT7A 3MQ4A 3SHOA 3JQBA 5IXJA 3RT1A 5DN6A 3HY4A 2FJUA 3WLAA 1SUSA 1Z8FA 5JDIC 5KMGA 2IDZA 5F7ZA 2E4AA 2F9LA 2PGAA 3HB1A 4MYCA 5HIAA 4WA8A 1U2DA 3I64A 4NCXA 2H1WA 1UXJA 4LKRA 4R1TA 1H1LB 3OZAA 2PYIA 3FZNA 2GNOA 3JARA 3MWDB 4N1AA 4EFCA 1O6GA 2RGCA 3C5VA 3W8NA 4C89A 1D0VA 3LU1A 3TG2A 3KYCB 1CVIA 2K5UA 3IPAA 3S55A 3Q3JB 4CDMA 4O2RA 3A8TA 4HGYA 3GIDA 3V46A 2VTBA 1K4MA 3YASA 1NY6A 1EUDA 4CXMA 1Z62A 1CJUC 4NBUA 2KLHA 1M0EA 2VNKA 1AZLA 2ACKA 2D1QA 5JU6A 3RUPA 1V9LA 1KDZA 4B76A 4B74A 2HA3A 2PCJA 3OMXA 3SFZA 1IEVA 5AIBA 3RVQA 3L1KA 1Y8RA 2B8WA 3T35A 3ETLA 4OLAA 3CZRA 3IP8A 3GJTA 4XH9B 3HU3A 3EPLA 4PSCA 4NE2A 4W6QA 1QIMA 4WOJA 2HHCA 3AY7A 3L1HA 3PXAA 5B2ZA 1NM5A 2W9XA 2QMHA 3NBZC 1N7GA 4GSKA 1TOAA 1Y1PA 4QPPA 2OSVA 5JD6A 4IILA 2XHZA 2HDWA 4NAVA 2C5EA 4AJLA 4KXLA 1GCGA 1SY7A 2IXTA 4JSTA 3FX2A 1L7QA 3KLMX 1XVUA 5H83A 2H5JA 1PDVA 5JZOA 4YEDA 1Z15A 3U5ZB 3ZWWA 4MDEA 3IAXA 4TQUS 5FLXA 1Q0QA 1NVMB 4RVOA 1N9KA 2PVPA 2AJCA 3VAYA 1BQEA 3LUJA 5A6SA 2CT8A 4MRRA 4ZCIA 4ECEA 1SIOA 1W4AA 1XV5A 1ZL0A 2GCPA 2RMKA 4HGZA 2J3LA 4JHXA 4ZEXA 3ZDRA 4EIWA 3CLRD 4LJ7A 5KIAA 3ES9A 1P2DA 4U39A 5FUQA 4LXIA 1WLSA 5TF4A 4YCNA 4RJIA 2IH4A 3MOGA 4ZC1A 3LO5A 5DLEA 3PXCX 2OMEA 4JC8A 2HMUA 2YXPX 4YO8A 1P6XA 1BD4A 1DSSG 1VC2A 2ZS8A 3BGOS 4M37A 4DLLA 4KUHA 4PSAA 3SC4A 1BDHA 3BREA 4HNTA 5DYWA 3HZHA 4AX8A 1C3LA 1RAGA 2NO5A 4XUCA 4BMZA 4ZJUA 2C83A 1XTJA 3I72A 1Q5NA 3D1VA 4IJ5A 1I2MA 1VIDA 1KJ9A 3K5IA 4UCQA 3CXRA 3Q7SA 3ELYA 2J7PD 2OHVA 3WSVA 5ANRB 4HQNA 2A5FA 3W6OA 4LEIA 1I3CA 2UYOA 5H4GA 3ISJA 2J0UB 1AA6A 1HDIA 1X7YA 2XUPA 4YDHB 1X87A 4ZVSA 1EEXB 5I7HA 4DAOA 4B6PA 3ILVA 5T64A 1UFQA 3QNWA 4BIIA 4RHCA 2CDBA 4PCLA 1U2GC 3W2TA 2PMKA 1G20B 5IT4A 1CIJA 1WP4A 1DBSA 4D25A 5BYJA 2CB9A 1G3QA 4JP2A 1G60A 2OE2A 1LCIA 3QW4B 4BCDA 1FIUA 3PS9A 4ADSG 1SOMA 5LP6C 1N3BA 2P2DA 2FW1A 3FF1A 3O4VA 3Q3EA 3PF9A 4J7XA 4M0CA 4P4LA 1I5EA 3T3PB 2WQ7A 4W99A 2OWEA 3G0GA 2B8NA 1HFJA 3Q3GE 5TEWA 1NU6A 3THYB 2LTAA 4KZPA 4ME6A 5E6UB 2HNKA 2AG6A 2XRMA 1BVHA 2XOXA 1BH2A 2HIAA 1WDWB 4AP9A 3HKDA 1WKVA 1WTAA 2E4ZA 2O6HA 3QGMA 4GPZA 4MCJA 3VFDA 4YPVA 5ALOA 3PX7A 2ZRQA 1ESNA 5EIAA 1DJLA 1UT5A 2C2XA 4RNDB 4BMOB 3HJRA 5ICEA 3MJVA 1KTVA 2VSQA 5LZ7A 3KSDO 4WZAE 3DM9B 1J70A 4N65A 4DJFC 4R81A 3CEAA 2MR5A 4E4YA 3P9KA 2ZT8A 3F74A 2QUBA 4QLOA 3VBEA 1KS2A 4U9IS 4B4OA 8LDHA 3PR3A 2Y1CA 1JPNA 1XNRB 2W22A 4C6TA 3GROA 4HSEA 1MB9A 4NBNA 1JJ7A 5EIOA 3TKYA 2ZIZA 2P3LA 1RI3A 4WX2B 5LC1A 4UTVA 1EPUA 4N40A 4OFZA 1KMMA 3IOYA 2BL4A 4DR2B 5BWNA 1U15A 2P75A 3KOMA 3OE7A 4XARA 4E3ZA 4EG5A 1H3FA 1II9A 1I4DD 1UKVY 4Z4CA 1XF9A 4PHCA 1TM2A 2Z57A 3RC2A 3VR3D 1AC5A 2OV8A 3FMGA 1ZITA 4CCWA 4OD0A 1R8JA 2R7KA 1PT9A 3U80A 1FNDA 1YFKA 4R3NA 2BONA 3DBVO 1L4LA 1SNYA 4I7EA 1Y80A 1U3CA 4FOLA 4HXGA 1G42A 4PZEA 4I81A 3DAPA 1SQ5A 2KI5A 2VTKA 3FMVA 3EIXA 3L8EA 3QLVA 5M2QA 1QMPA 3L9XA 4ARBA 3IB3A 1B14A 2P6MA 3LVQE 1S4MA 1NZFA 1XPOA 4A23A 1C1XB 4TS9A 4EY6A 2P6RA 2IZ0A 1PG5A 1WUJS 3FF4A 4XGKA 4HNVA 1PSZA 3ICCA 5KQMA 2OILA 3CNBA 3GDGA 4P3NA 2O2IA 4B1FA 2AW3A 3FWZA 3OZEA 2WNHA 1PR9A 1PZXA 5TGZA 3E53A 3JVDA 2I2FA 5KYUB 4RZ2A 5DK4A 4TZ6A 1I6WA 2ERCA 4IQGA 4M8IA 1HF3A 3HP1A 3KB8A 4IQFA 4TUYA 5CIQA 3UUEA 1EG2A 4JASB 1YDMA 5GWXA 3KO8A 3L7CA 2I8CA 1P17A 2ZDHA 5TGDA 