2JAOA

Crystal structure of d12n variant of mouse cytosolic 5'(3')- deoxyribonucleotidase (cdn) in complex with deoxyguanosine 5'- monophosphate
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
196
structure length
196
Chain Sequence
KRPVRVLVNMDGVLADFESGLLQGFRRRFPEEPHVPLEQRRGFLANEQYGALRPDLAEKVASVYESPGFFLNLEPIPGALDALREMNDMKDTEVFICTTPLLKYDHCVGEKYRWVEQNLGPEFVERIILTRDKTVVMGDLLIDDKDNIQGLEETPSWEHILFTCCHNQHLALPPTRRRLLSWSDNWRGIIESKRAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of Human and Murine Deoxyribonucleotidases: Insights Into Recognition of Substrates and Nucleotide Analogues.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
molecule keywords 5'(3')-DEOXYRIBONUCLEOTIDASE
total genus 72
structure length 196
sequence length 196
ec nomenclature ec 3.1.3.-:
pdb deposition date 2006-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06941 NT5C 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.40 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Deoxyribonucleotidase; domain 2 2jaoA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2jaoA01
2FPUA 4XQ0A 1Z4PX 2CFTA 2HHLA 2RB5A 5AKXA 3IJ5A 4CF5A 1S8OA 4UARA 4NV0A 4BNDB 2Q5EA 3KBBA 2AH5A 4KX5A 4BEVA 1Z4IA 2DQSA 2RARA 3HLTA 4O8CA 1Y8AA 3A1DA 3M1YA 4YH1A 3QU9A 4B6JA 3R09A 4AP9A 3OCWA 2MU1A 1T5SA 5AKYA 4I9GA 1SU4A 5AM3A 1MH9A 1SWVA 1WZCA 1RMQA 3SHQA 3SLRA 5FP0A 3AR2A 2ZBGA 1ZD3A 5AKKA 1F5SA 5ALTA 1T5TA 3N8GA 3UM9A 4DWOA 3KD3A 1L8LA 2ODAA 3ZI4A 5AW3A 4JDPA 1RKQA 1Q91A 5AVTA 3QUTA 1RKUA 3I76A 1Z4NA 3FZQA 4E88A 3E8MA 2NO4A 2QLTA 2GO7A 3A1CA 4UM5A 5AK5A 4KNWA 1QQ5A 1RKVA 1U7PA 2OM6A 3WK5A 4G9BA 5AI6A 4I9FA 1QQ7A 4UMVA 3QU5A 1U02A 3A1EA 1QH9A 4PNHA 1Z5UA 2W43A 3QX7A 4OHFA 3ZU6A 1XPJA 4HGOA 3B9RA 4UMFA 2PR7A 1ZS9A 5ALGA 2GHTA 3R4CA 1QYIA 4HGQA 4Y2PA 2HOQA 3ZX5A 3UMBA 1IWOA 5AICA 2HEGA 3WK4A 5AI8A 4DW8A 5AK3A 1L7OA 1KYTA 2B1RA 3CZ4A 3L7YA 5AKZA 2WF6A 3VAYA 2I55A 5ALYA 3N1UA 2YMMA 2R8ZA 2CFRA 5AW6A 5AW7A 1VJRA 5AIBA 2RBKA 4EENA 2OYCA 4YCMA 3N07A 1SWWA 1EK1A 2C9MA 2G07A 3L1UA 1ZRNA 5ALZA 2NO5A 4CE6A 2HF2A 3W5BA 3U7EB 2I6XA 3L8HA 4UU0A 3EWIA 3I28A 1QQ6A 4F71A 5AVSA 1RPZA 3EF0A 3PDWA 1RC8A 3OCYA 1L8OA 2WF9A 3I1YA 5AVUA 4L6CA 3WK6A 5ALJA 5JJBA 5AIAA 3ZWDA 2GHQA 3OCZA 4UMDA 2AMYA 2I34A 2YMPA 3AR9A 3ESQA 3L8FA 2YFYA 3ZW7A 1WVIA 4F72A 1Z4JA 2FPXA 2W11A 3NIWA 2ZBFA 4NAVA 4HGPA 1RLOA 5ALXA 3WKAA 2HCFA 2IOHA 2WF8A 5AW5A 1S2OA 4L6AA 4BBJA 1EK2A 3D6JA 3OPXA 1K1EA 3WKCA 3I6BA 2P69A 3A3YA 3N5KA 5ALSA 2BY4A 3AR5A 4RESA 3PCTA 3J7TA 3OCXA 1T9ZA 2YMLA 1TJ5A 3BA6A 1ZD5A 4UM7A 2HO4A 5AW9A 1Z4LA 4UAUA 3FGOA 3S6JA 3OCUA 2IA5A 1Z88A 1RRCA 5AW2A 2B0CA 2HI0A 3ZTYA 5ALFA 4GIBA 3QGMA 4EX7A 1U2TA 4KN8A 2W4MA 1TJ3A 2C4NA 2B8JA 3HYCA 4MWOA 1YV9A 3QYPA 2P11A 3ZTWA 4RETA 2FUCA 1VFPA 5ALIA 1ZJJA 3E84A 1NRWA 2R8YA 2YJ5A 2WHEA 3L8EA 5T41A 2ZXEA 3PGVA 3WKBA 2OBBA 1ZOLA 2D2VA 3KDPA 4XOUA 4Y2JA 3SF0A 2NYVA 1ZD2P 4YIHA 2QYHA 3KZXA 1ZD4A 2IOFA 1TA0A 4QJBA 4BX2A 5AW4A 5AW0A 1L7NA 2EATA 1XP5A 4OCZA 3W5AA 5ALQA 4KYTA 2FI1A 4HGRA 4HGNA 3QLEA 2G08A 3WGUA 4HAIA 5AW1A 2WF7A 3U19A 4IG4A 4FFDA 4Y2UA 4BX3A 3L1VA 3W5DA 2FEAA 4NFLA 3MC1A 5ALEA 3SMVA 3SD7A 4AS2A 2HF7A 3QUBA 4BX0A 4C4RA 1WPGA 3AR4A 3UMGA 2ZBEA 5AVVA 5IS2A 4UASA 1L7PA 5AK6A 1RLMA 2JAUA 4G63A 1Z4QA 3N28A 4MUMA 1YDFA 1X42A 4ZEXA 3RF6A 5AM1A 3NUQA 3ZUPA 2YJ4A 2ZG6A 5AHXA 4JB3A 2YN4A 3NALA 5IT4A 2Q4RA 3AR8A 3U7GA 2B1QA 5A3RA 1L7MA 2MSNA 2YJ3A 4EEKA 1VJ5A 4YCNA 5AM4A 4UAVA 3WK8A 4OD0A 2R8XA 2G1AA 1O03A 3DV9A 4Y3UA 2X4DA 5AI4A 4Y2SA 1ZRMA 5AK4A 2P27A 2ZOSA 3U7FB 1RQLA 2R8EA 2I54A 2BDEA 4C4SA 3GYGA 4H1WA 1JUDA 1N8NA 3QU2A 4Y2VA 4UW9A 2IOFK 3RFUA 3WK9A 3WK7A 2JAWA 5A3SA 4DFDA 4Y2RA 2B30A 3UMCA 3ONNA 2GFHA 2WF5A 3CNHA 1YJ5A 2ZBDA 3QUCA 4DCCA 4EZEA 5A3QA 2WM8A 5AI0A 4CF4A 4EELA 5AVQA 3E81A 2P9JA 4KX3A 2HX1A 4HYTA 3EPRA 2FUEA 5AM0A 3DAOA 2YJ6A 1CQZA 3IRUA 3SKYA 2JARA 3L5KA 5ALOA 3TLMA 2GMWA 2AGVA 4CF3A 4J2TA 4XE5A 1WR8A 2C8KA 2FPWA 1NNLA 3P96A 2FDRA 4IFTA 5AI5A 1J8DA 5AM5A 5ALRA 2CFSA 1Z4MA 3F9RA 5AKJA 3DDHA 1Z4OA 3R9KA 3ZVNA 3W5CA 1YNSA 2Q4TA 3MPOA 1N9KA 1CR6A 2I33A 3NASA 4QQFA 4YGYA 3NRJA 5ALLA 4AS3A 4UMEA 4OFZA 3WKEA 4NABA 3BWVA 2CN1A 3OCVA 3AR3A 5ALUA 2WFAA 5AKIA 5ALPA 4YIKA 3FM9A 3PGLA 3MMZA 5ALWA 3KC2A 1RMYA 2YBDA 1FEZA 5ALDA 3WGVA 3K1ZA 4BEWA 2IYEA 1LTQA 4ZEWA 1U7OA 3KOOA 1RLTA 3L0CA 3MN1A 3L0YA 2EAUA 2PKEA 3SKXA 4C4TA 4FYPA 1TE2A 1NF2A 3U13A 3IB6A 3QXGA 5ALVA 2HSZA 5E0OA 2O2XA 3NAMA 3DNPA 5AM2A 3ZVMA 3AR6A 2G06A 2VKQA 2YY6A 2G0AA 2RAVA 1U2SA 3QU7A 4BKMA 3QU4A 1Z4KA 5AVXA 2AUTA 3AR7A 2B8EA 4Y2QA 1AQ6A 3L8GA 1YMQA 3FPBA 5AKLA 5AKEA 1LVHA 5ALHA 4YCLA 1RDFA 1L6RA 5AVWA 1RMTA 5AI9A 1O08A 1Q92A 4NWIA 4FE3A 4Y2XA 3EF1A 2JGAA 2O9JA 3OTQA 2C88A 3ET5A 3ZX4A 4CNQA 4J03A 3ESRA 2BDUA 2G09A 3U26A 3NANA 5AVYA 1PW5A 2G80A 4XPZA 3U7HB 3QUQA 3FPSA 4Y2TA 4L57A 1RQNA 5AW8A 2OA0A 5IT0A 3ED5A 3B9BA 4UU1A 5AKHA 2C8LA 2FPRA 4EX6A 4BYGA 2PQ0A 4ZEVA 3FVVA 1YS9A 3L0BA 5ALNA 2I7DA 2B82A 4BNDA 3ET4A 2FPSA 1TJ4A 3ZWKA 3B8EA 4UATA 3E58A 4KNVA 2EARA 3QNMA 5ALKA 1J97A 3ZVLA 3M9LA 5AKGA 5AVZA 4GXTA 2YMQA 1Z5GA 4Y2YA 5ALMA 2JAOA 5AESA 5AVRA 2HDOA 1XVIA 3WKDA
