2JAQA

Structure of deoxyadenosine kinase from m. mycoides with bound dctp
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
201
structure length
189
Chain Sequence
MKIAIFGTVGAGKSTISAEISKKLGYEIFKEPVEENPYFEQYYKDLKKTVFKMQIYMLTARSKQLKNIIFDRTLLEDPIFMKVNYDLNNVDQTDYNTYIDFYNNVVLENKLSFDIVIYLRVSTKTAISRIKKRGRSEELLIGEEYWETLNKNYEEFYKQNVYDFPFFVVDAELDVKTQIELIMNKLNSI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Function Analysis of a Bacterial Deoxyadenosine Kinase Reveals the Basis for Substrate Specificity.
pubmed doi rcsb
source organism Mycoplasma mycoides subsp. mycoides sc
molecule tags Transferase
molecule keywords DEOXYGUANOSINE KINASE
total genus 67
structure length 189
sequence length 201
chains with identical sequence B
ec nomenclature ec 2.7.1.113: Deoxyguanosine kinase.
pdb deposition date 2006-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01712 dNK Deoxynucleoside kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2jaqA00
3GLHB 1TQ2A 2ZR7A 4QRHA 1E2IA 2JIZD 3ASZA 4MKGA 4TYWA 1G7CA 4A82A 4KCGA 3LXXA 2GBLA 4I1OA 5L3QB 1PV4A 2QTFA 4MGZR 3M1IA 1L7VC 4KFTA 3W6NA 3BERA 1YHNA 1WRBA 4TL7A 3X2SA 1W4RA 2ZPTX 4F93B 3P20A 1XNJA 1L4YA 1S1MA 2IUTA 5EE1A 1DADA 3K9HA 1J70A 4C2TA 3RAPR 4IXNA 1U8YA 4GNKA 3M4YA 1P2UA 2R6GA 4FN5A 3P4XA 1SULA 1XPOA 3K1JA 5G41A 4P33A 1DARA 4B76A 5CIQA 4GMXA 2BMJA 3CIOA 2GCPA 3AF1A 1Q12A 3U6BA 2NZJA 2ANCA 1S9HA 2D3WA 3TUZC 4PX9A 1AIPA 3W90A 4M1OA 3MWLA 2VSOA 1KI6A 5JJIA 3LO5A 2GDJA 5DO9A 2H92A 5FTNA 4Q66C 3TUJC 3DEFA 3OEHA 1HQCA 3U3OA 1NN3A 1XU4A 1WB9A 3NC0C 1T0JB 1LB1B 2YC2C 5A5GA 1E9RA 2GNOA 4OBEA 5JJKA 2GJSA 2ZYWX 3B1XA 1XXHE 1ZW6A 2H16A 2J1LA 4HZUB 3F8TA 4IVRA 3HPQA 1KNQA 4GMDA 4Q48A 2OESA 4X8OA 5DI3A 3TSWA 4PPGA 2OZEA 1KDOA 2IF0A 2WOOA 1E2LA 1EK0A 1LW7A 3ZYCA 3IIKA 4PTLA 2CLCX 2BHRA 2O8DA 3P1JA 1X3SA 3Q72A 1I2MA 1DO2A 1UKZA 2JJ1A 2A78A 3SOPA 5FR2A 3O8RA 1L2TA 4QL3A 3QEOA 3UG6A 2VSXA 1OHHA 1UPTA 4EDHA 1A7JA 5C46F 1QBKC 4FD2A 4CEJA 4NYJR 1Q3TA 5C2JB 3I62A 4PO1A 2GJ8A 4L15A 4KLZA 1J8MF 3GLGB 2YKGA 5FH9A 5B64A 4GDFA 2XJ9A 2IYQA 2ZSEA 2OE2A 1G5TA 4UJ5A 4QKQA 3PENA 2Z0MA 2IYLD 3SN6A 5GJBA 2CVFA 2ZRLA 4PC3A 1CJTC 3I8XA 5E3HA 1JXOA 2PX3A 2IS2A 1P7CA 4RCYA 1XEXB 4CEHA 2IC5A 3QKSA 1M7GA 1E0KA 1TADA 5M04A 3C4JA 121PA 2E1RA 3WXMA 1E9SA 3CH4B 3CWQA 3VX4A 3EIEA 3RDPA 1E1QD 1NVVR 2QNRA 3DPUA 5LBIA 4HUTA 2QI9C 3QF4A 4I81A 1VG1A 2GAAA 2YOGA 5AJXA 3KKNA 5CJ2A 2NG1A 5AJWA 4MH0R 4N3NA 5KO2A 1X6VA 1CU1A 2FEMA 3BB3A 4I1SA 2G0TA 4ERNA 4G5SA 3THXA 1VKJA 5JRJA 2XXAA 2ZI9A 2H5EA 3LDAA 3NBXX 1VG8A 5FPHA 1G5PA 4TZ6A 3B6EA 4F4JA 4X8MA 1XMSA 1MABB 2ATXA 3F3YA 2Z5FA 2OCPA 2GCNA 1W7AA 3MRSA 1G3UA 1KI4A 3GLFA 1QHHA 2JATA 1KI1A 1Z2AA 2D7DA 3GFOA 1KGDA 2WKQA 1CR2A 2XITA 2OFWA 4XTRA 5HR5A 3V4RA 1KNXA 1M6NA 1VYUA 3I8SA 2GCOB 2I1QA 5FBRB 3O47A 3D31A 1FUKA 1A2KC 2W2VA 1OFIA 3GJ6A 3B82A 4ZDKA 1N25A 2MSDB 3NVAA 4A4DA 1RYFA 3QPWA 2DFNA 4D80A 4Z54A 5B58C 1F2UB 1Y63A 5G40A 3OE7A 5FTLA 2ZITA 4US1R 1EFRA 2PLRA 5CK5A 3GJ7A 3R20A 1ZD9A 2ZEJA 4PC6A 5AUNB 2AXPA 2IEYA 3QKTA 3A1TA 2DCUA 4QG7A 3U61B 1VDZA 3AUXA 1JJVA 4TLCA 3EW9A 3RRYA 1PJRA 1GNRA 1ZINA 1N6NA 4Z8XA 2NPFA 3BRWD 3W5IA 5KPDA 1OPXA 2LKDA 5J4LA 3BFKA 1N0VC 4G0NA 3MGCA 4AKHA 4Q7MB 2QA5A 2CVHA 4ZI2A 2AK2A 5FBLB 3BGWA 2I1VB 2PT5A 1P2SA 2XOKD 3CBQA 4DRZA 1JAIA 4U5XA 5UKDA 4ZI3A 3K0FA 1XB2A 1S4QA 4URVR 2CJWB 3QE0A 1U90A 1YZQA 2CE2X 2F3TA 5KHOC 1TNDA 4DT1B 5LD2B 1GILA 1GKUB 2ZYUX 3RC3A 1MO4A 3J81k 1V5WA 3WHLA 4GL2A 4NCJA 2CCGA 4LJ8A 4ZDJA 2KB0A 3X1ZA 4A8JC 2QMEA 4D6PA 2VF7A 4AG5A 4E22A 4JKYA 1S0UA 4CT5A 1QF9A 4BFZA 2IYVA 2ZRFA 5A0FA 1SGWA 1UF9A 5GADl 2VA8A 2HXYA 2ODBA 4PSVA 2REOA 4QBGB 2ZUDA 1KO8A 1RIFA 1GTVA 2QRZA 2ZTSA 2ZUCA 2RGDA 3KB2A 2DWOA 3DZDA 2OFOA 2GZDA 3BFXA 3BWDD 3K53A 4TQ9A 1U8AA 3U44A 3BJIC 1Z5ZA 2YWGA 3SJCA 4JLPA 1ZUNB 4HDOB 1XBTA 3AKEA 3N70A 4JBXA 3IUYA 1GRQA 4OK5A 3CB4A 3DKVA 1QHIA 5IDVA 3UWKA 2G6BA 5J4HA 4Q4HB 5TDHA 2ZI5A 5F2EA 1OE0A 3UATA 4Q1AA 1XJCA 1DAHA 3A1SA 4HAYA 1E2DA 1G21E 2CCKA 3QXHA 1E6CA 4LOAA 3ICQB 2ZRNA 2FE4A 1CXZA 2J9RA 5JMTA 4HB2A 4RD3A 2FU5C 4BFTA 2E87A 3LQQA 3G5UA 1W4BA 1TMKA 5AWFC 4C30A 4WZBE 3CX6A 3RANA 2WAXA 3EG5A 3GMTA 4PQRA 4EKDA 5GJWC 1WE2A 3I61A 3QI2A 1J99A 3TK1A 2ZVPX 1MO3A 3DHWC 5CIWA 2XSZA 2RH5A 3K0CA 4EQ6B 2ZRCA 4TZ0A 1Q44A 1UKVY 2JEOA 1W1WA 3SFZA 4C0LA 1NIPA 2GK7A 4MRPA 1W46A 4JSYA 5J47A 2J3EA 5AUPB 5JWHA 4YQFA 3RRMA 1OYWA 3GLFE 621PA 1RRFA 4E07A 1DBSA 2NO0A 5FOUA 1P62B 4D82A 421PA 3AVWA 1JJ7A 4WAUA 1IXSB 1CULC 3EZ6A 1N6PA 1FP7A 4TYNA 1H65A 1W4AA 4TLEA 3PEVA 5ANRB 1A1VA 1D8TA 1YZGA 3KZ1E 3O8DA 3OEEA 4AC9A 1A2BA 2GZHA 2JLZA 2Q3HA 2H17A 2FV8A 1OV4A 1R0YA 1TUEA 3VHXA 1ZIOA 5KNDA 4OHYA 3LA6A 4BZQA 3LW7A 4GFDA 1G4UR 1IJFA 3IHLA 1G8PA 3PVSA 3GFPA 1CLUA 2UZIR 3C5CA 3OFND 2C03A 3DL0A 4JLVA 3GEIA 4YDHB 4QOSA 4QGFA 5AUQA 3WYFA 4TMWA 1CRQA 1N0WA 1IXZA 5CK4A 1M74A 1YZKA 2EWVA 2ZAOA 3MD0A 4C3ZA 3VR1A 1COWA 3R8CA 2E9SA 3ECCA 2YWFA 4IOLA 4BASA 2CCJA 4BEJA 4DSOA 1JAHA 3A37A 721PA 3GJ4A 4M4SA 3GP8A 2ERYA 1UDWA 5DIFA 1TQ4A 2RGGA 3PR1A 1HE1C 4KSBA 4MDFA 1VTKA 5FOWA 2DB3A 2YC4C 1XTKA 2QSYA 2F3RA 1SVMA 2JCSA 4B32A 