1H8HA 1ZWKA 2XWJI 4NDNE 3E2PA 3TR0A 3FNEA 2A0FA 3GY0A 5KUTA 1GTJ1 2A5YB 2PN1A 4Q9JA 3KR1A 1JXQA 1EQ2A 2R3SA 3IAFA 4WKNA 2BHLA 3FOZA 2Q1UA 2PGDA 3PNYA 4L4SA 1JQ5A 2GRUA 4G1FA 3WG9A 1QFJA 3OWOA 3WWYA 3MT9A 4TYPA 4X24A 3OFKA 3ZOZA 1NATA 4PHFA 2WD9A 1EQUA 4A36A 2D3TA 2NVUA 4ETIA 1FQJA 4YR7A 1BX0A 3RLFA 4XVUA 4C4YA 2J3QA 2BCEA 2VPIA 4FMPA 3LF1A 4FHZA 4WGGA 2A5LA 3ND7A 1GITA 1I1HA 4E22A 1KKUA 1QKIA 3M0EA 1P5RA 4LWPA 3BUSA 3D3EA 4OH7A 5KQLA 2QA5A 3SHTA 1KEPA 5JAMA 2C1XA 2PUDA 2C2BA 1DOZA 2C98A 5HDBB 4BX0A 3N8HA 1L3CA 5AVQA 4UM7A 1E3TA 1BGXT 3IRUA 1O77A 3PJEA 5BSGA 4DR3B 4WCFB 1LD3A 1JZTA 4O63O 4TS1A 4J4HA 4R51A 2E89A 7REQA 1T9BA 2YWEA 2GZDA 2P5TB 3O1HB 3R1IA 4F2GA 1FJXA 4GX5A 4AJKA 3LQ1A 3PHJA 3UW1A 3L4KA 1QE0A 1K66A 4P83A 4BVHA 1KNQA 2JG3A 2PUEA 3VHXA 3W6PA 1NUQA 2QZJA 4YMVA 3VR6D 4RDCA 3P0JA 3S8YA 4BKQA 1W9MA 1DC6A 1VP9A 2GN2A 4YBRA 1NR5A 1Z2NX 2Z8XA 5HNKA 1TCVA 1MABA 4BN0A 2DT8A 2QI9F 3EH2A 4ZMRA 4Y2TA 1BHQ1 1VBNA 1KFBB 1OV4A 3AQIA 2I54A 4Z99A 2OHXA 3D1LA 1C30A 3ZXUB 4B6OA 1O6ZA 4BL5A 3F7NA 2CHGA 1P75A 3VRHA 4P5EA 3ITKA 3WL5A 4BNVA 1XEWY 2QU8A 4RCZA 4WD3A 3P9SA 5JG7A 4MRNA 4HLNA 2FGKA 1I6KA 1KAHA 1FVXA 4YRRA 4TV8B 1AKMA 1NVVR 3IO3A 4HDMB 4Y9RA 5CLIA 5KNDD 4N76A 3HU1A 3R9XA 2FQ1A 1GTSA 3CT6A 3AH8A 4MR8A 3M6WA 1WPQA 2ZIXA 3LGAA 3HA5A 2YV5A 3LRTA 1VMKA 4DXHA 2GBIA 5D6OA 1XTKA 2DPYA 1V1RA 4JR0A 2ZJFA 3NBAA 2WD7A 1HKUA 2I6FA 3RS4A 1KEUA 4JODA 5BV1A 3OU7A 4C4SA 3FVTA 2YWDA 3DE6X 1NVTA 4ID9A 3N6VA 4KVFA 4MVJD 2O5VA 2PKCA 4KBGA 4R1MA 3IV9A 4R1NA 5BNFA 3ZV7A 4KO3S 1Z33A 2HQ1A 3IEXA 1NFFA 4LHWA 4Y0VA 1TM3E 3W2GA 4ZAXA 2AFIE 4R8KA 5JBNA 2I6XA 1DKOA 1UDAA 1TVKA 3JAWA 1M72A 2IXDA 2OBMA 2VPTA 4KHZA 5CYGA 4R3UC 5IZCC 3WQQA 3QBPA 4EVSA 3H5AA 1QP4A 3WZ2A 4TPKA 1V6SA 2PR2A 2YR0A 3IQGX 2VF5X 5AK4A 2W93A 4JIGA 4MV7A 1M2OA 5TMPA 3FYCA 3KEQA 3HJGA 3ZJTA 3GUVA 3HB4X 4PQRA 2JDID 1I0IA 3EXFB 4XVHA 2XYGA 1Y1RA 5EWLA 3HZRA 4MVJE 5HM6A 1C14A 3EGVA 3CPJB 3NOXA 1NC3A 2WJ6A 3LCCA 4MUFA 4ZKDA 4G0MA 2ZYDA 1PZEA 4KQJA 1E1CA 3HVJA 1RI4A 1ADBA 3BXHA 1FXUA 1R0YA 2QLBA 3FYUB 1FS4A 1ZGZA 2OLEA 3D2BA 5F33A 4PLCA 1WUKS 2DPXA 2G36A 3EVAA 5G3ZA 3W5VA 5EJ4A 4N7MA 2C4VA 1T3TA 4YREA 5TY0A 4DR1B 4QUJA 4YJ2F 3D8NA 1GFSA 2DR3A 1EH5A 4EG0A 4KODA 2A0XA 2E85A 1G5IA 2OP1A 2PUJA 3QPDA 4S05A 1KERA 2VHVA 3RKSA 2IZ5A 3W5CA 2VAWA 1QYVA 3B6MA 1Q5PA 2QTNA 2JAPA 3DW3X 3ESZA 4HG2A 4W7IA 5HBGA 4N7BA 2GEUA 2JLQA 4BMNA 2HEGA 3V9PA 2VNHA 3ZS8A 1HEIA 3M6IA 1EM6A 2Z58A 4MX8A 5TR9A 5BN1A 3U60B 4DPMA 1NDHA 2ZAYA 4Z6KA 4QLAA 1XG5A 1KSGA 4OMUA 1K2VN 2OK8A 2PM8A 2H2AA 2PTQA 1ISSA 4B6FA 1RQNA 4PC6A 3ZDAA 3CRZA 2WYOA 1CZRA 1UCFA 2IVZA 5EJEA 3GEBA 2PEYA 4HUQA 1UIRA 3TQTA 1PJCA 3EN0A 3UO8B 2GEFA 3VU9A 3W4JA 1Y48E 3MOIA 4CYMA 3VPAA 3KZOA 1ST3A 3LDGA 1E6LA 1EVQA 2LNDA 4XM1A 2DWCA 4D79A 2ARKA 2B69A 4GD3Q 4GECA 1HL7A 3WISA 4Z51A 1EB9A 3I2HA 3WGIA 3QHPA 4JMLA 1RLJA 1ZCAA 4LWOA 1SXJA 1WB4A 3V4VB 4I9FA 4LXTA 4Q7QA 1AF4A 4NCAA 2D0DA 1DBPA 2DTEA 3FSJX 4F9FA 4R71A 1K68A 1T8PA 5AVXA 1JECA 3IPRA 3O6VA 4FOOA 3EEFA 4CM9A 5JBIA 5BV8A 2LV8A 3IAS1 2CZCA 2QHXA 4C08A 1FTQA 4R1SA 4G23A 1HO3A 2M32A 3TZ6A 1QKJA 2P2ZA 4K46A 3U26A 3SGLA 2R87A 3QYFA 2I7CA 5EIBC 2W37A 4YRLA 1PX0A 1T0UA 1D2CA 2E7ZA 3A05A 3B6IA 3MGCA 1NF9A 1ZZGA 