chains in the Genus database with same CATH superfamily
3H5AA 1U16A 1EFUA 3SOPA 3SJUA 3SPXA 4F5ZA 1C3CA 2BZ1A 3G8CA 4Y18A 1DAPA 1J2JA 1PG0A 2YZGA 1VPVA 3A25A 1QYCA 2H7VA 4B7UA 4JYPA 1MAHA 3FNFA 4L8GA 5D00A 1C9YA 4OQ4A 4XVCA 4TV8A 2CV2A 2AN1A 3A06A 3LFHA 4UARA 1EUCA 1JNXX 2PYZA 4GGPA 1ZO8A 4BP8A 3HK2A 4RIHA 3MA0A 1G20E 4QAQA 1R6VA 3PFGA 1Z8FA 4UQOA 1XAHA 3ZH9B 4ASUD 1W1WA 1Z33A 3KHKA 4O8ZA 2X0FA 4ZCTA 4I1VA 1HLDA 4FLEA 2PUVA 2Y99A 4B3BA 1LI5A 5FFMA 1S3IA 2RGRA 3UK2A 2W0MA 5CITA 4ITRC 5ECDA 4H3VA 3S8MA 1N2OA 2WJ3A 2LTAA 2X0JA 1BG6A 3BQ9A 3T1QA 1U3TA 3X1MA 3V46A 2UZAA 4G5SA 1SBTA 4YQYA 1SWVA 4D9JA 1H1LA 1U7UA 5EZYB 2LR0A 1WKCA 1O54A 3B6ZA 3FUWA 5JYEA 1ZNWA 4QNRA 2C2KA 3KEQA 3JQGA 2VKTA 3DCYA 2BHSA 1RFGE 1RLIA 3L7JA 1I2MA 2JH8A 1CB7A 3LV8A 4L02A 1TM5E 2C9DA 2VCYA 3EARA 1NI4A 2DFLA 2VNHA 3HE3A 3Q9LA 3K71B 2AJBA 4RANA 3IT2A 2XADA 3K72B 4PNEA 3LS2A 2G63A 2NIPA 3CMCO 4NDAA 4KNWA 3PQCA 1US8A 5IJWA 1BMTA 1H0HA 5AHKA 3M6IA 3CZ9A 4DJDC 3B6IA 2WWHA 1SKBA 1XU4A 4LRYA 1XZHA 3QFHA 2CLFB 3FYHA 2GASA 3NEYA 2XGJA 5E6UB 5GGYA 1I2AA 1MO2A 3KFXA 1YJCA 3KVVA 5JJKA 1L4EA 2Q9BA 1KEPA 1SCJA 2ORIA 4UXHA 3NUZA 3ESBA 1YFEA 5E3JA 2ADMA 3DL0A 2GJ9A 1QLWA 2V7UA 5FHRA 1C4KA 3WYFA 2V7XA 1MJ5A 3GCZA 5ALGA 3TNYA 2RK6A 2XAUA 3U1TA 2RIRA 1PO7A 1WUKS 4ESVA 1C7IA 2RSLA 2WSYB 5EHQA 2OG2A 4QFMA 3PJRA 3R0ZA 4PTLA 4KW7A 1PYOA 5EHNA 1WOMA 3MWYW 4RENA 1I8TA 2BF7A 2QU8A 521PA 3DVSX 4H7HA 4XX0B 3URMA 5G3YA 1QHSA 2WTXA 1FURA 1D2EA 1K27A 1NKSA 5FBQB 3K0CC 3SN6A 2R8ZA 1HQCA 5IYZA 1HLGA 4IGIA 3VPAA 5AW6A 1NHWA 3JQBC 3A1NA 3N8HA 3OWXA 4BGEA 3OCCA 1W19A 3AUUA 3ZGYA 4PVDA 4EMTA 2Q1YA 2EX1A 4OYHA 4GKKB 4I1UA 2LDXA 5IZCA 1EK1A 1S2GA 3L82B 5DHUA 2C9MA 3KV1A 1FX0A 1X1DA 4D7AA 2PN1A 1GL7A 1YZUA 3C3XA 3X43A 3ZI7A 4ZI2A 1YL7A 1PR3A 4D43A 5HOEA 2O48X 2P7HA 3QI7A 4JLUA 1JSCA 2WBLC 3WYGA 2O59A 2P5YA 1D1SA 1UP6A 1JX6A 3L8HA 3ND9A 1NNSA 4FFRA 1NKTA 5T5QA 1L4LA 5BV7A 1PBNA 3MT7A 2YJTD 4LHEA 5JO9A 4Q1CA 3R7SA 1DBRA 4F2WA 1IM8A 1JBKA 1FRVA 4IJMA 3C6QA 1YZLA 5D5QA 5IC5A 2G04A 2H0RA 5K4HA 1KEZA 1N2IA 1MW8X 1VGQA 2OZPA 3IPXA 2ZYSA 3AV3A 3LHFA 4URFA 4X92A 3IDAA 1KJ8A 2Z1DA 3G5LA 5HJEA 1ZSVA 3UWOA 3HCBA 3DLPX 1OI2A 5JRDS 2BH9A 2VK4A 2QTGA 3I1IA 4GXNA 4KAFA 4QLBA 1QRUA 1ZVVA 2A9FA 1N0IA 3VKWA 1W0JD 4WCDA 4ZQCB 1PWXA 3T52A 3L8FA 1WD5A 3C8UA 2YFYA 4Q7EA 2WKWA 1L5MA 4BNFA 1JG4A 2EKBA 1XZKA 4G6ZA 3OKPA 4KQIA 3O83A 4ZAWA 4B8WA 4GNRA 3ENKA 4H15A 3JAMA 3KKQA 1AUOA 2WHPA 3NNDA 2D3TA 3OO1A 3VKUA 3ZK9A 4S05A 4Y0NA 4KH1A 1P39A 2N0SA 2ZE6A 3EGOA 1GRNA 5EIBD 2CLDX 3CUYA 3F49S 1I10A 4FYJA 5EYPB 5H3LA 1I3LA 5IW8A 3T5MA 1X8LA 5BXYA 4ADLA 2XTAA 3W04A 4OF4A 3QRWA 4HDSB 1LBTA 1TLFA 4GKVA 1Z2DA 1CE8A 4PG5A 4EZBA 1H4VB 3I23A 3OT4A 3TZHA 3WGHA 2X9VA 4YP6A 2FW9A 2HPVA 1MEEA 4KO3S 1U1EA 2HHCA 3H2ZA 3NZEA 1TXGA 4KWTA 3VNAA 4ZYVA 1PP4A 3DHWC 4ZT7A 4K2HA 3L93A 3WB1A 3RFFA 5BNWA 1V1RA 2GCEA 3EDOA 3HDJA 4X20A 1XKXA 3WL6A 1NNUA 2OZLA 1EGHA 1AKVA 1NUHA 3DE2X 3HG7A 5DZSA 1GU0A 1U31A 4RSGA 4MR9A 5PNTA 4LFAB 4P7JA 5IDXA 1XTPA 3USCS 4DCPA 2BHLA 3ZTWA 4KIFA 2YXLA 2EFHB 2JAPA 3BWDD 4DWVA 1YR9A 3ILHA 4DR2B 2VTVA 3QBTA 4UXJA 2VHWA 3I9KA 3PFIA 4Z51A 2Q6VA 5CTAA 3S2SA 1ZMRA 4ZOLB 2BKVA 1Q12A 1VMKA 1UBJS 2EJUA 4TXJA 1AX9A 2AEMA 2BVNA 1P4GA 2JD2A 3G5UA 3MHPA 1TAUA 3FGNA 3WSTA 1JXOA 2PPVA 2Z8ZA 1E0KA 1CNFA 3O7MA 5ICFA 4MO9A 1DAKA 2BFEA 5F1KA 3ZNNA 4GEGA 3W77A 2Z9DA 3STVA 5JZVA 4IDNA 4S12A 3TLEA 3KVYA 4JC5A 4GR9A 1GV0A 2QVXX 2H5LA 2DFDA 4E5KA 1FSPA 2X2PA 4G26A 3SE0A 1C80A 4BJ3A 1P5ZB 3NGXA 5JQWA 5LA6B 2DUUA 1L5VA 1TM4E 3O3CA 1XP5A 4HUJA 5TR9A 2Y9PB 2R6FA 2XKBA 3FNBA 4KYTA 1BD3A 4P7BA 4BGDA 4C7XA 1PJQA 4G0WA 2CL0X 2QQEA 3UJDA 4JC0A 1AF4A 1UPXA 2CVHA 5SICE 1KBQA 1G9TA 1GN8A 1HYEA 1CR1A 1FMTA 2XMBA 5P8WA 3CU5A 2FF5A 1MPXA 2NVWA 2JATA 1VYUA 2QX7A 3EUAA 4IG4A 3H1AA 3OJEA 3KOWA 1RE1A 1UPUA 4YHBA 4M53A 2VAWA 4P36A 4DS3A 3RC8A 2O5CA 1HZJA 1VBMA 2FG7C 1VOTA 4OQQA 2FJPA 4PZDA 2ETVA 4AS2A 3DZJA 2EBWA 3OF5A 4UCFA 6AT1A 1WXWA 4F91B 3CVJA 5COAA 2P2ZA 1K88A 2B6NA 3QE4A 4EI8A 2BGJA 1ECPA 4A03A 5U9CA 5I51A 1L7PA 4PN7A 3KLOA 2JAUA 4NK5A 4D92A 1XZJA 1T9HA 3RANA 3SQMA 2GRJA 1E4VA 1DO8A 2E5WA 1XKTA 1SB9A 1NHGA 2ZIWB 3QLUC 3ZU5A 2A0FA 3KQHA 3QV1A 5ER9A 3CMMA 1P1RA 1A04A 1FVFA 2QD5A 4N9WA 5LYJA 4F12A 2QRQA 4ENPA 3ITNA 5H70A 1A97A 4C2AA 4QYMA 4ESEA 4MVWA 5FBRB 1HEIA 4EARA 2PAFA 2VPTA 3QK7A 3BEDA 3M3HA 3QSGA 4CG2A 4ZV4A 5JIBA 1QC5B 4P58A 5B37A 1QG0A 1S2MA 2ZSJA 3PLNA 1G4HA 4XJVA 1Z7EA 2C5HA 3EH1A 4DIBA 4RKQA 4TL6A 4RCVA 4NLEA 4DJFC 1NN1A 1RQRA 4LGCA 3BYZA 4EPRA 3HPQA 1NLUA 1C3UA 2G1AA 4I7EA 4LWZA 3LL4A 4WKOA 2AT1A 4Q82A 2EJCA 3BXZA 1VZ3A 1IHYA 4JQCA 5A2QA 3T06B 3LHKA 4H18A 3GYGA 4KAAA 1LSSA 4QUIA 1UBOS 4WT7A 5AOVA 3C6BA 1PK8A 3U80A 2YC2C 3ZDRA 1USIA 3BXGA 2A1UA 3PEEA 2JAWA 4C6SA 1XEWY 3FVQA 3OTGA 4E1VA 1A98A 1NV9A 1NWCA 2AN3A 3QW2A 4H3KB 5I5GA 1UJNA 2XCTB 4KXUA 4OB6A 1K3UB 3G02A 3H8WA 1YU6A 1T8UA 4LXXA 5DHSA 3SVLA 2RGUA 3QX3A 2BEWB 2A0XA 4Q4HB 5FLKA 1EINA 2PJZA 4E33A 4HDQB 2D59A 4B48A 2CLMB 3HR8A 4DCCA 4AYWA 2OB1A 1FX0B 3K94A 5IKOA 3ND6A 4G2TA 2VR1A 4NHOA 4TTAA 4TYQA 4PPNA 3VU8A 2O7SA 1EXVA 4J29A 3F7TA 4ISCA 1CHDA 2NZJA 2PYDA 4OLAA 