2JAOA

Crystal structure of d12n variant of mouse cytosolic 5'(3')- deoxyribonucleotidase (cdn) in complex with deoxyguanosine 5'- monophosphate
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
196
structure length
196
Chain Sequence
KRPVRVLVNMDGVLADFESGLLQGFRRRFPEEPHVPLEQRRGFLANEQYGALRPDLAEKVASVYESPGFFLNLEPIPGALDALREMNDMKDTEVFICTTPLLKYDHCVGEKYRWVEQNLGPEFVERIILTRDKTVVMGDLLIDDKDNIQGLEETPSWEHILFTCCHNQHLALPPTRRRLLSWSDNWRGIIESKRAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of Human and Murine Deoxyribonucleotidases: Insights Into Recognition of Substrates and Nucleotide Analogues.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
molecule keywords 5'(3')-DEOXYRIBONUCLEOTIDASE
total genus 72
structure length 196
sequence length 196
ec nomenclature ec 3.1.3.-:
pdb deposition date 2006-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06941 NT5C 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.40 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Deoxyribonucleotidase; domain 2 2jaoA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2jaoA01
2BDEA 3NRJA 1ZD3A 5ALGA 2JARA 1YNSA 2RARA 2D2VA 3KZXA 4C4RA 5ALHA 3L0CA 3J7TA 1U7OA 4EEKA 1ZJJA 2YMLA 4Y2UA 1WR8A 5AW0A 2WF7A 3UM9A 4NFLA 2AMYA 2CN1A 2IOFA 2GHQA 2YN4A 2RAVA 1WZCA 3AR2A 3MPOA 2G80A 3QYPA 5AM1A 4QQFA 1RQLA 4ZEWA 1SU4A 2ZG6A 2C9MA 4J03A 5AI4A 1Z4LA 3ZUPA 3U13A 1K1EA 2HI0A 2OBBA 5AVZA 3WGUA 1Y8AA 2YMPA 2WF5A 2ZBDA 2G07A 1QQ6A 2WF8A 4PNHA 4MWOA 1IWOA 2R8ZA 1Z4PX 2MU1A 4CF4A 1PW5A 4BYGA 5AW8A 3NUQA 4KN8A 3KDPA 1T5SA 1N9KA 5AW3A 1ZS9A 2O9JA 4NV0A 4YIKA 3KC2A 3L0BA 3SD7A 2Q5EA 2I33A 3DDHA 3EF1A 3N8GA 3FM9A 2ZBEA 3I6BA 4KNVA 4Y2RA 3PGLA 5AVYA 3A1EA 5AW6A 2GHTA 2JAOA 4H1WA 2FPWA 1T9ZA 1NF2A 4YCLA 2QLTA 4O8CA 4BX3A 3OCWA 1YMQA 1QQ5A 4UU1A 4HGPA 2G0AA 2Q4RA 1S2OA 4J2TA 4BEVA 5AW4A 4L57A 2NO5A 5AVTA 1RKUA 5A3QA 5AKYA 3W5DA 5ALWA 2PQ0A 5T41A 5AKJA 5AI6A 3AR7A 3NALA 2R8XA 3DV9A 5ALDA 2JAUA 5AKIA 4UU0A 2HEGA 3A1CA 3FZQA 4HGNA 3KOOA 2IA5A 5ALNA 1YJ5A 4XQ0A 2PKEA 3GYGA 2I34A 2YMQA 5AKXA 5AI9A 1Z4IA 2WFAA 4KX5A 5AM0A 3OCVA 3SKXA 3OPXA 3U7EB 2YMMA 1VJ5A 5ALOA 4G63A 2EARA 3M9LA 3IJ5A 3EPRA 3E81A 3NAMA 1L8OA 1RPZA 1YDFA 1RKQA 3WKBA 1SWVA 4DCCA 2I7DA 1Z4OA 5ALSA 1J97A 2JGAA 3U7HB 3L8FA 5AKHA 2GO7A 3SKYA 2QYHA 1L7PA 4MUMA 2PR7A 4YIHA 3NASA 3QXGA 1Z5UA 5AVUA 3B8EA 4F72A 3OCUA 5AK5A 3OTQA 4CE6A 1Z4QA 5AW9A 2X4DA 3ED5A 1U2SA 1XP5A 4Y2YA 5ALRA 3L8EA 3A3YA 4Y2QA 5ALXA 4HGOA 3SHQA 3AR3A 2AUTA 2YJ5A 3I76A 4E88A 3OCYA 1L7NA 5AIBA 2W43A 1EK2A 1YS9A 2P11A 4F71A 1MH9A 4IFTA 3QU2A 2B1RA 3R9KA 1ZRMA 3ZWKA 1RMQA 2NYVA 3E58A 4KYTA 2RB5A 2FUEA 3R09A 4UAUA 2GFHA 2HHLA 1ZRNA 5FP0A 4EENA 3QUTA 3QU7A 1Z88A 1WPGA 4OD0A 1QQ7A 5AKGA 2IOHA 4YH1A 1VJRA 2WF9A 3WKAA 3WKCA 2ODAA 4BBJA 5AVRA 2YBDA 3ESRA 3UMBA 5AW2A 4CF3A 5AKLA 2EAUA 1RDFA 1ZOLA 5ALPA 5AK3A 5AVXA 2O2XA 4UAVA 3SMVA 3HYCA 2HF7A 2ZBFA 4RETA 4BKMA 3L7YA 4FFDA 4I9GA 5AI0A 1RLOA 4Y2JA 1RC8A 1LVHA 5IT0A 3ONNA 3S6JA 2I6XA 3QNMA 2P9JA 3WK6A 1QYIA 3AR9A 3OCXA 4HAIA 2P69A 3ZI4A 1SWWA 2C4NA 3E8MA 2FPRA 1ZD5A 3WK5A 1AQ6A 4GXTA 4OCZA 3BA6A 4UW9A 1TJ4A 4C4SA 4EX7A 4HGRA 5AESA 1XPJA 2ZBGA 3L8GA 3QLEA 1NRWA 4EX6A 3K1ZA 5AM5A 3ZW7A 4B6JA 3MMZA 5E0OA 2BDUA 2B8JA 1Z4KA 3WGVA 2OYCA 1RMTA 2HSZA 4NAVA 4UM7A 3FVVA 2B82A 3KD3A 3QUQA 1XVIA 5ALQA 3BWVA 4GIBA 5A3SA 1Z5GA 2FPUA 4UM5A 5AW5A 1YV9A 2JAWA 4OFZA 5AW7A 3ZVNA 2I55A 3IRUA 2WM8A 3ZU6A 1J8DA 3L5KA 3MC1A 3E84A 5AVSA 5AVQA 3ET5A 5ALKA 5ALZA 2IOFK 4BX0A 4QJBA 1S8OA 2WF6A 3AR8A 3ZWDA 3ZX5A 3MN1A 1L8LA 5AK4A 3AR5A 3AR6A 5ALIA 2C8LA 2C88A 5AVVA 5AICA 3WK7A 1T5TA 1Q92A 2YJ6A 1O03A 4DFDA 4YCNA 5JJBA 3P96A 2HDOA 2DQSA 3B9RA 4ZEXA 3ZX4A 3ZVLA 4UMFA 4XOUA 2B30A 2MSNA 1VFPA 2FEAA 2YJ3A 3QU4A 2CFTA 1EK1A 2HO4A 1TE2A 1ZD4A 4C4TA 2G08A 1LTQA 4FYPA 4HYTA 1Q91A 3OCZA 4L6CA 5ALFA 1TJ3A 3B9BA 4UMVA 3EF0A 2AGVA 3QGMA 3FGOA 3I28A 2W11A 3WK8A 3RF6A 5ALEA 3ZTWA 4KX3A 3N1UA 3UMCA 1RKVA 1U2TA 3AR4A 3NANA 3PDWA 4UARA 1U7PA 3VAYA 2G1AA 3I1YA 4AS3A 3W5AA 4BX2A 2P27A 3L0YA 3QX7A 4Y2SA 5AKKA 4UATA 1CQZA 4KNWA 1TA0A 4UMDA 4NABA 3RFUA 4YCMA 3W5CA 1L6RA 1ZD2P 3FPSA 4JB3A 3U7GA 4Y2VA 1FEZA 4Y2TA 4AS2A 2EATA 1U02A 3DAOA 4XE5A 2ZOSA 2B0CA 3SF0A 2OM6A 3N07A 3M1YA 3UMGA 2G09A 3HLTA 4YGYA 3KBBA 3TLMA 5AW1A 1RMYA 4EZEA 3SLRA 3R4CA 4DW8A 2WHEA 2B8EA 4BNDA 2Q4TA 2CFRA 2VKQA 4BEWA 2HX1A 4Y2PA 3WKDA 5ALMA 3U19A 5ALUA 5ALJA 1O08A 2FPXA 2CFSA 4L6AA 3L1UA 1TJ5A 2ZXEA 5AVWA 5IT4A 3U7FB 1RRCA 3WK4A 4CF5A 5ALTA 3IB6A 2OA0A 3QU5A 5AM4A 1RLTA 3CNHA 3L8HA 2W4MA 4IG4A 5AM3A 2HCFA 4BNDB 5IS2A 3ZVMA 3DNPA 3QU9A 5AKZA 4G9BA 4FE3A 2R8EA 2AH5A 3W5BA 4XPZA 2YY6A 5AIAA 3EWIA 4EELA 5ALVA 3ET4A 5AHXA 1JUDA 4Y2XA 1WVIA 2BY4A 1L7MA 4Y3UA 3D6JA 4CNQA 2FPSA 3F9RA 5AM2A 1CR6A 5ALLA 2FUCA 2IYEA 1F5SA 4I9FA 2G06A 1Z4NA 1RLMA 2FDRA 2GMWA 3FPBA 2NO4A 4HGQA 1L7OA 4UMEA 3WKEA 2R8YA 3ZTYA 2I54A 3A1DA 3PCTA 4DWOA 2HF2A 2YFYA 2RBKA 4UASA 5AI8A 1QH9A 4AP9A 3L1VA 2B1QA 5AKEA 5ALYA 3QUBA 4ZEVA 3WK9A 1KYTA 3ESQA 2C8KA 1N8NA 3QUCA 3CZ4A 3N5KA 1Z4JA 1X42A 1NNLA 2HOQA 1RQNA 2YJ4A 4JDPA 3N28A 5A3RA 4RESA 1Z4MA 4NWIA 5AI5A 2FI1A 3U26A 5AK6A 3PGVA 3NIWA 4OHFA