4PQYA 2DWPA 5FOSA 1E79D 3LRPA 5AK0A 4UNQA 4QHYA 4TTRA 2QUZA 3REFA 2O8EA 4NKRA 1CEEA 3W34A 4PPFA 4UJ3A 5A4JA 4U00A 4N0DA 4DJTA 2P5SA 4GBMA 2N1BA 3GJXC 1F5NA 1GOTA 2R8RA 1KI9A 3IPYA 4IEEA 3EZ9A 5IRCD 3ND8A 4AKGA 2XTMA 4C0SA 1CJMA 3SZRA 1T3SA 2XEXA 2GVZC 3AQ4A 3Q3JB 4BLQA 2ZU6A 2DR3A 5SZJA 1F2UA 2HJVA 3TNFA 4KVAA 2J0UA 4WIAA 1TF5A 1KSFX 2G3YA 2ZSDA 3EZ7A 3NTUA 4PXAA 3ZGXA 4ZIRA 5C4MA 3ZQJA 1P2VA 1J7KA 5JHHB 2IYYA 4RFSB 2ZAMA 4Q03A 4C0BA 2BVNA 2AL7A 3EWSA 1WA5A 4HB4A 5E4FA 3N5CA 3NEJA 4OQNA 2FMXA 3WBKA 3GLGE 1LFDB 3U3MA 1TQDA 3SYLA 2WSSA 4TLBA 3AKYA 2C9YA 2ODEA 4DIEA 5FOXA 4NL4H 4URUR 2IF2A 3CKLA 5CITA 3GLIE 1SKYE 5B57C 4BLSA 3CRMA 1H8HA 4LJ4A 2YWHA 5C4GB 1E4VA 4B2LA 3EPKA 3JZMA 1N0UA 2UKDA 4EPXA 3FKSD 1KI2A 2QEQA 3QF7A 4F38A 4L5BA 3FMPB 1GL6A 1NG9A 3T06B 4R71A 3JVUA 4Q21A 2G88A 3MCAA 4PO8A 1U98A 1VCOA 5EQTA 3HP1A 1AQUA 1J90A 1ZM3A 1QHYA 1ZUIA 2IEZA 3TGPA 1CR4A 4PAQA 1DS6A 1XMVA 1DAMA 2ORVA 5FBWB 4ACBA 3RS2A 1KK3A 3TMKA 2KJQA 2ZYTX 5DH9A 2X2EA 2IWRA 5BWMA 3EAQA 1Q3HA 3HWSA 1U0HC 3TVTA 2F43B 3K09C 2G1JA 1NBMD 4ZKDA 1RJ9A 1OFUX 2NO1A 1AK2A 5GVSA 2ZE6A 3EPJA 1YZTA 1UKYA 1OIXA 3AVPA 3R7WA 4C7OB 2ZJBA 5DGXA 1SKYB 4L4UA 4ASUD 3RS5A 4DCUA 2FH5B 1XTRA 3D7MA 2QAGB 4A1FA 2RGCA 2B21A 3I1FA 3VKHA 2NMVA 2HCBA 5LPNA 2XB2A 3UPUA 1N6HA 1OXSC 5EE0A 1BKDR 3W3ZB 1BMFD 3B78A 3DMDA 5FR1A 1YRBA 1HT1E 4YXWD 4AIIA 1IN8A 1NP6A 1JQJC 1CS4C 1TQ6A 2P2LA 2V8OA 2ZRGA 3GJ3A 3GLHA 1BH2A 3K9LA 2ZS9A 3M0EA 3OIVA 4LJ7A 4ZO4A 5LB2A 4FWTA 3U44B 1KDTA 2A3RA 3DM5A 3QXSA 1ZJ6A 4URWR 5JS8A 3TJZA 1PUJA 2VPPA 2WPDD 2MMGA 1ELOA 3RHFA 2IYUA 4IKEA 1GKYA 3B13B 3SI7A 1F3OA 1D2NA 1US8A 3W8RA 4CEIB 3AP3A 4LC0A 4TYPA 2JA1A 3Q8XB 5FOTA 1GWNA 1JECA 2CL7X 2F1HA 4EQ6A 1XXHA 2QE7A 1Q0UA 3IKJA 5AJVB 2A9KA 4JLAA 5D3MB 4LBWA 3LLUA 1S9DA 1WDTA 4Q1FA 4WOPA 1E0SA 2B7CA 1AS0A 3EWAA 4FI3C 1KMHA 3U7FB 4P32A 2ZSAA 4LBZA 2Z6VA 3KKMA 1ZP6A 4D4KA 2FPMA 3F5FA 3EZ2A 1QVAA 4CRWB 2ZR9A 3NKVA 5DLQC 1IY1A 1XTJA 2JLUA 3A58B 3WRYC 2ZJOA 4MDEA 5LDDC 3RSOA 1UAAA 3TSZA 2LKCA 2FX3A 2YNMA 4YC7A 4B2IA 3MWYW 4MGKR 1R8QA 4BRUA 3RYTC 2PMDA 2C99A 3EPLA 1XCMA 4BFSA 1RFLA 1JXMA 3QUSA 3RS4A 2VP6A 4DSNA 3V4FA 1VYTA 3B1ZA 2QBYA 2NO6A 3I5YA 4KV9A 3UMRA 4DZZA 1FL9A 2GILA 4LYAA 1IOZA 2B7BA 4JLDA 3CZQA 2HYDA 4AYTA 1CP2A 3GLGA 2ZRMA 3QQ5A 2WTUA 1R5BA 2R6DA 5GVRA 2FNAA 2RGEA 4M1YA 1Z0AA 4QJ5A 5JEEA 1S3GA 1XTQA 3CX8A 4Q02A 5D3QA 3SHFA 1NNEA 3CRW1 4R2HA 1NF3A 4LBYA 5CM9C 2X1VA 4LY6A 4KBFA 4JYCA 4LC1A 3AGQA 3LWNA 4QC2A 3QJYA 1I4TD 2WJHA 4DKXA 1P3JA 3IHWA 2A5YB 1DAGA 2IYSA 1YR8A 2FZLA 2NQ2C 2O8EB 1PLJA 2Q6TA 1SXJA 2ZJ2A 4LV6A 1SXJC 4RVCA 3H86A 4NPHA 4BQSA 1FW6A 1NY6A 3KQLA 1KK0A 3PQCA 2IXFA 4OI4A 3ZD7A 4H1UA 3QXJA 2NPIA 1Y3AA 4Q9KA 2F1RA 2IYZA 1Z6XA 3H4MA 1OH6A 1F60A 2SHKA 3DM9B 3ZVNA 3CUEF 3EIHA 5GJCA 2C95A 5LB4A 4EJSA 4B3DA 3MMPA 3WBJA 1L8QA 4TL9A 4HLUC 1QHGA 1KMQA 2OEPA 1ZRHA 1NKTA 2GTPA 3QIAA 4KITB 1XD8A 3T1VA 2OXCA 3FE2A 2C9OA 1D9XA 1DEKA 2FWRA 2G1KA 2XAUA 3L0OA 3CRQA 4D0GA 5IHPA 5KDDA 3ZD6A 3VU9A 2ZJ8A 1AGRA 1EG7A 2BCJQ 1GNPA 1K6MA 2HCJB 2WIBA 4M1WA 4KVGA 1DG3A 4FW9A 4EUNA 1RRPA 4DDWA 2IYTA 3ADDA 2P6RA 2QTVB 2QPAA 2YOFA 2NZ8A 1OH8A 1RKBA 4KU4A 3ZVMA 3QG5A 4OQXA 1XDBA 2O0HA 4MYUA 3K0EA 1JB1A 4HZUA 4XVUA 5DI3B 5H8WA 3IGFA 2VTKA 2EYUA 1G8GA 1KDPA 1W0KD 4QJ4A 5B30A 5CB6A 2QG6A 4IDQA 2WJJA 1ZCBA 1P4SA 4B6FA 2OT3B 1E2NA 1OB2A 1Z29A 2FOLA 3KKPA 1IN5A 1Q20A 4GOKA 4KLNA 4FMDF 2ZREA 3VHLB 1G19A 2WWHA 3KKQA 2BMFA 4UXJA 3VTKA 1W2HA 4Q19A 2QE7D 1R2QA 4PR0A 2GETA 1G64A 1XEWX 1JI0A 3C14C 2JDIA 1EESA 1N2CE 1VG9B 3E5HA 3HJNA 2B8WA 3QVUA 2BJVA 4F7WA 1N6IA 1S2MA 1CRPA 2GA8A 4B47A 4M9ZA 1X8JA 2RCNA 4JS0A 2IS4A 3CF2A 1G291 4F92B 3X1DA 1EFTA 4JT2A 3TAHA 1N5JA 4G5OA 4C0HA 1MRSA 1QHSA 1P9RA 4KO8A 1RRGA 1YKSA 3AF3A 1YR9A 1KO5A 5J40A 2CE7A 4OK6A 4XD7D 5EZ6B 2ONKA 3A1UA 3WMEA 4QBFA 2EFDB 3B7GA 1BMFA 3R7WB 4CDGA 1MOZA 2G0NA 4TL8A 3SFVA 3ZZ0A 4EPRA 1HH4A 3FMOB 4OQLA 2D4HA 3DOFA 2GF9A 2J87A 3EX7C 2HLDD 2QAGA 3C5HA 3VFDA 2GF0A 4NMMA 4TLAA 5EXTA 1JEDA 4MGIR 1NVUQ 3MG9A 5FPTA 3VR2A 4L9WA 2WBLC 3B8HA 3V9PA 2VHTA 1S1CA 4OI0A 2ODWA 4JLBA 1G1MA 1BOFA 3P32A 3QKSB 1U94A 4MYCA 5HTKA 3LQRA 3ICEA 4J0QA 3L8YA 1I4DD 4IEIA 4LV5B 1HYQA 4XSGA 5EZ5A 1MABA 2HT6A 4PQFA 1JR6A 4HLCA 2NO9A 2Z4SA 3I3SR 1MV5A 2OM2A 1SXJB 5K8UA 2J0QA 4ARZB 4DLTA 4UNPA 1VECA 4JLOA 2F55A 4XIGS 2WV9A 1KJYA 2DHRA 4FINA 3FHCB 1C9KA 1DAFA 1X8KA 3KL4A 1DAKA 3LBIA 4AY2A 4PHFA 3SE0A 3PUYA 3WP0A 4ZKEA 2YYZA 3TW4A 5J4YA 1I2DA 2JLRA 5CLQA 1W5SA 5CM8B 4Q4HA 3UXMA 3PEYA 4OHXA 4B3BA 1IONA 2QY9A 1T0HB 2V54A 4JJKA 1U81A 4EPTA 2AFIE 1Z6TA 2KBFA 2X77A 3CRVA 1SXJE 3QBVA 4HLQB 3TUIC 1E2KA 3GLIB 2FPKA 3KXLA 4BFUA 2GAOA 3T61A 2BMEA 1BS1A 1Q1ZA 4BZXA 5LD2C 1GIAA 1U0JA 2WSSD 1P2TA 1ZIPA 2B92A 3GLHE 3Q5DA 5EP3A 4D4LA 4M9SA 4LYHA 4RD2A 2ZJ5A 3QEJA 2IX3A 5IK2D 2VL7A 3FWYA 2BV3A 3EARA 1VCMA 4LHZA 1NMZA 5K8LA 2J7KA 1XPUA 1XPRA 4M21A 5SZIA 4LJ6A 4OL0A 1KMHB 1YVDA 2ZJAA 4Z51A 3NXSA 2IHYA 4V0KA 2GEDA 3HDTA 3W3AA 3QENA 5KOYA 3PUZA 3UK6A 5KDLA 5C1BA 1UFQA 4LRWA 3AVXA 4NCNA 2IK8A 5EUMA 5BN4A 4Q5IA 4Q47A 4UXIA 4Q9LA 3FYHA 3MLEA 3QKRB 3ZZTA 4URYR 4MA4A 4LDJA 3LFUA 1KOFA 2CL0X 4A8JA 