1AUVA 4PO9A 4IXDA 3FSGD 4J3NA 4IFTA 3E9EA 5DNUA 5KC9A 1ZR4A 2PRKA 4H18A 4BASA 4CM4A 1OH6A 3KR0A 3CUTA 4BCCA 1G8SA 2FMXA 4KQGA 4G0VA 3KRTA 3WL3A 1OWMA 3AC0A 1CQPA 4MUKA 3WQHA 3IIKA 5BT9A 1MMFB 3VJMA 1M34A 5JYDA 1N6PA 1X7ZB 3FPEA 2NWQA 2NN3C 1P2FA 2SECE 2ZITA 3L4BA 3LWZA 2AXEA 4MUNA 4D99A 7YASA 3VA7A 3RABA 5KNLA 1TTQB 3QE3A 4IIUA 2Q5JA 4RK5A 3G9TA 4X20A 4BKMA 2XVMA 4KR9A 2CGEA 3AUSA 1TA4A 1PT5A 3IULA 2AW5A 3NGLA 3I5AA 1TU3A 1MHTA 3D02A 3N2EA 5FOUA 4D97A 1I3MA 4BQEA 1W88B 2HIHA 4PRLA 3EQ7A 2Q6IA 3T41A 3LBHA 3IUEA 4MIOA 4HBZA 4HF7A 1QJCA 2HIMA 1OBCA 3GRYA 1WUYA 4LZAA 4DMUB 1WETA 5IHPA 2DKFA 4HPXB 2Z2ZA 4J1TC 4WOPA 2O14A 4KXQA 4Q1FA 2FP3A 4P7GA 2DUUA 1RFGE 1VB3A 1HETA 1GNRA 3RUDA 5KS2A 5KMGB 2E18A 1E5TA 1D2RA 4NMWA 1P4JA 1V8OA 4RLQA 4AZ3B 1XMJA 2Z2KA 3FFTA 1G3UA 4F8YA 5COQA 4BNDA 1GL7A 2GM5A 1WJGA 2HUPA 2IYAA 3JARB 4N82A 5IC6A 1B4DA 1SHUX 4IGAA 1BE6A 2HIGA 2M1XA 3R8CA 4PZLA 1EZ4A 4MR7B 5K0SA 1E0DA 1BMTA 5AK0A 4RPGA 1ZXLA 4P7BA 1KIMA 4F4UA 5EJGA 5CU7A 1U1FA 3CF4G 3E7DA 3TJMA 1PDOA 5DXAA 3V8BA 4AJ2A 5AOCA 821PA 2VDQB 3VDQA 4BLQA 2UUBB 3WQBA 2Q3EA 3RREA 2ZTSA 4B6SA 2IUUA 2PUCA 4EFKA 1JSXA 2GO7A 5CCEA 3M5WA 1VRWA 5KWEA 3N39C 4KQXA 3D6JA 4NFHA 2HMAA 4EHJA 1GPKA 1PAUA 5ESWA 5DW0A 5B5SA 5JJIA 4DYDA 2YV1A 3COPA 4GU5A 1PJSA 1J0XO 2VHEA 2VA9A 5FEMA 3IAM1 3RFTA 3A6DA 3P32A 4PE5B 4Y9DA 2HMYB 3ZJVA 4RSGA 1HNNA 4G5SA 1HY1A 2BGRA 4RY9A 1YTLA 2BDTA 4EJSA 4BB6A 1QPBA 3WO0A 4JEIA 4L4ZA 4KO4S 1M5RA 3UWPA 3H8WA 4YJ2A 2Q0SA 3ZK7A 2PR7A 1UC9A 4MYSA 4PX2A 1M5UA 3LQYA 4AP5A 4ED9A 1G7TA 5JI2E 1X1AA 2IL1A 4EY8A 1FYFA 2GK3A 5D00A 1YHZA 2Q9CA 3T38A 1GCAA 3ZWKA 5IDXA 5A6SB 1J7KA 3G89A 4DDVA 3D4BA 3I52A 2HRCA 3PEEA 5ENDA 2SNIE 3F5QA 2VDWA 4ZCPA 3WNQA 5IXSA 1W7AA 4E2XA 3E2MA 4WUTA 1GRCA 4PONA 2F55A 2DR2A 2AZDA 2ZBPA 1WY5A 3DR3A 4KKVA 5F52A 1OZFA 1JHMA 1NBOA 1TZMA 3ZY2A 1O6CA 4IO1A 3EULA 4YH1A 4P4NA 3RHTA 2ISCA 2QLJA 1JQJC 2PL1A 4G0UA 3P26A 1KQNA 2VBGA 4HWGA 4QODA 3TVTA 2EGHA 2GPSA 3TDMA 1H4QA 4KIFA 3PE6A 1VCHA 1FVOA 2HRBA 3WC4A 2PSHA 3MWJA 1Y81A 1J25A 1HQDA 2DC1A 2WSLA 4RXUA 5K8LA 1FP7A 4X71A 4W5JA 2HAEA 5CM9C 2JIOA 2WWIA 4EG4A 2X76A 5JAZA 4PINA 2O48X 2R4QA 1KZ6A 4EYQA 3DFUA 2IVFA 5KHAA 2IEAA 3QHAA 3ZC3A 4RYLA 2C9DA 1F12A 2OXIA 4AWXA 3P4UA 3ZGLA 3LE8A 1PQUA 4ZI7F 4IWYA 3VTKA 4NATA 1HSOA 2W4IA 3K0KA 3MJCA 3PNBA 4HAVA 5BR7A 3RW9A 3GVXA 3T0IA 1W6UA 4OXKA 4R7ZA 4I5GA 4TWRA 3HJAA 5C1OA 3LUPA 2J0VA 4RJKA 1ZSNA 3SIWA 3ZQJA 4CMKA 2OBXA 2ONKA 4QYXA 4OLFA 3BF8A 2ZWPA 2A9OA 3P9NA 3KB2A 2IHZA 5I7WA 4FSXA 4E5MA 3E7WA 1OW3B 2KS6A 3GFGA 4WCFC 1CRZA 4NV1A 1I7SB 4V0LA 3VZSA 4B43A 5K51A 1M1NA 4M3NA 3R74A 3BIXA 5A7FA 1P1HA 1SRQA 1RP7A 3OE5A 4PAOA 3REQB 2JA2A 3I37X 1TA9A 4Q3NA 2AC7A 2PAFA 4U7TB 2ZIAA 3R44A 2BZ0A 4CKYA 2GVDC 4M1MA 2DLNA 3HCPA 3HKDB 3L06A 1ZIYA 4HH4A 4IIJF 4ZYTA 2Z08A 1SKAA 2XGGA 3CJRA 3NIFB 1ZVMA 2W6OA 3M81A 4R8VA 3KQUA 1TIPA 3ONFA 5DTQA 2IGTA 4KXFB 1N5IA 2DPHA 2X8WA 3COYA 4QJ4A 1FQKA 4JU8A 2AC4A 2IX9A 5SY6A 2HN9A 3TG8A 3OAAD 3ECSA 3C6MA 4JOCA 3V8EA 4ZQIA 4C6TB 3PHCA 3H7IA 1L7NA 1ZJ5A 3HHPA 3ZTTA 1VKZA 4N8SA 1JG7A 2VA8A 4P58A 1D09A 1EFRA 1P6QA 1T13A 2I4LA 1GD1O 3DJFA 5EJ5A 4DARA 1Z6GA 1HDEA 5COBA 3VV2A 5HGJA 5D84A 3GG9A 5FI0B 3R6QA 3LFHA 1X94A 1EM8A 4YT8A 1IULA 