chains in the Genus database with same CATH superfamily
2BDEA 1ZD3A 5DI3A 5K8JB 2GN8A 1O97C 1U0RA 4C7OB 4JOSA 1L7AA 4DJTA 4PZUA 3OE4A 1JG1A 4HJRA 2IYUA 2JCBA 4J8PA 2FW7A 3V2IA 1JEYA 1C80A 5FEMA 2WTMA 2G4VA 1X8XA 1DIHA 3ESYA 5BSTA 2OBLA 1DJNA 2QMQA 4FM9A 1GIAA 3H5IA 2X7XA 3R41A 2KSQA 2WDZA 5LB4A 2ZE8A 2V7QD 4EATA 1W8DA 1IWBB 1SNYA 2CNWD 2RC5A 5L3RA 5IAAA 4U7TB 4Y9RA 3WS7A 3AHJA 2DM6A 3CNQS 3D2LA 1HBJA 1ZN2A 2YN4A 1ACJA 2R1UA 4I50F 4XM0A 1X92A 4A9AA 4DEVA 4HVCA 4LRUA 5IARA 4AZ3A 2WWFA 1QDEA 1QX4A 1VI5A 2X2FA 3NT2A 2G9QA 4W7SA 5CR9A 3CLSC 8ABPA 1RQLA 4ZEWA 3VUFA 1ZU4A 2BV3A 3KKMA 3M89A 4MPPA 5CCEA 5H83A 2WNHA 2X1HA 2CB0A 2BZSA 4L15A 1V3UA 4IF6A 4KDCA 2GB4A 3QPBA 1KWGA 5AQ1A 2QV0A 1UQUA 2O1WA 3GARA 3BEOA 5CURA 4CM8B 3HCWA 2W42A 1AUWA 3BXOA 3RUCA 1FL9A 1W0JD 4V0NA 3ICOA 4A82A 1XTPA 3S7ZA 4PICA 4X7MA 3Q15C 2MU1A 1UPBA 4L1KA 1ZW1A 2XLBA 3F3YA 4JXJA 4BYGA 3JV7A 1TUGA 3RS7A 1USGA 3KDPA 4KFCA 1Y8ZA 6GPBA 2BCEA 5B53A 4IQFA 1T5SA 4ZALA 4LF7B 2ZUFA 2Z2XA 5BR7A 3QXJA 3D8SA 3HU5A 1NW7A 1OU4A 4YIKA 2B2NA 4NZNA 5FL7A 1HORA 2GN1A 5EUQB 4C0LA 4PYJA 3O4HA 5CJJA 5KJ6A 5E2AA 3QIAA 5EEHA 3J81A 2JNWA 2R5FA 5HF6A 3NYQA 1JSXA 1VE9A 2OKCA 2ZBEA 5SZIA 1KU0A 2Y1KA 4NU6A 1IAVA 1ZJYA 3E23A 3AONB 2IYWA 3KSMA 1JHYA 1RRKA 5PNTA 3VAAA 1XQ1A 5KU1A 2DP4E 2NPOA 3AG6A 3A9VA 4RSHA 4G0NA 2DX7A 2LCIA 2MINB 3PQEA 3HBNA 2A4MA 2VJOA 2Z57A 4ZDJA 4WWHA 1L3BA 1NSFA 2ERYA 4PRZA 3UG6A 4RXMA 4EVRA 1ISPA 1IRIA 3NW9A 4HGPA 5ECDA 3H2JA 4BVAA 1EWKA 4C01A 1ST2A 2E4AA 3GH3A 3A7DA 4NLLA 4N5LA 4P5PA 3RC2A 1LS1A 3C8UA 2ZJ8A 3JYHA 5IEBA 4ZYZA 5KYKA 3UGJA 1WP9A 2PH7A 4X54A 1E1LA 3SBEA 1NRXA 2VRBA 4A2QA 4P0TA 3L7JA 4JA2A 3VKGA 5TPWB 3RC9A 4AKEA 2VWQA 2E82A 3W4KA 1MJHA 3M9WA 4FVTA 2PUJA 3CX8A 1Q77A 4V38A 5DHQA 4V0LA 1FW8A 5ER9A 1XMVA 4PCUA 4ENUA 1G2IA 1LLUA 4FQ5A 4HS9A 4Q9IA 4QASA 3O0TA 4U8GA 4K88A 5T4HA 1ENPA 3ZDXB 3K32A 1V1RB 3ZKWA 4I4TA 4Q3CA 1HK7A 2OBYA 1YR7A 3HE3A 4FUTA 1I14A 5AOVA 3UQYS 1ZH8A 3P9YA 1JFVA 5E3JA 4R9SA 3DOHA 2A9KA 4ABTA 3KLNA 3ONEA 5ADVA 2Q2OA 5B4VA 1A1SA 4NX2A 1BFKA 1NBME 1VGVA 4DJAA 1P5RA 4LHYA 3D3WA 1L0BA 1NVWQ 1GZ5A 4QIHA 2PUFA 2ZKIA 3I53A 3S1AB 3SEFA 1Q14A 3L7OA 3Q6IA 4JBIA 2FVYA 3WAJA 3GUUA 4E94A 3T7IA 1GZSA 1U9YA 3VI4B 3QK7A 4E1AA 7REQB 2QX8A 1U1FA 3U81A 5AKHA 4UOQA 3SM3A 4YJ3A 1T8YA 3SOZA 3AJEA 4EFCA 2ZRQA 2RC6A 1XZLA 1T6YA 2VYND 1YDGA 4TXNA 5KNBD 1US8A 3TSAA 4UHJA 3SXUA 1XQYA 5AK5A 4ZCQA 1NVGA 1FDIA 4K9PA 5EJ9A 1T43A 4NZOA 1MMFB 3RC7A 5U1PA 2LDBA 1Q20A 2Q99A 3KQTA 3KXPA 2QROA 3GUHA 2BPOA 4JVNA 2IYTA 1SH7A 4ZT6A 1SJ9A 4PPGA 3T7KA 4QVIA 4KHPB 2QMUA 1W1UA 1L5VA 3MCWA 5KWVA 2JGLA 3O4VA 4DV6B 9MHTA 1B8VA 5CBKA 3I9JA 1XD2B 1E3WA 3EG5A 5K4AA 1Y5IA 2RAPA 3H16A 3PJDA 1NVUQ 3E35A 2JJ2A 5JMOA 1R0XA 3Q2IA 2RHGB 4HNGA 4TUYB 1OA1A 1ZYUA 3NEAA 5G02A 2IYSA 3I23A 1PZFA 2B1RA 2GXUA 1EA7A 5GZ3A 2XYQA 1YACA 3EULA 1FSFA 4KQ9A 4P5DA 4DQ0A 4QTUB 4I19A 3CN7A 4TS1A 3T4EA 1WU7A 2Q0QA 3G49A 2CNNA 5CVUA 4KMOA 2H1VA 4LY0A 3RJTA 1H1LB 3GPBA 4G4JA 3CTPA 4R2IA 2A35A 3P9XA 4TYMA 1W36C 2QX6A 3MCVA 2ACKA 4JR1A 4GR5A 3WAKA 3KZOA 1XROA 2OQVA 4B8YA 4PG8A 2B4YA 5ESRA 1BDJA 1DAEA 2IYZA 3KTFA 3JR3A 4FGKA 2WSYB 1YJCA 4BO0A 2XBUA 1RR6A 2IWRA 2XGOA 2AD1A 1OUMA 1WHSA 4GZ6A 4ER6A 1BS1A 1TU4A 2Z8YM 1MOZA 1PT8A 3CVYA 2Z43A 3L6EA 1ISSA 3HYSA 4LC9A 2G76A 3D6HA 3BUSA 1PR6A 4B3JA 4Y1EA 3DW3X 2VZ8A 3LCCA 4GUDA 2PYZA 1QO9A 3NOQA 4JGIA 3OFND 4TL7A 4EKIA 4FFDA 1WW8A 3GVPA 3GLFE 2H4ZA 5AI0A 3L01A 4ID3A 4OGLA 4R9UC 4HWGA 2IY8A 4WUTA 4JL6A 1CP2A 2WD9A 4K8OA 2FG5A 4MUGA 4OMCA 4CKXA 4JYCA 3WWPA 3WOHA 3U40A 3W5HA 4AQYB 1OPRA 1H22A 2LKCA 3U48A 3ZE6A 2HGZA 5HKOA 3HS3A 2PSFA 3N8NA 1SBCA 4CN8A 2PPVA 1L6IA 1U0SY 3DAFA 4P7FA 1XB2A 1P77A 3F98A 4ECAA 3DEAA 2DLCX 3ZHVA 1TQ2A 3WRXA 3ZVKA 5FTJA 4TYYA 4UVIA 4HB3A 1X80A 1CFJA 2J0SA 1WBJB 2EQ5A 3PE4A 2XRZA 1A9PA 3HJUA 4PYMA 3G1WA 1U80A 2VF7A 5B6IA 2YKGA 4XWWA 4F56A 2BFPA 2FSSA 4GECA 2FX2A 4QOIA 3D1VA 2VJMA 1KEPA 2FYTA 2HPAA 1MPXA 1A8HA 1JMKC 4JGBA 3AFGA 5KZMB 3OWHA 3THOA 1P9NA 5ITZA 4MHTA 1T9HA 2WVHA 1GTMA 4Y98A 5H7XA 4DMKA 2BJWA 3C1UA 2FEKA 5M29A 3ABRB 5L6LB 2B8JA 1XQ6A 2H1OA 1V4BA 3SICE 5K20A 4IXNA 2NV0A 1X9HA 5HPYB 4G1EB 1ONBA 1XC7A 1LU9A 4RHXA 2X86A 1KI3A 4AWBA 4C6HA 2B82A 1S2MA 4BB6A 2B34A 5J4KA 3OZEA 5KTKA 4Z53A 2VHJA 5ILOA 2HBQA 1FZQA 2BFMA 4R40A 1RXIA 3DB2A 1Q2XA 1X1SA 2ZSIA 2LNDA 3K9GA 3VYWA 4EH1A 3Q8MA 4HDRA 3EA0A 3EXHA 1A8IA 3UWMA 4FLEA 1OWNA 3U49A 1IEQA 1UPAA 4K40A 2C03A 4AU1A 4AXXA 3IEMA 4HH0A 5F73A 2PBRA 1R9GA 3ZY2A 1J00A 4GE3A 3Q85A 4OGGA 5DIFA 3ZJ5A 5HFAA 4Y0VA 2O6LA 4ZVQA 5JU6A 2GZHA 4GGOA 3ZWDA 3ZX5A 3S1LA 4F5ZA 4LK2A 4Q4JA 2UUPA 4OUKX 4OXXA 1R5OA 1XUOA 1YR1A 4GS5A 2ZAOA 4NDNE 4YDRA 3AR6A 5AK4A 1NR5A 1U5BB 5TGDA 2FJUA 4EY5A 5AOAA 5BUQA 3CONA 4QGGA 3ISTA 2NAFA 1Z56C 3OE5A 2HA5A 5FXMA 4XWOA 1OYOA 4M0PA 4MPDA 2O1SA 4RL6A 1IJKA 1DU4A 3F6EX 4RVOA 3V46A 2QBYA 4DFDA 3UV7A 5A06A 2BCJQ 3G85A 3MTJA 4FYHA 1ZU5A 2HU5A 2NO1A 2P9GA 2Y1XA 4JELA 5E2BA 1THMA 2GZ2A 4G65A 4ALLA 4EHLA 2DQSA 5KNDA 5BSEA 1J8QA 3CEJA 1I2BA 2R1VB 2OSBA 2AXPA 3D1LA 4ITRC 5DCLA 5EZ5A 4J4BA 2PUDA 4GSLA 5IBPA 3U3MA 4CU2A 2JLRA 1DC5A 2QQFA 2MSNA 3DMPA 1TZJA 3A4LA 4KYIB 3K31A 