3BIFA 4QJ3A 4RCZA 1TTTA 5G3ZA 2W00A 3KUCA 2KBEA 4I1UA 3GEHA 1G3IA 5EXPA 4XWKA 2Q9CA 3CWZA 2PT7A 521PA 1IJEA 3A1VA 4QHTA 5JCZA 2ZANA 4NZYA 4HAZA 1E9AA 5TY0A 4JYBA 3DMNA 3CF0A 3C16C 2RKOA 4DXAA 3T34A 1JBKA 1XMJA 3UIEA 1E3MA 1G6OA 2W58A 3AEZA 4O25A 2IW3A 4Q9JA 4DCVA 5L3SA 2R9VA 1F6BA 3SBDA 1HEIA 3AKDA 1FMLA 1E2GA 1Z8FA 1AKEA 3AF2A 2ASEA 4IJMA 3D8BA 3PFIA 4PAMA 4GT1A 1GRNA 2REXB 4C0QC 1KJZA 2ANBA 3B1YA 2RHDA 1EFCA 1QVRA 1W0JA 2GVDC 2ZI6A 4IDNA 1NLFA 1ONBA 2CLDX 3HPRA 4BLOA 2I3BA 4QNRA 3FOZA 1G7SA 2AKYA 4JL6A 2QSZA 1SQ5A 3PIRA 3LLMA 2AR7A 4Q4AA 1FZQA 1NSTA 2WOJA 2FSGA 4LV8B 4TWZA 5EE3A 3CPHA 2RB4A 3SR0A 3E1SA 1CIPA 2A5GA 2D62A 2H1LA 2VHJA 2VBCA 1CTQA 4RZ3A 3D3QA 3FDIA 1NI3A 1KSJA 3N2IA 4ACAA 2ONJA 1Z08A 2WICA 3L0PA 4EIWA 3U7EB 2QU8A 2JAQA 5HZHA 1GNQA 4LHVA 2VLIA 4FIDA 2YJTD 1FTNA 4WZ6A 1UEIA 4A0FA 2QPOA 2AK3A 2ZI3A 4YXWA 2BBOA 4NYIQ 2JLYA 1U9IA 1Q57A 4QBIA 1EGAA 3PUWA 2WAYA 4IW3B 1YJ5A 1YZLA 4Z8YA 4DLVA 5FL3A 3LNCA 4Q1CA 3PXGA 5BYKA 4AKIA 3TW8B 2REBA 4XSHA 1E9EA 2N42A 1KSGA 1HTWA 2NIPA 4WW0A 2ZYVX 1V43A 2RAPA 1G5RA 3LX8A 4UXHA 5CYOA 4B75A 2CLSA 2GXSA 3DDCA 4MRSA 5DSZA 2WJVA 5DE3A 1E2FA 1NBMA 2NTYC 3CO5A 4UNSA 4HLUA 1OIVA 3WNDA 4GZLA 1FNNA 4LI0A 2AFHE 2PMKA 4PZYA 2IS6A 1AZSC 1GM5A 3ND9A 2QM8A 2ZRKA 3EPHA 5CDFA 3VMFA 1P72A 2C04A 4DSUA 1W36B 2F6RA 2O8DB 1LTQA 4C0AC 1XJ0A 1VIAA 2P65A 3HYRA 2WMNB 5FPYA 1LVGA 2AHOA 3CONA 4M0LA 4PC7A 2HDNB 2RHMA 2GJ9A 2OO7A 4QM6A 3M6AA 3RSLA 3BC1A 3H0KA 2HXSA 1IM2A 4HZIA 1DE0A 2XNDA 3EIQA 3OIYA 4GZMA 4P4SA 4RKEA 1NKSA 2C96A 4I99A 4OHWA 4V02A 1SHKA 3FKSA 3QY0A 2P5TB 3C15C 4W5WA 5K8TA 1PLKA 1OYYA 3FMIA 3TR0A 1W36D 2PLFA 4YMTA 1O87A 1JNYA 4MUAA 2OLJA 1Q21A 3QPUA 2A30A 2VP5A 4U02A 1XEXA 2VHQA 3VX3A 2HYIC 3WYGA 4AI6A 3GQBA 4CYMA 2CMKA 2C77A 3B9PA 3W6OA 2Q3FA 1E2QA 1WF3A 2JLSA 4JLJA 3WMFA 2UZ3A 4A2WA 3NIBA 3U3KA 3OZXA 2MSEB 3IILA 1E2JA 4M53A 4NDZA 2XZLA 1GL9B 3L8ZA 3R9IA 5BYJA 2WHXA 4EFMA 3UKDA 4JVNA 4B44A 4B73A 3AVQA 2QMUA 5JI3E 2ZIAA 3KJHA 4IVPA 1CKEA 1GRRA 2XOKA 1NJFA 2AX4A 1OFTA 4B6EA 2GXUA 1ETUA 2VHCA 4KBGA 3U4QB 2EW1A 4NTZA 4BEBA 2IUSA 2DFKB 3CM0A 2VEDA 1JPJA 2GXAA 1E99A 3RVBA 3ZJYA 3CRRA 2V6JA 5G53C 1RC8A 3IIMA 1DELA 4Q7LA 4R9UC 3GLFB 1K5GA 2EQBA 4YONB 4DLWA 4DCNA 4M1TA 3B9QA 4RD6A 4BZPA 4CW7A 4IDPA 2J0SA 3RRNA 1YR6A 3KJIA 3DVLA 3UWOA 1J2JA 3K8YA 1U8ZA 4O2LA 1NSFA 2XTNA 2IYRA 2AKAB 5F98A 2OHFA 1UBEA 4ZIRB 2CHQA 2IL1A 1E0JA 1EFRD 1II9A 2OBNA 3CLVA 4Q7JB 3OE7D 3SJAA 5JI2E 1T9HA 2QORA 1R0WA 1G7RA 4M9QA 5D3MA 4A15A 2CL6X 4MGYR 4L8GA 4O3MA 1FUUA 1R5NA 1VIYA 1ZD8A 1DAIA 1UM8A 1ZD1A 1EX6A 2J46A 1M2OB 3ASYA 1TAGA 3AGPA 4PC1A 2DFLA 1COWD 5IF9A 5FUWA 1TU3A 4NCIA 3WNBA 1G4AE 1VHLA 4KYUA 1HY3A 2C5LA 2QZ4A 4DIDA 2G9NA 5E7MA 3QXCA 3KQUA 3ZVLA 4LJ5A 3OFNA 1K8RA 1G6HA 3HU1A 3A6PC 1WCV1 4MUBA 4WZAE 3WY9A 5EP1A 4DLRA 1D2EA 1AGPA 2FFHA 4MRRA 4OKSA 3O8CA 1D6JA 3JVVA 3OEED 4E03A 5JZVA 1CBUA 1Z83A 4II7A 3QKRA 3QG1A 2EFCB 1M8PA 1LS1A 3NH9A 5FFMA 2JLXA 1XZQA 4DSTA 4B71A 1E9CA 4GI7A 4LHWA 4A8JB 4C0KA 4LJAA 4WXPA 4KODA 4YMSA 1T8UA 2V7QA 1Z6AA 3CPJB 5CJPA 1Z0KA 2WKRA 4FCTA 4WBSA 3A4NA 1DOAA 1KAGA 1X8LA 1HQYE 3AF4A 4NHOA 3CR8A 1M7HA 4ZCMA 4G01B 2JGNA 3VR5A 2R62A 1OIWA 2ZUBA 2K5UA 5E7JA 4G5QA 2J45A 3THXB 3H84A 5E95A 1QHNA 2FN4A 2RGAA 4HAUA 3HYTA 1LF5A 4NH0A 3BXZA 2JLWA 2F1JA 4MKIA 2JJ8A 2QRNA 4P0TA 3PUVA 4Q4LA 1VPLA 2MMCA 3THYB 1IHUA 3U5ZB 2DBYA 3RWMB 2OXRA 5DHAA 2DYKA 1KDRA 4MRVA 4TMVA 4G5RA 4EJSC 2W2TA 3X1XA 1US8B 3I5XA 2QN6A 1IBRA 5FUXA 1NLYA 4BFVA 2WIAA 3OIUA 3K70B 3UMSA 4OYHA 4EPWA 3IEVA 4AYXA 4PZLA 3U3RA 1G7TA 4AK9A 1OXTA 1E2HA 2PJZA 1OHHD 5B2ZA 5AJZA 1S96A 3KX2A 4FMCF 2GHIA 3T5DA 3EC1A 1TF2A 1NMYA 2JJ1D 2R65A 1X1RA 3C7KA 1G3RA 2FSHA 2GK6A 3GPLA 3FPAA 1AZTA 3TLXA 2C2HA 4KI0A 2IWHA 5CDFE 2R6CA 4D4MA 1F2TB 1NVVQ 2W2XA 3I73A 3EZFA 3CNOA 2G77B 3IO5A 4JLNA 4TMXA 2ERXA 2GCOA 1UEJA 5KTYA 2JJ2D 2OLKA 2PZGA 4R7ZA 4OK3A 2WMOB 1XJQA 4V0MA 1E4YA 3F0TA 2GJAA 1QDEA 2OV2A 3E2IA 1LV7A 1ZU5A 1CJKC 2IA5A 1VMAA 4Q4JA 1G8FA 1DG1G 3UANA 1EFUA 1Q1QA 4P3YA 1RPZA 2X2FA 2ZE5A 2OCYC 1T91A 3NHAA 2QBYB 2CJWA 4XOIA 3U6KA 3MUFA 4US0R 4CGZA 3SYNA 2F9LA 1LF0A 2O8FA 1KY3A 1RVDA 2MSCB 1IQPA 4FMBB 2Q0HA 1W49A 4M2LA 1M7BA 1YRAA 3VQTA 3KB1A 2V6IA 5ELXA 1ANKA 2D2EA 1K5DA 2EVWX 1JEEA 3FMFA 1YZUA 1PVOA 3K0CC 3BFVA 1NVXQ 3MSXA 1N6KA 2ZM5A 3KQKA 4PAOA 2JIZA 3NBYC 2QL6A 1WXQA 1KZ7B 2PBRA 4A2PA 4AWXA 4BE7B 2QM7A 4ABYA 4RD1A 1T5IA 3ADBA 3ONWA 5EXSA 4BFWA 1I4LD 4O2RA 3T1TA 1HE8B 2VP4A 2ZS8A 4OHVA 2VO1A 4QGHA 4C9BA 4P31A 2GJKA 3BB4A 1MO6A 2A5FA 2XXAB 1E9DA 4PHTA 1NN0A 2V9PA 1GG2A 4W7SA 2X19A 2OAQ1 4HEJA 2GEUA 1KY2A 1XTSA 2EFGA 3LXRA 2BCGY 3CF6R 4HDQB 3WMGA 3U4QA 2PH1A 1SVOA 3KTAB 3TRFA 1G16A 5H1YA 1UDXA 2BBWA 1KKLA 4A0RA 3FHTA 3VKWA 4U7DA 2VHUA 4HB0A 4M8NE 2OAP1 4FCWA 3RS7A 3QXXA 1KIMA 1OXUA 3VKGA 1VHTA 4AKEA 1YE8A 1PZNA 1SVIA 4HDCA 1N6LA 4NBSA 5HCIA 1QG4A 2GEVA 5H70A 5L3RA 2FDCA 2WSMA 1Z47A 3K0AB 4MITA 4B33A 4ZCIA 5HE9A 3RLFA 2BIFA 3SC3A 2P3SA 3GD7A 3FVQA 4PFSA 2WWIA 1GZSA 1NY5A 1X86B 2J0UB 1LY1A 4MQBA 4TTPA 3B5JA 3OAAA 1N3BA 4D4JA 5HCNA 4Q1DA 1C4OA 2BJWA 2P67A 4D26A 2IBMA 2JDID 1E1QA 1CJVC 2LWIA 3LX5A 2W6ID 1E2EA 4PHGA 3SS8A 