1MXHA 1JLLA 4RD3A 2C8VA 2ECQA 1JFSA 1NUAA 3OJOA 1YUNA 1SUWA 2Q0XA 4TS4A 1OTHA 5TEWA 3MJRA 3ZU2A 3E70C 2IHBA 3TWOA 2NVBA 2PXAA 4JI7B 2O2HA 1KO1A 2CNBA 1BVRA 5FO1A 3RIMA 3F8SA 3G7NA 3HP1A 4FFMA 5A4DA 1AXRA 4E4YA 1BAPA 1T4DA 1Y82A 1ZEMA 1KDRA 3GG2A 3IGFA 1K06A 1MB4A 2K7ZA 2OV6A 3NHWA 3D3QA 1G7SA 3ZJYA 3JZFA 1Z28A 2V9ZA 3ZCXA 1YA6A 1ULZA 4HQNA 3CZ5A 1A82A 1UDWA 2ZUBA 3AEZA 1HE1C 2P77A 4XR4A 5DVZA 1I7PA 1TTHA 2O0KA 3WLJA 1X7DA 1GZHB 4JNCA 4OQDA 3DP7A 2CXSA 2X2FA 4D9EA 2HMSA 5F5LA 1CUYA 1WW3A 3IULA 4ERXA 3K9HA 4QQFA 2RHDA 3IMFA 2DLCX 1K8XB 2BE7A 2HMYB 3HFSA 4JN6B 1G3UA 3IURA 4CJXA 1GPBA 3T3PB 3EIHA 2QSZA 3FBGA 2IELA 3D7KA 4M1KA 4Y9TA 1WXIA 1DAFA 1QMPA 1WMBA 3JQCA 3P9CA 3S8EA 5FOXA 3PGLA 1JKFA 3P0JA 2BLNA 3KC2A 4L28A 3SZMA 4ZYTA 1R9MA 4HDSA 2WD8A 1KK2A 1SBCA 5TDHA 1W0CA 4O2AB 4CMJA 1FRQA 3B1WA 1C1DB 1NF9A 1DSSG 3MN1A 2HWKA 4NZPA 4ZWNA 5FPYA 4AJJA 2DOKA 2IF2A 4LK2A 4FVTA 4WZBE 3HKCB 1QYVA 4FYPA 4R6XA 5JANA 4DLAA 4NZYA 1CUIA 1UM9B 5B4TA 1O96A 2HSZA 3BX1A 4WNIA 1YIDA 3K0SA 2D7CA 3C3JA 1NC3A 5F7OA 1Y8RB 1XF9A 4N9QA 1VI6A 3I32A 4BC1A 2AQ8A 5IRCD 3BMOA 1L7AA 2YWRA 5CB8A 3RVPA 4BN4A 1YK1A 1C4XA 4EB8A 3M9WA 4Q3NA 5GV7A 1IWPB 1KIMA 4E94A 1UT6A 2HQSA 2ZS8A 4RY2A 1M5UA 4YACA 4AS1A 2DR0A 4X3OA 1AKTA 1ZIYA 1JXMA 3TTVA 2WHQA 4J7UA 2G9ZA 2XMZA 2PZJA 2PRYA 5J5AA 2FU5C 3COPA 4LGMA 3FBWA 3WGKA 1RI2A 1GUAA 2WMNB 3FLAA 3KZVA 3M2TA 1RTTA 4UTZA 4F92B 1Q16A 4OHVA 1UBCA 4I6EA 3JVDA 3RG8A 1KVQA 2VRCA 4TS1A 2H51A 3D7NA 2ZR7A 1WBDA 1YCDA 2BFEB 2JI9A 3K5WA 3L7OA 4DIMA 4IOKA 1D2RA 1I01A 2INGX 2GEKA 1JTFA 4ZO8A 3HCEA 4P93A 3O0DA 3RUIA 5IAAA 4FFVA 3W3AH 4IXWA 1V6CA 3K73O 1T4BA 3OETA 5K0TA 1QWOA 1HPLA 2ZXUA 1Q0RA 1X70A 2RGXA 2RAUA 5GZ6A 2MINA 1OZHA 4UBMA 4M7RA 3ROFA 3O2SB 1E0DA 2X0RA 3ENVA 3UA4A 4EYQA 2E5LB 4OGKA 2IGTA 5G4LA 4AY3A 1UP4A 4C76A 2D2IA 2ZBQA 2VPPA 3JYPA 1UMCB 4KR9A 3L0PA 3ZDCA 4KLAA 5KVAA 4KCGA 2BEUB 4ZHQA 3H3FA 3FPSA 2DP4E 5DYWA 2Q5QA 1X1SA 4BAUA 1M5RA 1KI2A 2UXBB 1NN5A 2PKYX 3PUVA 1OT3A 2PY6A 3ORYA 1SU6A 3TN7A 4E12A 2NVUA 4KPUB 4RM3A 4BMSA 3GT3A 4RKYA 2J87A 4TKZA 1WU7A 2DFTA 3Q12A 3ER9A 1JAHA 2AFHA 3IT0A 3KE9A 5K8IA 1TM7E 3T4XA 4L9AA 1DOAA 2GPBA 4FKBA 1GGMA 3L0BA 3MSXA 2QG4A 3OJWA 2GO1A 4KQHA 4MP8A 4PRZA 1L5LA 2GJAA 4CM4A 1K5HA 2COEA 4KU4A 5DYGA 2EW2A 5AVJA 3INNA 3FJYA 4PZLA 1GGEA 1SHUX 2J7PA 2PTRA 5E1MA 1BXRA 3GJYA 4IIJF 1AGPA 2R1VA 2LBPA 4QOIA 4YONB 4YDHB 5JCJA 3T5DA 4Q4DA 4HAWA 1J7JA 2WPDA 4XARA 1BW9A 3CVXA 2PFKA 3BHIA 3ZBUA 1RJ9B 4FFSA 2WI8A 4ZMSA 5FRDA 4KQGA 2HDOA 3PX7A 1AS0A 3T15A 3GLHB 2UXCB 3EBLA 4V2UA 1IG3A 1KSGA 4ZFNA 1G9SA 1PJZA 2JZCA 2B9VA 4WMLA 2WYWA 3EIFA 3SZUA 2ZJZA 4V0QA 1AG9A 1K8QA 1TVMA 2JGEA 2YOGA 3WNBA 4CF5A 3HVJA 4HNTA 1PJ8A 2CLKB 5K6AC 3AJAA 4F21A 3UK6A 3E7WA 1KEEB 4BEVA 2NZUG 1F51E 2YASA 1NXTA 1PVDA 4OXKA 4WE3A 4HATA 2IHZA 5H3CA 5KDDA 5JH7B 4ZXFA 4EY4A 3M89A 4ALJA 3M1YA 4FMDB 4JBXA 2GPAA 2VP9A 1M7BA 1IE3A 1OI3A 1RU3A 2ZR9A 1K8ZB 3L18A 4ZEOA 4WZ6A 3BSYA 4OHZA 2G1PA 1WL8A 2V5UA 4A0FA 5C9ZA 1CPYA 1Y5RA 2Q8NA 2JLCA 1XQ9A 2PMWB 1DJPA 1NBEA 1T5BA 2I1VB 2QRUA 2RMKA 3PUHA 3QHPA 4C30A 3SS9X 4YT8A 1BX1A 1XCLA 4L4RA 4REMA 4F5EA 4M9UA 1CJUC 1ZIPA 2H4XA 2H9AA 1ZD3A 1FFHA 1TRKA 4CKBB 1F5SA 1WV0A 4WJLA 1UZUA 3UC5A 5BUCA 3H9JA 2QAGA 2IP1A 2POCA 2ZR0A 1VC2A 2DFPA 4MWGA 1A9RA 3OZAA 3IVXA 4UNNA 2BTEA 1GDDA 1TUIA 2C61A 1Y34E 1DXOA 1EBUA 1T8TA 5A5VA 3M6XA 3FYCA 4IILA 3URKA 4PX2A 2VYVA 4NU0A 4R8MA 3L40A 4ABTA 1GKIA 2XYQA 3R3SA 2IJGX 2Q2OA 4NKRA 1J2RA 2W5UA 4O4JB 1VIYA 2QGNA 2ZSAA 3DZIA 2WK1A 1NVBA 5EUMA 1QQ5A 2GM4A 2PKQO 2QD3A 3C5CA 3CLRD 4UVHA 5GVRA 5B3JA 3WK5A 3WQRA 4BB5A 2WVAA 1E9FA 1N9ZA 3PJDA 1LDBA 4LSMA 3OP1A 2GDJA 2AJLI 5DYIA 4N8DA 3W3AD 1CZNA 2BGLA 3MJTA 4PZ0A 4CIVA 1IDOA 2CMKA 3P8ZA 2NU6A 3CH6A 1EM8B 5G4KA 3UWPA 3PFKA 5JMWA 4X9XA 2EW8A 3OZ7A 4Y9UA 1U9CA 4YWHA 3HVIA 3E3OA 2VDPB 4J0GA 2W6OA 1LJ8A 2OXTA 4KQKA 1EMDA 1A9ZA 4AJEA 1N92A 2ISQA 3PGKA 4HLUA 3ES9A 4X0EA 4FZ5A 1O9BA 2L19A 2V8BA 1ACLA 4NAUA 4LJ4A 2JFQA 4JGIA 4LN1A 4ETWA 4LX0A 5AUOB 5KQRA 3DFKA 2QOEA 4NECA 3OQIA 3K20A 1KIFA 1L5RA 1E2DA 3H2BA 4PLFA 5HBRA 2O2SA 2Q1SA 2BJHA 5FIUA 1B3RA 3GEHA 5HIKA 1QG2A 3UNXA 3QTLA 3AHGA 2XT0A 5DNCA 4EKGA 2O2IA 4LVUA 2Q1XA 4ML3A 4EENA 4JOSA 2GXUA 2UKDA 1MH1A 2Q49A 3HWSA 2XNJA 1M1XB 1SWWA 1E7RA 1U2GA 3DV0B 3GCDA 4QYTA 3AU9A 4IOMA 1CUVA 4LNAA 3D31A 1WCV1 3FMPB 4CM6A 2AC4A 3E61A 3B52X 1UR5A 3SS8A 3NCTA 4X90A 4XDGA 1BWRA 4HDOB 3OM0A 4D0LB 2YWDA 4I50F 4IDDA 5L3QB 3C4QA 3WRXA 2PV7A 3CWZA 5KYUA 3K16A 4D45A 4ARZA 5IKPA 1JHZA 3WBBA 1W5EA 3AW9A 1S4MA 3ZQ6A 4Z8XA 2YQ5A 3AESA 4LG1A 4WCFB 4CXMA 1HI9A 1ZR2A 2K4MA 4I1YA 3SFTA 4DDHA 1RC8A 2BTQA 2FEOA 2OBNA 4GI1A 1BSVA 2MR6A 3GFQA 4AUKA 4DGSA 3NUGA 5LIPA 4B47A 1A7KA 3CWCA 3OU2A 3UV7A 5AVUA 3UQZA 4LTNA 5ILGA 2HHJA 3A2LA 4QATA 4G5YA 1G2QA 3A9CA 4JEIA 1NPDA 2OV2A 1GZ5A 4BO6A 1UXKA 5F9FA 3QLJA 4YALA 4I66A 2A3NA 4UMDA 1K66A 3U4CA 1RRGA 1OJLA 2FR8C 2OO7A 4INAA 4S35A 3ZGNA 5M29A 2HA2A 5E1DA 2F55A 3RS7A 4ZOBA 2ZRLA 2C5LA 5IVPA 4IRMA 4HAYA 1PV2A 3SQWA 1WVIA 1XMOB 1T3TA 3NIWA 4WXEA 2Q1TA 4W63A 4B9AA 3GJ4A 1ORWA 3O91A 2IH5A 2Q0QA 3AUJB 5JRJA 2CDAA 2NUAA 1I9CA 5J5CA 1CC1S 1QNLA 1KZHA 4QUDA 2ZIVB 4WGGA 