2VYVD 1QK4A 1V16A 3SOPA 3ZJUA 3BEDA 5FR1A 3V1KA 1NAHA 1P7VA 1GKYA 2OECA 4V03A 4YXWD 3U61B 2ZUEA 3I05A 3E9ZA 4EI2A 3DZ8A 3UXMA 1B41A 4ZOEA 1YOBA 4JJGA 1TT7A 2UZ3A 4V24A 4O0MA 4DVJA 3WWCA 4PG4A 2J48A 1LB1B 1PIWA 3H4VA 2HJRA 5JMOA 1H9CA 1UMCA 3W6NA 4BFCA 1BCSB 1VBFA 2X75A 1NLUA 1ZRNA 2I99A 4N6GA 4ZK2A 5LXTB 2GZSA 2HMTA 4HSGA 4ENRA 2BJHA 1DE0A 3P97A 3A28A 1K9VF 4YVFA 3W8DA 3TJRA 4CBVA 5BWBA 2GXAA 4F7WA 2GETA 3WLOA 3KWJA 1XF1A 1RABA 4QPJC 3ZEAA 2FN8A 1R0RE 4JS0A 2N9UA 4NFYA 1DAOA 1R0ZA 2OBFA 4KG7A 5ALRA 1RXWA 2D28C 3VH3A 3NR2A 4FGKA 4L74A 3MC1A 2NSLA 1KP9A 3A9WA 3H5NA 3NYIA 5TPZA 3RAGA 421PA 4Q00A 1FZTA 4LRXA 3O8CA 3KZKA 3B3AA 4JKIA 1SOUA 4WZAA 4ZAZA 3BX1A 4BNYA 4IRUB 1PJTA 2YWRA 4JVSB 3R0QA 5HDQA 2O0JA 3KALA 2QQEA 4WY5A 5DASA 2EAUA 2OPHA 2DWUA 3FYUC 1XLTA 4ZCLA 3PI6A 4OLBA 2GRAA 2CHUA 3RTBA 4M6WB 2X4IA 4L8LA 3V6LA 1LNZA 4LC1A 1P3DA 3ESQA 2FPIA 3CLUC 1N4AA 3T7EA 1UBJS 4XFJA 5G0VA 3L1VA 2NADA 5HEKA 4Z7OB 4ZZ0A 5LQJA 1H4VB 4IGFA 3S2SA 3KXKA 1GUBA 1C9EA 1E2EA 3IUPA 3NOVA 2PPVA 3CO5A 2LCIA 3OCWA 3INNA 5THXA 4D9MA 5AVWA 5KWVA 3GOHA 3QQ5A 1WW8A 5H0IA 2NVUB 3R9IA 1L3BA 3MAAC 1QG6A 3WIOA 3BH7A 2UZ1B 1Z4OA 1I9GA 3P9XA 3SQDA 2IYSA 4DA7A 3NGXA 3JQDA 4OXIA 3DOEA 3FPCA 5FTLA 1T5BA 1N1DA 1S96A 4JJEA 1XXHA 3OWXA 4DB2A 1U99A 5BYKA 1VHQA 5CR9A 2C2OA 4ESVA 2QK4A 1R12A 4Y67A 2VHJA 4BLPA 3WRWA 1DTWA 1PJZA 4MVJF 1MEOA 1P7PA 1Y5NA 2ZSIA 4JJKA 1YZQA 3LKVA 4OHFA 5F3RA 3RT9A 3LPMA 3ZW7A 2YY5A 3F6RA 4PYIA 3PUZA 2OV4A 2QF7A 4KQIA 1PNRA 4TX1A 1QGZA 5FRDA 4ENVA 3G8YA 1LY1A 2SHKA 3GT7A 5K01A 4G86A 3VHXB 1TTHA 2IQIA 2JBWA 2XYQA 3A7DA 4UHKA 4DLXA 1XKLA 4L27A 4HLUC 4JL6A 4DSOA 1D9ZA 4HVLA 3E03A 1CRPA 4B7AA 1Q11A 1W0KD 2ADMA 2FW9A 2HJ9A 4PC2A 1NMQA 1DRVA 1M2VA 1DC8A 4HQ6A 3L4JA 4AMUA 4X44A 1HBJA 4FS3A 4XI9A 4C07A 1SH7A 3C7TA 2I87A 2EL9A 1C30B 2IIQA 2QG9A 4IIJA 3DV2A 1DTEA 1ZUIA 4BOYA 5I7SA 1PTJA 4EHDA 3GNTA 1X2EA 3ZDQA 4KXWA 3IKTA 2B4QA 5JPIA 1RQ2A 2ZEJA 4ND5A 1QZUA 2CLKB 3DB2A 4OXXA 4P2GA 4IIGA 3TLBA 5C1BA 3OA2A 3VC7A 2ZQZA 2DE0X 1E96A 3R9XB 3KJIA 2WNIA 3HY6A 1G38A 1MZPA 2EKBA 4MR8B 3FWPA 3V7YA 2ZIXB 3DHWC 1LBSA 4QOEA 2B1QA 3H6KA 2QJRA 2WVGA 1V1RB 2AN4A 4JZKA 4E70A 2WD7B 5K8UA 1VJCA 3V00A 3MQFA 4D4HA 2CYAA 4O59O 2VNSA 1OX6A 4LQ4A 4BBZA 3D7NA 1HQYE 1SOAA 3DD5A 4A2QA 3BF7A 2I22A 3QV2A 4M1SA 1JDVA 3R7AA 1GKLA 3P96A 4IDFA 2C96A 4P8RA 2EKLA 4O5AA 1XA3A 2KMLA 3FXAA 4R5MA 4BVJA 2JJMA 1ZM4A 4XWOA 3WNZA 4POOA 1GQSA 1ZD4A 4YAFA 2CL0X 3I2JA 3MWYW 1N2SA 2M6LA 1COZA 3JQBC 3VSDA 2C4KA 1GP2A 3T9CA 1C7RA 3E9QA 1M2OB 1WZUA 4QHYA 1DEOA 1N8KA 4ADLA 3HXTA 1OI3A 1GTZA 1OAAA 2CLHB 4AT1A 4J75A 2VSYA 2GS9A 2FLVA 3EVNA 3JSXA 1U2DC 4NARA 1G98A 4PRYA 2X8LA 1ANKA 3IV7A 1BMQA 4ZRMA 3ZCVA 4Y2YA 3KLPX 2JCBA 1XCLA 2YW2A 5A4KA 5IKOA 4FDUA 4P86A 2JLXA 2GPAA 4BNHA 1JHDA 1E1CB 4KSCA 2VTDA 3AIOA 4QPNA 4F9TA 4OB7A 4PFKA 2TRSB 2Q1SA 1IE3A 1OBVA 3D8SA 1I33A 2PH1A 3IP5A 3TO5A 3O73A 1GGEA 2BD0A 2Y27A 2YHBA 2NQ2C 3HSYA 3OE4A 5EINA 4XB1A 3LCVB 5HMMA 4A0SA 5HYVA 2Z1NA 4HV4A 2ZJZA 1R64A 2WU0A 4CPDA 1TADA 1T10A 1IB0A 4ZGBA 5SICE 3HGTA 2DSTA 2GBCA 3GDHA 3TI9A 4EVIA 2GZMA 1WEHA 2ISSD 2C5FA 2JVIA 4GOJA 3GOQA 4TMWA 1LK7A 3GBVA 4KV9A 2HPZA 2BEKA 1NM5C 1D03A 1CY8A 4XLLA 3QXGA 1M6HA 3JQQA 1TKAA 4LOAA 4UTPA 1V7ZA 