3FB4A 2WZQA 1KI7A 2XJ4A 2J7PA 2PCJA 4JIMA 1KSHA 4US2R 3SJZA 1Z2CA 3R9XA 3SQWA 1WP9A 4M1KA 4QGAA 4PHHA 5HE8A 4TYYA 1ZUHA 3KJGA 2YOHA 5EP4A 2WJYA 1FQKA 2KE5A 1B0UA 1P61B 1Z0FA 4DB2A 2P0EA 1W36C 4CIDA 4DT1A 3SNHA 4Q4JB 3QVVA 1E0AA 2QMHA 2W6JA 2CDNA 3GFTA 4EFNA 3EASA 3IEUA 3PEWA 3IIJA 1W48A 3BE4A 2QP9X 1XCGB 1GVNB 3FTQA 3AP2A 1JR3A 5KSPA 2ZRDA 3VNUA 2O52A 4WA7A 2W6IA 3WYAA 1NLZA 2FF7A 1L4UA 4A6PA 3THWB 4M1MA 2PJRA 4KHZA 3AVUA 1ESMA 2W83A 4HUQB 4E5UA 4DWJA 1NRJB 2BEJA 1MT0A 4YMWA 2QENA 1E98A 1XWIA 3S1AA 5EUQB 4AD8A 4B35A 1XD9A 3WNCA 5L8VA 3SQXA 2AWOA 4TT3A 3TH5A 3DKPA 4BUJA 4G3XA 4BFXA 1ZNWA 2EYQA 1M1YE 2Z43A 4JMPA 4POAA 3CR7A 1DVRA 4IHQA 4LYJA 3B85A 3THYA 2CK3A 1ZM4A 2ZS7A 4UQOA 4NONA 1R5OA 1E9BA 3AF0A 4B3CA 3HR8A 1X1SA 3Q5EA 3X1WA 4CZ2A 2VP9A 2OUKA 1NVWQ 1KI8A 3TR5A 5AJYA 1NJGA 5JWRA 4XVRA 1TL7C 3LY5A 1KZGB 1QHXA 5DYIA 4ITRC 2QPTA 1HA3A 1ZVQA 3LBHA 4D25A 1SXJD 1AA9A 1R0ZA 2FGKA 3OF5A 3BORA 4NE2A 1F48A 3BK7A 3UMFA 5G3YA 5BN5A 4RZ2A 2XB4A 2ZI7A 4BPBA 5KNBA 3IQWA 2NGRA 4NYMR 4TQAA 3GJ0A 1E9FA 5TXGA 2KWIA 4UNNA 4HAWA 4LJ9A 2IYWA 1ZC4A 2OBMA 2RGXA 2ZRIA 1FX0B 2HJGA 1UBFA 2VQSA 4AG6A 5DHFA 2WJGA 3LVRE 1KO7A 1N5LA 3Q7PA 2YWEA 3PITA 4OI1A 4Q9HA 5AUOB 2IS1A 3LH5A 3KFVA 4BECA 2ORWA 1HUQA 3PCRB 4FCVA 3MAAC 4A36A 2CEAA 2PZEA 3T1QA 4TL6A 3IQXA 1UADA 5F9FA 3ETLA 4HATA 1E2PA 1ZBDA 2IT1A 1Q1EA 1BIFA 3GLIA 1IXRC 4D0NA 3AVOA 1II0A 2FA9A 1AJEA 1KI6B 3AV0B 1EX7A 1II8B 1OT3A 1E1RA 5KSZA 1ZM2A 2BWJA 5J4VA 2N46A 5JS7A 1KTVA 5J5CA 1NL3A 1A5TA 1FOEB 1FP6A 1GKIA 3EC2A 1ZU4A 4NCHA 2PX0A 4EFLA 1OJLA 4Q9IA 3NDBB 4IFBA 3EA0A 4XJXA 5P21A 3TE6A 4CEJB 1DO0A 5JCPA 1OB5A 3W8NA 1W2GA 3I72A 4G5GA 1S3SA 1XMIA 4Q00A 2Q9AA 2ZQ5A 2FFQA 4NYIR 1W4CA 1MH1A 4XH9B 5BQ5A 4S35A 6Q21A 4TTQA 2CNWA 4GOJA 4TMKA 2FFAA 3P4YA 1N5IA 4W5JA 4QBHA 2Q21A 4P4UA 4C4PA 1IY2A 4DHEA 4GP7A 2QT0A 3RNLA 1XTIA 1OH7A 2JLVA 2ZVQX 2ZETA 3FHOA 2BOVA 5C18A 2NO7A 1YQTA 3KDSE 1OF1A 5HPYB 2QT1A 2ZXUA 3A4MA 3OESA 3NBFA 1Z28A 2UVQA 2O8CB 5JSZB 4BLPA 4A92A 3ZS9A 2OCBA 1HV8A 4C7OA 4G1UC 2JJ2A 2FPLA 1KI3A 2WVJA 3I32A 3U3JA 4DEYA 1Z06A 4V0OA 1EWQA 3QF4B 3THWA 2ZJZA 3GJ5A 2AWNA 3IDQA 1AS3A 2WPDA 2GESA 2GWHA 2QQEA 2JASA 3QKUA 4D81A 1GP2A 1H8EA 4DEXA 2I4IA 4LK2A 5L3QA 2HV8A 4D0LB 2WWXA 3AUYA 1T3HA 3VR6A 4AURA 5SZHB 2DFTA 1XZPA 4A9AA 4BLTA 4FMCB 1P75A 3TVDA 2PL3A 1Z63A 1XF9A 1U2RA 3BH7A 1IAQA 3PEUA 2HF8A 4B48A 2VP0A 3BB1A 3IBYA 4C2UA 4FXPA 4RZUA 2HT1A 5L3SB 1NBME 1JQLB 4RSGA 2ZSBA 3RRZA 1ZNXA 3LW8A 1EFHA 4HAVA 4LPSA 3T35A 1OXXK 3CNLA 4ASUA 3QSYA 4NYJQ 1AM4D 3W6PA 2EFEB 3OHMA 5EJEA 4ZPXA 4Z1MA 1U99A 1MKYA 4CT4B 4LWZA 4DUGA 1VG0B 2WWYA 3VU9B 2AD5A 1KO1A 2BM0A 1ZNYA 5FL7D 2RGNA 3U7GA 2GRJA 3KTAA 2RGNC 4Q4AB 4QHSA 4LSGA 4QFMA 4TYQA 3ZIAD 2CHGA 3LV8A 5DN6D 1HT2E 4YDSA 1NN1A 2VRWA 1U9IC 1SVKA 1TU4A 1GSIA 3B1WA 5FPSA 1CR0A 3LAWA 4ILEA 1FQJA 4B3GA 4MYTA 3BOSA 3W5JA 4I1VA 1FX0A 5HKKA 4QM7A 5BXQC 1RRCA 4ZDWA 2CXXA 2V7QD 4MKHA 5FBVB 2C98A 1EWRA 5DISB 2H57A 4M1SA 4X8HA 2Q9BA 4H1VA 2ZRJA 4PC2A 3U2QA 4LHXA 1H8HD 3EA5A 4P4TA 5FPKA 3KFXA 1T6NA 3PUXA 1WMSA 3I4LA 3BS4A 3KQNA 4PPNA 3CZPA 2CHVA 2WM9B 1BO6A 3SYKA 2Z83A 4V0NA 5CB8A 1YR7A 5TV2A 1R6BX 3KUDA 2AN9A 2H8KA 3ZVRA 5E7IA 3Q9LA 4BRWA 2W0SA 2XX3A 4F4CA 1OLOA 5TARA 4A0HA 2G83A 1R0XA 3REGA 2EU8A 3RC8A 1XRJA 4LCBA 4RD4A 4P4SB 3LVQE 4I4LA 2FSFA 1P9NA 2GXQA 1SKQA 3K09A 4F91B 4GP6A 4FMDB 3BH0A 1W44A 4LPKA 3OIWA 1ZNZA 3CX7A 3MJHA 3NG1A 1KK2A 3C41J 3TAUA 4B2PA 5J4KA 1GAJA 3DOEA 4TSFA 4RJLA 2ORIA 3A1WA 3CNNA 1AN0A 3RS0A 3NHBA 3Q85A 3G82C 3V00A 3L2OB 2BC9A 3P26A 4HUQA 4DVGA 2V3CC 1N6OA 1A82A 4LJYA 4S2EA 1IY0A 3RABA 4XWOA 2ZRBA 2IUUA 1Z6YA 2LCFA 1XEWY 2VYFA 2WWGA 3S1AB 4K46A 3AVTA 3ZZUA 4E09A 1TEXA 4TSFD 4KYIB 1AKYA 3BH6A 4BFYA 3VR4A 1E96A 1E79A 3THOA 4DCTA 4EPVA 3H2YA 1P73A 1PUIA 5DYGA 1W47A 2QP4A 4JL5A 4KSCA 1FFHA 4QXAA 1CJUC 3ADKA 4YMUA 3CPEA 1E32A 1SVSA 2J5XA 1VYVA 1ZM7A 3SU8A 4BWYA 1QHHB 2OG2A 2V55B 5GJVC 4FWIB 2OFXA 3KJEA 2IXEA 2AD1A 3LD9A 3NBZC 4DLYA 2IYXA 2QMOA 3TIFA 5JRZA 2FG5A 4EJSB 1XXHB 1OH5A 4OI2A 2O5VA 2QTHA 4MRNA 4OJKA 2QQ0A 2C8VA 5KPJA 2F9MA 5JLJA 1BYIA 1O3YA 1TF7A 4B74A 2XTZA 3WP1B 3KXIA 4M9XA 4NYMQ 1P6XA 1II8A 1OSNA 1OKKA 1ZM9A 1GDDA 4KFRA 3ZQ6A 4K81B 2B8TA 4DCSA 2BMDA 4IFEA 1UKEA 3T12A 1FTSA 4ESHA 4KXFB 2R44A 3HU3A 1LNZA 2XNDD 1Z07A 3TQFA 4OQMA 2GZAA 4HB3A 1KO4A 4JL8A 4TN1A 2BBSA 1F2TA 5JECA 3NDPA 2PEYA 5JBQA 1J8YF 4L16A 5HKKD 3AB3A 1Z3IX 4OJQA 1G8YA 1Z0DA 4DDVA 1MRNA 1NG1A 2V1UA 1P9WA 2EFHB 2Y8EA 4IOJA 2O0KA 5EXXA 2GBLC 1KHTA 5JWOA 3GJ8A 1UJ2A 5DN6A 5TB5A 3VAAA 2XZPA 1G8HA 3MWKA 3ZIAA 2XZOA 2XSZD 3KQHA 3R9WA 4V0LA 2CBZA 1QZXA 2O8CA 1XD2A 4DDUA 3MJRA 4AYWA 4JVSB 4TMTA 4TLDA 1D9ZA 1ZC3A 4Z1MD 3SJBA 2ODNA 3TSOA 2R6AA 3WHKA 1DPFA 2A7QA 2RMKA 1HURA 1N5KA 4R2IA 5DI9A 1FPMA 4IOMA 4LHYA 2QP3A 3NH6A 3AP1A 3DO6A 1WQ1R 3B2EA 1CR1A 3U7HB 1Z0IA 4NU0A 3VR3A 2D06A 2X8AA 3ZH9B 1N6RA 2V4ZA 4PSAA 4HYYA 1T5LA 2WWFA 4RKFA 3TBKA 3U60B 4LBVA 1SVWA 1Z6GA 3HR7A 2YV5A 2NOAA 4K8OA 5FTJA 5EE9A 1Q1BA 1PLLA 2Z4RA 1XP8A 1G41A 4YMVA 4V0ME 1OW3B 4A0GA 4HAXA 1IN6A 4DLZA 2XGJA 4PO9A 5TMPA 1ZYUA 4ZV4A 2QROA 2WWWA 4KFUA 5SZKB 3ZLJA 2YVUA 1XCPA 1CF4A 2FFBA 