5ED4A 2CD7A 1FJXA 3D6HA 1QHNA 4EY5A 2FPOA 2R68A 4ND8B 1T6XA 3ZHRA 2LXNA 2P9HA 2GEBA 4M9SA 4DJAA 3I9MA 3R1IA 4ENUA 3T99A 1QF6A 2IYFA 1JLKA 3V4VB 4MDYA 2JHFA 4KREA 2YV2A 3NBXX 3H1FA 1ILWA 2X40A 3DHEA 4UHKA 5JQGB 1KYXA 1F5NA 2HO4A 1G2OA 2QXTA 3AEQB 4GX2A 1SVWA 4ITUA 4DIUA 4LIPD 2VSXA 3SK0A 5HKAA 4Z4GA 4FGUA 1K7WA 1PR9A 1UPCA 2YJNA 4I5FA 3P1JA 4P80A 2W2LD 1WY7A 4C1NA 1RXSA 2A57A 4MDHA 4WVFA 1NUUA 1NW7A 4Q7LA 1PL8A 4NRDA 4F3NA 2GEUA 2H6EA 4K3UA 4B1FA 3IAHA 5HKLA 1N34B 4OHOA 4N0EA 1NBMD 2JIMA 1ZOIA 5EFOA 2K7FA 4X54A 4M0DA 1KFBB 2FUCA 1H8EA 5KI6A 3MPUA 5J43A 2XEXA 5F77A 3AUTA 2CNKA 3KQQA 3PSHA 4BBAA 4D4MA 1RYFA 1AZSC 1SULA 2PSDA 5ILQA 2V7QD 5IULC 1KI7A 2C9CA 3ECSA 3RJMA 5BMVB 3RCBA 2R84A 3BB1A 1FDVA 5KOYA 2GF0A 5GOTA 4JEUA 3T0GA 1YDHA 1C7RA 2FEPA 4JC8A 4Y7DA 2AYYA 3LYLA 1U9JA 4HN9A 4AF8A 3GTDA 1AB6A 3R0VA 5E7MA 4QARA 2FXVA 3V48A 2YVKA 4GYYA 4RW0A 4XH9B 3ROXA 4BX2A 1FXSA 1JRLA 2QTCA 4JDUA 4MGEA 4BOYA 4YR9A 4TTIA 2ZRCA 1RADA 3DKRA 3QEMB 4GKAA 4CKCA 3LHDA 5IKEA 5BWBA 2YNMC 1UFOA 2H54A 3ETDA 4XYLA 4H59A 4LZPA 4GMHA 4EGFA 3H17A 3RC7A 3IT3A 3DE1X 1P81A 1WA5A 3IAXA 4XGQA 2FPMA 2Z08A 4HGNA 3SJ7A 5ES4B 5JR3A 2G08A 1GA6A 2BMJA 2IVZA 3ED1A 4Y6SA 3S29A 3V5NA 3W06A 1DBPA 4Q3BA 5B1HA 1A5TA 4NCHA 5L3RA 1GAWA 2J3JA 3GFPA 3C6XA 1DHTA 3DAHA 4FFDA 1GZDA 5ENVA 1JFFB 2BT4A 4C43A 1DCFA 2OFXA 3VR5H 1DIGA 3NHFA 1JZSA 1Z6XA 2FPIA 4HLCA 1VCIA 1NBMA 1ODKA 1YUMA 4QM7A 1E1CB 4MTLA 4JUIA 1TJPB 3AQIA 3CBGA 4R8LA 1KJ9A 4DRXA 3D5QA 2HIAA 4RYLA 1GRVA 3INTA 4XPIB 1DEHA 2JLVA 2ZTMA 3ROMA 4UASA 2ZK7A 3M49A 4EG3A 4TV9F 5CXSA 1QP4A 3HC7A 3OQMA 3HKDA 4Y8VA 1S9HA 1U90A 4MUMA 1W8DA 4XQ9A 3I73A 4MRRA 1BS9A 1X42A 2QYOA 2WWFA 4FD3A 4XD7A 3KSZO 5DRYA 4F3KA 4Y6LA 4HX9A 2YJ4A 3CV3A 3WYNA 2YXBA 3ZUPA 5CLLA 3JAWA 1PEYA 5AJHA 3LUDA 2NTVA 3KHSA 1Z0DA 2H3EA 2IOYA 4IDBA 4WKGA 1VDKA 4CG3A 3ZD9A 5HYVA 3GUCA 2VJYA 3BK7A 2AG5A 4HEJA 4Y9DA 5IJ0B 1RXUA 1VJ5A 3VKFA 4D6YA 2FDCA 4HRVA 4HDCA 4ND6A 3R3ZA 4F7DA 2PD4A 1CQXA 3ANLA 4BFWA 2LDBA 2G5GX 2A4MA 2NQ8A 2YZKA 1O03A 3MZ0A 4D9NA 2IEZA 4IHQA 1CEYA 1N36B 2CUNA 3R9XB 1JU9A 2ODBA 1M34E 3WMGA 5E6SB 4BVLA 4HUQB 2WJJA 1B43A 3ZCQA 1ZUD1 5M5BA 5EWJB 3SC4A 1VLLA 2G36A 4JGGA 1OXBB 1XZCA 3DEFA 3HQ4O 4RX1A 4UKDA 2PEZA 2G25A 3IP7A 4ZZ1A 4TV8B 5IU6A 2XWPA 1WXEA 1PFUA 5I9LA 1UBSB 3WK7A 4M1QA 2FHPA 3NAQA 2ERYA 4FMCB 4Q9IA 3AUYA 4LXQA 3J81k 2XNDD 3R5XA 4CLXA 3F3KA 4LY0A 4XYEA 1NOKA 4Y2RA 4D96A 4AI6A 1LV8A 3VC2A 3ONNA 4JQOA 1R8QA 3K4PA 3B5IA 1H42A 2DPMA 2O06A 1VE9A 3OSUA 3PNVA 3PXXA 4LJKA 3GLHE 5ESWA 5C31A 1NYQA 1ST2A 5ICSA 4Z4EA 1O6GA 1ZVQA 3N2YA 3EZXA 3BL5A 4GL4A 4KQJA 4E08A 5AI0A 2AK2A 4OATA 5K0FA 5KOJB 4KV9A 5G0VA 1F7VA 4P0QB 2RHMA 5JARA 2H8KA 1FNCA 1JSXA 1R6XA 3MOIA 4YO8A 4FDMA 3OCFA 5KYUB 4FN4A 2X5JO 2ZUEA 2XDAA 1T5DX 1IOVA 3C8ZA 4DABA 1EWQA 1A5AB 3U4GA 3DYBA 3V9PA 4EF4A 3SKVA 1ZD9A 1S1CA 1V26A 2UVDA 2DHCA 2C4VA 2PV0A 2DG2A 2XUJA 1KJNA 3OPMA 2V1XA 3PVSA 4MW0A 1KDTA 3VAAA 4BV2A 2QAGC 4PWYA 4O0LA 1HSZA 4EDFA 4F04A 3SS7X 1CR4A 1JNYA 3QPUA 2H7XA 2OY0A 3U3MA 3C3YA 1UKCA 2RAPA 3MAAC 4LZZA 3WWZA 3I1FA 5DBFA 4R0NA 4JT9A 1VLJA 2GWRA 5SY9A 3KSRA 5TNXA 1KI3A 4Q3DA 4KYIB 1EIWA 1XDGA 1Z4OA 2HT6A 1WHTA 2QZ9A 3E0XA 2G8LA 3MGGA 2F8TA 2WUDA 2CL6X 1GPJA 1YNSA 2PWYA 4OI1A 2XZLA 2VHUA 3VSEA 1WIWA 4FOOA 3TLBA 3JZMA 4I0WB 4ATNA 4PG4A 4LQDA 1RWBA 3MT0A 4CTKA 1G3RA 1DCNA 2R79A 4WFIA 1A0OA 2I2DA 4G9EA 3RRFA 3T7DA 4C87A 2G9QA 4E22A 4NABA 2OYSA 5CM8B 2XW6A 1C1HA 2P9ZA 1JHXA 1BFKA 1HKHA 2XYRA 5BOVA 3R44A 4FNMA 4DUGA 3ZGVA 2JJYA 3AESB 4WCFA 3NEJA 3RK1A 1LUAA 4JXJA 2X22A 2YBDA 4ZT5A 1Q6ZA 5LZ5A 4Z9XA 2BTQB 4NV1A 3UK0A 1LTQA 4B87A 2ZUDA 4ZK2A 2YL2A 1H4QA 1PNOA 2QD2A 3DCNA 4GNKA 4LZWA 2QGFA 3UCEA 1N6LA 1RJEA 2PU7A 2WIJA 4DNXA 4BKRA 1ISPA 1FYDA 2B7CA 3QOXA 3EDQA 3FH0A 2EU8A 3CE6A 3X2SA 3COZA 2Q46A 3G79A 1GILA 1ODTC 4WIAA 3WLEA 2UZ4A 2OAP1 2P6OA 2WP8J 3RVNA 2PZLA 2UU9B 1AUXA 3HZRA 4IXTA 1BH6A 4D99A 4ITVA 3WLKX 4QWMA 3OIDA 4EHDA 1Y48E 1T0PA 4EBFA 5JJCA 1NR1A 2HWXA 2Q3MA 2BUCA 3NTVA 1XNGA 4BKMA 3QEMA 1CUAA 5J9FA 2OK8A 1KA9H 3EW7A 1BCRB 1ULTA 3AR7A 2ZAMA 4BKQA 1UUFA 1MTOA 1ZCAA 4RCYA 2ZJYA 5C8YA 3GLIA 1MHTA 4N18A 4QPZA 3SSMA 2RI0A 2DULA 3MWJA 4Q05A 1XZQA 5IBCA 1HE2A 5AQEA 3RSGA 4ETIA 5C4GB 3OZRA 2JGNA 4ZGBA 2I62A 2QLFA 3C41J 3C15C 2DT8A 4S3MA 3S1LA 1J2EA 3TDMA 3L43A 1JALA 1TT5B 3WWYA 1X1TA 4UEJA 4A15A 3IKVA 1HNZB 1FFEA 1DAHA 2FLVA 4IFEA 2PGNA 1GAJA 1SCUA 3RVKA 1H9BA 2ZSIA 4M8NE 3W05A 2EL9A 2Q27A 3FB1A 2JGLA 4MWDA 4KPEC 1H2YA 4J8PA 5DLDA 4S2UA 4JEHA 3T3DA 5DPMA 2ZWVA 5E7JA 1W46A 1GYQA 2VTBB 2MYUA 3RU9A 1PV4A 2G80A 3D8BA 4QSHA 1QH8A 5HCNA 4OPMA 4EPWA 3TG2A 3WMWA 1ZK1A 5CH8A 3QF4A 3H19A 2PJUA 1TYZA 3CRRA 4MIEA 4D80A 3A4YA 4ZK6A 3LZCA 4WDQA 3CHYA 3E03A 2NZVG 3KB1A 4WLFA 4DPLA 2EQ5A 4CQNA 3I39X 1GT91 1PFGA 5CDTA 4L15A 1JQDA 3BSSA 3BWXA 2NM0A 2ZB7A 1P0IA 3MXTA 1K4MA 2BEKA 2XUKA 3W7VA 1VSUA 4OJYA 3KKPA 5HW2A 4JBGA 3VOAA 4EUKA 1GSAA 2Q4OA 5CW1A 2EGHA 5DH9A 2EFYA 5DXAA 2IDZA 3ODGA 1JFTA 1EJ2A 2AOTA 1DIAA 4HWKA 1NFRA 4MW7A 1H8HA 4OBXA 2AV6A 2IZOA 3GEGA 5DLYA 1L3IA 1J97A 3SZRA 4C05A 1TQDA 2AOXA 4EFDA 1SBYA 1W93A 2JEYA 2V7TA 4TTTS 1X1BA 4L27A 4DZZA 5HHTA 5DLEA 5GIPE 1P2UA 