3DO5A 4B6GA 3KM0A 4FFOA 3LS2A 1Q1BA 2Y0BA 1K89A 1DT5A 4X60A 2ZVDA 5GJWC 1NMQA 1ZD4A 1E32A 2H7XA 2R6HA 3E53A 3GEHA 3ORYA 3I32A 1Z73A 1PF7E 4F9FA 4G0VA 3KIPA 1Q91A 2O3UA 2FZ4A 3CO5A 1EIWA 3K5WA 3JW8A 4GLJA 4YAWA 4UTRA 4UMVA 4KJZA 5T6BA 3RS2A 3BT7A 1V7PC 1NYQA 4M8SA 3ZWCA 3BOSA 5H81A 3FGOA 4IHAA 2AXNA 4RVHA 5L7TA 1C30A 2XJ9A 5ALEA 1OW3B 3DEFA 3E7PA 2ZUEA 4ME6A 1VMAA 1XTQA 2QE7D 3HEMA 3KELA 3NEYA 4OSPA 1A5BB 2UYQA 4JCCA 5EYPB 4DDWA 4EGFA 1VSTA 2DULA 4OHVA 3KJIA 4REQA 3I1YA 5D3ZA 2CSXA 1SCJA 1FYXA 1Q3HA 4JLPA 1HLDA 5JOQA 5AP9A 1WB4A 3N05A 2HPZA 2PUAA 1AS3A 2AV6A 3OPVA 1QNLA 4JSRA 1KQ7A 4XFDA 4LWQA 1F0YA 1K8ZB 4G1FA 3PDIB 3SE0A 5K0SA 1XNQB 3LQ2A 3NHLA 4G4SP 3WL7A 1BDBA 1QO0D 1YMVA 4EQ6B 3SDBA 3SS9X 2IHJA 4MUYA 3K0HA 5JJLA 1XFDA 3EGVA 4RTLA 1M0EA 2I4OA 3Q87B 2E9FA 1F3OA 5CX1A 3AJRA 3OP1A 4IOMA 5EGSA 1JQBA 3WQBA 4RD1A 3BTOA 1QFSA 1XTBA 2UZ1A 1KEVA 3COPA 4JLKA 1C2YA 3GGGA 3UUWA 3IC5A 1JG4A 2DSTA 3TTUA 1JKJB 2XUDA 2MTBA 3EZYA 4QEZA 3VKVA 1W94A 2OM6A 1VYVA 3QG1A 3WGHA 1KY3A 1L7BA 3VR2A 1I8TA 1F9AA 1YB1A 2R4UA 2RGDA 2XX3A 1KQNA 7ADHA 3COSA 3FYHA 1PZGA 2WVAA 5AW1A 4IQJM 3IBYA 3L0OA 3TRIA 3IBTA 4V0MA 1VZ3A 2HHAA 4XX1A 1XAGA 4KO1S 1Y7PA 3I30X 1TZCA 2FSHA 5EHQA 4GX0A 1JAZA 2I4LA 2XYVA 4A0HA 2CLKB 4UNQA 4ARAA 1RBMA 4HZGA 2CYBA 4OSOA 2IDMA 4H1HA 3UMJA 3P9PA 1H1TA 4RABA 4WCFA 1P31A 4LSZA 4G0ZA 4Y7CA 3U19A 3K9CA 1D04A 1BOFA 1WNTA 1EX9A 3V9PA 3VJMA 1G60A 1QHSA 3V5NA 1F2DA 2XMRA 1E4VA 1TJ5A 1XZ8A 3EBLA 4PZDA 3NHZA 2IXFA 4D8VA 1XLVA 1VCNA 3H3JA 4M37A 1DQPA 3NFYA 4HFNA 3NXKA 3FNRA 3IB6A 3K2QA 3NPAA 4KK3A 1ODTC 3U1BA 1GITA 3WRYA 2Q07A 4K81B 3HJGA 4BFSA 2BW0A 2Q2NA 4ZO7A 4KH0A 1FIUA 4AZ0A 2A9OA 3L7KA 4FYYA 2CFIA 5CUQA 2XQKA 4QLOA 3TK1A 1U2EA 2Q5JA 1BJTA 4IDCA 2QSYA 4DB4A 4JLBA 1TYCA 1X7GA 3RYFB 1K7XB 1KBZA 4B3MB 1QH0A 1D2MA 3K5IA 3MJSA 1C5KA 1OGIA 2JJYA 3WYBA 3P2YA 5BUZA 3IL2A 1TM1E 5CT5A 3ICQB 2LVBA 4FWBA 2QOEA 2D5IA 3M2PA 3FHOA 1T3HA 2F8MA 2C4HA 1VL1A 5GOTA 3G5AA 1E60A 4UTXA 2FR8A 4P81A 2ORYA 4RZUA 1BQEA 4KQFA 3TOCA 3IUQA 4U7PB 1DBSA 1YDHA 3IAXA 2XE4A 4JSTA 3MRTA 1K5PA 2EEZA 1DQSA 1JKJA 4FB5A 4KXNA 2IHKA 3FROA 1UBJS 1ABFA 1N8TA 3F49S 5KO2A 1QHYA 3IPCA 4AMZA 2WD7A 1P7CA 4CXMA 3VR4D 3QVSA 1KFBB 3M3DA 1VMDA 4X3PA 3VX3A 2DBYA 1OIVA 3DMTA 4XPIA 4HP8A 1LTHR 1Z7YA 2EDAA 5JS8A 1DOAA 1QH9A 4TWZA 3DEJA 1JEAA 3EXG1 5ALYA 1NW9B 1QDLB 1G98A 4HQ0A 2P9EA 3E7FA 4HN2A 4M1EA 2V5AA 3MTGA 3MOIA 4JI8B 2O5CA 2J9ZB 3OCEA 2ZIGA 3TOVA 4HRVA 4YYEA 1TU0A 4J3NA 5EINA 5TMEA 3TLYA 1M6EX 3TMAA 5H8WA 1ZISA 2R66A 1ZMOA 3A4YA 3TZKA 3O26A 3V4OA 5I3CA 2FW9A 4LRTB 2O4UX 3KOZA 4JDPA 3VPXA 1OH5A 2P78A 3DLAA 2RGXA 1NLUA 3V3TA 1FFEA 1XCOA 2OWEA 2D2EA 3AF1A 5D7BA 3TF5A 2JHGA 2B0JA 2YCBA 2YN0A 1PK8A 1QPGA 1TA9A 4WZ6A 2ZYUX 2SECE 5F5LA 1PBTA 3CUWA 4L3VA 4YP6A 3PYLA 4JP2A 3YASA 1FQWA 4AIIA 3UJ7A 3HKBB 4C4RA 3ID6C 3RBVA 4Q48A 1G59A 5EZYB 3L7MA 2HCJB 3PFCA 5SICE 2Q46A 1SUFA 3R3WA 3X2SA 5A9SB 4R1TA 1S5PA 2ZSEA 2J33A 3A2KA 3VO2A 5I01A 4IG9A 4D3YA 3R5FA 3GEDA 1M0TA 2I87A 3LQYA 3Q4GA 4BGVA 3URMA 4JVLA 1EDOA 3VNAA 1TOAA 2ZSHA 4BIIA 4R7GA 1Z6AA 2RHJA 2W22A 3UC9A 2RCNA 4N9WA 4IZ6A 2Q8PA 4GFDA 3RDPA 1QRAA 4TKMA 3RUAA 1YDWA 2C9DA 1TJVA 1G5PA 4MUNA 1A2QA 3B60A 4K9NA 3VU0A 2R7KA 1PGQA 1LK5A 5K7SA 2AN5A 4EARA 1P5HA 1CQJA 1ENYA 5LMCA 5EEGA 5LDHA 3LBNA 1WB9A 2I76A 1W34A 1Y8AA 3D2CA 1RYNA 3FUWA 1Q3TA 4O4IF 1X7WA 2PT9A 1DX4A 4N03A 4WZAB 4KPEC 4MAAA 4LE2A 4OJTA 3HA5A 5EZQA 3TSWA 1Q0SA 3AHHA 1TQ8A 1TJPB 4W9RA 4P3YA 3ZDYB 4D6PA 4EUKA 3HB9A 4PZCA 4L4UA 3LCUA 2B36A 4PCLA 3A37A 5JYBA 5MN5A 1U63A 3K5HA 2NPIA 5B7NA 5BNIA 1X7XA 4NV0A 5JECA 1BXRA 1ZC3A 4KE7A 4RIEA 3V2GA 3QVJA 1DDGA 1OF1A 4NS4A 4HNSA 1MJ5A 1JMVA 4CKCB 1Y6FA 1P33A 2BEJA 3E18A 3NO4A 1THTA 1K3TA 4O6VA 2YYZA 3FM9A 2F43A 3ZH2A 1OZHA 4B3FX 1L7QA 1C1XA 1O57A 1V3TA 2QDXA 2ZITA 2EP8A 3GUYA 3DBLB 5TPWA 5DX0A 1MC1A 1C4XA 4I1UA 1TJWA 4H7FA 4EABA 4TVSA 1CXZA 3QE9Y 1K7EB 1ZUIA 2R96A 5BN4B 2CBGA 4JI0B 1QRDA 1NQTA 4G41A 1GNRA 3ILHA 1PP4A 1UADA 2NYAA 4BE4A 4EPTA 4BNWA 4C07A 5CFOA 4IKPA 1X7YA 3FYCA 1SBYA 1G4UR 1QHHB 4R2LA 1VIMA 3PUVA 3JYOA 2X0RA 3QXSA 3KALA 1ZD8A 2H0QA 4AKSA 3NHYA 1KQPA 1P3DA 5T41A 3D0OA 3RAEC 1M1ZA 4YRQA 2PWZA 4ZAYA 1TGYA 1NC3A 1N0HA 1K9SA 1R4AA 4IP0A 3CGGA 4O2AA 1BGXT 4PRLA 4MI1A 2A9VA 1CPYA 2GYYA 4U5XA 3N74A 4I5EA 3DFFA 4QU8A 5D85A 1KZGB 2WKSA 5TVGA 4E5PA 1QVAA 1MX3A 2P8SA 4M7WA 4F0JA 3ZDAA 1TAGA 1IHPA 3O94A 3O3OB 2REQB 2QTMA 4BP9A 2NWQA 1TMGE 4Q05A 5AKXA 4BLUA 5I48A 1GJRA 4CLHA 1BYUA 1P4JA 4UBLA 4CHTA 3TNDA 2O6HA 3IURA 1OCEA 3PPVA 3LGAA 4FW9A 1XZKA 3DF9A 4MW9A 4Y9SA 1Z06A 4MGHA 3TOSA 4DRZA 1KZ6A 1M33A 2OILA 3IOMA 2ZRKA 3RS3A 1RPZA 2EVWX 2JLVA 1RXWA 1CEYA 4CDGA 3MSCA 1FUIA 2A33A 4MWTA 4ECEA 3NUGA 3ETDA 3NAZA 1DAGA 4QRHA 3IBGA 2OO7A 2MR5A 1ZMTA 2FGJA 4DUPA 1Z4OA 1E2FA 3K0FA 2JEZA 1Z9BA 2W6IA 1MO3A 1IXZA 1UODA 2BRUC 2VF8A 1BS2A 3AGPA 3EZLA 3PQCA 5EP2A 3FOZA 1MJNA 3GLHA 4MV7A 1XLTA 1KBQA 1Z15A 1GDTA 4KRFA 4DRXB 2WJ3A 1T0PA 3OUTA 3GVXA 1YZHA 1QDUA 2EX1A 1UK8A 4LW8A 4K9MA 2O8CB 5EZSA 3EY9A 2Q4OA 4YR7A 2HSGA 4CKEB 1E20A 4E5NA 1JQKA 4INZA 4YP7A 1JMYA 2YZGA 1T6NA 1RJWA 3ODPA 1QK4A 4F1JA 4GGPA 1JWLA 3LT0A 2CDNA 2OT3B 3FPLA 2AI1A 