3Q7QA 2YZ2A 1EXMA 4XTCS 3R8FA 1OKKD 2VP2A 3E70C 5FUVA 1YZNA 1RW4A 2IHBA 4Q01A 3AH8A 1NN5A 4W9MC 2OBLA 4JBWA 4Q1BA 4YLGA 4JLMA 5KU1A 1E69A 3K70D 2D7CA 1W0JD 4ARZA 3PG5A 5BW8A 4OHZA 3KKOA 2QAJA 3VNVA 4QGGA 2BDTA 4DC9A 4ON9A 5FTMA 5KUTA 1GITA 5CYPA 2ZRPA 4UNRA 8OHMA 3EXAA 2H18A 2OSBA 3UG7A 4GOXA 4JLKA 2YINC 1JALA 2KI5A 3K9GA 5K8IA 3RS3A 4A2QA 3BD9A 4R98A 2BM1A 4DLSA 3DZ8A 1IN4A 2QGZA 1UBGA 4IRUB 2O0JA 2A5DA 3FKQA 1KJWA 2QGNA 3BBPA 3O8BA 4N1AA 4TMZA 1E1RD 4WVFA 3X1YA 2D74A 4JVMA 2ZI4A 3PV0A 1QG2A 4EAQA 3K0AA 4F4IA 4BGDA 4Y0VA 3RWOA 5FI1B 4Q1EA 3QBTA 3I92A 4Q18A 5BN3A 4PZZA 4OQFA 4JVLA 3GCGA 2D2FA 1RE0A 1G18A 5F9HA 3B1VA 1A4RA 2OCAA 4JKIA 5JHGB 3C8UA 2O8FB 3BAFA 2J41A 3L0SA 1KKMA 3QPVA 1RZ3A 2ATVA 3AVYA 2ZU0C 3SHWA 2C9CA 1JR3E 3CW2A 4XWAA 1ZCAA 2PCLA 2V1XA 1FMJA 1SVLA 5FTKA 2ECKA 1TPZA 1B23P 3L43A 3W9YA 5HZKA 2A5JA 2ZRAA 3LBNA 2FEOA 1E2MA 3WRXC 1KYIA 1XFAA 2P6UA 3QNUA 4KJZA 4D2IA 3TQCA 4PANA 3L82B 1RJ9B 4HSEA 2JLQA 4MYHA 1XD2B 2ZJYA 5KDOA 1VCNA 1TX4B 3IPXA 5IK2A 4C0JA 2O8BB 4DLUA 4PPQA 4H9GA 5JEDA 2J0VA 1P5ZB 4URXR 1G9XA 2BKUA 2J59A 2BBTA 4LZZA 4RFVA 1QRAA 3TKLA 4BLRA 2PEZA 2TMKA 2HUPA 2BKEA 2RGBA 2CK3D 4RY2A 1YU9A 5L3VA 4W5HA 4IOKA 1LS6A 4CEHB 3ZDQA 2HEIA 4X8LA 2AXNA 4JZKA 2XNSA 1C1YA 1R4AA 4CF7A 4TT3D 2VH5R 1GUAA 1Z0JA 3CH5A 4M22A 1Z22A 1SZPA 2R6FA 1W5TA 2FZ4A 5EP2A 4B3XA 5CLLA 3PJRA 1IN7A 4GPTA 1ODFA 1NIJA 3T15A 2DPXA 3KXKA 2PZFA 1ESNA 2VF8A 3FFAA 2FSIA 2WJIA 3QOFA 1JR3D 4TQUS 4CEIA 5FOVA 4UKDA 4ZCLA 2F1IA 2IXGA 5FBQB 3AM1A 2OILA 2VIIA 2C78A 2W6JD 3A36A 4XVQA 5KSYA 3SDZA 2Q3MA 3SEAA 1NMXA 4IVQA 4V03A 5FL7A 5H68A 4RFSA 4PSKA 2FGJA 4N0EA 4DUGD 2B6HA 3IBGA 1XEFA 4B43A 1G17A 1AS2A 1D2MA 4IDHA 3A4LA 2L0XA 5IT5A 3FGNA 5KYKA 1MO5A 2WKPA 2J7PD 2ZSFA 1WBDA 3MFYA 2ZR0A 4JBYA 1TEVA 1G3MA 2ZE7A 1SHZA 3D6TB 3P27A 2HLDA 4JSTA 4KAXA 2QAGC 5KNCA 4MKFA 4Y0AA 1T4GA 2GKSA 2P6NA 4KFSA 4IDOA 3OAAD 2YHSA 4NP6A 3JZAA 4O0MA 3ADCA 3A8TA 4NCKA 2FJUA 2ZRHA 4QNMA 1R8SA 4XD7A 4A6XA 1XX6A 3FFBA 1DAEA 1H8ED 3L0IB 4DLXA 1OFHA 1JPNA 1VCIA 4CVNA 4B34A 1RYHA 4HLDA 1FNMA 1U0LA 1GL7A 3NC1C 3NEYA 1GFIA 2BEKA 1T3LA 5JFGA 2F7SA 4WXRA 1TUIA 1G3QA 4LUCA 4RD0A 4JT4A 5EE5B 5TVKA 5FI0B 1S8FA 1KK1A 3AVVA 3K9NA 1KAOA 3OEHD 1OXVA 2ZE8A 4ZDIA 3K70C 1DTSA 3NWJA 1P60A 3GEEA 1MR3F 1R7RA 1UBCA 2R2AA 1BYUA 4L9SA 4Q7KA 3T5GA 2H7VA 1D5CA 2F43A 1ZMXA 4LX0A 4URZR 1R10A 5JJLA 2KSQA 1G20E 2HF9A 4JJZA 1M34E 2DWQA 4B3FX 4ESVA 3IO3A 5DNYB 3K0SA 1T8TA 2CNWD 5AR1A 1ZAKA 3H1TA 1WBBA 2A2ZA 2EWWA 3K0FB 4GSYA 4HI0E 821PA 4DDTA 3G0HA 2W0MA 4GRAA 4EPYA 3MWJA 4DBLC 3T1OA 1W0KA 4LGMA 5JSZA 3SBEA 2VSFA 1E94E 3N2EA 5F3WB 3AKCA 5FUYA 4LYFA 4DB4A 2DY1A 3B60A 2ZROA 2O8BA 4RZXA 221PA 4IXMA 1AQYA 3ZS8A 1Q22A 3HU2A 5KSOA
chains in the Genus database with same CATH superfamily
2X23A 1TQ2A 2ZR7A 3KKEA 1H2AS 2JIZD 5FUBA 3ASZA 4F97A 2PYDA 1SCUA 4TYWA 4KCGA 2GSDA 2JGAA 1IUOA 4RM3A 3M1YA 3G0IA 2QTFA 2R4UA 3D2LA 4MGZR 1SZCA 2G76A 1L7VC 4KFTA 4IUDS 3H0CA 3GFSA 3T9BA 4YRLA 5A4KA 4TL7A 2R5NA 2ZIXB 2ZPTX 1N92A 4QE3A 2FWIA 3RVLA 1L4YA 4E5KA 4CM8A 4H0CA 1DADA 3K9HA 2QAIA 2JFOA 3VPSA 3ZEIA 3HBJA 4A27A 2AI3A 5JTTA 4GNKA 2DGDA 4HNQA 5H81A 1M6WA 1JDNA 2R6GA 2PXAA 4J0HA 1QSGA 1ILWA 1XPOA 3K1JA 3FRHA 3HUDA 1I32A 1BQEA 2ZQYA 3BG5A 2OV3A 4RF5A 3CIOA 4QBKA 2AFVA 2GCPA 1AZWA 3ZHUA 4F6RB 5KWEA 2CUZA 4F56A 3U6BA 1S9HA 2ZFUA 3TUZC 3EZYA 5J1SB 4AS3A 4RQTA 3F9RA 4R2MA 4M1OA 3ZGNA 1R6UA 3GGPA 1XKTA 2PLNA 4MWDA 4U2DA 2ES4A 3U7QA 4KRGA 3KQOA 4XDYA 1RQRA 2CXPA 1C1XB 3DSRA 1XU4A 2Q27A 4BO0A 2A0XA 1Y8AA 4ZO7A 1ILEA 2YC2C 1E9RA 5C8XA 2GNOA 5JJKA 3R75A 4YT4A 2GJSA 2ZYWX 1BWPA 3AOGA 3B1XA 1OI4A 4H7FA 3RRBA 3RUFA 1AHIA 2H16A 3DB2A 1GPLA 1E58A 2E2WA 2D5BA 3HPQA 5K0LA 1DXQA 3FPBA 5ETJA 4NOJA 3V7FA 5EKUA 5DX0A 4TRRA 2PQ2A 2IF0A 4YIHA 4B80A 1ORTA 4JBNA 1C9JA 2I5PO 2QR5A 2DPMA 1PYOA 2JFYA 2ZB7A 3EISA 1CFJA 1HZJA 3K30A 1SBTA 1DI0A 1OJ7A 2X0KA 2XVYA 3G2QA 3P1JA 4PFJA 4Y9DA 3AEKB 2O8DA 1UKZA 2JJ1A 2VNKA 3ITKA 5ALRA 3RSZA 3SOPA 5JC1A 1QCYA 1M2VB 1L2TA 3S99A 1V5IA 1EZ4A 1Z5WA 2RK3A 2VSXA 4TWJA 4ZEVA 1GV1A 1I0IA 4EENA 5GZ3A 5C46F 1QBKC 2CB9A 3FYDA 3H6HA 4D9JA 1Q3TA 5C2JB 1HG0A 1RKXA 1E5QA 4DTIA 4EI7A 4WD3A 5EJGA 1L7QA 4MWCA 1XMQB 1WW8A 5FH9A 1YDHA 3D3KA 4GDFA 4OFZA 5C5EA 2IYQA 9LDTA 5JROA 1C0EA 1CZRA 4HGNA 4YQYA 2VJCA 4ZVLA 5HCUA 4QKQA 4QWWA 1ZJ5A 2Z0MA 3E18A 5EGNA 3SN6A 3WB9A 1QZUA 2VYVA 3PFWO 1EGHA 2ZRLA 3CX3A 3SSNA 3BHNA 1Y9ZA 1FYVA 3DT6A 5E3HA 1JXOA 3WS7A 2PX3A 4J2HA 3RFXA 3F4KA 1GG5A 2XQFA 3DOIA 1KE1A 4HNGA 3SHVA 2VT2A 5DTQA 3S7TA 4EZEA 3VZQA 1U5AA 1Z0UA 1QQTA 3CWQA 3VR5D 4LMBA 3VX4A 1RSZA 1ZICA 1E1QD 1NVVR 2QNRA 3DPUA 5LBIA 1TKAA 4I81A 3OECA 4G0VA 3TZQA 4LF8B 2UYGA 4HADA 5BSVA 1JGTA 2GNAA 2NG1A 2A1UA 4WLUA 4WOBA 4N3NA 1HGXA 4UTRA 3WL5A 5E9AA 2VOEA 3BB3A 3UHOA 3A9RA 1PL8A 4ZYXA 1FY2A 4L76A 4V1CB 5JRJA 1TA9A 3S55A 2HL6A 1VG8A 3DZJA 4G26A 3CW8X 5A62A 1E3QA 3B6EA 5K8CA 3F3YA 2MSKA 1TJPB 1XAIA 3A4IA 3H9UA 3H2HA 3RRNA 3MRSA 2ARKA 3U4DA 1GCGA 2Y4NA 1KI4A 3FVRA 4RPIA 3GLFA 3O95A 1JQ3A 1MJFA 1V26A 2X9QA 1HKHA 1QHHA 2JATA 4C6TB 1LU9A 2ZBEA 1KI1A 2H9AA 3PHJA 3EQ8A 4Y67A 2QKYA 5FRDA 1KGDA 2VLBA 3VC2A 4K6MA 4PTYA 