1BXKA 4YBRA 5NLLA 2GM5A 4TSFD 5HF5A 4P86A 2WM2A 4KJZA 4BE9A 4G89A 1J5EB 1Q7BA 3OOYA 3V80A 3OHPA 1G3MA 2VIIA 1MB0A 2IVFA 2GRAA 1E3SA 1ECCA 5HILA 4ZPXA 3GD7A 4F4HA 4XDZA 1KQGA 4J76A 3AY0A 1T5OA 4OL0A 3ML1A 1KMHB 1DS6A 3FDIA 2HF9A 2JIOA 1ZD8A 1G8SA 3B13B 1I2BA 1R0WA 1TJNA 3IEPA 3MRVA 4ND8A 3S2FA 5EHIA 2JI8A 2Y3IA 3KOXA 1SXGA 5D87A 3RAGA 3WGQA 4PCLA 4W7HA 4BECA 2G4LA 3E5NA 1V11B 2TMDA 4WZAB 3ULKA 4MDFA 2Q28A 3QA9A 2VYNA 4PC1A 5A7GA 4E2YA 1HDOA 2RDMA 4AP9A 2Q6OA 4Q9DA 2BGKA 3HZZA 3TVYA 1ZINA 1E6CA 4XQEA 2R6HA 4QFCA 3AIOA 4CMHA 2O54A 1RMQA 3EIXA 3LHSA 3OVMA 5CLHA 4B0OA 3DVQX 2ZBGA 2FZWA 4O02B 3DGFC 5G1NA 1CZRA 2FDXA 2QQ5A 3WNVA 3E3AA 3UM9A 4DDMA 1WTCA 2WIFA 5CIYA 1UWVA 4KFTA 2XCOA 2C2GA 1M8JA 4PYNA 5EWMA 4YASA 3T12A 3ENZA 5AW3A 2R9VA 5HKBA 5M34A 3RI3A 1Z3CA 3NV9A 2ONZA 3KZ1E 3KO8A 3QUTA 4WVLA 2ZTHA 1ZLYA 4E88A 1NG1A 3I52A 2NO4A 3T3IA 2QLTA 2E85A 4EVSA 1XA3A 3T3EA 1CS0A 3NI2A 4II3A 1UJ4A 4IKOA 4MVCA 4FHZA 4REQB 1RKVA 3W5HA 4LNUA 4X20B 5JLAA 1L6IA 1W0KA 3NO4A 1QYDA 2D0DA 1KOJA 2GBFA 1TDJA 1ULAA 1CULC 1HNNA 2VPWA 1W5SA 5CVDA 4BNZA 4CMIB 2BCGY 5FAKA 5CM2Z 1G1MA 4RZHA 4J0QA 1Z5UA 3I72A 2JEZA 3QX7A 3QW4B 4RNCA 5EI5A 5HZKA 1AHIA 4P81A 4DLKA 2RHTA 2YYYA 3PE3A 1ZNZA 1V8PA 2GHTA 4QBFA 5FBZA 5GM2A 3RFCA 3GFSA 3C3AA 3IPCA 3EG9A 2DCUA 1W85A 5C3MA 3OMWA 2GPNA 2AFHE 1F6BA 3FPJA 4PZYA 4DAOA 5AK3A 3DVAB 4V0OA 2FVXA 2XI4A 4Z3KA 4MKGA 4PU0A 4TTVA 3NIDB 1L5GB 4D8YA 3OD1A 5J4YA 5JO0A 2IE0A 1U1GA 4B4WA 3QBJA 4BNXA 3QOWA 4D8VA 3PRYA 4DTIA 1I4OA 2BEVB 3CW2A 3OA0A 3QQPA 4L08A 5DGIA 5EE5B 1TCAA 1ZUHA 4AJ1A 5LOVF 1EP1B 3FPLA 3AVYA 1AV7A 2EZ9A 4YCMA 3KQNA 2P67A 4PC6A 3CLSD 5DYNA 5LWHA 2WWIA 2AFIA 3U44A 1LA2A 1CQJA 3PHIA 4E70A 2J85A 3UV3A 1DEKA 2A35A 1MO6A 4LSWA 4I55F 2VDRB 1T4CB 4HB0A 3PQ5A 2WZQA 3ANSA 1CY6A 1AS2A 1W2HA 2DUWA 2QL7A 5HE8A 3QSYA 5HIIA 1II0A 4C0KA 5KNLA 4BLOA 2I2AA 4TVSA 1JHYA 3OG9A 1FFXB 1Q74A 3L6UA 4ND5A 5FPPA 1MD9A 1V6SA 2HD4A 2XOXA 3NXKA 5JS8A 3E9DA 3CISA 1KC3A 2OZKA 2R7MA 1YD7A 3FMOB 4V0LA 5FB3A 2I9PA 1NQOA 5EP3A 1KAMA 4EUNA 1Z29A 3T95A 1FW8A 1TUEA 2H00A 4YQZA 2JA1A 1EDBA 2GHQA 1C5KA 2OCAA 1ABFA 3CC8A 4QO8A 4F9EA 5A2GA 5BSVA 2UV8A 2HJ9A 1MA3A 1Y3HA 1H2WA 1S2DA 2CT8A 2QMUA 3TRJA 1H5QA 5EUCA 2VJLA 4JMLA 3TZCA 1NJ1A 1T36A 2X5OA 1CJKC 3AM5A 2NU9A 2EERA 1SXJD 1M8FA 3H05A 5EXPA 2IE8A 3KEOA 2K6GA 3ZD8A 3QEBZ 1WB5A 2JEOA 4CVNA 3MBKA 1Y3DE 2Q29A 5LZ7A 1U1IA 4QJ3A 3B7GA 3LW8A 4QUEA 2W70A 1T1RA 1U9IC 3G0DA 1CF2O 1LS1A 4FSDA 3WKCA 3PB3A 2P69A 1UXGA 1P74A 1XXLA 5MHTA 1L4BA 4RSHA 3GW8A 3GB9A 3ZZTA 1EXWA 1G21B 2NQTA 4MQLA 4Q37A 3V4FA 4A6EA 2ICAA 4K9OA 3B6MA 4D4GA 3EGCA 2UYGA 2JVKA 4RA9B 3ZEIA 4UAUA 3I6YA 4KDCA 4QBTA 1TKAA 2OV8A 2DCMA 1C4OA 2E9SA 2BONA 2UVPB 3ZTYA 1MX3A 3ELUA 3N75A 5A3JA 5BW6B 1RC0A 1XRMA 2RHHA 4D46A 5BRNA 3FVTA 3TPFA 1YKGA 1JQAA 3O4RA 1QFJA 5EIXA 2XUZA 2YWEA 5A0VA 1AKYA 4P1ZA 2BEWA 3GLGB 1PQ4A 1YZVA 5ELXA 1Q0HA 2FLKA 1I0LA 2OMEA 2VPXA 1FVOA 3R3VA 4UTXA 4EPYA 2XMGA 5LR6A 3GXOA 3DBIA 3LOQA 3VX3A 3SNKA 3DEKA 5KJ1A 1CVRA 4RAQA 2C5SA 3OEHA 1FK8A 1TEVA 1LNQA 2D7DA 4HWSA 5T41A 4C7VA 1LKZA 4JP2A 3RUPA 1VHDA 2OM2A 4U2CA 3K9FC 4EQ6A 1PS9A 2W2QA 1JA0A 5DGHA 3AHEA 3SF0A 3RUFA 1JKIA 1NP3A 1FU8A 3OQJA 1QH8B 2X2OA 4IX9A 4DCSA 4EPXA 1U8YA 3LC1O 1LSUA 4NEQA 4DDTA 2YS7A 1F6DA 3JWIA 4D8TA 3N8IA 1TC2A 4YCAA 1RWWA 2CDRA 1IQUA 2P91A 4DLPA 2UZ0A 3NONA 4K86A 4CIYA 5EC8A 2A9JA 2QW0X 4WZAE 4TS3A 2DHRA 1YZ3A 4U5QA 4DA6A 4D5EA 2NO0A 1JIKA 2R7AA 1KMMA 2FI1A 4MLCA 4TWJA 4OGWA 2PPLA 4JLKA 1K9SA 3ZE2B 3HJFA 3OC0A 3UXEA 2XUIA 1ETHA 5IYZF 2Y4NA 3AUXA 1Q50A 2BKLA 3FGPA 4JJEA 4MMXB 5H9VA 3HI6A 3WGUA 1DZIA 1UOQA 3L46A 2GYUA 3OUTA 4Q1DA 1Q11A 4U2EA 5IXYA 5JI3E 1NVAA 1BXGB 4JJGA 4RQAA 3NVKI 2JAHA 4B3GA 1WM1A 2H4WA 1FLDA 4BX3A 5HA5A 3UW1A 1DXYA 2Y1WA 4JCCA 4NZ9A 5TPWB 4EF5A 1T0JB 2H65A 4IVPA 2IUSA 5ALEA 2A5GA 3G9XA 4MR7A 3PQ8A 2Q6LA 4Q4HA 1AK9A 1LEHA 2ZRBA 3JD1A 5C35A 3K0FB 1PSZA 1ZI9A 1R9JA 5I9TA 5AK6A 1GVNB 3RAPR 1S7CA 2N42A 3L06A 2ATIA 5ICGA 1T2FA 1KJYA 2C92A 4TVKA 3PR2B 1VMEA 3C1UA 1L8XA 4B6SA 3SU8A 1IJFA 5AM1A 4FNOA 1U11A 4KHZA 4QECA 5KNBH 1JH9A 3DOCA 5B7GA 1O96B 1WPRA 2R6R1 3S2ZA 4A26A 4CV1A 1LV7A 2Q4DA 3BZUA 3VYVA 2ZWIA 4FSXA 2JFVA 3EGIA 4DHEA 3LMKA 4X6XA 4LXGA 2FMTA 2UYYA 4N54A 4O0MA 2DWOA 1Y6QA 4AY2A 1HWYA 3FOAA 1J39A 4FBGA 1IXKA 4OAPA 5AM4A 3QKTA 3F47A 1M1NB 4XFJA 3IEKA 4Q16A 3V4PB 3VYTB 2OECA 1Y4SA 4AMGA 4QDUA 1U3GA 2E2WA 2VJQA 3LX8A 4TTRA 3S2IA 4RTRA 4GVLA 2Q2WA 5JVDB 1ZISA 1R88A 1CRWG 3DXFA 4U9IS 4YRSA 4YUZA 4L0DA 1YGYA 1G8JA 1T26A 1LY1A 3M83A 1JVNA 4ZYXA 2HJGA 4I8DA 4YUYA 2GCPA 1ZGJA 3BRWA 3PQ3A 4Q9HA 3W79A 3KVOA 3WYAA 4XLLA 3RTAA 4MS4B 3WIUA 1KDOA 3IAAA 3M9XA 4X8MA 4PAOA 5LB2A 3EXG2 2GFHA 4IHJB 3RO7A 2E6KA 1NT4A 4CCAA 3JW8A 3CW9A 2FPGB 3CNEA 1Z26A 3AEXA 4LNUB 1Z56C 3QVMA 5HFJA 5IF9A 1CQJB 2X7XA 1CEXA 3TYXA 4RVOA 2CJPA 5AVQA 1GZSA 1MQSA 3HCCA 1BXZA 3A36A 1OF1A 1SC9A 2BKEA 3IHWA 4PO8A 4XIYA 3ROEA 4YYZA 1IN4A 3G9TA 5A1JA 3K53A 1J09A 3QPCA 5BPFA 1T36B 2WUVA 5DLPA 4NYIQ 4R8RA 1B1CA 1AKMA 4ZC1A 1QVWA 2J59A 4NOMA 3MRTA 4G5FA 4ZQEA 5AXCA 2IXAA 1OC2A 4WL0A 2O6HA 3TSOA 1QZTA 3UY4A 3RYIB 1PNQA 2G0TA 3VH2A 2OC4A 2QAIA 4Q4JB 2ZJ5A 3HBNA 5BWNA 