4QRDA 3IJEB 2QD5A 4QSMA 4R5MA 2JH3A 3SFZA 3AM3A 2D06A 4ZOAA 3LK7A 4AX4A 2WWWA 2OV8A 3I9MA 1K7CA 1TEXA 3ICWA 3KLBA 1BMFD 2HSJA 1ZRHA 3FTFA 2CVQA 1JZTA 4KDFA 1DC8A 1X38A 3G8CA 3H0KA 4IO1A 1EM8B 2QR5A 4NYJQ 5C4GB 1EP1B 3KKZA 5ITVA 4KRXA 1SB9A 4FT4A 3MJVA 3FWNA 4Y6PA 1KAMA 5DF1A 1D7OA 1L4UA 2ZYGA 4FUQA 4RKFA 1ULAA 3UMFA 5K0JA 4CM9A 1TAUA 1IN7A 1W4CA 3DYBA 4O63O 3KOUA 2DT8A 4ZT5A 2ZZKA 1T3SA 2PSDA 3BWDD 3DLCA 4G0PA 2PGDA 4KWCA 5K8IA 1FX0A 2MSDB 4J6EA 4JT9A 4QD3A 4ZRDA 4YRMA 3AIOA 1R27A 4N39A 4C87A 1SXPA 2ZJAA 2C96A 4UE3S 3JWHA 4N18A 3C1AA 2HHJA 4AZ0B 1AQYA 5ICMA 1WW3A 3VZDA 1RDFA 1SKQA 4D97A 3I2KA 1I4DD 5FLEX 2WD8A 5CB4A 1QIGA 3BK2A 3IIMA 4FD2A 5EJ4A 3VPGA 4KFSA 1Y8RA 2Y76A 4BTEA 1FFCA 5CNMA 3FOFC 4FI3F 3LUDA 3OE1A 3A3OA 4KQIA 1OXMA 1H6AA 1K63A 2C7PA 1T9KA 2I2CA 4UTZA 2VSNA 1Q6ZA 5L3ZA 3ZWNA 4FNMA 4LSGA 4CLRB 2ZWPA 2ODPA 4KXLA 3OO0A 3S81A 2W9XA 2A67A 1USVA 2RGBA 2A5YB 4DXHA 1G1AA 1WDMA 1AK9A 3OLWA 4GL4A 2D0OB 2YNMD 4UNNA 1BE6A 3MFQA 2OHIA 3ONNA 4G2TA 2ZBPA 1VE6A 4FE4A 4NCHA 4RAQA 5HQJA 3S6JA 4BJHB 4EW2A 2WSSD 2YV4A 5HRUA 4G4IA 3UGQA 4ZANA 4GOND 1POXA 1X94A 2H5LA 5BSUA 1B0PA 3REOA 2WD7B 1F7VA 1TIPA 1A4IA 2H59A 5EIHA 4WPGA 1F1JA 4AZTA 1C0KA 2O5VA 4M1TA 3W3AH 2C4NA 1JEEA 2GRAA 2ATCA 2IY7A 2D8MA 4HLDA 4NNPA 3RFVA 4Q15A 4BKRA 5I4KA 1L4NA 3TFQA 4PQFA 1P45A 3AFMA 1JYEA 1UF9A 3KQPA 3M6UA 2GTHA 2JI7A 3DE7X 4NOKA 1DXQA 5F4BA 4DWVA 4UFPA 4OXRA 2PE5A 5CA0A 1YFJA 1RRGA 3NJ4A 2G36A 3P19A 2UYOA 1WXXA 2DT5A 4KGDA 5JCXA 1WBDA 1R0CA 2JKVA 4BDSA 1EXMA 1Y81A 5JSFA 2XGJA 4M0MA 3SAJA 4EFLA 4DLXA 5B1EA 2CMFA 2HN9A 3N3BC 1TLLA 4G5XA 3KXIA 3EG9A 4G67A 2IZ5A 4P58A 3FGNA 2OYCA 4HCJA 5D1HA 1W93A 4TM7A 2F3QA 1TQDA 3LBYA 4WXRA 4I9UA 1NLFA 4TLAA 2BFAA 4WK4B 4F9GA 1Z6TA 1SIOA 1OJLA 3JQFA 2V59A 2V6GA 3GDOA 4IZOA 4K46A 4LBWA 4OJKA 5FA5A 3T3IA 4B3DA 4TKVA 2V0CA 3RS0A 2VRCA 2KM1A 3KHSA 1M2OA 2WM8A 4HT3B 3L5KA 2JA2A 1GDDA 2O50A 3LW8A 1D4ZA 1NQWA 1W59A 4H6PA 4M8LA 4R3UC 4WKBA 4F86A 4HNTA 4BXOA 4UZFA 1MB0A 4DR3B 3AY6A 3SFVA 4B84A 4W5HA 2OCLA 3A3NA 1GG5A 3V4VB 4TQAA 1MIHA 1X13A 4I2VA 4YHHB 4PN3A 1V1RA 3ZKWB 4LYHA 2YIDA 4HWKA 1I3OA 9LDTA 3OJWA 3NBXX 4OBEA 3IBCA 1M8FA 3IO3A 4XDGA 4BX9A 1JI3A 3OEWA 3PGKA 2EZ8A 2C88A 3LUJA 1E1CA 3WK7A 5AUOB 2WBLC 3RUFA 1VMEA 1GKKA 3BCHA 3R8XA 4GP9A 4ADLA 1GQOA 1NBIA 4DQKA 5EIXA 3P45A 4AMVA 2XWQA 2HUPA 4OHPA 1NMSA 5FA8A 3V6MA 2PKQP 2H1LA 3UMVA 1GPWB 2HFJA 2PU7A 2EJWA 4OP1A 3CF0A 4ZDKA 4HLCA 5KX5B 5L4SA 2Q6KA 1H9BA 1G291 1ZD1A 3KZ1E 3BK1A 3G5LA 1QIDA 2IIPA 2RBGA 1C30B 3WLFA 4ZVOA 2W2TA 4B7XA 2Q62A 3M5DA 1UFQA 2HT6A 3W0LB 4DTIA 3W1EA 1LK0A 2FEAA 4F1WA 1KRWA 1FA9A 1YOVA 2W6NA 3B1JA 4I50B 1JEYB 5HKLA 1N4AA 2ADOA 3HHPA 2P2LA 3DUWA 1L5HB 3GEEA 2ZI7A 3CUKA 2G5GX 1E64A 4JX9A 4ER7A 4UEQA 4L6CA 2B94A 2D59A 4FCTA 1EJBA 1K9VF 1EU1A 3AY0A 3LUPA 4GZLA 3I2HA 5KSYA 1B6GA 3I39X 1GQYA 4E5KA 4P84A 1LPPA 1TVMA 4KV9A 4DY4A 3O8RA 1PFWA 1UZAA 3PNLA 4OVKA 1YVUA 4KYUA 4LMPA 4PGAA 1PQWA 2HA3A 4BFLA 2D6FA 3MWFA 5A5EA 2BIFA 3IEUA 5JNTA 2YFQA 4H0NA 4NPAA 2GEFA 5JQGB 3KK0A 1F4PA 1IY1A 1WCYA 1ZSVA 3NHBA 4JC5A 4TVKA 8MHTA 2ZWOA 2BUAA 4YQEA 1Q16A 5DTIA 4DBZA 3AF4A 1FDSA 3HKEB 4BX2A 2COUA 1IC6A 1BA3A 4AW9A 3ES9A 4GD3Q 1XEXA 3PC6A 4QPNA 3T54A 2JCGA 2C3YA 2EJTA 3MQ2A 3RAGA 4B83A 4D0LB 5FUMA 4KR6A 3CIFA 1HT1E 3DKVA 2BI8A 4JJEA 2HWWA 2WIGA 4YCMA 3L8DA 4EHHA 5LZ4A 1DIGA 3OQIB 4IIJA 1L6RA 2VN8A 1NDUA 1CC1S 2PNJA 5B1YA 3BMQB 1VPLA 3DG9A 4A8JC 2XMSA 4XGNA 1DQRA 4Y2TA 4JXZA 3SKVA 1E98A 4MR9A 2O2DA 5K3OA 4K05A 2XUFA 1U5AA 4JL8A 3PEFA 1F8XA 1U3CA 4RZHA 5D84A 3SJZA 4ZQFA 2ACVA 4RL4A 2HCBA 3ROZA 3TTYA 1ZINA 3K8OE 3DE5X 2CLIB 1ECGA 4LAFA 1KZ7B 1WQ4A 4IH4A 1NZDA 5LA6B 3ZE2B 3ZCPA 3T5AA 3ZHOA 3ZHUA 2PKQO 1NHGA 4TTAA 1J9EA 4JYZA 1B1CA 5DMXA 5JQGF 2H2FA 2ETXA 2PT7A 4TTJA 4B8WA 2WILA 3H9QA 4QKQA 4X64B 1KVTA 3EB9A 4A26A 2WAAA 2GCNA 2JJMA 2ZATA 5LYJA 4ETWA 2HLNA 1SR8A 1L5ZA 1MTOA 2AFIE 3PFIA 4LSWA 4BFVA 2AKYA 1NVAA 2W8BB 4NR0A 4CQNA 1X7DA 4BTLA 2JB9A 4H0CA 3OPQA 1VHTA 2ECOA 3EVBA 2HK7A 3ZU4A 2ZXEA 4TTRA 5KSZA 1VA5A 5BNTA 2BEWA 3HVJA 1QG6A 1Z8DA 3P0HA 4KQEA 5DPMA 4NFSA 3C5CA 3CNHA 4ENTA 4TMFA 3QVOA 3KQMA 3T1YB 3L6UA 3AM5A 3TR5A 3NDIA 3JXEA 2FLKA 3E1KA 2X9LA 3SCZA 4B4DA 5L3VA 3U39A 2JLZA 2YIMA 1VHDA 1FFXA 3K05A 4TTVA 4EHJA 2AEJA 1RFGE 1XEXB 4YXWA 1JTEA 3HU3A 4LNUB 3T61A 1C7ZA 1TW2A 2AKAB 3DFZA 5HF5A 4UJ3A 3NGXA 2GESA 4BLVA 2JFNA 1SIBE 4FFSA 1TKCA 3EFEA 3EPHA 3B51X 1ECFA 1KEWA 4MMZB 3FNEA 3F6PA 1KAEA 3BMQA 4LOKA 1S2LA 4MIKA 4CNQA 2ZI9A 3USES 8ADHA 2HNKA 1J42A 4GI7A 5DNDA 4N76A 2H7VA 1K2WA 4JBXA 1L5SA 4WK2B 3KQLA 3RREA 1BD3A 4I9FA 2EHDA 5M3BA 4E5UA 4RPKA 1Z4NA 3G9XA 4BKUA 1G42A 1QP8A 3ZZMA 1SU8A 3OLXA 4M0FA 2ZJ1A 3GMIA 2GCGA 2O19A 2QAGB 4AJ2A 2FFJA 4L73A 2DJIA 3AF5A 3PGA1 4M0LA 1XZCA 3AUSA 5GV7A 1UT5A 2RGUA 4R1UA 3TVYA 4DYDA 3LCVB 1AUOA 3KUDA 3M2TA 4R8SA 2PT6A 2PBZA 4U9IS 521PA 3WHLA 2X0FA 4CMEC 2ZJOA 4G5OA 3S2GA 2P2DA 2X0IA 4OP3A 2FZEA 3MJCA 4M1YA 4PBSA 4Y0AA 5AKEA 5KOHA 1NQUA 1CB7A 5CM8B 2Q5IA 3K53A 5GJCA 3NH6A 5TY0A 2QJWA 4UHEA 1V26A 1IQPA 3CE6A 3E5RA 3ETJA 3UAWA 3K9HA 1SUIA 3U37A 2CLLB 2VDQB 3GXOA 4MRMB 4CCAA 3WFZA 1C7EA 3PZBA 1CUJA 3WNDA 4IQGA 7ABPA 3UJDA 4HGVA 