2XITA 3UAOA 3V4ZA 3ZK8A 4GS5A 5K0EA 5CVUA 1VYUA 3NV7A 2GCOB 1L5RA 2NSLA 2ODAA 1TAUA 3HGTA 1RXEA 3KUUA 4KE7A 5FBRB 3O83A 1ZH6A 3GJ6A 3P94A 3UAGA 2Y71A 3FPLA 2PS0A 4A4DA 4C7MA 3SLGA 1RYFA 4EI9A 2DFNA 2QUKA 2VF4X 3QWFA 3Q88A 1F2UB 1D6SA 5DP2A 1VJRA 3ILXA 5DCYA 4BYMA 1CB0A 2F90A 1NF9A 1ZD9A 4CIBA 4PC6A 1WUHS 4ZVMA 3RSSA 3U61B 4K5QA 3A1TA 3IOBA 4EX7A 3DZFA 3LP5A 5KYVA 4BNJA 4Q7QA 3AUXA 1NXTA 5B36A 1OX4A 3EN0A 4GC5A 3W6UA 1NM5C 1PJRA 1EE2A 4CMHA 4NAVA 3DAYA 2C5EA 4EW1A 2NPFA 1F5SA 2D2VA 3BT7A 3DLCA 1NR5A 1UPAA 2UUOA 3PT9A 3PDUA 3LUAA 1GGMA 1WU8A 1WCIB 1YCHA 3V7YA 3BFKA 5SY9A 2IBTA 1U5BB 3V55A 5LMCA 3LKBA 3BJRA 1WF6A 2Q5HA 1UP7A 5B2EA 4BY9E 2CXUA 2QA5A 5ALYA 1E6LA 4LIPD 3BGWA 2EKPA 3U7JA 2XOKD 1P2SA 1U2DA 3EUEA 1N8NA 4B6OA 3IUJA 4Z4GA 3FNGA 3S2FA 4WNAB 4MS3A 4U5XA 5UKDA 1J8DA 2Q8QA 3GOQA 4GWKA 2CJWB 3T5PA 1XLWA 2CE2X 1GZ5A 2DKFA 3NWOA 3K05A 2BFEB 5CPFA 3WIDA 1W2WB 2W42A 4N03A 4CTJA 2HWUA 2I4OA 2JPDA 4ZRNA 2BFCB 1GKUB 2ZYUX 2OXEA 3J81k 2SCUB 4UHBA 1OU4A 3WFJA 4EF4A 2WQ7A 2CCGA 3DOJA 2C7RA 3IEMA 5T57A 4LVUA 3W7BA 1DOHA 2QMEA 4IIDA 2HPHA 2VF7A 4F46A 5JAPA 1T1SA 4JKYA 1S0UA 4QUBA 1EX1A 3VSCA 3WK9A 4QXQA 4BFZA 3GX1A 3RYCB 5LNK6 2OPBA 1UF9A 1Z2NX 3S4YA 3FAKA 3GCDA 2ZUDA 5LL6P 1DCTA 2HBYA 4QDTA 1IK6A 1CUBA 1SBYA 2ENWA 3EGXA 4QTXA 4BTEA 1YQWA 4I55F 2JFNA 4F12A 4GAEA 3ICPA 2CFRA 1PK8A 3NAGA 4MKRA 5JOQA 3BWDD 2GZDA 2BH9A 1GQRA 1YS7A 3JD0A 4FX2A 3ZCXA 2QZPA 3N70A 3QEMA 3DFKA 3F6EX 1O94D 3IUYA 1GNSA 2B4AA 2EOAA 3FLMA 4Q24A 1XNHA 5U4XA 4OK5A 3DKVA 1QHIA 3G17A 3SJ7A 3D0KA 3IUBA 2VJPA 4Q4HB 5TDHA 5F2EA 3UATA 2EHDA 4Q1AA 5C7YA 2P2NA 2CW5A 1FS4A 1N2CB 2GKGA 4QTZA 2W2NA 1G21E 2CCKA 3AB8A 4MWZA 1YR1A 1VKNA 2QD3A 3O84A 1CXZA 2I78A 3LUJA 4D9EA 1Q5PA 4Z9XA 4GSLA 3H8VA 1WSDA 4RD3A 1MO2A 1L7XA 3MYYA 3OCWA 1YBFA 4GEGA 1FVHA 4XIJA 5BSRA 3BUSA 3CISA 3B6IA 4G36A 1B8UA 3KZXA 3LWBA 1Z2OX 3ZHXA 1W4BA 3GP3A 4BMNA 4DQVA 2HRCA 4OQQA 2ZJ4A 2J32A 3CX6A 4P3OA 1GLNA 2FZEA 2CLMB 3OPYB 1FDRA 2XB6A 2XUFA 3B5EA 4LISA 4P4LA 3ZHVA 4D8YA 4EYGA 2RD2A 4PQRA 5HW0A 2XCUA 1WE2A 3V7UA 1N5RA 1J99A 5IJXA 5C53B 2DH5A 2DPGA 5IXYA 1MO3A 5CIWA 4IP0A 1Q0ZA 2X4DA 2XSZA 2XVAA 3EBOA 3UJ3X 1Q44A 1ENZA 3SFZA 1W1WA 4IHAA 1ZRMA 1JJBA 1QFSA 1L5HB 3ICVA 2LIVA 2D1TA 4BNWA 4OP3A 3QVSA 3V1LA 1H0HA 5J47A 2FRXA 1HRDA 1FU7A 2P9FA 2UVDA 1UXIA 1WXDA 2B1IA 3MRXA 4EMSA 1BRMA 3MC1A 1DBSA 3C6KA 2NO0A 2LBPA 1QG0A 3C43A 2QN2A 3A3KA 3TFQA 1E4OA 5DWVA 4JJ8A 4DR7B 4XM1A 1JJ7A 4WAUA 1IXSB 1CULC 3EZ6A 2XMPA 5TR9A 3AVWA 1E4EB 2Q28A 2YIMA 3BF7A 3N28A 3HJGA 4OHCA 5EHGA 3SD7A 3UW3A 4TYNA 4FYMA 3E2MA 3H97A 1YZGA 3O8DA 1FRVA 1TZJA 1A2BA 2G7MC 2Q3HA 2OA0A 3K3PA 3KE8A 5IJ0B 1VMEA 3E03A 3EF1A 4OHYA 2NVWA 3SS9X 1SUCA 1VRWA 3IHLA 4UHHA 1VE5A 3DEKA 1P4RA 3G8DA 1F1BA 5FNZA 3K16A 5LVAA 3STYA 4K9RA 1C3LA 1SVNA 4QGFA 4TMWA 1CRQA 1IXKA 1LBHA 1XYVA 3I0NA 4BS9A 4DUZB 3HJFA 2VUUA 1W88A 2IFTA 5H80A 4C03A 4N5LA 1FK8A 3GXBA 3O0DA 1PWEA 1IVNA 2QTTA 4ND8B 1MZVA 2P2SA 3TO5A 1D6MA 2YWFA 1VHJA 1SO8A 4U6SA 5ENDA 3UBMA 4BASA 4BEJA 4DSOA 1JAHA 4YMHA 3A37A 5CFPA 3GJ4A 3HZRA 3GP8A 2ERYA 1TQ4A 3LWZA 2QRKA 1HE1C 3OZEA 3FSGD 4Z4HA 3MIZA 4MDFA 2NQ8A 1CY1A 3HB4X 2DB3A 2YC4C 2ZT6A 3DDOA 3E7XA 5B1DA 3VVMA 4B32A 5FLKA 2PMEA 2VAVA 4PQYA 3TG2A 4P93A 2J08A 2DWPA 4QYSA 4ZANA 3PX7A 3VR4D 1JLSA 3AVYA 4TTRA 4TYMA 1Q6YA 2XYVA 3ILHA 3NJ8A 4PLPA 3CZ4A 2O2IA 3W34A 4PPFA 4AJ9A 4PNHA 5BUZA 5IUJC 4IRMA 2CFOA 3OTGA 4U00A 1OAOC 2C31A 4DJTA 1NXPA 4FJ1A 3GJXC 3JR7A 5G02A 1F5NA 4IV0A 3SSOA 2JFWA 4FM9A 1V1MA 3IPYA 3N76A 1AG9A 5CDSA 2XTMA 1VM6A 3OLVA 2F8LA 4C0SA 2XEXA 2GVZC 2QRLA 4M99A 5JZMA 4ENWA 2DR3A 5SZJA 4C87A 1APBA 3QMVA 4KVAA 3WB0A 3FNHA 2ZZMA 1GRCA 4KO3S 1UOOA 4D6YA 3KZNA 3ZC3A 2XMQA 1QHEA 1PK9A 3P9QA 4PXAA 3EZ7A 4QEZA 2A35A 4XUCA 3ZGXA 2G36A 4EYEA 3MILA 4MLZA 5EJ5A 4WCFB 4RFSB 4PLZA 1Z33A 4Q03A 3ZHTA 1KU0A 4JV5B 3OWHA 4YAFA 3T9CA 3V1TC 1WA5A 3PJGA 3CE6A 4JI2B 1KS9A 4ZQHA 2PT9A 4TVKA 1R6DA 3TWOA 3VBCA 2OCIA 1XZCA 3FHLA 4R8RA 2PL5A 3A9TA 5C0OE 3O93A 1JL3A 4JWTA 1DIBA 2PD3A 2ODEA 4WESA 4C4ZA 4ZRMA 1N8SA 4TRNA 2E4ZA 1JEYB 4C06A 4A26A 3A6JA 1JJAA 2B5WA 1KBOA 4QQRA 1H8HA 2H2GA 2YWHA 5LDGA 3T5BA 4B46A 1E4VA 4OGKA 3K1TA 5AHKA 3BYZA 4WLVA 1TC2A 5HNKA 1LLCA 1KRHA 4L5BA 2J4FA 4MV3A 1FFSA 1B93A 3ZGLA 3TYXA 1NG9A 1MQAA 1NW3A 1QGUB 3F46A 3WB2A 4R71A 2C83A 3EUAA 5IZCC 4PQEA 4CLDA 3DOOA 3MCAA 4PO8A 3K15A 1Y7HA 4PYLA 5EQTA 4DR1B 4IIUA 1WABA 3L7DA 1J90A 3M83A 1VA4A 1ODKA 1L5LA 1DS6A 3L41A 3M6VA 2BHLA 3T7EA 3PRYA 1YDGA 3E4DA 4IHKA 5FBWB 3GT4A 5A7FA 5JSFA 3RS2A 4QU8A 1YMVA 4RM2A 4DRXB 2EZTA 2X2EA 2IWRA 1DQRA 4JENA 3EAQA 3FFTA 3P52A 4JUCA 1U0HC 3K09C 3LG2A 1BGWA 5FHQA 2NO1A 1IU9A 1XU9A 5TGDA 2ODQA 3H8JA 1YZTA 2ZAGA 4DJJA 4AU1A 1UKYA 4KWIA 3AVPA 3L8DA 4PV7A 3NALA 3FB1A 4C7OB 1QJ4A 3QU9A 2I4LA 1XTZA 1SKYB 1YZVA 4YP0A 3ZG6A 4ASUD 4D99A 4JBIA 1PYGA 2FH5B 2W48A 1VE6A 1ZRNA 2C4KA 5EYPA 2XKBA 2P0YA 1HEUA 4GGPA 4PICA 2NMVA 3ZWOA 3DCIA 4R1MA 5LPNA 4F2HA 2IOQA 1UMDB 3KT6A 3PZBA 3TOSA 3UPUA 3H8SA 1UFOA 5FR1A 5CX1A 1HT1E 2H4HA 2I7VA 1XFDA 4FVTA 3K6SA 1IN8A 1JFLA 1TQ6A 4R31A 4YAIA 2Y1FA 3GLHA 3OIVA 3M0EA 5LB2A 3U44B 2IY9A 1GA4A 3IAEA 3DC2A 1ZJ6A 5CNMA 