3OE5A 2FDRA 4XCXA 1Z13A 2WSBA 5HXAA 2FG5A 3UTDA 1CFZA 5ALRA 1LD3A 3EGDB 1MKYA 1Q95A 3COSA 2H1OA 1YR7A 2HA6A 2VDVE 4GPEA 1WXFA 1RXVA 1FXWF 1FCJA 1EVKA 3F1KA 3ILXA 4PW0A 4QXOA 2J31A 4LE1A 3B1VA 5BSKA 1CR6A 4C6TB 2ZYHA 4JWKA 4LF9B 1JSRA 3NBFA 4RHFA 4J1TC 1PJ3A 3CUWA 4TUYF 4HN4B 1A8HA 5FT9A 2AK3A 2OPBA 4P3KA 3USES 3IALA 5BUQA 1T4GA 3RSQA 2W90A 3WL7A 1VE6A 4MQ4A 4WKNA 1N5RA 1THZA 2Y6UA 3WL3A 4YIKA 4AF6A 4IR7A 3EZNA 2W71A 3E1GA 5ALQA 3KUKA 1WPQA 3UTCA 1PDOA 3CCCA 5D2CA 4AIIA 2HLPA 3JQQA 1DRVA 1HGXA 2ROQA 5ER6A 2P1DA 3WNZA 3HP7A 4TXHA 3L4BC 3SHOA 2X58A 4DG8A 1WCWA 1FDRA 3DEJA 4KFUA 1JEYA 1LWNA 5KVQA 1O3YA 2H48A 2PA0A 2EYUA 1NF2A 1XL1A 4HS9A 4G3XA 1L3BA 1IN7A 1NSFA 1OA1A 3EVTA 3HCNA 3LC2O 5B7PA 4EYEA 4J49A 1L5QA 5KNDH 3ZR4B 2V0GA 3NWBA 1N3BA 3V6MA 4FT2A 1XOIA 5AM2A 3HU5A 1L7RA 2GN2A 1W9MA 3DUFA 3LVFO 1T24A 1UKBA 2QL5A 2XUDA 3N8NA 2Z43A 4S2EA 5I8WA 3AVVA 5HZGA 2IYPA 2WV7A 3TSZA 1K9VF 2CCGA 2XCLA 3AHFA 4QXPA 5IDVA 6REQB 1EQ2A 1NX6A 1YR2A 4KK3A 3OKAA 2O7VA 3IDZA 2YFKA 4XKJA 3AJRA 1YA4A 1QZXA 4MUXA 1HFKA 2B8EA 4BLTA 4D9BA 3OJFA 3DKKA 4Z4FA 1FUEA 2F62A 3EZ6A 4TMXA 5DMHA 3LP5A 1LDGA 4WD3A 4EI9A 3TIIA 3MCWA 1F0KA 1Q5NA 1WEHA 5KJFA 4JYBA 4DSUA 5JT1A 4V1CA 3HNOA 4YJ3F 3WOHA 4BFTA 2HNBA 2XMSA 3AUFA 2UUAB 2XWJI 1U99A 4P34A 4RPIA 1E6EA 3E04A 1THGA 1Z6GA 2ZUVA 4HV4A 4RMJA 1QK4A 2WJWA 4DT1B 3DZCA 2WJGA 2ORED 3I61A 1KO7A 3LPDA 4URYR 5K0JA 2IHNA 4U6QA 3USZA 4JH0A 4W6ZA 3QYJA 4JC4A 2DHQA 2H18A 2BFBA 2BSXA 3L8CA 3DBOB 3PFHA 1U9IA 3O4VA 4XPZA 1WW8A 5LWQA 5HE9A 1KYZA 4D3DA 4DNOA 2W9XA 3W4IA 4E21A 1XCBA 1RQNA 1U6KA 2VPZA 2YX1A 3MF4A 4MV0A 3T6KA 2OOSA 5IT0A 3K6KA 2CXXA 5KO2A 1LF0A 3ED5A 3HHPA 5DOVA 1CJMA 4IJVA 4C0SA 3GGJA 1SD5A 2CDCA 1SZJG 2NPIA 3C3KA 3DE0X 5THKA 4D3XA 4N3GA 2ONCA 3WO1A 3ZDXB 3AEQA 1B6SA 1QPGA 1BU5A 2JKVA 2JGJA 3ET4A 2WDPA 2RC5A 1TFUA 1EFKA 3MINA 3WWDA 1IULA 3QMWA 3GU3A 4ZV9A 4PGFA 2H4YA 1P3Y1 3G3EA 4JX8A 4UATA 1NQXA 1WMFA 1CR2A 2D5IA 3IQEA 1T43A 3OFNA 3E5RA 2PUGA 4I4TA 1IIRA 1G5HA 1NUQA 3JQ9C 3UC9A 1KS9A 4XJTA 3ZXYA 4BQPA 4A8HA 4XI9A 4YV0A 5T4BA 3QLVC 4ZP1A 4UTRA 2H3HA 1D0VA 4F3YA 3A3OA 3K1TA 1HT3A 5BSRA 4AJNA 3RK0A 5HMMA 5LXTF 1ESNA 4LV8B 2QPAA 4EL0A 1E5VA 2FN9A 2CLLB 1DG1G 5IABA 1GGFA 1PZNA 4OGFA 3TR5A 1E1QD 3DM9B 4KQEA 3TLYA 2W6QA 4DOMA 4BUZA 4CTOA 3VDNB 3WSVA 1NBHA 1A95A 1Y7LA 2IV3A 4IIJB 2O2ZA 2EQAA 2PH1A 3FNIA 3KL4A 1JDTA 1LLQA 1FTYA 2DQSA 2RARA 4BASA 1DXHA 3DTVD 4LHSA 5FAXA 3SQXA 3QU9A 2PX0A 2PL3A 3BWEA 4P84A 3RIEA 2WJVA 1NF8A 3VR5D 3CNQS 2FP4A 1J0DA 1E1KA 3LRTA 4RD0A 2PD3A 5KWIA 1ZUWA 2OB2A 3WNQA 3NCHA 1KDVA 2XT6A 2ZYUX 3I0ZA 4YA6A 5FBVB 3PPVA 1WZCA 4CKWA 2HU7A 2FEXA 5EINA 1AVTA 1XTZA 4D9FA 1NW6A 1NW8A 1DFIA 3HGTA 3ZLVA 5GJCA 4QX6A 4R5MA 3ZD6A 2FQQA 3SC2B 3B60A 1R0SA 3QP9A 2G83A 5CEEA 5JD4A 3DV0A 3WGZA 4YVFA 1VMIA 5B1EA 2N9UA 1LDYA 1YBFA 3PXAA 1RHMA 4LXTA 2P8SA 3BD6A 4CLOB 3STXA 1V6AA 2WFLA 4B76A 3IAFA 4GH5A 4ARZB 5DNEA 1PJSA 2RG7A 1EK0A 1LVUA 1KP9A 2OCKA 2X3YA 2RGNA 1X7GA 3P4YA 1DAOA 3LKBA 4EKEA 3DOIA 3Q8LA 3K1YA 2B99A 3RUAA 1QQ7A 1KXZA 2HK9A 3GFVA 4LOAA 3IDQA 3NPMA 4UMVA 2O4CA 5EMHA 5JSHA 4MWCA 3CZQA 4TXMA 1CUSA 2FYTA 1SVKA 4NMWA 4TV9A 1FP2A 1PIWA 2VO1A 1UMDB 1JTVA 1U0GA 2PX8A 3AHJA 3B51X 4HYEA 1E0AA 1S02A 3VR4H 3OLVA 1ZS9A 2QDKA 5CB6A 1E2UA 4M37A 2JLWA 4UAGA 4P9NA 1GU7A 2XMRA 1QOPB 2I76A 2PNFA 2GX6A 1NJFA 3HNPA 3JALB 1OC4A 2IKQA 2RGEA 3AGQA 4RPJA 3V8VA 2Q5IA 4JJFA 2X5NA 2YZ7A 1MJGA 4L5BA 1HE5A 4FZVA 3G8AA 3M4YA 4RHYA 1RRMA 2QJFA 4LS3A 4CUZA 4X7BA 4F0JA 3HJRA 2P4SA 1JILA 3TOZA 5DP2A 3LLMA 5ALYA 5EJ4A 2Y1DA 3FWNA 3T5AA 1C29B 2R5FA 1R66A 2AFRA 4LBVA 2HUNA 2F7SA 2VZ8A 5K8UA 1IBSA 4PZAA 3L7MA 3Q0IA 4YCJA 1TM3E 3U9SA 3EQ9A 5CR9A 2BH2A 5DSZA 4B33A 3PTAA 4QYIB 1GPAA 4PQRA 4RS4A 1XYYA 4TPKA 1C0LA 1ZU5A 5FPQA 2IYVA 3L1UA 3STTA 4NOJA 4WUVA 4TWRA 5JEDA 1JDJA 3SEAA 1AKUA 1I6KA 3W2EA 3SZ3A 2HF2A 1NC1A 1BROA 1YS7A 2R97A 3TX2A 1L5YA 2BM9A 2QRHA 3BWMA 4GXQA 3SDZA 1ADFA 1L4HA 2I4RA 4F46A 3T1TA 1XTVA 1UK8A 3Q88A 1SCDA 1ZBDA 2EG9A 2N46A 3BGDA 1IM5A 4XASA 3RS5A 1Q0PA 4KTVE 2EP8A 3A3KA 3JASB 4WN9A 5E4YA 4QO7A 1EAYA 3ECAA 4J43A 2P1ZA 3H1BA 1MLDA 1KZ9A 3KPVA 3P9PA 1XXHB 4WINA 3SHVA 3QFSA 1EWKA 1ZCJA 3A1TA 5FL7A 1IBLB 2IUTA 1J70A 3ADKA 3F6RA 4P3PA 1RJFA 4EG4A 1ID1A 3QUAA 5IAGA 3M8KA 1XELA 2D1SA 1C7FA 1YE5A 2UYOA 4CEIB 4AJ2A 1RPTA 3K2QA 1N25A 1KP3A 3KR1A 3P97A 2WIKA 3UG7A 1MW9X 2J46A 4OKSA 2FE1A 4YUWA 4KV7A 1JDUA 1FYVA 3D0RA 3RAJA 2WHRA 3OPQA 4BKUA 1T1EA 1ESZA 1RYEA 1SBQA 1V71A 5EE0A 3KZNA 2V0NA 3KR9A 3KHTA 3SX2A 4BQSA 2HQ1A 2C3OA 2IOHA 4CLHA 6Q21A 5KX5A 3R7WB 4DARA 4J9VA 3D6JA 4HD8A 4Y67A 2GZHA 4NDNE 2I6SA 1TRHA 5CNMA 4Q0MA 3JU3A 1PYGA 2XA9A 3GZJA 3PUJA 1QVRA 1VG0B 3EWNA 4NP6A 1NXQA 4PLYA 5DT2A 3WRVA 1XAIA 3SBXA 3QE3A 2IH4A 2ZRAA 3OCXA 1C7QA 1NT2A 1E63A 4DEVA 2O6LA 4OUDB 1TQ6A 4O2RA 3RUDA 4QG7A 2IRWA 2D0IA 5BR7A 2VLIA 3BGOS 4UHFA 4GPTA 1EQAA 1OLUA 1N1GA 4LI3X 2VT3A 2J6CA 4WH0A 3VZDA 2ORYA 3KVNA 4AG3A 1RRCA 2HKIA 3TH5A 4PV7A 1J07A 2B9EA 3CTPA 3AWIA 3ILVA 1UDCA 1X92A 5ALFA 4GIBA 3O47A 4UZSA 1RAEA 4CLDA 1UH5A 1A8IA 2FOLA 1RKBA 3A4TA 3TTWA 3A4NA 1KL7A 1KZ1A 1ORHA 1NRJB 3WBJA 1Y9DA 3ADCA 4MWOA 5DHAA 4DRXB 1HY1A 2PT5A 