1C4OA 1WOMA 5BUSA 5DCUA 2GVDC 3JARA 2H2HA 1XAJA 3NTXA 4P31A 4B35A 5BPFA 3N28A 3ZE1B 3QTBA 4E31A 2ZJ3A 2E87A 4LRYA 5LZ8A 2HPHA 1S8AA 5GY7A 1F0PA 2FV8A 3TVDA 5AK6A 4O4JF 1OZ0A 2OFPA 5FCDA 1TO6A 1I4OA 4KRGA 3NDJA 2B8TA 3M5CA 4ZU3A 3SY8A 2GRJA 4BQIA 2V6IA 2JFHA 3OKCA 3L04A 1K2VN 1NSTA 1ONSA 2IXTA 3IUNA 4C21A 4CFSA 5HM6A 4KQ6A 1ECJA 5K0ZA 2OSVA 1JG6A 4S0XA 1XELA 1J22A 2B2CA 1XMJA 4TMZA 2Q5FA 2IHNA 5LQJA 2XDWA 4C6RA 2NGRA 2O54A 1JIQA 1JA1A 4BLSA 3VPSA 3MGCA 4IDQA 1TD9A 4MYCA 3LY8A 2ASVA 1FU7A 3LF1A 4EOGA 4LCEA 3VYTB 4IRXA 4IH9A 2Y1DA 3MINA 2AMYA 4IDAA 3K0AB 3CR7A 3OU7A 1U7TA 1WRBA 5C4MA 4XQEA 2EL7A 3H04A 1UEXC 1DRVA 3KVNA 4KQKA 1TYAE 4QO8A 4FFMA 3UAVA 1KQ3A 2AFHB 1SC4A 3R0XA 1DJQA 4E2XA 3BERA 1BFUA 1XWOA 2G7ZA 4KXUA 1D6JA 3GV0A 1SU4A 4M9QA 2JLAA 5B7PA 1NY5A 1OI7A 5C4IA 4GOKA 2H6EA 1I33A 4KK4A 3OZCA 2PUCA 4BNFA 3GDGA 4LRQA 2R6CA 1P6XA 2PKWA 2YMPA 2KS6A 2NOAA 1W88B 2ZBDA 1II0A 4B0OA 4OPMA 3PD1A 2A8YA 3Q0TA 2QHXA 4LPSA 4P33A 3O47A 2Y92A 4F6RA 2H1HA 2FPOA 4MMYB 2ET6A 3B6IA 3MT9A 3BWEA 1G4HA 2PLFA 1FRVA 1C9JA 3DL2A 4R2MA 2GD1O 1M2OB 4R84A 5H4HA 3S4YA 4C0JA 4Q3DA 4MEJA 4D9EA 1LGYA 3OD5A 2UZ1B 5H0IA 3ACCA 4GMKA 1PK7A 3T5GA 1IG3A 2BKAA 3PRJA 3JAMA 3JYLA 4WLEA 1GA4A 3FKSD 3DDHA 3OC6A 1K06A 3L8ZA 1MN6A 1JEJA 2JI6A 4QVKA 4MYHA 4C20A 4Q3EA 1CDOA 2ACEA 1OT3A 3DAYA 3KNZA 2VJPA 3RIEA 3OURA 2YOFA 3TTTA 1PVDA 3PUIA 4EO7A 2Z8XA 2LRHA 3IV9A 4ZC8A 4IILA 4IGEA 1I7NA 2Q5QA 1ISRA 2P2YA 5DM1A 3R7DA 4DG8A 4Z1MA 4B17A 2HRCA 4EGCB 2P6NA 2AIRA 1CQIB 3BWYA 5LP6A 2ODNA 4AIRA 1W2HA 2QLJA 1DIOB 4HZIA 4PO9A 2ZTUA 4QBGB 2XNHA 1Z6QA 4WOBA 4MGIR 2C9OA 4J2TA 4N8SA 4NDZA 1QMPA 2VUIB 4XR9A 5BWBA 4Y6RA 4ND8B 2FHPA 2PNFA 1HY0A 4MJLA 5J5AA 3KAJA 1NL3A 5HHTA 4MROA 3PG5A 1H69A 1KO4A 1QNFA 2GCIA 3R75A 4L5JA 2O3RA 4QELA 5TEWA 2AEMA 1PJLA 5GM2A 3U0BA 2MINA 3HFRA 3L3BA 1JJVA 3MWDB 3PE6A 4Z4EA 4B7CA 4ARZB 5JRZA 3ZWOA 1YQQA 5CD1A 3NVMB 3AKZA 2WK1A 1QOPB 3NBYC 5KNDH 5FOVA 1TM3E 3K0EA 1M10A 1YJ5A 4U8HA 3ZYZA 5DWQA 3C6XA 5AI9A 4BLQA 4YCCA 3VMMA 2VAWA 4BU0A 1NV9A 2C4KA 2ETVA 1Y1KE 5TT0A 2VJKA 2YV3A 4GBMA 1DBPA 1KR2A 1UJMA 2A9PA 1UWKA 2RHHA 3FCOA 3EZ7A 1XXLA 3SIWA 3V6LA 3V7YA 1YAJA 2P9CA 1XZJA 1Y1RA 2ONCA 3IE2A 2IW1A 1QGOA 3KT6A 4BB5A 1B16A 2HV9A 5F5XA 5THXA 1M7BA 1U0GA 1YKFA 1MAVA 1U2PA 4ZMRA 1H0SA 1J4AA 1DMRA 4KBGA 5BXYA 5LUAA 1J97A 4LQ4A 4AC9A 2WIBA 3BAZA 1XTTA 4GMXA 1WWKA 4R8RA 4B5LA 5BQOA 3P32A 2QEQA 5JLJA 1B23P 5IMSA 2VK1A 1C0PA 2M32A 3NWBA 4QQ8A 1V6AA 5CITA 4CKBA 2YJGA 2YWDA 4S1VA 3W6PA 1JJAA 1XF9A 1HYEA 2G7MC 5JYCA 2DG2A 1U2SA 5CM9C 1WG8A 2NU9B 1BMQA 3AEUA 2YJNA 5AVKA 4DLSA 5KWEA 3SJUA 1ECCA 2IPMA 2RGCA 3T5TA 5JW6A 1JU9A 1YRYE 2ACWA 4GOXA 1HL3A 3MS7A 4YAGA 3TZHA 1R6XA 1FBNA 3UQZA 3Q6MA 2YW9A 4WOKA 3VNQA 1KJNA 3VNVA 5KOYA 3CEMA 3A27A 1D2HA 1YS9A 3E3LA 3I6ZA 3KKNA 3C3MA 2PJZA 1SK9A 3NDRA 2FZLA 1I5OA 3OSUA 4IO0A 1HFJA 3SXUB 5IG2A 5CVDA 1RMQA 2IBMA 3E1SA 4IMRA 1WUTA 3WOVA 5SY6A 3QE4A 4GQBA 3NDPA 5JSKA 5KNCD 4OBXA 1QAQA 3L41A 4CKWB 1WPRA 2PVCA 1P29A 2ZU6A 5C5IA 4LXYA 1OXKB 3FCUB 2AUNA 1NI5A 5LQAA 3FYTA 3WMRA 2IHBA 2IOHA 4ARBA 2CXXA 5CLIA 3VISA 3DTTA 3TUJC 3LIIA 1E2BA 2G4CA 3IAAA 4CM6A 1NJ1A 1KQGA 4IUCS 2CXUA 4TUYA 5C53B 4ENPA 3QBTA 4P2GA 2AZXA 4RY2A 4R2XA 3KOMA 1RQ7A 1TCAA 1X77A 2CHUA 1C4WA 4OV6B 4R41A 3TQFA 1NN5A 4GUAA 1X15A 2OTCA 1JHOA 4JYPA 3ZZ1A 4DA4A 5D51S 4J1NA 5HIJA 3GN1A 2OCXA 3L9XA 3SMVA 3IFSA 4BRZA 4YHBA 1CHDA 1KAHA 4YJ2A 4NFYA 1I5RA 1L5LA 2HT1A 2BE9A 3K9WA 3WZMA 4OKIA 2CBZA 4A6DA 3FOCA 3ZU3A 4GXQA 2VDVE 3A28A 4UVDA 3DGEC 4B5KA 2QGAB 1VPDA 5GGXA 2GTIA 3E03A 4YLYA 2C5LA 4D92A 2JFXA 2Q41A 1RC8A 1OLXB 2HWUA 3PWZA 3TNYA 4LJAA 4HH1A 3EOAI 4ENQA 1U0OC 4L74A 3RU2A 1T2AA 5DK6A 5JC1A 5EC8A 2C3UA 5CB4F 3EFHA 3OMLA 5IH3A 4A1OA 4HPXB 3IPAA 1ZK1A 4DUYB 1AKYA 2VCYA 4DQDA 4PQEA 1BO6A 5H9VA 4FGLA 5A4KA 3RU3A 5LA6F 1JQAA 2JFYA 3FPHA 2FPRA 1THZA 3SVZA 3SYNA 4YRBA 4CL3A 2F43B 4RCZA 3C48A 3K7EA 3KHTA 1JB9A 2W4QA 3LT5A 3G2IA 2QVGA 3PTZA 4UW9A 1KKLA 2V74B 1KSHA 2QL6A 3IDSA 4A5OA 1PYOA 3ZBPA 2D3TA 4P83A 3RM3A 1YJ8A 1EFKA 3WB1A 5C5CA 5IFKA 5JARA 1ZVVA 1R0YA 2PJRA 3O5AA 1CR1A 2RK6A 1K6MA 3B9QA 3HN2A 5H3HA 5TR9A 4DR5B 2EFDB 2D3WA 4IX1A 1T2UA 3P2EA 1QKJA 2NU6A 1HTWA 4ND3A 3UATA 3CBQA 2WKWA 3U4HA 4EKGA 3P2MA 4EMUA 1A9SA 5JH7F 2I67A 4ZVLA 3R5HA 5I9BA 5EVCA 3C5HA 3EA4A 1QHGA 4YP9A 4MVYA 1POWA 4U7GA 1JR6A 3LBHA 3H4VA 4FDUA 5F52A 1UJ6A 2GCOA 1KK3A 3WGIA 1T91A 4JOCA 4URHA 3FAZA 3TE7A 3N2KA 1MG0A 1WMFA 3A06A 3DZCA 3LC2O 1NQ5A 4EHIA 4IRMA 1XX6A 3U3OA 4KN6A 1DV1A 5HOEA 4RVDA 1J8DA 2BSQA 3MGGA 3LM8A 2GWHA 3HUDA 1L7DA 1W29A 2CE7A 2XR1A 1VYTA 1PJ4A 3QPWA 4WD3A 4BLOA 4DA8A 2GM4A 1RXCA 4DSNA 2FCAA 2QUIA 3N3AC 2TYSB 4L4XA 4X6XA 3IEVA 1WUKS 5DW0A 2C00A 4KFTA 2WF6A 3IMEA 3RBZA 1YHZA 4D74A 4OG2A 1HI9A 4LOJA 1V7CA 4P38A 1PUIA 4IQ0A 3V7NA 1DCKA 3TPZA 1CJVC 3CSSA 1XJ0A 4K6OA 2X77A 1ZEMA 2UYYA 4X85A 3ZD9A 3DMYA 1RM0A 2UDPA 1YOVB 2QN9A 5IWCA 2FZKA 2QYSA 3F4LA 5EG5A 3WSTA 4QUIA 3LG2A 3WDSA 2BGMA 2X1MA 2Y0CA 4GI1A 5ELMA 3WWYA 3FNQA 1O03A 1SOVA 3L77A 4PYOA 4W9NA 4BNVA 1GG9A 4BMSA 1OWPA 3H42B 1ZMRA 4JYMA 1P4HA 1VC2A 2O4CA 1HA3A 2HDOA 4XOIA 2R6R1 5GWXA 4BMDA 1W30A 5KWJA 2F4VB 2A1TS 2HKIA 1S2DA 