3I1YA 5MN5A 4WN3A 3TJZA 3UT0A 2A1TS 4NE7A 2MMGA 5HIKA 3R3WA 3NTXA 1ITZA 4MLDA 2VPTA 4BMDA 4RVOA 3B13B 1JIIA 3ELYA 5J1TB 1NOIA 1QZ3A 1VDMA 3JQEA 1E7QA 1D2NA 4QJBA 3W8RA 2XYPA 1GPDG 4CEIB 1ST3A 3H5OA 3G6WA 4TYPA 1BDHA 2XYRA 2Q07A 3Q8XB 1P5JA 1GWNA 1QQ7A 1XU7A 2RDMA 1GTJ1 1ZBQA 4GOLD 2F1HA 2EWMA 5A5VA 5I9IA 3PNQA 3CTPA 4PR3A 1XXHA 7REQB 2QE7A 2R6ZA 3NOVA 1V4VA 1U3TA 3IKJA 4N3GA 1U28A 4PLHA 2H4FA 2C00A 1GR1A 1PFGA 1QWOA 1ECFA 4K9DA 4WLFA 1ORVA 4CCAA 4JT9A 5D3MB 2TECE 4LBWA 1F8YA 3C2QA 5HUJA 5AW6A 1YDFA 2OHIA 3BL5A 2BFBB 4RKRA 1IG3A 1AS0A 1XQ1A 1YDEA 1ZA1A 2YFYA 3EWAA 4TUYB 4AMYA 5LZ9A 1O0CA 4ZZ1A 2ZT7A 3NM4A 1KMHA 1PJZA 2AIRA 2E4YA 3PXDA 2O1WA 1EDOA 3H2IA 3LP6A 1VJDA 4CCYA 4EA9A 4EHLA 4I4IA 4CRWB 2HI0A 1JIQA 4G2NA 3S8YA 1IY1A 2JJQA 2CDCA 1A71A 2C4UA 3A58B 1OCEA 1JDTA 1UAAA 1L4HA 2HMUA 3M5DA 5JO9A 2FVYA 2LV8A 4TS9A 4N3BA 3MWYW 5G1OA 2CVPA 2HK8A 4OTZA 5D51S 2J07A 3RYTC 1KMNA 2VJBA 5JH7F 2I34A 3DZIA 1U3VA 1D4FA 1O4WA 1SCAA 1XCMA 2G25A 1RFLA 1N1GA 1U7ZA 2VP6A 4RC9A 4X7PA 5LA6F 4CM7A 4DSNA 5HTOA 2BYTA 4B82A 2QBYA 4FC6A 1U0GA 1EBBA 1QAOA 4KV9A 4DZZA 1LK0A 4YMGA 2JK0A 4LYAA 2B7BA 2EKZA 2D0DA 1AZLA 2AUMA 3CSUA 4NFYA 5DSTA 1NXVA 2MYTA 3DZCA 1T9GS 5AW3A 5BORA 3M6LA 5IJ0A 5HBGA 4PTLA 4UVIA 2G9UA 2FNAA 4IO1A 4X3CA 2Z1MA 2D59A 1X9IA 4Q02A 1OFUA 4FGZA 5E6SA 5KNBD 3VYRB 2W2QA 3CRW1 2XCIA 1E3SA 1TYDE 5CM9C 4KBFA 8LDHA 1UJNA 4CTOA 1P9OA 4F60A 3O1JC 4QC2A 4DKXA 3PD0A 2WJHA 4RJKA 1XJ5A 3ET5A 2HRDA 5TPZA 3CUSA 2Y9MB 3UXEA 2FZLA 2IU4A 3AM3A 4GOMD 1RDFA 1ZY2A 3EXFB 5AI9A 5AM4A 5ER9A 2AG0A 1SXJC 1GQSA 2VWPA 2M1XA 4DILA 1GSOA 1MAWA 2YXPX 1IL0A 4HQFA 3JVDA 4FDLA 4JJ6A 4ZCSA 4BNLA 2IXFA 5A5FA 3IAM1 4GKBA 4J29A 1J9EA 1NQUA 1DAOA 2ECOA 4MP8A 3ZWQA 1VL6A 3DM9B 3ZW7A 1UC5B 4BXOA 5GOZA 3ZE0B 5GJCA 5ALPA 3N2GA 1M34A 3SHWA 4EJSA 4IIGA 1X92A 2R0QC 4R1UA 3CN7A 1I7QB 2FW9A 3GHYA 1SUBA 1EVYA 1BVUA 1KMQA 2HD4A 1N2ZA 2PSDA 4M37A 3RUIA 4XDGA 5CA0A 4XLLA 4G5YA 4WOJA 3QIAA 1XD8A 1EVJA 2OXCA 3A7DA 2C9OA 2JFQA 4B81A 2FWRA 1KARA 3ST7A 5IHPA 1FJHA 4YP5A 1J6UA 2C3UA 3RSGA 3NYRA 3M5CA 1AGRA 1XG5A 3G68A 2ASVA 3T52A 1AUVA 1EG7A 4EUFA 3NHZA 4R6XA 4INJA 2IU3A 2HCJB 4F2WA 1TOAA 1KJQA 1DG3A 3FYUC 3OA0A 4DIMA 3PZRA 2IYTA 3QMWA 4CQMD 2B2XA 4MVJD 4R5MA 5TF0A 3SSMA 4B6JA 3VJRA 2HREA 2QTVB 3RYIA 1OH8A 1N5DA 3U4QA 4OQXA 1XDBA 4OXXA 4BKQA 2GN9A 2BFFA 4BO5A 5DI3B 2W9XA 4KQ6A 1Z7YA 1HOXA 2EYUA 3RUDA 3T4UA 5BR4A 4NR0A 2C5BA 1KDPA 5CH8A 1YIDA 4Y6PA 2W11A 3SXJA 3EGIA 5CB6A 1XLUA 7MHTA 4H3VA 1ZCBA 1P4SA 1C0PA 4B6FA 3RVRA 2CXHA 4YCSA 2NU9A 1E2NA 1GYQA 1XRPA 1E3JA 1CUEA 4EY6A 4JWKA 3AOEC 2ZREA 1CYEA 1XXLA 3OIDA 3PFBA 4P9NA 4RK6A 2WWHA 3ON5A 4MIKA 1LJUA 3JVIA 5KHAA 4DWJA 3D2AA 3RVSA 3VC3A 3MLAA 1HYHA 2DBVO 4WGFA 3OCVA 5JBIA 2QE7D 1PI3A 1G64A 1GADO 1N1DA 5JS2A 5KNBH 2BD0A 6NULA 1NVTA 4WL0A 4Z0HO 5BMVF 5DHRA 1HNNA 3E5HA 1VG9B 1FDTA 1YMQA 1A27A 2B8WA 2WVGA 3HJNA 4BO6A 1OLUB 1S2MA 1REQA 5BN3B 1CRPA 4UUOA 4X62B 4BDTA 5I9SA 4B47A 5LUAA 4MUXA 2G67A 2WYWA 3CMMA 2ECFA 3WLSA 1W9MA 5LYJF 4ALKA 3DQQA 1DC6A 2WD7A 1TIBA 1PIWA 3CH7A 1ADGA 1UT6A 3TAHA 4EUKA 2L2QA 2PMBA 4FFDA 2O1XA 4G5OA 1QHSA 1IRXA 1YCDA 1GR0A 3RF6A 1KO5A 5J40A 1DC5A 4QTUB 5EZ6B 2J3MA 2YHIA 3A1UA 2AE2A 1VPEA 2XWPA 1OA0A 3R7WB 1BMFA 4CDGA 3ZZ0A 2YRWA 4BPRA 4EPRA 1HH4A 1LBSA 2PX8A 2D4HA 1JWLA 1PVVA 2GF9A 3EX7C 2V9CA 2QAGA 1E66A 1H2YA 2X0NA 4KQ9A 3C98A 3G5MA 3C3KA 4MARA 2GF0A 2O20A 5HUHA 1LC0A 2GPJA 4WY8A 5DLYA 1UH5A 2X4IA 5FPTA 3VR2A 2IZ1A 4FFVA 3JQCA 3V9PA 2VHTA 5LQAA 4U2FA 3EOZA 2YMPA 2GZ1A 2WJAA 4LF5B 1F8XA 1LDEA 4Q0MA 3P9ZA 4J0QA 1NV9A 3CLSC 1OV6A 4LXQA 4WGGA 1SHTX 2GZ3A 3FNRA 4HR7A 4IEIA 4W1SA 4G0XA 2JIOA 1JR6A 2HT6A 1NW4A 2RB5A 3H2KA 3ISVA 4MWSA 3BBLA 4HPWA 4WH0A 2WKSA 4ARZB 4INZA 3I34X 1VL2A 1E1MA 3S2YA 4ALNA 1JSRA 4ZI7B 3VJLA 3D4PA 2BFPA 5JZ9A 1W8DA 4CT0A 3ZGYA 3ZCTA 5AQEA 3VOTA 1C9KA 1DAFA 3HXPA 1X8KA 2YZMA 3KZKA 3ODPA 3AU9A 4I50A 3SE0A 4AY2A 2C3MA 1I0LA 3PUYA 4RTQA 1O0SA 3K6SB 2NQTA 2IOFA 3TW4A 3X1JA 4TTIA 5DYWA 3VTAA 4KIGA 1YK0A 3PNPA 4Q4HA 2IPAB 3R40A 1WUKS 2ISCA 4H3HB 1HT3A 2CNLA 3QBEA 4WN9B 1VGVA 2NZYA 5CU7A 2HU7A 4JJKA 3FPFA 3QLVA 4QDJA 1Z6TA 2PH5A 3CRVA 3QBVA 1SXJE 4FFSA 3RO7A 3ZY6A 1FCJA 1UWCA 1UPCA 1VJ5A 3B3AA 4BVFA 4CKZA 3URMA 5K4AA 5JJCA 3DDZX 3FZEA 3MUNA 1WQ3A 3N3BC 4WPGA 4R2KA 3VRHA 5AVVA 1G20B 1E63A 1L9XA 3KSMA 1GYPA 3HVJA 3KZOA 1AU9A 2AG5A 4JQZA 4OM8A 3U81A 5JYDA 5CFOA 3L1JA 3ID6C 3CVXA 1XZGA 1Y9DA 3HRIA 2BEWB 4KQMA 1U6IA 2XW6A 3Q5DA 4LHSA 2JGIA 4O2BF 3SVLA 1DBWA 4WZAA 2XMRA 4EKGA 3B51X 1FYXA 3SLKA 5IK2D 2GRUA 2D00A 2VL7A 2FEWB 4FKMA 1NJSA 3NNDA 2JB9A 1JDBC 4J0GA 4BNXA 4LHZA 1U2PA 3LGXA 4W7IA 3OQIA 1J2UA 3FCYA 4MTCA 2JZOA 2O2JA 1XPRA 1XPUA 4LJ6A 4OL0A 5FD8A 2ZJAA 1P7YA 5LMNB 5JD4A 3UUGA 3EZNA 4V0KA 1JLMA 3E5RA 3W3AA 2B0CA 4ZVUA 2JZCA 4WKGA 2DF8A 3V34A 1OZ0A 3CZ9A 3VA7A 3GH1A 3IVXA 4QUAA 4JEUA 4FYHA 4LRWA 3NTVA 1PZHA 5FADA 1UDCA 2BFCA 4L8WB 3E9RA 4L08A 3FYHA 4NF2A 3KSBC 4ND3A 4NOKA 4C3OB 3QKRB 1KRWA 4DF3A 4XRRA 2FR8C 2PNFA 3JQFC 2FKNA 2PUHA 3HGMA 4BN4A 4ZMRA 4A8JA 1SCBA 3DWIA 1NVGA 2ZG6A 4YX9A 4M0UA 2A1IA 4ZJPA 4NFHA 1J0AA 4PW0A 2KBEA 3FI0A 1QYIA 1G3IA 4XXHA 4XWKA 4FGKA 2HF2A 1DFIA 