1O2DA 4MW1A 1WG8A 4BXOA 1FMFA 5E0KB 3GFBA 2QJRA 2TMKA 3D6UA 1XLTC 3ZV7A 5KAMA 4HMQA 1DRJA 1DBVO 4H7KA 2C2HA 4U7PB 4B82A 1XMXA 1YULA 2JNWA 4XUGB 2RHRA 3BE5A 1RM5A 3ZHBA 1UANA 2FG6C 2X8JB 4XR9A 3ETNA 3LE8A 3Q3IA 5J47A 5IVKA 1Z6ZA 4P4SB 1VBKA 2J3EA 3CFYA 2FZVA 3RU3A 3VR4D 1QF7A 4XOUA 3H75A 4H7EA 3Q5DA 4Y2JA 2NSJA 3DDSA 3KL2A 1JHAA 4MV1A 1D6JA 3BFJA 4FE4A 4LMBA 5FBWB 4MI6A 4ROSA 5DGXA 4LZOA 5HK9A 3S0JA 2P65A 1JKJA 2ZIAA 4BVJA 5D7NA 3SICE 4MKZA 3OOEA 5DW3A 5P21A 1Z8DA 4P4UA 5FH9A 2CK3A 2CL7X 3EOBI 1L4GA 4JSYA 4NC9A 3K6RA 2OSBA 3AEUA 2WW8A 3B1FA 3LOPA 1P3DA 5G02A 4DDKA 5ADVA 2HHAA 2ZT8A 3PKIA 1XL0A 4B4DA 1TT5A 5M04A 1QGAA 4MVJH 3ITDA 4DANA 2XF8A 3D2LA 2V0CA 1N1EA 4B6RA 4AYXA 2CHVA 2KWIA 1NOIA 3T61A 3E9ZA 2JIDA 4F5WA 1ZK4A 3E4CA 5BYAA 3HFJA 1A5ZA 1NJGA 2GUGA 1G1AA 1JHDA 2ZJ1A 3AVWA 3NXSA 1VCOA 4RH0A 2YBEA 2O3UA 1OQAA 4B71A 4B3TB 3KR2A 3HEBA 4IP0A 3SMVA 3R41A 1EP3B 1U4OA 2A9KA 1X13A 2R6ZA 1E58A 1MVLA 1Q19A 5LMCA 1P9NA 3WRYA 1C0IA 2YR0A 1M8PA 1OREA 1NLYA 4ZAGA 4A2WA 4U2BA 4COOA 3OZGA 4TQ9A 3ZHOA 2Q99A 4JELA 3Q41A 2V7PA 1MZVA 2ZI9A 3PGXA 1U6JA 2WA1A 3QXCA 2LP4Y 4NG4A 5AHXA 3OOJA 5EIWA 4INZA 1OFGA 3AOEC 2WAMA 2PS3A 2REQB 2HIHA 2NUPB 3GGDA 4MQFB 1XZGA 3KEMA 4NYJQ 4D4KA 3I5XA 2VOJA 1VSTA 2FJUA 3H7AA 3HO1A 1SUDA 3VVLA 4PFKA 2JFPA 1I80A 3BILA 1U8XX 5B1IA 3DXYA 3OECA 5EQTA 3PA8A 3TUZC 1EX1A 1FOEB 3AB8A 2AQHA 3A9UA 4OD0A 1BHQ1 4DNPA 4TVBA 5SY6A 3SM9A 1SK9A 4BEJA 4A0SA 3RRPA 2WEKA 3QKSB 4ZKEA 1GEGA 4OMFG 1SBHA 4N48A 4JLSA 2PO7A 2FB9A 2YIDA 1T3SA 2O7QA 4X44A 3CZRA 5IZ4A 3EVBA 4LPKA 4Z2AA 1DADA 4EW3A 4JKIA 2VK8A 2XSZA 4L0MA 5FTLA 1NVDA 3LQRA 1XCGB 2XB4A 1PFYA 3W2IA 1ORVA 2EZTA 4IGKA 4OOEA 2YNMD 1HMPA 4EB0A 3B3FA 4OQEA 3SXUB 4DB4A 3UMCA 3IUSA 3KM0A 2DLDA 2C54A 4NCXA 1HQDA 3SP1A 3ZE7A 4JQSA 4DN6A 3TZLA 4GWKA 2A92A 2PKWA 1O57A 2VCEA 3QV2A 2Z0MA 4MS3B 1V11A 3CH4B 1C3XA 3KKLA 4WZAA 3H7IA 3SX0A 4PONA 2Z9CA 4PYQA 3UAWA 2ZJAA 2F9FA 3NV7A 2R2AA 1ECGA 2LVBA 4NYMQ 1WDWB 2G4CA 5TSDA 1YZTA 3UA3A 3YASA 3L4KA 3RDPA 1U8ZA 4PPFA 8ATCA 2C20A 3R3HA 4UQLA 3ZOKA 4GX5A 1YDMA 3ZIDA 3ZWCA 4CBVA 1I33A 3KJFA 1TYAE 4H77A 3A4MA 1JG2A 3IOYA 3OU6A 4XVHA 4IKEA 4PINA 4AZ0A 3IT1A 4DSZA 4L8WB 1AZTA 1I4LD 4W5JA 3K2BA 4MV5A 2PA3A 1TF2A 3TAHA 1ZA1A 5HP4A 3TD9A 3LCJA 4I1OA 5F1OA 1OXMA 4IJQA 3GN1A 5LA6A 3RTDA 1DMSA 5C52B 2QRVB 3HCWA 1SN7A 1PWYE 2Z5LA 1CF9A 4RU1A 3L6OO 2MINB 4B45A 4OUDA 4P2GA 2HMVA 5GTDA 4Y0AA 3IJRA 5KPJA 2QUKA 2QU7A 4HVAA 4GMFA 3MTGA 5TIIA 1SKYB 3K7EA 3WIEA 2NV0A 2DHDA 2R6AA 3AF4A 3SWWA 3FVRA 2XYVA 4P98A 5DNDA 1IYZA 2BN4A 3M7IA 3UFBA 3N6XA 1XF1A 3JAKB 3K92A 3NRJA 4QBHA 2XB8A 1PJLA 4YRFA 5GWXA 4AO6A 5LYJF 1VPDA 3OPVA 2OUKA 4HNSA 2VATA 4WLVA 1GR0A 3GYBA 2CN1A 4WKCA 4BYMA 4ER6A 3FPHA 1M9NA 3LU1A 3CVWA 1ND5A 1J0AA 3OLWA 2EJTA 3HY3A 4MV6A 1KKMA 5ALPA 1GNVA 3OPYB 1U0NA 5LZ2A 4BXOB 1XSEA 1PJTA 4D9MA 5TX7A 1JLLB 5B58C 4RWZA 3SX4A 3UJHA 2EDCA 1U7OA 1QOQB 2OCYC 3MTDA 4JUBA 2GCNA 2NV2B 3LCUA 2EJVA 2GNPA 3GRZA 2YINC 3DFZA 4YREA 1ZAKA 1ZR4A 4E6EA 3ZXIA 1QFMA 2B4AA 3R77A 2XQJA 1RHJA 5J3JA 4C4TA 3OIFA 5A03A 3ZBPA 2RAFA 1VDZA 1G0NA 1T8RA 3FHCB 2ZYWX 3OWHA 1VIDA 4PO3X 3GRRA 3TLCA 3L01A 1A2OA 2ZATA 1QJCA 2E4VA 5LQCA 3ZHVA 3IA2A 1ISJA 1E8DA 1O77A 3A6KA 3C6KA 3FB4A 4NY1A 2AOWA 3NWJA 4XZ3A 3PXGA 4CR6A 3CG0A 1GNTA 1CX9B 1QFZA 2IXDA 2JIRA 3BD9A 3H0CA 1N2HA 2GBCA 3MTQA 4K7JA 4TL9A 1HM5A 5BQ5A 4CG0A 3LSTA 5EAIA 1U2SA 4PLCA 2IV2X 4LFCB 5BSUA 2JLYA 1RTKA 3ILYA 4AURA 3GHHA 4IWXA 3AEUB 4QEKA 1C9JA 1JS1X 2Z2JA 3ETEA 3KE8A 4J1TA 1I7NA 2JC3A 3MELA 4MA4A 4RKEA 4R01A 4WESB 4YI5A 4ZGWA 3B89A 1WVGA 1W36B 7MHTA 3I2IA 1W75A 3QF4B 4DMLA 4DKJA 3IEMA 3GLIE 2BZSA 1SXQA 4P0TA 3BMNA 3FIUA 2PMKA 4UVGA 2CCJA 5C8YB 1BIFA 2YOHA 1JFLA 2NZYA 2R86A 3HUTA 3JQ7B 1AQLA 1I9GA 4FDLA 3CB2A 3DEIA 5FBKA 3VTAA 3SG0A 5NULA 5CDFE 3D43A 1KFJB 5GONB 1Z35A 1U0BB 4IIUA 1FVXA 3PHHA 4EG7A 4A4DA 1L7BA 3O8OB 1PX0A 2B0JA 2NSHA 2J3QA 3C4JA 4G8BA 1SD2A 4NF2A 1L7DA 5FTNA 2RGCA 4BO1A 3IUQA 3OQNA 1CJTC 3CEMA 3G0OA 1M7HA 1IZ7A 1MJNA 2G09A 2Y1LA 2W2MA 3NPAA 4K9DA 4MYDA 1A9TA 3CLUC 4PR3A 4RFSB 4ZRMA 2G6BA 3UKJA 2DERA 1SQ0A 3V1KA 2O50A 3EVDA 2YRFA 3IP5A 1FQWA 3ZJ5A 1VJ0A 2QRPA 1KAOA 1LQUA 4TKUB 3F1LA 2OO3A 5I9MA 3WJ1A 1SUSA 3R9WA 3OTWA 2AX4A 1H6AA 1Y3BE 1G55A 3Q3JB 4FXPA 2IU0A 2X8JA 1R8XA 1SEPA 2JBWA 2VQDA 3Q0TA 2YVLA 3NTQA 2B1JA 3O90A 2KM1A 2DVMA 1XRQA 2NZ2A 3FVVA 3D7LA 4AUEA 5HX7A 1Z38A 5ALNA 4DADA 2OXEA 5DSXA 4ZU3A 4B09A 4TX1A 3EVGA 5KU1A 1E99A 1TJ4A 1Z0UA 3SZGA 4C3OB 2OXIA 5A02A 1FSFA 2Y76A 5EJ7A 1A96A 3B48A 1KY4A 1Z39A 3C3CA 4X00A 4C2TA 1T3ZA 2BGTA 2EARA 3MLEA 3SHTA 1UFRA 3FOCA 4A5OA 3FJ1A 2EX0A 4M1SA 3N86A 5JNLA 3CKYA 1ZMOA 5ES3A 4AFNA 2NU6B 5G4KB 3RYTC 4O4LA 3QG1A 5GY7A 4QOGA 5JYBA 5L6MB 3RVOA 1DCMA 2AW3A 2WHPB 1VDMA 3JS5A 4IZ6A 5IWAB 3MD0A 5ICEA 3DW3X 4ZI7B 3CXUA 3WKDA 4EHKA 4DDUA 3UKOA 1F4PA 4A8PA 2IPOA 5COQA 1MIOA 2YIMA 2RHOA 1WZIA 3V2UA 4MPPA 5D6NA 1A1SA 4H60A 2IYLD 5A9TA 1U2GC 4C4PA 1LPBB 3PNMA 3O03A 4E11A 4MCAA 2Q9AA 3PHBE 3OURA 1W6UA 4HJXA 2NP7A 2LWIA 3OE4A 2I1QA 4Q5IA 3IUNA 4IEIA 2Y4OA 2Q5CA 2P30A 1A9PA 1MRSA 2OFPA 1GARA 4DC0A 3GP5A 1WXDA 1XTRA 2CC2A 2O0MA 1SRQA 3HLTA 4JLPA 1TEZA 1ZCZA 3CUVA 5I7SA 