1HL7A 2LUOA 1XTVA 1PR0A 3PWSA 8LDHA 1GARA 1VFPA 5BSHA 4O4LF 1SUPA 2YJ3A 4HAWA 3DCIA 1ISIA 3X1DA 3WQSB 2L0XA 5LZ5A 2O0JA 1Y8QB 3JD0A 3GP3A 1VXOA 1ML4A 1IZ9A 3BAFA 1JPNA 2F62A 3G17A 3TCXB 4BFTA 5JVDF 3V42A 3LQ1A 2QLFA 4X7BA 1MLDA 1Y9JA 2J3DA 2WJ4A 3I4CA 1OROA 5E8RA 2QPAA 4ADSG 2EW1A 1ISHA 4XYGA 4UEJA 3LLSA 4P3NA 4F2HA 4YWHA 1JDPA 1WXEA 2J4DA 3A6HA 4P34A 4DLAA 2PBLA 3HWWA 1DIBA 4O4IB 2XOKA 1DV2A 1LC3A 3NHPA 1OOEA 5CFMA 3VV2A 3FXAA 1OAKA 4I8XA 5DLDA 3NANA 1T1IA 1EFDN 4NFHA 5HG0A 5HE9A 2C2HA 2NG1A 2BKXA 5ED0A 2GN9A 5EIFA 8AT1A 3EIQA 1G4AE 3QX7A 5FRDA 4OJNA 4MUBA 1KVQA 4UATA 4IXDA 1GYRA 5IJXA 5CHEA 1APBA 1VBFA 1LW6E 1L5WA 3EISA 3F2VA 3Q98A 2C97A 4BQNA 2A9FA 5ITSA 4R2HA 3ROFA 4BTVA 1XNJA 4HADA 1L1QA 2Z1DA 4BIMA 1WULS 3WXBA 2HHCA 3RO7A 1M0WA 1VKRA 2D62A 3BSYA 4J9UE 3UPUA 1NAIA 1X86B 1CNFA 1TVKA 3CZPA 2ZTLA 3BH7A 4W1RA 1WOYA 2PX6A 4DIEA 1SZCA 4AO7A 4A3SA 4BQPA 5DZSA 4PSKA 5KHAA 3B36A 3IPRA 4G23A 2DYKA 4J16C 1HE1C 3UT5A 4BE9A 2PLRA 4HKTA 2W6CX 3KBBA 4US2R 3U4GA 5KYWA 4UU8A 3I34X 4KMRA 3KSZO 4NK5A 3VKFA 1Q0UA 4CV2A 5G0VA 2ZIZA 1AGYA 3ZGOA 4CLRA 1E63A 3OQJA 2JGIA 3DXFA 3EZFA 3U5ZB 1XTSA 3OF3A 1XFAA 3HJCA 4UCXA 4ZJPA 4WTOA 4P35A 5ENZA 1SKAA 2X6QA 4YQFA 4L2IA 3UJNA 5CLLA 2BI4A 1X1CA 1OLSA 4MV6A 4W99A 2GCPA 4M0UA 4XM1A 2IDZA 5D6NA 2Y67A 3QVMA 2DKFA 3ZNPA 1QP4A 5GQSA 4V2UA 5ES3A 1FMJA 1P17A 5CMLA 3K9LA 3A6GA 4QOEA 5AH0A 5EP3A 4QTTB 3ENQA 5AM4A 4EECA 2OVBA 2XKKA 2AK3A 2FW0A 5CD9A 2XY4A 5IS2A 1D8AA 3WIVA 3I6MA 3IR7A 1LDMA 2I1LA 1SZJG 4F45A 3ZJVA 3G0CA 2ISQA 1D03A 2OV2A 1U8TA 3NV7A 5FI1B 1HY3A 2SKCA 3ZLUA 2HRBA 4ASUA 3TLAA 3OZDA 4HSGA 2PBFA 4DCPA 1KJIA 3C7CB 3BQ9A 4WW0A 2NU7B 1GFSA 1ZKMA 5DNWA 4QM6A 1AGPA 4FC7A 1T0IA 4OXNA 1O89A 1N6RA 1OBCA 1YZLA 2VJCA 2W6ZA 2YICA 1WDLA 5EN4A 1C8LA 2D7DA 3W5SA 4G8JA 5EXEA 2J6BA 1VJTA 5JD5A 3VNBA 2ECKA 4UEWA 2P1ZA 4BZQA 1Z0AA 1IDN1 2JAPA 2QLLA 1E9AA 4BMPB 1USUA 3RANA 3X2EA 5GAJA 4NQRA 5EMKA 3OPYA 1J2UA 3E61A 3VJLA 5CLQA 1Q1NA 1RRVA 2GBLC 3KSRA 3U80A 3BEDA 2I2DA 1QKIA 1U8YA 1OVMA 2OCBA 3TEMA 1UXOA 2B4QA 3N7TA 5BORA 2WTUA 3TBHA 2PVSA 1KP3A 2WMOB 4U3JB 3A6DA 3B20A 3BXPA 3WMEA 5IBRA 1A7JA 4QQNA 1P1JA 1JPJA 5A03A 1TF5A 3O8LA 1RRMA 3FLAA 1LI5A 3KJQA 1GZVA 1YE5A 3SDZA 2C2ZA 3MJ4A 1ZC4A 3LZ6A 4ZEVA 3Q3EA 1L4KA 3SHFA 4CQMD 3GLIE 2E9SA 1DTWB 1ODKA 4WN9A 4PZAA 2V54A 4GKAA 5FPQA 1G3UA 1ABEA 2R8PA 4L5YA 5JS2A 4ATNA 3N5KA 3CEHA 1Z4JA 3FTPA 1C9NA 3WB0A 2W6PA 1O58A 2HOQA 2AMJA 2GEKA 3KU1A 2JAXA 4MVJG 3GOHA 4R0NA 4UUMA 4GOLD 1KYIA 1TCVA 5BSGA 2CL0X 1KXZA 2Q6IA 3HU1A 2E4ZA 4OJYA 1B7GO 4WKNA 1GFZA 2Q6OA 1F14A 1Z2AA 4YPOA 5JAUA 1TRKA 2XH8A 2HLHA 4ZOBA 1CQPA 1D5CA 4KTVE 3QMMA 1WCV1 1HZZA 3WWDA 4BV2A 5GINE 1IIRA 1XTIA 5HIAA 5DHUA 5IC6A 4GL2A 2GBIA 3CLSD 2EZTA 2UZ3A 3H17A 3CX6A 5BPHA 2RIPA 4PCAA 3I1FA 4Z54A 1B42A 3NM5A 4J76A 4M7OA 4OYYA 2D5LA 1WR8A 4LQLA 3ND8A 2QLNA 4QC2A 5B58T 2CF6A 1FX0B 1JSZA 3BGDA 5AW0A 1K98A 1OTYA 2WF7A 3G23A 1M2EA 4FGSA 3D1JA 4APBA 2WPNA 4FYVA 3HGTA 2FCRA 2V1XA 5K6RA 3OZUA 3WJ7A 5DGXA 1JLLA 2PTHA 1YB5A 2GHIA 4DZRA 5KHOC 2RI1A 3WIEA 4KI0A 1JU4A 1B2LA 3FB4A 3M8KA 4FW8A 2J7PA 2ONYA 1MT0A 3G6KA 2HVGA 3V1NA 4MRSA 3OZBA 3LLCA 3X1MA 1RIIA 3PL5A 5F51A 3B8HA 3R0QA 1EQUA 1RKXA 4JNCA 1U16A 1NF9A 4AJJA 4E21A 1WXQA 4PLYA 4HV4A 4ERXA 2XA9A 4EJSC 2C1EA 3GT0A 5CA1A 4YONB 3HR8A 1XEFA 1NUTA 2O0MA 3CT6A 3N6VA 3WBKA 1TPYA 1T8WA 4ARUA 4C6TB 1UAGA 1T2FA 3JQRA 3NIBA 3PA6A 1OWMA 5K4GA 3DPSA 1Q74A 4UNIA 2O5RA 4ARSA 3B6ZA 1I13A 4DJJA 1UJCA 1RAAA 1WUIS 2XUPA 4JLNA 3DDCA 4H7IA 5EKSA 3D54D 4D5EA 5B1DA 5ITWA 1QTRA 3F74A 3M4NA 4DCMA 4TZKA 2BBWA 1HE4A 3ZQ6A 1HMYA 2O3JA 3MD9A 4C0QC 4P4SB 4KLZA 1JG7A 2Z5GA 5I9IA 2FN9A 5JISA 5KTNA 3GJ4A 1T15A 2QT9A 3DF7A 4J91A 4Y2RA 4YT4A 2NQ8A 1UPTA 3B1WA 3B78A 3K0CA 4WNYA 4V0RA 1V5FA 4U5QA 1FYFA 1X19A 5AOCA 2I1QA 4QOHA 2L42A 2WMYA 3W1VA 3F47A 4XVCA 5CXUA 4ZZ2A 1SD1A 2P4SA 5HP4A 4E5DA 5CH8A 4EEZA 1E1KA 2PZMA 5A5GA 4TQUS 3BHJA 2YUIA 3OZ7A 4YRKA 4WLVA 2OOKA 2QP4A 1M72A 3W9BA 1PZHA 3S2YA 2C5GA 4Q82A 4LF5B 4CQMA 5JCJA 3UN1A 1D5WA 1E6UA 2Q4RA 1MXFA 1V39A 4ZCMA 1SFRA 1NHWA 1EE2A 2NO5A 2Z08A 2JGEA 2NQTA 2I4TA 4TL8A 4Y6GB 2IWHA 1JH8A 2JFPA 3K0KA 1NVTA 3QKSA 3FTCA 1J20A 3O7MA 3OKFA 4KMSA 1A8QA 4RDHA 3C3AA 2PG3A 3QY9A 3LY5A 1RLIA 3OEHA 1AK2A 3DR5A 2XOEA 5DXAA 5CDHA 4EGJA 1Z22A 5FI3A 3O83A 1AZWA 4R5HA 1QK3A 4GI5A 4JQZA 3WLEA 5IAOA 4AJIA 1GZ7A 3PR3A 3F5FA 4OHRA 3ORHA 1WSWA 4NNOA 4JITA 4NV3A 4YMHA 1HDIA 4ZDWA 1AMUA 1EI9A 1H65A 3MG9A 5TDHA 1SZDA 2I1VB 1WUHS 3AC0A 4ZQGA 4F3CA 1QHHA 1BS9A 3L82B 4KCGA 3UPDA 4HNRA 2QTTA 3IS3A 4OXIA 1B1AA 1D4FA 4MX2A 3AI2A 3BHNA 4LV8B 3J81k 3TL6A 5A02A 1GTVA 1W8IA 3T7AA 4I4IA 5TGZA 1B43A 2Q4DA 4ENVA 5KIAA 1LVGA 3G8BA 3H87A 1QHFA 3R4VA 4Q24A 4C7XA 5G0WA 4PNPA 1CB0A 4U02A 1YVRA 4E03A 2G5CA 5JALA 1E58A 2H2DA 3E9ZA 4DM3A 4IHQA 2I7DA 3F1KA 1RXSA 5B12A 2ZVJA 1QF6A 2H1WA 2XECA 2JGAA 2QM3A 3C15C 1D6MA 1Y9AA 3GCXA 3N2NA 4R98A 5F1PA 4ZO6A 4WOJA 3PJFA 4JS0A 4AY2A 1R12A 4EPWA 1IPHA 1CLEA 1K4KA 2VXCA 2X41A 3QXGA 2WA2A 3D6TB 3F4BA 4RKYA 1H4TA 1ZBQA 3RYTC 3B8EA 3ADKA 4XSGA 5FR2A 3B48A 1NUHA 3P2OA 2PZ8A 2AFRA 1U8UA 4A8TA 1DE0A 1ZJ5A 1IY2A 2IDJA 2OR3A 3DMNA 3DL0A 1EWVA 3II6X 