2E82A 1ACMA 1Z5WA 3C6ZA 3SE0A 3UJNA 2CXNA 2SCUB 4NU8X 3VM6A 2PDAA 3AJEA 4NEHB 4QJBA 4K9DA 2VIIA 3BKWA 1QIDA 3E82A 3F5SA 3O9MA 3TTYA 3TLGA 2H51A 1N2ZA 1PR5A 4JLWA 2ZRAA 5BQPA 4DUGD 1QHHB 2XWQA 4PIMA 2YIDA 4F11A 3BB3A 3CS3A 5LLTA 4Y2VA 2PYDA 3AF2A 5J5VA 3VU9B 2HA5A 4P31A 4W9NC 3R7DA 1FE8A 1J2EA 3RSZA 5LNK6 3FHOA 3MTBA 2C7PA 4JT4A 1X9IA 5LBIA 3N86A 3U7HB 3FE2A 5AUQA 4KRYA 4PFSA 2ZSFA 1XPJA 2UVDA 3WGOA 3VR2D 1J1UA 1QQAA 1SXJB 1UZLA 3OZUA 3QBVA 3QW2A 3UB3A 3AO0B 2J59A 4KOAA 4E5DA 2AOUA 4UFOA 3AFHA 3JYNA 1D1PA 3ASZA 3OM1A 3RFXA 2IOFK 4ABTA 2MJLA 3UFXA 3D3WA 2Y1OA 1P9RA 5G2OA 1IOVA 3LLVA 1RCUA 4YECA 1XLWA 4HGRA 4H3SA 4ON9A 4LUCA 3ICOA 4MUHA 2FSVC 2CUKA 3FMPB 2J85A 3SKXA 3H2BA 2ILTA 1TJYA 1X42A 1ZJZA 4Q9NA 4P0QB 2FMTA 1KY4A 1XWOA 1R6DA 4AX4A 2AI2A 4IFEA 1JF8A 4KLAA 4R9RA 4DA8A 2ZUSA 3WGJA 4CM4B 4HOYA 3AZQA 4WDRA 1BGVA 4EG7A 2RARA 3TLAA 2EDAA 4X8HA 3PC3A 4MVXA 4TMXA 5AI5A 4YUWA 3SEQA 1XQ9A 2WEKA 3KAJA 4PTLA 4UHDA 3D1JA 1M34B 3OJCA 3FSRA 1N2IA 4C4PA 1SN7A 5ALYA 3RC9A 1XTRA 4BHTA 1RFLA 2HHLA 1RBQA 3AHEA 1ZDMA 4Q9AA 1C4OA 3AHIA 1UPXA 2BRUA 1IG3A 3MCAA 3CMMA 2BGMA 3DYIA 4X20B 3UATA 1GTVA 1RQRA 3ZG6A 3DC7A 3HRKA 3P45A 4M1EA 3C1UA 5SZKB 5E6RA 1K6IA 1NR1A 2EFYA 2XGSA 3KD2A 4IYJA 5EZYF 3C43A 1UBCA 4JWKA 4FM9A 2H9IA 1Z2DA 3J7AC 1ECLA 4G26A 4GZLA 4LHXA 4DREA 3W5AA 4BV3A 5TJHA 4URWR 2X0NA 4IY1A 4LOHA 3RSSA 1XTIA 4KYVA 3EBPA 2ZYHA 3F96A 5FR2A 3DEAA 3PR1A 1UK9A 1N32B 1H2YA 2WFZA 1K08A 3PWSA 2HRZA 1W47A 2X2PA 3AUXA 4ZT7A 3UAZA 1YRHA 3T1NA 1PHRA 4KQHA 4ASUA 2C58A 1K4YA 4BNDB 2NP6A 2D13A 2O4UX 4KO2S 1ECCA 4GM0A 2LIPA 2OZVA 2OO7A 4PY2A 3R5FA 4LXUA 5KNCA 1VL2A 2UVPA 1FDWA 5A5VA 3CLTD 3OQMA 2NZ8A 1KE1A 3KNZA 3OURA 3IJPA 2WZDA 1GAWA 1NW3A 1AUWA 1R3DA 3HUDA 4PC3A 5AVOA 3H9BA 1CQWA 3FCCA 3RLIA 3ZGZA 4P7FA 3ROXA 1QTRA 4CQMD 4X1YB 4H0CA 2JLVA 2OMKA 1KU6A 4IUYA 5JXIA 1JU4A 5JXWA 1U3GA 1ZI8A 4IINA 1R18A 3I58A 4HJXA 1C2YA 1ULAA 3PKJA 2E48A 3R2JA 5JCJA 3UB2A 5AT1A 5F1PA 2M6RA 3SJUA 2R2GA 5TPWB 3QX8A 1GL9B 4WCDA 1Y4UA 5FFNA 4KGZA 3T7AA 3NM5A 2J9GA 2UVQA 1XDSA 3KT3A 1NJSA 1ESZA 1RJ9B 1YOVB 2C8KA 2UUOA 3ABSB 2FV8A 2YXBA 4K6KA 1E1RA 3QEKA 4B5KA 5JS2A 3DF7A 1YZGA 3NC4A 3QLVC 5IBQA 3HWSA 4KAAA 4YJ2B 3U7IA 4CU5A 1TZCA 4B8ZA 1POXA 2OVFA 1JEOA 2QRVA 1XNHA 2V4UA 2C07A 3B52X 2V6FA 1NONA 4NLEA 2JD2A 2PMWB 3GPIA 4BU0A 2NO4A 3G2IA 4OGKA 3VSAA 1E3QA 1A8HA 4TTQA 1TPYA 2C97A 2K6GA 1B26A 4E4RA 4W8OA 4KTTE 5TARA 3N87A 3DXYA 5FTWA 4ZVOA 2VDWB 3R0XA 3GRCA 1G64A 4DSTA 5DYGA 4YMUA 5CHYA 1KVTA 2RFLA 5ILQA 1L5LA 1TNDA 1XBTA 3VHRA 1T9KA 1JFVA 3F1LA 1K8QA 2X2FA 4ZV9A 4DXAA 1BEZA 1U81A 4MOWA 5HQJA 5A4MS 2XODA 1WCXA 4GOKA 2O54A 4IDOA 1AKQA 1E9DA 2CLMB 2W6NA 3LCMA 4Z9AA 3AXSA 4W5QA 4REQA 4ADMA 1NZJA 3SR4A 4RY0A 1GTL1 1K62A 4JQSA 5DYTA 2FN4A 4HDSB 5CXSA 1RYBA 3SJ7A 1NQWA 4JUDX 1MGOA 2Q5EA 1HM5A 2R96A 5HRCA 3LKDA 3KFVA 1OAKA 1QFSA 1UBFA 2CF5A 4FYHA 2J09A 5BQOA 4F2DA 4JI2B 3TB6A 3RBZA 4AB1A 2HX1A 3A26A 3I6QA 4ZGGA 2OBNA 2W6IA 4X8OA 1G9TA 2YY7A 2V9ZA 3AHJA 5J9FA 4UPDA 2WU8A 4YROA 2M6KA 1O4WA 3AUJB 1UXHA 4KACA 2C03A 4UQLA 1TF2A 2VHCA 4NICA 5CFNA 1RZRD 5C3UA 1M9NA 1PHPA 1XJQA 3OSUA 1NG1A 3D2AA 3OP4A 4LGYA 2XWPA 1ORHA 2W0MA 3L0ZA 2NVOA 3LDUA 2C7BA 2X22A 4L4RA 3U62A 4EW3A 5LOVF 2VWHA 3IBSA 