1O1YA 2FEPA 1Z2EA 2HFKA 2P75A 3N39C 3I2YX 1HDIA 4NZYA 1KJNA 1LBEA 4JYBA 1JQBA 3CF0A 1Y6FA 3DS8A 2GNPA 2WHYA 3GUYA 4NESA 4HNRA 3ZOZA 3T4PA 3FOAA 4N47A 1JMYA 1JBKA 3FSGA 4GBJA 4M88A 3T34A 1E3MA 4PS1A 1G6OA 3Q4GA 4QUJA 5TGTA 1HZZC 5L3SA 2R9VA 1F6BA 2REQA 2WUGA 3AZOA 2AZMA 2P41A 2QD5A 3KXPA 1O57A 1Z8FA 1E2GA 1M33A 2ZYRA 3HFJA 4LG1A 1AKEA 2J9GA 3NRBA 5IBRA 1XA4A 2HWKA 4NV1A 3ROGA 2HA0A 3PFIA 2QIPA 4GT1A 4FB4A 4C0QC 1A04A 1CNEA 3LXUX 2ZLBA 3SM9A 1EFCA 1NT4A 1W0JA 2GVDC 1ISGA 1T29A 1NLFA 4BLOA 3B89A 3HPRA 1E7YA 1RAGA 2HLPA 2BLNA 4DWWA 5JAQA 1SQ5A 3PIRA 4F6LA 4Y1RA 2AR7A 3WQBA 5BYBA 1VKZA 3E1SA 2WZCA 4FNOA 2A5GA 5FKJA 3GU3A 2VBCA 1CTQA 1V11B 3N7TA 4J9VA 4BV3A 1X70A 1MJGA 2B82A 4D02A 3UWOA 4Y2VA 3L04A 1SCKA 3N2IA 4D8TA 4NBKA 4P84A 2ONJA 1DO8A 2Z8XA 3AR3A 2N1MA 2WICA 3DHYA 3FPCA 3L0PA 1QFMA 1FXWA 3U7EB 3KLNA 5HZHA 1TRKA 4M6WB 3GJTA 2VLIA 1UQUA 3D7RA 4XUGB 4D9BA 2HA7A 3LKZA 4LXTA 1S89A 4MUNA 4WZ6A 5E4TA 3QRWA 3WLJA 4A0FA 2BZGA 5ICSA 3FOCA 3G8AA 1N0IA 2QVCA 1A5SB 4O1HA 2P4SA 1CZOA 1L5SA 2I3GA 2XUKA 4KR7A 4DYVA 3NWBA 2CLIB 4LZPA 4WK0B 3PTLA 1EGAA 3PUWA 4HQOA 1N2GA 2WAYA 3H5VA 4DMGA 3LUBA 1YZLA 4DLVA 4EG6A 8GPBA 3LNCA 4Q1CA 4ZV9A 6GPBA 3WLMA 3QVGB 1RLUA 4Y8VA 5DT9A 2D3TA 1ISMA 3TTXA 4E12A 2OUIA 3ESAA 5FV7A 3I9JA 4EGJA 1JILA 1R18A 2UVPA 1H2HA 4UU8A 1C9YA 2CC2A 4G97A 2RAPA 4WW0A 1G5RA 5E2AA 4ZU1X 3P0EA 2DT8A 2XDWA 1EQAA 4I4TF 4UXHA 5G0SA 3LL4A 4V2IA 4W5NA 4FFBB 2WA1A 2NVUB 4JGIA 2LGJA 2G5TA 2HQOA 5DB4A 1Q0QA 1E2FA 2NTYC 1R3UA 1SBIA 4HEA6 1NF8A 4KI7A 4BZZA 1AZSC 4IQ8A 2O2ZA 2QM8A 3PHIA 1V4NA 5CDFA 2HSWA 4BQPA 1YR2A 1P72A 2PWBA 2F6RA 2Z3ZA 3MTGA 2P65A 1RI3A 1NONA 4RACA 1OX6A 4IS3A 5FPYA 1KIFA 5K9ZA 4J94A 2AHOA 2B2NA 4ZOBA 3UT5A 1YUNA 3GFFA 2VNIA 4G09A 3UC5A 3A2MA 4UHCA 3HV0A 1KBQA 3G0GA 4UDNA 3MFQA 3DLIA 4HZIA 2WD7B 3NASA 4I9NA 5K3BA 2XNDA 2JH8A 1RE1A 4BMOB 1NKSA 4YECA 4KR2A 1SC1A 1SHKA 2QV7A 3FKSA 5K8TA 2P5TB 1I2AA 1OYYA 4FSDA 3FMIA 5IULC 3CGWA 1EFDN 1T2DA 2D2XA 3V8PA 3PDHA 5HKLA 2HM7A 2OLJA 3UUFA 1Q21A 4RW0A 2A30A 4PO3X 2DLDA 4U02A 3RASA 4JXJA 1XEXA 2QJRA 1UP6A 2VHQA 4O5AA 2E0IA 3LIIA 4I6GA 2OZLA 3L8GA 5JYEA 3ENVA 1NBAA 4C01A 1FU8A 1KFKB 2P8JA 1GQ2A 4JR1A 4NX2A 4WV3A 5B7PA 4Q15A 1D1QA 4KPYA 4A2WA 1EM8A 2ADFA 3IOYA 4ECAA 4TXMA 1LRKA 1ULAA 1P2BA 1YWGO 3NIFB 1T6BY 2XZLA 2X41A 3HSSA 1T2UA 4LSWA 4KN9S 1X8XA 2IY8A 3LY7A 4MS1B 3N9IA 5BYJA 4G8CA 4B73A 5DASA 3PHBE 5JXJA 2RH8A 3FTEA 2JFVA 1Z82A 3COPA 3P2KA 3KJHA 4NC9A 2ILTA 4RL6A 1C0IA 3EDOA 3GZTB 3ONVA 3OZTA 4IJ6A 1NJFA 1PZMA 3TPZA 1OFTA 3FWHA 2BSXA 3REOA 4KBGA 4B6EA 4E2XA 5EJ9A 1D4AA 3U4QB 4BEBA 4AM8A 3O91A 3HFSA 3CM0A 4ID3A 1ZIXA 2AW3A 2JJYA 2I03A 1T25A 5BVHB 5EWLA 1W5FA 5CHEA 4Y2PA 1E99A 2XCLA 2ZBVA 2AMLA 4YH1A 5H0IA 3RVBA 3WIEA 1QE3A 1V1MB 1QJCA 3O4VA 3S68A 1P0CA 5G53C 1SXHA 4WZAB 2P2ZA 1DELA 3A11A 4TV8A 5F2OA 3UK0A 4CM9D 1DLIA 1C4XA 3B9QA 3D1VA 2W71A 3JQ8A 4RD6A 4BZPA 2J0SA 2I8AA 1L8XA 1J2JA 1Z7EA 2RH4A 2VSQA 3AFOA 4N4AA 3MWEA 4O2LA 3Q0EA 4UDOA 4BEWA 2DPLA 2SKCA 3GZNB 2I4NA 3RJZA 3COYA 4BQQA 1XALA 1M2JA 5BNZA 2JCGA 4S0ZA 4TXLA 3R0ZA 3CLVA 2IL1A 1E0JA 4G37A 5JHGB 3ETHA 4YAGA 3SJAA 3KOYA 5JI2E 1J24A 3BJMA 5CPBA 1R0WA 1OTHA 1G7RA 4MVJE 2GLUA 1UQRA 2CL6X 1CDZA 2G9ZA 2HTFA 2YV4A 2ZUWA 3IOMA 4O3MA 3UJHA 5FQNA 4I6EA 1VIYA 1ZD8A 1DAIA 2A94A 2ODTX 2PPLA 4JC4A 1GHTA 4RBNA 3ZH2A 1UJ5A 5AVZA 4Z0TA 3EQ7A 3RTDA 1NJ6A 3VKVA 3N2KB 1U1FA 3N8HA 1KL7A 5K45A 2PH7A 4I5EA 4EHIA 1RBQA 2XH8A 3DT8A 3IKLA 3MQ4A 4KXNA 4Q05A 4D44A 4YCMA 4ZYYA 2G9NA 2P1DA 3IT3A 3HBAA 3PK0A 3QXCA 4WFKA 5E7MA 5KREA 3OFNA 3PE4A 1SA0B 5KQRA 2NTEA 4YR9A 2Q6VA 1C7JA 1QDLB 3Q7EA 1G6HA 1U4SA 2Q4BA 4MUGA 2AT1A 3UJ8A 4PX3A 3WY9A 5E1MA 1E1KA 3FD8A 4OKSA 4W63A 5BSWA 1D6JA 3OUZA 4X97A 4XYLA 1MORA 3F7TA 3OKAA 4E03A 1YACA 3G2KA 5DYTA 4YRNA 5A4IS 3BTSA 3NC4A 2A0YA 2XF8A 3EEBA 4NBVA 1J56A 1JR2A 1L5ZA 1M8PA 2BEVA 4QAQA 2YY7A 3W06A 1E62A 1J8FA 1E9CA 4L75A 5KTSA 5IAJA 4BVJA 3ZYZA 4LJAA 4YMSA 1X1BA 2XMDA 1R9GA 5JS6A 1Z6AA 2MINA 3SQOA 4WBSA 3A4NA 1DOAA 3AF4A 2NV2B 1HQYE 3R6WA 2Q7DA 4EZIA 5IEJA 2JGNA 2RI1A 1CE8B 2WK1A 3A1DA 3VR5A 4ML3A 4YAOA 2ZUBA 3DBHB 4RLFA 3L6EA 1KJJA 3QVXA 2VDLB 3H84A 4BV2A 1QHNA 2B1JA 3HYTA 1N77A 3L6CA 4M83A 2FW7A 3ANXA 2FE1A 1Z5PA 3RG2A 4RNCA 2JLWA 1C4KA 4KXVA 3OZSA 3TTYA 3ZWVA 1J2YA 2PX6A 3EBPA 3PUVA 4Q4LA 1IG0A 1VPLA 1RP7A 1ZH8A 4M8KA 5AKXA 3W78A 5AXAA 5KC9A 2XT6A 3RWMB 2V7TA 4CKBB 4L3WA 1B26A 3UQYS 1YVPA 2X5NA 4WSOA 1UKCA 1UMDA 2QN6A 3FOBA 2O5EA 1F6WA 2JLCA 4O8CA 5FUXA 5A4FS 3OIUA 3GUZA 5BV8A 1PZXA 4Y6GB 5F12A 5HQ3A 3N59A 1H6AA 4Q3KA 1DC3A 3V8VA 4EPWA 2H54A 3IEVA 4DQUA 2OYCA 3SKVA 1T8RA 4RQAA 4WLNA 1OHHD 5B2ZA 4C3UA 2ZXEA 2R7KA 3T5DA 2JD1A 5M7EA 4NZ9A 2JAUA 1J4AA 1XDDA 1CCWA 1H2ZA 1UBTS 2EBFX 2VJLA 1G3RA 2FSHA 3S2EA 7ABPA 2GK6A 2EJBA 4G9GA 5DVZA 3W5BA 4DDKA 1HE2A 5KOHB 2H29A 2AVDA 1STOA 2C2HA 2FQWA 5CDFE 2R6CA 4D4MA 1NVVQ 3UK7A 3EZFA 3GAAA 2QJOA 3P7MA 5ED0A 4TMXA 1DX9A 3HY6A 3ZY5A 5P8WA 1Y5NA 4RANA 3RK1A 5KTYA 1XZEA 3ELWA 4TTAA 1QCZA 1PJSA 2PZGA 3D6FA 4R7ZA 4LOJA 2ZWVA 1XPJA 1XJQA 1YV9A 4V0MA 2BGMA 2Y3IA 3QW2A 5IBCA 5JSQA 2QRJA 4X84A 3OQ6A 1F17A 1Q6ZA 1WZUA 3BMCB 4LRTB 3OCJA 1ZU5A 5LSAA