4YCAA 4DXDA 3L8EA 1V16A 3R20A 4KR2A 3CR3C 2QVZX 4GICA 2VC2B 3IAFA 4ZT7A 4G5HA 3E15A 5E7IA 2C1ZA 4D8UA 1IOVA 3AR3A 3VPDA 3ANMA 2C4MA 4OO3A 3I76A 4E88A 3Q9NA 1X0XA 1H85A 4MLDA 2VJYA 4NTZA 3NBKA 1UOEA 2FMTA 2I3ZA 3WBBA 3WRYC 3FF1A 4CL0A 4YGXB 4BGEA 4UBMA 3RD8A 5CPBA 2VJMB 1L5NA 4ILKA 4YT2A 2KW5A 3R09A 5J47A 1OLUB 4HH4A 1B2RA 5H3LA 5ITZB 2ZS7A 4OKNA 2GVZC 2TS1A 3QY0A 5AHWA 1N77A 3KTDA 2NZ8A 3LVRE 2OAP1 4NAHA 3CRNA 3G3EA 4OD0A 5EPOA 4ZAZA 4DF3A 1C8KA 2Q1TA 3V33A 4FR5A 1UPCA 5A5FA 5CJ2A 2JI9A 1XO1A 3UJAA 3A0UA 1VHQA 3FH0A 4ISCA 4YRGA 4XYBA 4Q5IA 2EP7A 4WNIA 5EI5A 2EQBA 4HJXA 4EW6A 3COVA 2ZT6A 4G4SO 6YASA 1R6BX 4MIYA 1SG6A 5HE8A 2MMGA 1EM8A 3THWB 1V25A 5CLGA 3HRKA 3RVLA 4UQLA 3ZGLA 3QFFA 4HO1X 4DAOA 2V1UA 1I3MA 5BV2P 5FBVB 2JFZA 3RKUA 1RYFA 1UOQA 4EY4A 1QHXA 5LLDA 2QRHA 3HYCA 4WIAA 3MYRA 1HDCA 3IQDB 2Z3VA 3CRW1 2OCAA 2FZGA 3WJAA 3OOEA 2JGFA 3VQTA 5LBIA 2W48A 2AA3A 1P74A 2OMKA 4OP2A 5CDGA 3KU4A 1NXVA 3FYSA 1XVLA 2B2XA 1HWYA 2P9TA 7AT1A 3P2KA 3A8TA 1P9OA 4V1CB 2AOTA 4XB2A 1GGVA 2A1TR 3FWPA 1G1MA 1GL6A 1OFUX 1UXIA 1ZHFA 4MVJE 1HDGO 4PLTA 5MGBA 3ZHRA 3W06A 2QY9A 4NY1A 2ZQZA 2OV3A 5A9SA 1JBKA 3Q2KA 3SGLA 1FFHA 3C1TA 2BR3A 3B85A 3UWKA 2FW8A 5TARA 3N0TA 4FMDB 1X74A 5CT8A 1CX9B 4YFYA 4Z5XA 3H2HA 4QO7A 4N54A 3KPVA 2ILVA 4BO5A 5LWQA 4IV5A 5JNUA 3RQSA 1Y4DE 3MOSA 5E4FA 3CLTC 3H8WA 4R8KA 2HLPA 3E8XA 2OFXA 3GBPA 1JQ5A 3LP6A 3GDHA 3O03A 3QVLA 2LGJA 2OYSA 3KYDA 1V96A 1KY4A 2G17A 1ODSA 2EW2A 2OQ2A 2RJOA 3BD9A 4HLUC 4K87A 4NYJR 3SFTA 1DG3A 1TVEA 4AUNA 5LQKA 2SKDA 4CNBA 3DP7A 5JH7B 1QFZA 3C6YA 4IGIA 4CIBA 4BCDA 4DSTA 1HX7A 5EVJA 5DVZA 5JBIA 3AUAA 3C85A 3UXEA 3O4JA 2I9PA 1DJPA 4JJIA 1Z29A 1KYWA 4ARVA 4IEEA 3IQXA 2Q7XA 4DDUA 1NBAA 2FR0A 4TLDA 2YXPX 3QUQA 5ALQA 4DL9A 1FP6A 2QQ0A 3QV2A 2X9GA 4PHHA 3EVNA 4BNXA 1KWKA 2XXBA 2PFGA 2I7XA 3RFTA 3BMNA 1SCAA 4WINA 3T5PA 2UAGA 2WKRA 4GE0A 1KP2A 3O8QB 2IS1A 1DUVG 1EXNA 3GLTA 3OOWA 1OLOA 1P1HA 1JTVA 2ID8A 3MWDA 3H5RA 1WB6A 3RSOA 3W8EA 3VYVA 1XWIA 5ALZA 4F4IA 3FBTA 4NF2A 2H3HA 1F6BA 1EFPB 2LBPA 1K68A 3FFWA 2J08A 3G7SA 3IR6A 3V1MA 1DP4A 3TLJA 1UJBA 2IRWA 2TSYB 2WTAA 3QWHA 1FFYA 3MUEA 1Q95A 5HW0A 1NATA 5J58A 1PKEA 1JDBC 3QLUA 3W6NA 3WLIA 3AEZA 4QJ4A 3WGNA 2I6FA 1R5JA 3LX5A 3V4FA 3DMGA 2REBA 1KEEA 4N8EA 2O5EA 3IMKA 2P90A 1VYHA 4PC2A 2GR9A 4R2KA 1CEXA 2XVAA 4RV5A 2ZJ6A 4UNSA 2GDJA 4JT4A 1GQSA 1NPYA 1C3XA 1Z34A 121PA 4IQ4A 3WDKA 4DR4B 1ZGCA 4CKYA 4K9SA 2CZQA 4XQ9A 2D7CA 3DC7A 1ZONA 1PJ8A 3I37X 1UFVA 2XUAA 1O94D 1OTXA 2RSLA 3N2IA 5DLPA 4WXYB 4MJXA 1E18A 1CZUA 1XZHA 4TSFD 2H63A 5IEJA 4KGVA 4IHJA 2WFZA 4CKBB 1SAYA 4OYHA 3QYAA 5AQEA 3TW6A 2ZRJA 1YHYA 3ZWQA 2BGTA 5DIZA 1T8PA 1RYYA 2GM5A 3UO8B 5EJ8A 1OZFA 2QSJA 2XE8A 2NU9A 3EVEA 2A3RA 1KI7A 2FRDA 4WJKB 2CC2A 5BRJA 1E6EA 2OP1A 4BVHA 2BFFA 3QF4B 4KXXA 1PJRA 2V9PA 4R3NA 3QI2A 1BFDA 1XYGA 2CSUA 2YFKA 3CCBA 1T3TA 1QWSA 1AQUA 1UEIA 4C0AC 1V11A 4Q9AA 2VF5X 2REOA 2XCRB 3MRXA 4F4DA 3CLUC 3BMNB 1YOBA 3QVKA 1SOWA 1ODJA 1T3LA 2VCHA 4O2BF 2VT6A 5TJHA 1TTQB 3VDRA 5IKEA 4FILA 2A86A 2HJGA 4CCYA 4YRIA 5FNZA 2W90A 3CNEA 1CQZA 5IAKA 5A7FA 1YR2A 1GGFA 4KNWA 2PUTA 1EM6A 4OXYA 2VRNA 1WKVA 2QZZA 1FP4A 1RAHA 4F84A 1ZG3A 4PTZA 2JGRA 4KU4A 5FH9A 4CR6A 2JFVA 2YQZA 1D1PA 3I6IA 1GVHA 5DDIP 1UZLA 1ULUA 9ATCA 2ONKA 4WACA 2HJVA 1V6SA 3OICA 4AS2A 3TAXA 4EYEA 4DCUA 5L51A 4XR4A 3AQIA 4WAUA 2HIGA 3HKEA 3OM0A 4I55A 4CMIA 4URWR 3UFBA 3HN7A 4LC0A 3SQMA 3P8ZA 2WTNA 3MB5A 3HLTA 1EFUA 5FI0B 5BN3A 4RSRA 3EA5A 4I6JA 3MLAA 2ZSKA 1I3KA 3QIVA 4GW3A 4H7HA 5CB6A 3J80A 4U00A 2XSZA 2UZAA 3S5JA 2PGOA 3AV0B 3OHPA 1SRQA 3R4CA 5AJUA 3SLRA 3VO9A 5BN5A 3U60B 5JSQA 1T8SA 2DPGA 1E9DA 2BBSA 3S28A 4B73A 2ZM6B 2FF5A 3SQLA 1IB0A 1QG0A 3QVTA 4YRZA 2X6RA 1XBTA 3E7DA 4HYYA 1DLJA 3ZCUA 3WB2A 4NKRA 1T6ZA 3PQ7A 1G9SA 5IDVA 5A3JA 3HCCA 3P9RA 5DISB 1QOZA 3FHCB 3PNQA 3VH4A 1YZGA 4N5NA 5ESXA 4IQ8A 5KHLB 2XB2A 3ORFA 1XMIA 4EFDA 2QRKA 3NHWA 1G5QA 3EH1A 2QGNA 2ZI3A 3THSA 3IMCA 1KPHA 4TX1A 3GFQA 4D6XA 1Q7GA 4EG3A 3ER8A 1RLTA 1NUPA 3ESDA 1WUYA 4M0EA 2P4HX 1J8MF 2ANCA 3BVPA 1W4RA 1Z08A 1GT91 1KC3A 3MWJA 4HEA1 1LJ8A 3F6YA 4BJ5A 4C4YA 1M73E 2HW8A 3BGSA 4W6ZA 5J23A 1EK6A 4NARA 1AF7A 3IPYA 4BUJA 1DKPA 2W8BA 4S35A 4TTQA 4HY3A 5FUVA 5KS2A 5BQPA 3EVTA 4CM3A 3IDZA 4WDQA 4EELA 1OPXA 4RKQA 5JJ5A 2RFLA 1N75A 3CJRA 2BHNA 2NQ2C 4HATA 4I4LA 4J1SA 5F64A 2PUGA 5G2OA 1RJEA 4EYGA 2R9VA 3K9BA 4Y3UA 4S24A 2EW8A 1FY2A 2F3SA 2PKCA 4KITB 3A6LA 3GMTA 3LW7A 3F9RA 2CV1A 3LDAA 1NI3A 5HFJA 3H1GA 5KNLA 3RIMA 4NBVA 1R6DA 4L02A 1HGXA 3IPLA 5JO9A 3U9TA 1MTZA 1E3TA 2R2AA 3F6BX 4P53A 4COKA 4H15A 5KYYB 3OPYI 2XYHA 3ZDEA 2QD2A 2XNKA 3KT8A 1XF1A 2GMWA 4Y8VA 3TIXB 5BN3B 3EWSA 3CW8X 5JAPA 2QRVA 1XXHB 2XPCA 5KAPA 2VA9A 4JASB 2QN3A 2W2MA 5EQTA 4DYVA 5FPKA 1LRKA 1HO3A 5LBTA 1QYXA 1N0WA 4D25A 1GVNB 3SVTA 3W2HA 1WIWA 2QWXA 3GZNA 4AP9A 1SCIA 2XDAA 4U6QA 4KPGA 4FQ7A 1E3QA 1DRWA 1Q22A 4MV9A 2UXBB 1L4HA 4OK3A 5CB0A 3THWA 1NMXA 2W6ID 3LQ4A 1DWOA 2VYNA 4RTQA 2DQZA 2P1RA 3P1JA 4FR0A 2JFUA 4R4JA 4EYOA 5MDHA 3AEUB 4AURA 1GUFA 3EPLA 1PR5A 3J7AC 4ZQIA 1E0DA 1PZEA 3BL8A 4F4JA 1Y3HA 2OOSA 5KWSA 2O3TA 3PL1A 4LYFA 4C2TA 4GOMD 3QKUA 4G3XA 1JAHA 4RESA 5JCOC 4KXFB 3A36A 5K0GA 3T5CA 