4OA8A 2O8BB 5HJEA 1Z4LA 1P4SA 1KIFA 4CMIA 1N4DA 2D7CA 1UT6A 3RB8A 2AB0A 4LYEA 5JC8A 4MVJP 1SU7A 4Y6RA 3TOXA 2CXUA 2AOWA 5LQRA 1GRNA 4NYMR 1M1NB 1P45A 3NBKA 4P3PA 2ZI5A 3KIPA 1VPLA 4N8EA 5F12A 3EG5A 2QVYX 5IC5A 4B5LA 2FG5A 2HXGA 1SEPA 2AJDA 1BX1A 2QQFA 4H1HA 4M87A 3RS2A 3SZ3A 2J6HA 3GAFA 4DWWA 4J6FA 1AV7A 4BQPA 5FB3A 1BJRE 1XD2A 3CRVA 3ETHA 2F3SA 3B5JA 1HDYA 3TIIA 3TNFA 3NYQA 1E92A 4X7BA 4Z4EA 4CJXA 1PVOA 4IVRA 1VKRA 3VSCA 4D02A 1S3SA 3AEYA 3B20A 4TT8A 2QGAB 5EGSA 2XUJA 4GOLD 2ZVJA 2BTEA 1DAIA 2AWNA 3NC0C 5J4YA 3CGGA 3AU8A 5CW2A 4E33A 2BFBB 5EZYA 3ESYA 1FSGA 1T5TA 5DJ5A 4UNNA 1YRAA 3B78A 1DAMA 3SYKA 3ZI4A 4A10A 1P7CA 2C5GA 3R0IA 3MT8A 3VPBA 2TYSB 3IUSA 3M6XA 2GZ3A 4BE7B 4F9GA 4ZCMA 2H1OA 1E2QA 1OKKD 5E2AA 1OQAA 5AP9A 2ACVA 1BD3A 4IOKA 4MQ5A 2J9YB 3EMVA 3ZGVA 2WU3A 3NYWA 5D6NA 5JEDA 2P90A 3VR4A 3SC6A 1EM8B 2GM4A 1SKQA 3GFVA 5LQSA 4YRSA 3AWDA 1SULA 3R41A 2H4WA 4MYHA 4FHCA 3NALA 4Q7EA 5K0ZA 1R5NA 3BMOA 3AGQA 4H3VA 3T5PA 1JTEA 1QOPB 3O92A 1HG1A 3W7BA 4DXDA 3HXKA 2NZJA 1WMFA 4ROSA 2F3UA 2EYUA 1DEHA 4CLDA 3NHFA 4Z1OA 2BGKA 4OK3A 1NWHA 2HL6A 4AO8A 4DLAA 1CDEA 1H2HA 5B6IA 2ZM6B 1OR8A 1RVDA 1SU6A 2OV2A 3L6DA 1XDUA 2A0UA 4N47A 1F6BA 5EJ7A 2V3CC 2YYAA 4D6XA 4RF4A 2G1AA 4GGOA 1P1BA 5FV4A 4FCWA 5B1HA 2C3PA 3GG2A 1W8IA 3SYLA 2PIAA 3CUYA 1EGAA 5AXDA 3ENWA 5KDOA 1OFTA 4Q9KA 2B98A 2I4NA 3EVFA 1JIUA 1XJCA 1N7HA 2ZZKA 1NLFA 1NUPA 3I2YX 1DIGA 2XV1A 4R98A 3JRNA 4WK0B 4ZV4A 1A7AA 2BMAA 3U3KA 3T5BA 1BVYF 2WJJA 4WFKA 3MTGA 4TQGA 2XZDA 3TUJC 1JNXX 1XA4A 4TRMA 4TYNA 4PBSA 1QRAA 3QWAA 4WZAB 1SFRA 3D7MA 3A4YA 3PT9A 3R4VA 1YVPA 3KXPA 5A2QA 4YACA 4LSZA 4FS8A 3EYWA 1DJNA 1JJIA 5LB2A 2BHNA 3VJLA 2BCGY 1NQUA 2WP0A 2UXCB 2FPIB 2RGRA 2K87A 4LCJA 3VVCA 5C51B 2WPDD 1ZD5A 4BNJA 1UKCA 1FBNA 4RDXA 1N2JA 1ZGHA 1T0JB 5J63A 5I6DA 1IFXA 3D4IA 2BMDA 1PW5A 3QMWA 2W4MA 3SOZA 3R5SA 1RPNA 4EELA 1GUFA 1HSZA 4R7GA 5LQDA 1WU8A 1OC2A 2ZUBA 2YZKA 3ET5A 5CFQA 1RRKA 5I7RA 1DQZA 2ZANA 3TQIA 5K05A 3K9HA 1MX9A 3CH4B 4MMZB 1KAGA 1T8WA 2DUNA 2JVKA 2QZSA 3LGSA 5DCWA 1A9YA 2DERA 2BEUA 1Z08A 3GRFA 3C7KA 3H4IA 1X15A 4FHGA 4GRIA 3ZCSA 2DEUA 4PHGA 4ENUA 4D98A 1U0SY 4WACA 2GZRA 4ZI7B 2IH5A 1DTWB 2JK0A 3E9CA 4EFMA 3IVXA 5I45A 4D4GA 1ZJ6A 4ZO9A 1FNSA 5K0JA 5JISA 4PVDA 8ADHA 1WRBA 5B4TA 3QMVA 3O4HA 2DPMA 1T1EA 2XT9A 3QP9A 2X0FA 2ZAIA 3QF4A 1SXJC 5LOVA 2EFGA 3HUUA 3DOCA 1PE0A 2WR8A 4AF8A 2O2CA 3PFIA 2PO5A 4MRPA 2JGJA 2ETVA 1IPFA 1DC4A 4J0GA 4P82A 5K0FA 2V7TA 4YRJA 2HSWA 4JT8A 1GV0A 4BXOB 1P29A 5T8KA 4MV0A 2WM2A 4AXXA 5GIOE 2UYYA 3Q6IA 5ELMA 1AGXA 1XEXA 4PLFA 1CUCA 3JD2A 1TYBE 2H11A 3NS7A 2EWVA 3FM9A 5F9MA 2C84A 1CQZA 5EGNA 1E7WA 3HZOA 4IMPA 1HH4A 1YGYA 2C5HA 3P20A 2VOJA 4Q3EA 2I3BA 2RIPA 1E2JA 4IIJB 1OHHD 1LWNA 2GAOA 4TT3A 1VKOA 3Q7QA 4M8KA 4YCDA 1Z4QA 1WL8A 1J0DA 4LV6A 3GU3A 1VMIA 4NHEA 1II0A 2FHPA 3NAZA 4Q24A 1Y6GA 2RHCA 3PC2A 2QN3A 4CI9A 3O2NA 5GONF 2QI9C 2R7MA 4A2WA 2YFHA 6LDHA 4WKOA 3MMNA 5THKA 4CF7A 1CS0A 2W58A 4NG4A 3L4BC 4YFYA 1N0HA 3GD5A 1GSOA 3SK0A 1ZLXA 3ZE9A 3HCOA 4MGIR 4FIZA 4OLHA 4HI0E 5F98A 2O8CA 1U7UA 4DV0B 1N2EA 3TTTA 4BZXA 3CE6A 1AS2A 3GPDG 2QT0A 2ZJ5A 4ALIA 3NT5A 2VP2A 3O4JA 3NWPA 1O0SA 2XA9A 2PX4A 1IXKA 3V2HA 4XQEA 2F67A 3K94A 4JFRA 1K89A 3M8KA 2Q27A 3NHPA 3MCUA 4BNZA 1M8PA 