1KBOA 4Z9AA 4G8JA 3N7UA 4RSRA 2WR8A 1K6XA 4OFWA 2BC9A 4C04A 4IQJM 1QAQA 1F48A 3UGQA 4H1HA 5DMXA 1EA5A 5A5GA 4MKHA 2Z2IA 1D6NA 1R3DA 3NHLA 2B35A 3R20A 4LDPA 2YVQA 1L4KA 3TNJA 2IQIA 1FPQA 3O1JC 2A84A 3PHJA 2ZSBA 3X1ZA 1GL9B 4C6RA 4CEIA 3ORQA 2A5DA 3HBMA 1V5GA 1F8YA 2XMCA 4C0XA 1W48A 1T5TA 5ULLA 4OOFA 3FPKA 1HDCA 5FUQA 3FMFA 1UMBB 1YKSA 5DIFA 5I5EA 2GKSA 1GGVA 3PNBA 1F1JA 1GZ3A 1N75A 3HACA 5C81A 3VO8A 1M10A 3EEBA 3H5RA 4TTQA 1Z0FA 4C4YA 3U49A 3WYBA 1G16A 4I99A 4K1XA 3PSAA 1M34A 3BMXA 1EFDN 3BG5A 5DF1A 5M2QA 2NGRA 2WIDA 3BB4A 4IMRA 3K6SB 1FVHA 5DN9A 1D9XA 3IPLA 2FAXA 1V5IA 3FGZA 1ML3A 3LPCA 2ZU0C 3PHCA 1G98A 4HP8A 3D3JA 5AI6A 3U0VA 4UM8B 5CDFA 3TD2A 2EEPA 3IUYA 5HRUA 2FW8A 3AV0B 1ISRA 1Y1PA 1FP6A 2C2BA 1QH9A 5FA5A 3ONVA 4GC9A 4PNHA 4RV9A 3RGGA 3W5JA 1V9CA 2EV9A 2ZWOA 1XPJA 3TCXB 3TZKA 5IDWA 4Z0TA 1U8FO 3GFRA 3REQA 3TEFA 1RYMA 3ZDBA 1RP1A 2BJVA 3FDJA 4GU5A 4WV3A 3WHIA 4EPVA 4MV7A 3TMAA 2NU8B 1OOEA 5KIAA 1H05A 4L4ZA 4YYEA 5EE1A 5CLIA 1P4HA 5J23A 2B1RA 1NNI1 1TNDA 4CZ2A 2AFHB 2P2GA 3CSDA 1MC1A 2X6RA 3TKAA 2PKQP 2R8BA 1O87A 4JSRA 4LC1A 1FMJA 4M8IA 5AWFC 5LBTA 1QKIA 2QN9A 1CUDA 1Y6ZA 2CFRA 1KE1A 4GSKA 1W2WB 2G82A 2IIVA 1CXZA 1JWAB 2XV1A 1ZHOA 2XVAA 2J4DA 2PL9A 3LRXA 2YUIA 4OA8A 4P0PB 2EEZA 2H4FA 1IG0A 1VL8A 2ZPTX 4TMVA 3D1JA 3F5DA 4EEXA 1C9MA 1JIUA 1PK9A 2WTAA 2Q6IA 3UMVA 5IVDA 5JD6A 1QO9A 3QM1A 4KAXA 3V4SA 1EVLA 2H2FA 4QLAA 1JBQA 1TM1E 3W9BA 5LYJB 2GN1A 5F76A 5A4JA 1CKEA 4PZCA 4B6PA 2QVCA 2PLFA 1V8FA 1JB1A 3ZK8A 4OHBA 1FL9A 2R7KA 2Q2VA 4FUQA 3TLGA 3HDTA 3TCKA 3GGOA 4HCJA 2I65A 1FU4A 5L45A 2DH6A 4MYTA 1MQ8B 1FXUA 4J07A 5JSFA 3SY8A 2WZDA 5JECA 3PDWA 4TSKA 3DMDA 3L6RA 1JQ5A 3HKBB 1FTQA 3HU1A 5BQFA 1OTYA 1TPYA 1VKJA 2WF9A 3LBYA 3BRQA 1GKYA 1W94A 1CY7A 1BCSA 1H93A 2WU1A 2SCUA 5JJBA 3PUKA 2RHLA 5FWXB 3HM2A 5TQ2B 1EIZA 3BWYA 1WSDA 1S3GA 2Z2XA 3LUHA 4FW8A 3DDZX 1EFAA 1BDHA 5KYXB 2E21A 3FN4A 4JL5A 2WLSA 3M6VA 2EP7A 2FFHA 4R40A 3IODA 5DX8A 3RRJA 1Z2AA 1ZEJA 4PAGA 5IVIA 5JNUA 2O2GA 1R0CA 1YL5A 3L7IA 1HFEL 5DO9A 3BIXA 3FYUB 3VU1A 2AR0A 2C1ZA 1E77A 2FPXA 2HJRA 2I2CA 1OBCA 1G3IA 1SCQA 1K92A 2OWDA 3O95A 3T9BA 3L6CA 3SYRA 3PWTA 1N9GB 2VLBA 1QHYA 2E4YA 4ICIA 2FSHA 2HSGA 1O0BA 4G1BA 5K1ZA 3V7FA 1JIJA 4XCVA 5JS7A 2R6CA 3QHAA 4KE7A 5EL0A 2J6HA 2JL1A 3E7FA 1SKUA 1UQUA 1YS6A 4L8FA 2BFOA 1XP8A 4BNNA 1QS0A 4R9SA 4NICA 4C08A 4KR0A 2G70A 1T9ZA 1MO3A 1Z3IX 4MKIA 4XIJA 1ZWLA 1CZHA 4X1KA 2AEEA 3GT7A 2REQA 3E15A 2XT9A 5EKSA 1S0UA 4LQ4A 1NVMB 5H9WA 2M6RA 3GAZA 1G21A 2FFQA 2Q3JA 4IIXA 1Q1QA 4KE8A 1E3MA 4WBNF 2ZBUA 4DR5B 1M1YE 1ZHFA 3N9IA 4K0RA 2WKQA 2BJWA 3K09C 4RY8A 5KNBA 5A0TA 3SLKA 1JWBB 3A27A 3S1AB 1HTTA 1NATA 2QNRA 4HN2A 3FOBA 1HO3A 2C4NA 1R8YA 1KU0A 2A9RA 3U7IA 3UT5B 3COJA 2HL6A 4ZA2A 3C48A 3CGGA 4G56A 4BP9A 2P11A 2XNHA 1I6MA 1YBVA 3RT9A 4JIGA 2GJ4A 4H31A 3JQFC 5I9BA 2OHIA 4AZ3B 2GHIA 1XN1A 4NPCA 4BO7A 4S24A 1NRWA 4DQVA 1Q0LA 4I55A 4MAFA 3SBEA 2JDID 4DLRA 3TRKA 3IAUA 2GERA 1IH8A 1N2SA 5C2JB 4KBGA 1T0HB 1ZOLA 2VHXA 1X14A 3P5BA 2HXSA 3L84A 4JQYA 4MKXA 5E1OA 5DHFA 3CEJA 4L5IA 1WCYA 1X9GA 2X2EA 3ITKA 3AETB 3O4HA 3CPEA 2OORC 2V4ZA 4MPTA 4E32A 2XQKA 1NAHA 1OKKA 3P9XA 3VAZA 4AP5A 4UPEA 5AW4A 4LF7B 4FGLA 2EATA 3K4QA 2GYYA 4JZKA 4YRNA 2MYTA 3HUUA 3OH8A 3TW4A 1YGPA 2POQX 3PDJA 5KHAA 2AR7A 2IWHA 5F9HA 1RZVA 2VRWA 3DOUA 3UB3A 1FSGA 1KVRA 1VBNA 4YP5A 4RJJA 3ZIAD 5GP1A 3GJ3A 3O8NA 4HQ0A 2AYZA 2BWJA 4MVJF 3T9CA 3UZUA 3MCVA 5JXJA 2WF7A 1QE5A 3Q15C 4RIFA 2OZEA 3LQ2A 3V8BA 3C1TA 1VXRA 1YQTA 4F96A 4EHFA 4K6CA 5IKXA 2DH5A 5BWOA 3D64A 3K0BA 3L7AA 5CFRA 1U5BA 2NXCA 5IARA 3PLAE 3LA8A 2XEDA 2M1ZA 1N33B 3EXEB 1O4VA 3RFTA 1CQPA 4D56A 3F3SA 1ZIDA 3AM1A 2G0NA 4RVFA 4G4SP 2CVOA 1E5QA 4J0JA 1E2IA 3HWRA 2JI7A 2Z5FA 1QR2A 3UIEA 3VJKA 3COVA 4ZQIA 1UOPA 4BLRA 4YJ3B 3FOWA 1QVAA 4DV6B 3N28A 3GY0A 1YDFA 4NENA 5D6BA 1FNBA 2BDTA 4NZNA 4Y1FA 4Z9FA 4QGHA 1L5OA 3NUQA 1CK4A 2WSSD 4POAA 2ZG6A 5H16A 5L3VA 3OFJA 1BFDA 1HE3A 1Z7WA 2DT5A 3LT5A 4JB3A 4LKOA 2LPMA 4U2KA 4YJHA 3QWFA 3WHLA 2V7BA 4JAVC 1NW5A 2A6PA 1X2BA 4HFNA 4O29A 1JH8A 1Q3TA 4RQBA 4CQLA 4WQMA 1W4CA 2WC1A 2B1QA 2EKQA 3EZFA 4IDQA 3GXBA 1DXQA 1KI1A 4RZ3A 3LUKA 1HDIA 5I8PA 1NONA 4RZXA 5B6IA 1R18A 3R5JA 1IHOA 3GFTA 3UAOA 3A2KA 2EGUA 3WFZA 2R8XA 3CX3A 4EYGA 3H4MA 2WILA 4BO9A 2WM3A 4KPGA 5LA6F 1RQLA 2CZGA 2J5RA 2Y6VA 3OT5A 3DV2A 4FDUA 4N0QA 3SSOA 4BTLA 4C4SA 5K2OA 4KFRA 5A5FA 2P2SA 3LP8A 1HZZA 4LWQA 1XZBA 1IY8A 5LQRA 1BEZA 3A4LA 4Y2VA 3VPSA 1QDUA 1Y8QA 4UVIA 4PZPA 4ARCA 1C1XA 3ZWNA 2FX5A 2AI1A 1Y42X 4LOLA 1T0BA 4W1QA 3RYIA 4FZRA 2ZCVA 3PFWO 4Y1GA 2FZKA 1G59A 2OENG 3CVVA 3PDIB 4DLLA 1LRJA 5J4KA 2ZUSA 3HL4A 4WOCA 1YCGA 2HMUA 2PBFA 2Q6KA 4YUVA 3DDUA 2OT3B 4Z7OB 1ZJ4A 1TUGA 2NT4A 2R62A 3AHCA 3AI7A 3PEYA 4NCBA 3E7XA 1IZZA 4EELA 2CMHA 1AT1A 1E1DA 2YH2A 2ZCJA 2D5CA 4L2IB 4MVJP 2HX1A 3B1KA 1YZFA 3TJZA 3M3PA 1BCRA 3ZLTA 4XIFA 2H8GA 3N7AA 4TTSA 4G5OA 3VO9A 1V45E 1Y37A 1TMYA 3NRBA 3Q9SA 1OILA 5GZ3A 2I6FA 1OWNA 3FTQA 4PX5A 3UAYA 2IP2A 4ZVPA 4RGBA 2YY5A 1WXHA 3KT3A 4RF2A 1F0YA 1KKUA 4J2TA 4ZV7A 3SC2A 5LP6C 1ZKMA 2OYRA 1H2EA 4WK6A 3NT4A 4E5PA 4G2NA 1XTJA 1R5JA 5FWXA 3IC5A 4Y6RA 5L9AA 3H6KA 3WS7A 2AWOA 2Z4SA 4IUCS 2ZQ5A 3DEAA 3PP8A