1NJ8A 3D8BA 4EG5A 3ND9A 2YS7A 3TD2A 2GRUA 1RXVA 1C1XB 4AJOA 3KEFA 2VPYA 5G4KB 4W4TA 4N3NA 1YDEA 1F8GA 4BNYA 4K6GA 3HWRA 1HR0B 4HWSA 1HE5A 1IK4A 1FRQA 1Z28A 1YZQA 4MYDA 1TZMA 3OPNA 1GHTA 2ZDGA 5FBHA 1F48A 3DDNA 3DAPA 1U7OA 1XU7A 2V4UA 1SM4A 3M6FA 3IHKA 3PUZA 2A59A 2AXQA 1SQ5A 1GEGA 2JIRA 3KUKA 4KQMA 1GG8A 3M33A 4RU1A 4ZAFA 3WADA 1E6CA 3H9JA 3GG2A 1E5TA 2CNLA 4GM0A 2OQIA 2FZCA 5H70A 3E70C 3VYRB 5ICFA 1J70A 1RWNA 3IERA 1ZMXA 1T29A 1CLUA 3UT6A 1K3FA 3A1SA 2LP4Y 3TINA 1AKMA 2WHYA 5KMGB 1ZGHA 2XB6A 4URFA 1YK1A 2IH5A 1IN8A 3UFXB 5B36A 2ZXFA 3KDSE 4HAZA 4WLNA 4ZFNA 2R62A 3FDZA 5D7NA 5A04A 4PQRA 4YACA 5AI4A 1TDJA 4K9QA 3IHTA 1SCKA 3DLPX 4RENA 1HRDA 4QYIB 2CJWB 3W8NA 2V5UA 2X9NA 1UMDA 1BHSA 1Y6ZA 5GV8A 5KYUA 2QIPA 5IJ9B 2AQKA 3ADOA 3KTOA 5KX5A 3BFJA 4P3PA 4A8HA 5BSWA 4EKYA 1IH8A 3A1FA 3KJNA 3JRNA 4ZVVA 1MB9A 2DR0A 1RQXA 2H0AA 1DHTA 2P7IA 5KINB 1GPNA 4YPVA 2QTLA 5KVVA 4DIMA 1I3CA 2Q29A 2ZYWX 3E5MA 3KR9A 2UVQA 4A0FA 1N9KA 1VOTA 3K4PA 2I78A 1Y6QA 2DFTA 2ATVA 3QBDA 1XWWA 3QFCA 4GGMX 4X95A 4YAFA 1L5HA 3ZW9A 2YNMC 1V47A 1SBQA 3CR8A 3KZVA 2I6QA 4GBGA 1P5FA 1N2CE 1O5OA 4UAJA 1COZA 4N7RA 4IDBA 2VJNA 2XDYA 3FAKA 3I6BA 3OJXA 5DX8A 4ZC1A 3ADBA 2G83A 1GFWA 1ZUNA 2QN8A 4K3UA 4DZZA 4P7GA 4Z4CA 5BNZA 3K0CC 2IX3A 4WBNF 4DRXA 1SG0A 1CJKC 2OC9A 2ZJ4A 2ZWIA 1DKNA 1IATA 4EKNB 3D4OA 4MYTA 2FLVA 2UU9B 2ZWMA 4JI4B 3VR5H 2H8KA 5CG2A 2EBFX 5JI3E 1KI8A 1HZJA 3GLRA 4UU1A 4TMTA 4KUEA 1FJHA 1NIPA 2N42A 5HRCA 4ROSA 4TSKA 4ITVA 3DHVA 3MT7A 3CRZA 4XYLA 3OY7A 2JGNA 4Z4IA 4ZOLB 1K27A 3SQXA 3WHKA 3NHJA 1A96A 3K3PA 3PQ3A 1EINA 3SLKA 1FDWA 1LWOA 2V6FA 4M6WB 2WYVA 1ZGJA 4C1BA 3S2ZA 3NALA 5C37A 4IHJB 3L02A 4XRGA 2OY0A 4EM6A 3GMDA 3H1PA 2EIHA 4S2EA 3O0DA 1YFZA 1A5SB 1DAKA 3SC4A 2JAUA 2PM8A 2V0NA 1ORWA 1I80A 4PZLA 4II3A 2E18A 4R8LA 5JY1A 2PAAA 5JRDS 1OH7A 1RQGA 1DOHA 2NU7A 3CZ5A 3DZDA 4PBRA 3RC1A 3KV3O 3NBMA 3O1IC 2WIDA 3CKMA 3L18A 1H5NA 5ETJA 1P6QA 4KSYA 3IPXA 4N6GA 1CJMA 1Q3KA 4P6VF 4WL0A 5EUBA 2ONJA 1P2FA 1TM2A 2VTDA 3EPRA 1PT6A 4KZKA 3PEEA 3NZEA 3Q7RA 2GZ1A 2XNDA 3L40A 1YC5A 4H6VA 2PZEA 1QAMA 2WG0A 5EL0A 3A05A 5KCMA 3FLEA 2R44A 3UHPA 2YYAA 1DSSG 3T4PA 4O2BA 2JFGA 3SHOA 1J90A 1W5SA 4MK4A 3KOYA 3W9UA 4WECA 1W5EA 2C2MA 1J8VA 1EVKA 5IM5A 1ZUNB 3MPUA 2WU0A 1JLMA 4RTMA 3T3GA 4UUNA 3AVUA 3FB1A 4N7MA 1CS0B 1QMGA 2NXJA 1AX9A 2WOOA 3H5WA 4Q7LA 3UV6A 4NBWA 3IKTA 1X8JA 2JASA 2NTNA 4WBSA 1IZZA 3IIKA 3KHKA 5KNDD 3FNIA 3LC7O 3IALA 4PZEA 2O8DA 3QNWA 3R6DA 2PXCA 4CE6A 2PGAA 3PEYA 1NYRA 2VYQA 2W2PA 1ZCBA 1QUFA 3FWZA 2GWRA 5CXQA 1TIBA 2NP6A 4Y2QA 3DMFA 1SXJC 1W49A 3AI1A 3FZYA 1HTBA 4LDAA 4RHEA 4KPFC 4YRPA 3NAGA 1AHHA 2AOVA 3QE2A 1FRZA 5FJIA 4KR9A 2AOUB 4CODB 3F4KA 4B85A 1GGEA 3IA2A 3KZMA 1G3MA 5SYMA 2XQGA 1U2RA 2Q21A 3O8OA 4PVDA 3NMUF 2OORA 3AEQB 3H11B 2HO5A 2GN6A 4MJ3A 4RF5A 4WASA 5DBEX 2ZIUB 2C54A 3T9DA 5CA0B 1YIOA 4PYQA 2PKYX 2P4EA 4B48A 3GRAA 3Q10A 1NBWB 1Y7HA 3HPQA 3R24A 4DAEA 2M6SA 4RH1A 3MMPA 3L7BA 4AQ7A 4EENA 3QOFA 5DYGA 1TKAA 1QV6A 2VTVA 2JJ1D 1OX5A 4I1VA 3S2FA 4IW3B 4E3ZA 5JHHB 1LCIA 1QGZA 3S29A 5I45A 1A9ZA 2NVOA 3OTWA 4LYYA 1T35A 4NHOA 3EZNA 3F4RA 4BEBA 1P5JA 4LF4B 1L5MA 1FMFA 1XYYA 2IYLD 3BS4A 1S4QA 1VE3A 1MPTA 3S2UA 3IVCA 1F60A 4K0KB 3F78A 3BJEA 4J1TC 3EHEA 1L5RA 2R7AA 4EF5A 2CV0A 2GZ3A 3OZVA 4MMXB 3NAQA 1ZRSA 4O2BB 3JWPA 4Q9HA 2EKBA 3AT1A 1A4RA 1ZUD1 1V1MA 2QVBA 3C3WA 4LJ5A 5FOTA 1NSYA 2HF7A 2F3TA 3ONWA 5FWDA 4CCWA 1NX9A 5DYWA 1DDIA 3LHFA 2Z9BA 5DCYA 4LN1A 1CE8A 4Y9DA 2GPNA 3B6EA 4EYQA 3JYNA 1SB8A 4CM8A 3K15A 3GIDA 3SE7A 2BEKA 1U1CA 4O4HF 2BGJA 4RY8A 5INTA 4EUSA 1X1DA 2BMDA 2FFRA 3LL7A 1LVHA 1WXFA 5CT6A 5FULA 1VIYA 1N6LA 2C0PA 2F1RA 3OU2A 3NVAA 4ID9A 2HA6A 2AMLA 3VZCA 1U0LA 4OLJA 3CCCA 4A36A 3QA9A 4MPJA 3LPDA 2P3QA 4RJJA 1TUBA 2HMSA 5LM3A 4CIDA 3RK1A 2J9FA 3Q0IA 4NIMA 2IE0A 2F00A 2KLBA 3B3FA 4XB6B 2X5KO 4LY6A 1DWPA 1LH0A 3X44A 1W36D 2PWBA 1X9GA 3KKKA 2VPPA 4C4SA 4KC0A 1K6JA 1G5HA 1RWWA 2H48A 4QUJA 2EHJA 2ON6A 5TMBA 3QWBA 2BFCB 4DLVA 1E9BA 3SJCA 4AN4A 1KIAA 2PGLA 2FLWA 4PRKA 1LTKA 3INGA 4B9EA 5K51A 3I1IA 5LOVA 1N6HA 2XRYA 2C2WA 4DMCA 4Q66C 5E1DA 1JFLA 2F17A 2PJDA 3L06A 3LBIA 2YZMA 3KQYA 4EF4A 5C52B 2HSZA 4UM7A 5JDIA 1CERA 3TG8A 2Z0MA 2HL6A 5G40A 1EFLA 5MN4A 1E2GA 3GAFA 4S2UA 5F1OA 3BSWA 4QTYA 2X15A 1M6WA 5HUJA 2JFWA 2XA1A 1CUHA 3ILSA 2FKAA 4GIBA 3DA8A 2JJ2D 3C16C 4NJOA 2O8VA 3P0IA 1MEEA 4RZ3A 3NI2A 1QGDA 2XI4A 3TL3A 1AHIA 5BMVA 3ZVNA 1JHDA 3GEBA 2HIHA 2P3OA 3M7IA 1BE1A 4MKXA 2BEUA 3DXYA 1E2PA 4A15A 4PC3A 1XKTA 2I8CA 2RK4A 2Y1WA 3PUKA 2GN4A 4Q7KA 3ADDA 2QMEA 5GOZA 3LWBA 2QTAA 2OK7A 4B34A 1GT6A 4OOFA 4QBKA 1PJBA 5DGIA 3WIOA 2XHZA 3DBHB 3NFRA 4M86A 3U3RA 1I2MA 1G19A 1VRCA 2VHTA 4DLKA 2J4FA 1VJ1A 1NLMA 3ELUA 4EZIA 4IKOA 3HNOA 4YI5A 2C58A 3SK0A 5KMGA 2ZB8A 3B53X 4YV1A 4Z2YA 2E4WA 1CUSA 1Q92A 2CWWA 4OLAA 1ZOOA 2OK8A 1P8JA 3PLNA 3CM0A 1JI0A 1B4DA 3T7JA 3NHMA 4JKYA 4MVCA 2QNBA 3KLMX 5SY9A 1IE3A 1U9IA 4PANA 1Z7BA 4PAWA 1NF3A 1YB7A 2OV4A 4LZJA 4CJXA 4LVUA 1N78A 2H4WA 2HQOA 1GRRA 2Z5LA 4AICA 1FS4A 4R6XA 1FJGB 1B8UA 1E3IA 3AFOA 3K94A 5JCPA 3V80A 1BDHA 1OU0A 3CB4A 5EIBC 2H3EA 4MQLA 3U4QB 3QU4A 1SKBA 2AMFA 1J2RA 2CFTA 2HO4A 4RHUA 5KSOA 1A72A 2CNOA 4AJHA 1YZVA