4ZDKA 1VJ1A 5AKEA 2QQGA 2DPLA 3AM1A 3AUYA 5ALFA 2QP4A 4FNAA 4UD2A 1MTZA 1ZCJA 5CFOA 1ZIOA 3AUKA 2OCDA 3M3DA 3SICE 1KKMA 3FPBA 4KVGA 3VKFA 4Q48A 5EE3A 3EIWA 1YU9A 2BT4A 5DVZA 1KYIA 4GH5A 4PC1A 2ZCUA 4HDKB 1EA7A 4B44A 3GGDA 4WXPA 3CZMA 4NRDA 5CLHA 5BV2P 1NBAA 1YB6A 2WF5A 4OG2A 2WWXA 4AWBA 4MB0A 1NI3A 1E6UA 3NVDA 1OREA 3SAJA 1SVWA 2BDUA 1OI4A 4PSVA 1ZNXA 2JCGA 3K5PA 1F38A 3WNBA 4UHJA 2O6LA 1ND5A 1W4CA 1HT2E 2EJWA 4FP9A 2Z3WA 1M2WA 2HDNB 2HA0A 3IQZA 4FYXA 3WYFA 1N1EA 4CLOB 1GHTA 3ET4A 4IXNA 4WVFA 1E1QD 4A73A 2ZR9A 1V3VA 4AECA 2I3ZA 1X8JA 2CV2A 1D3AA 3UV6A 4G09A 5JS7A 1P4AA 1U7ZA 2LRHA 4IIDA 2VPZA 5FPYA 1YD7A 2QUZA 4M0MA 3EX7C 3QVXA 2TMKA 1KJQA 4JXXA 3QYAA 4I5EA 1HPLA 5EUQB 3I0MA 1UC5B 3G5TA 4JVLA 4MVYA 4OO3A 5CLFA 5H8WA 3KB1A 4KL8S 4TVOA 1N8TA 1JAXA 3D31A 3OPQA 5A3QA 1YE8A 4R1PA 3MF4A 4EZIA 1Z35A 3CQ9A 1A9QA 5FCDA 1KAEA 3H75A 1VLQA 4C7OA 1H93A 1J2JA 4GWGA 4GMGA 2BGNA 1R9GA 3B8HA 3TLGB 4EUSA 4A5OA 1QB8A 4BKRA 2JI9A 3D43A 4Q3AA 2FPUA 4TOIA 4A2PA 1DT5A 2YZMA 3V33A 3BDVA 3MGGA 1P1CA 4E11A 3I6YA 4EB6A 2AFIB 3CPHA 1TJWA 3MTIA 3FNGA 1EAMA 4GBJA 4P5PA 3QPWA 2Q29A 2DMRA 2Q3DA 3E1KA 4PZZA 2RAPA 1TRHA 2V9CA 2B21A 5INTA 1EFVA 3M4XA 4MV6A 1LS1A 3FCOA 2AOUB 1G7RA 2YWGA 3AI3A 4JLAA 3FRJA 4LGCA 4Q66C 1PQWA 1PJAA 1ZMXA 8MHTA 5TT1A 1EMDA 3D3WB 2G1KA 1JU9A 1RZ3A 2ORIA 1WNFA 4GXTA 4EG3A 4B4VA 4F7DA 4I55F 1QCCA 2BZGA 4HXFB 2QX9A 2KW5A 2QMQA 4HN4B 3TPFA 5HJ5A 3AL3A 5HKKD 4C2AA 3Q6NA 2QLNA 4JUIA 2XMZA 3REFA 3SXJA 2HCJB 3M83A 4FOPA 4UU0A 5HK9A 3KD3A 4YIHA 1RXVA 1G8GA 4FYKA 2Q5LA 4UNPA 4INJA 4XLZA 1W73A 3TSOA 4FTWA 2ON6A 2QG6A 4NV0A 5LUAA 1K5PA 1WSAA 4G1BA 2PV7A 3EIHA 1BDBA 1IN4A 2GN9A 4UZEA 2B8JA 5KTRA 5D86A 1IC6A 1KI6A 4HH0A 2FE4A 2W2MA 3PQDA 2AJTA 3KXLA 1WXEA 1LBTA 2RHLA 5E6SB 2D1YA 1CQIB 4PU0A 4M7OA 2OAEA 4LBVA 1BVRA 1HQKA 4YMTA 4TZTA 5ESDA 1TEXA 2NO9A 1E6MA 4NCIA 3GHYA 2Q1XA 2VT6A 4PZPA 4RKFA 4M9ZA 1PFKA 3FVRA 2HC9A 2IDMA 4NYIR 5E6RB 1AB6A 4BRZA 1C0EA 2ZQ5A 4ZQCB 3WI7A 3I9V1 3WVNA 2AF4C 2WJYA 2ZYUX 1XL1A 4WN9A 4DMRA 3Q11A 4QQFA 5J43A 3U6BA 1DMRA 4TQAA 2NP7A 4TVSA 2OHOA 3TAUA 2PKQO 1VYHA 3O9ZA 4UM5A 2J3IA 2P35A 4ZXFA 1QGUA 2AWOA 1L7BA 2W2KA 2WJAA 5ITWA 4MW9A 5EN4A 1P1IA 3N28A 1PWZA 3DDOA 4YWHA 2INGX 3I2KA 1UANA 4GUAA 4NONA 5F92A 1JFFA 3FVVA 1D9XA 4YRKA 1CEQA 1H22A 4NH4A 4HQRA 1RJFA 1KF0A 3WLSA 2EHDA 2AYYA 1ADCA 2BHSA 3AFGA 2GCNA 2KB0A 1WXFA 2GR9A 2GYWA 3LP6A 1KI3A 3NBMA 4GE3A 1UOOA 3WGQA 3HU2A 5JZ9A 1Z4NA 3SHQA 5FOQA 2FZGA 4GRAA 3LQRA 1T6ZA 1P33A 3NH9A 4UATA 2XEXA 5KAPA 2IJGX 2QSYA 5DNYB 2F9MA 3GPCA 1XZAA 3QITA 5CB4A 2ZT7A 1JT9A 4ODIA 4HEQA 4YAJA 5ALLA 4K26A 3ZQKA 1DKQA 3ZDBA 1NBIA 4TL7A 3ZE6A 1Q6ZA 5DWVA 3H2JA 4B32A 4DLPA 3GGGA 3QBJA 1UBMS 4PYQA 2P9EA 3NUQA 4YASA 4MB6A 4F12A 4MAFA 3LW7A 5HUQA 4INZA 1E79D 3UJ7A 2Y77A 2C20A 1EG7A 2REOA 5HMLA 5I5GA 2VH2A 3ZIAD 5HZKA 1VSVA 3IKMB 4GVLA 2JEOA 2GD1O 1TK3A 2QRVB 5HR5A 2O8EA 5CVUA 3SCZA 4PR3A 3D8UA 1UOPA 1XZ8A 2DFDA 3H5RA 3NRBA 3WQSB 2IFTA 2XT0A 3FSEA 1L5ZA 5F2NA 3C3YA 3ZH2A 1XYGA 5AJHA 5DI3A 1ECBA 3URKA 2MYUA 3A9UA 4RJLA 5IJZA 1R74A 1XROA 1WW2A 1CC1S 1PUIA 3CUVA 1SK9A 3PFBA 2I80A 3USZA 5B37A 3GZHA 3D6MA 2UDPA 3B6EA 1RW4A 1HTBA 3C24A 3ODGA 1N6KA 4PYJA 4CM8A 2VYQA 1GQ2A 1CNMA 5G02A 4AY4A 3OCUA 2D3WA 1JG6A 3T4EA 4YJFA 3W1WA 4REQB 5F91A 1QIJA 2O8NA 3PGJA 2IPXA 4UM9D 4Y9SA 2ERXA 4D92A 2DB3A 5K4HA 4KAFA 3BMCA 2ZSEA 1B73A 4BWYA 4KKXB 5IUNC 2OFXA 1KI2A 2B83A 4RF3A 3WRYA 1L8QA 1NVVQ 3BK2A 3PC7A 4R8RA 3G7SA 4XVRA 2WMYA 3OCXA 4H16A 3L6OO 2BGGA 1IVYA 4ISBA 5EJMA 3E70C 3JV7A 1DOAA 1U04A 1GNVA 2BH2A 3SJBA 4BEJA 3IP3A 2WMOB 3HA3A 3FPLA 4DN6A 3A2KA 2JKVA 1CEYA 4FYIA 2IRWA 4I55A 2OKCA 4YNBA 1BDIA 1K7WA 4L8YA 1I3KA 2QR5A 4LDRA 1L8LA 4A0HA 3O3CA 3CV3A 2NTVA 1M6WA 3ORRA 1YS1X 1U0TA 4FGWA 4MEBA 4RGYA 3ZTWA 2MYTA 4F04A 4ZPJA 2Q6KA 3W4KA 1C3OA 2BOVA 1XLVA 2ZKIA 1FP1D 1GTMA 2P1ZA 1DBQA 2PLWA 4JBLA 5AESA 4WW0A 3LHDA 1E3SA 4MIEA 4QA9A 4EA7A 4ZVRA 2QBYA 2HCTA 2NXCA 3LMKA 1X1BA 4OXQA 4BMDA 1DKLA 2OFOA 1QO0A 5C1PA 4AUMA 1S8NA 1SKUA 1U8XX 5CYFA 1DT3A 1XD2B 5C8YF 4IEEA 4DG9A 2BFEA 3BD7A 4O08A 4OFWA 4G5GA 5K3DA 3DL0A 3X43A 4ZODA 2D0IA 3BFKA 4LS3A 2O3SA 4CKXA 3OLWA 3AUFA 4R41A 3OQPA 4UUPA 2OXFA 1R9NA 1DX6A 2A33A 1E9AA 4D6YA 3I30X 4NJMB 3RC3A 4H3KB 5EZYB 1T1SA 2A9JA 2YY6A 3DTYA 1RQGA 5EZ5A 4DIUA 3R8FA 1IBSA 2FWIA 4TLLB 1E1KA 2GEBA 1KVSA 5EE1A 5IJXA 2JFQA 1SXHA 2GVNA 5ELXA 2E9FA 3JWIA 4CV0A 1AU9A 1RWQA 2Z4RA 3KJXA 3T54A 1RWXA 2RJNA 4M7PA 2PH5A 2G9RA 2VDVE 1V5IA 3SBXA 1H5QA 1GG8A 1D4OA 4MKFA 1IJFA 1GNSA 1ST2A 4OUKX 5IVIA 3EIQA 5JSYA 3DE0X 3RS8A 3RS0A 1DAFA 2OL4A 3ACBA 3D6FA 5IBPA 1NYRA 4MUIA 3PCTA 1WY7A 2NLOA 3C85A 3B1YA 3I2FA 1VCOA 1D2HA 3HNOA 4LHZA 1FS5A 5DXFA 4ZV7A 3RFCA 2W6MA 3ZY6A 2TSYB 3BMOB 1Y7PA 5K8VA 3BZWA 2REBA 1U5AA 3KT6A 5DIFA 3RODA 3WYCA 1A5SB 2ID9A 1GTG1 3G1TA 3RJ5A 3L8GA 1JBEA 1H2AS 5IVDA 2IEZA 4RA6A 3TPZA 3A1NA 4MQLA 5FUVA 1SWWA 2DWQA 2PT5A 4Q34A 5I51A 4U3JA 1E99A 1NNUA 4K40A 3N2GA 3KQLA 4MQBA 4YTEA 1JVSA 4HRVA 1UDRA 2JVJA 2ZRJA 4MI9A 5CTAA 1ZI6A 2EQBA 5HS4A 3JQFA 4EAAA 4EEZA 4UE2A 5BQXA 3Q8LA 1TQ8A 3ADCA 3LUCA 4GOND 3SQXA 4GT1A 4ENQA 5KAMA 5M7EA 2AMLA 1W96A 2C7GA 3ROFA 4QICA 3TUIC 3ED5A 1LBEA 1OI7A 1H0RA 3D7LA 4G0XA 2JAWA 4JYPA 4K9RA 2WW8A 3DAFA 5AOAA 5BUCA 3QPAA 3HUFA 1KMHA 3AHGA 1N9GA 2BSAA 2IYTA 2PT7A 2VP6A 4R2WA 4YAGA 1RCTE 2C82A 4XM2A 5LA6F 2X5JO 4JOQA 1DVRA 1U9IC 3TVYA 1KARA 3GX1A 1GPH1 4LXQA 4DR7B 5C4IA 1E7SA 5CFPA 1RQPA 4PQFA 4B4KA 3TSWA 3N76A 4NBSA 1NF8A 1F17A 5BXYA 1CBUA 2P9HA 5PNTA 3RVKA 4DA6A 1XZGA 2DPGA 2J3DA 1G8JA 4RMIA 3CISA 3R6TA 4BNKA 4HAYA 5EJFA 2YDXA 2IKSA 1RXEA 4GSLA 4RVNA 1FYDA 1ZU5A 4DPKA 1YC5A 2DOKA 5AXAA 1NSYA 2O4CA 2XMSA 3TNLA 2P79A 2FW0A 1WXWA 1LQ2A 3TTWA 1PGQA 1X1RA 1QO7A 3PE3A 1YE5A 1RWKA 4Q7LA 1Z07A 5J5AA 3TLXA 4CDGA 3RVJA 4EJ6A 3EAFA 2XITA 3TTVA 4EFNA 1YE3A 1E6WA 1ZRMA 3VPHA 4GXRA 4ZCSA 2NGRA 4BFYA 1PJLA 4CT4B 3EWNA 3RD8A 3M5CA 3EGCA 1ULUA 1KEEA 1CZUA 2P11A 1TO6A 2BEUB 2ZSJA 4I4NA 4NK4A 5J2TF 5L3SA 4L5CA 5L3VA 2HT1A 1CT9A 1YHYA 1FP6A 2DHQA 2ID8A 1B42A 2QNRA 1OYYA 2XMGA 5AVZA 4RFLA 2OCXA 5DCUA 2CY0A 4EPWA 1XZKA 3O75A 2OFFA 3RGGA 4HXEB 4DV3B 4L3OA 4YJHA 2ID4A 1W44A 5A3VA 2VQ6A 5ALSA 4K6CA 4DR4B 1JQLB 2EP5A 4GI2A 3B13B 3QF4B 2QM8A 3B53X 3KJFA 4RHFA 2IQ5A 3I0NA 4HLCA 2W6QA 4ITVA 4OMCA 5LOVB 4U02A 1E3DA 2AN9A 2FF5A 5AKLA 3U7QA 1KEKA 2VT7A 1Y8AA 3KWMA 4Q1DA 3K0SA 3ZD8A 1M2FA 2JI6A 2R8EA 3NV9A 3OLCX 4MS1B 5EJ6A 2FUSA 2LR0A 4C4AA 4XB2A 1N8SA 1QK5A 1GLNA 2HXYA 4OBBA 1YDWA 3L7BA 4TXMA 1XEXB 3P4XA 4BNWA 2HK8A 2WWGA 1TUBA