2JASA

Structure of deoxyadenosine kinase from m.mycoides with bound datp
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
200
structure length
194
Chain Sequence
MKIAIFGTVGAGKSTISAEISKKLGYEIFKEPVEENPYFEQYYKDLKKTVFKMQIYMLTARSKQLKQAKNLENIIFDRTLLEDPIFMKVNYDLNNVDQTDYNTYIDFYNNVVLENKLSFDIVIYLRVSTKTAISRIKKRGRSEELLIGEEYWETLNKNYEEFYKQNVYDFPFFVVDAELDVKTQIELIMNKLNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DEOXYGUANOSINE KINASE
publication title Structure-Function Analysis of a Bacterial Deoxyadenosine Kinase Reveals the Basis for Substrate Specificity.
pubmed doi rcsb
source organism Mycoplasma mycoides subsp. mycoides sc
molecule tags Transferase
total genus 66
structure length 194
sequence length 200
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.1.113: Deoxyguanosine kinase.
pdb deposition date 2006-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01712 dNK Deoxynucleoside kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2jasA00
3QBVA 1NI3A 3LW7A 2ZETA 4W7SA 4FMDF 5FH9A 1E1QD 2ZRBA 1HQCA 1O3YA 5JI2E 1Z28A 3CLVA 1ZP6A 2OESA 4X8OA 5CYOA 5E4FA 1Z0AA 3HDTA 5CITA 1KAGA 2HCJB 1PLLA 4B32A 1E4YA 1KGDA 1R8QA 3D8BA 2CE7A 3T1VA 3AVUA 4A8JC 4H1VA 3FMFA 5J4LA 3QKSA 5TVKA 3ZVMA 5CIQA 1RFLA 2IXEA 5LD2B 3TW8B 2EFGA 3QKSB 4AKHA 4JMPA 4EPTA 2CHQA 1NY5A 5M04A 4M9QA 5EP4A 2YHSA 1VYVA 2JIZD 1U94A 1FX0A 1GNPA 1QHHA 2VA8A 4PC6A 2FF7A 4Q00A 1VCOA 1G6OA 1Z83A 2XOKA 4NYIQ 2ZI4A 4LJ9A 2VLIA 1Z0IA 5H8WA 1KZGB 1FX0B 1Q22A 2BHRA 4EPWA 3IIJA 2BDTA 2EFCB 4R7ZA 1COWD 4PHHA 1F6BA 3U5ZB 3CRW1 1YZNA 4QBFA 4BZXA 1NVXQ 3KTAA 5IF9A 3I1FA 2P5TB 1GRRA 2AN9A 1XPUA 4DVGA 1XTJA 2HLDA 2ZTSA 4PQRA 1CRQA 3W3ZB 2P65A 3V00A 1SVSA 1DO2A 4HB2A 1Q20A 1XEWX 4LJ5A 1CEEA 2YVUA 4HAWA 4JBWA 3FDIA 1YKSA 2GILA 2ZJ8A 3AKYA 1S4QA 5EE5B 4QGFA 4NMMA 1UKEA 4B44A 5JWOA 4A15A 2OM2A 4NBSA 1GKUB 4JLAA 2BIFA 4OI1A 4DCNA 3FOZA 2J0SA 2XEXA 4LRWA 3T5DA 3CNNA 1GFIA 5TXGA 4D0NA 2IT1A 3I8SA 3GJ0A 2ZSBA 2WJVA 1AQYA 2DCUA 3RWOA 4AIIA 4NYIR 1G5TA 4C7OA 1G3IA 1ZAKA 2DFLA 2NO1A 2ODEA 3SYLA 3VR2A 2MSCB 5E7JA 1RRGA 2RGBA 3F3YA 3K53A 3KKNA 4TLCA 4OHYA 4YLGA 2A9KA 2ANBA 4DSNA 4PZLA 3SHFA 4ACBA 1Z3IX 4M2LA 5J4VA 3KX2A 4DEYA 3G0HA 5E3HA 2CCGA 3VKGA 1T5IA 1DE0A 3H84A 3SHWA 3ZYCA 2ZE5A 1CU1A 1N2CE 1QHYA 2R62A 3PJRA 1TF2A 5KPDA 3ZIAA 5HR5A 2J87A 1II9A 4OJQA 4AURA 1LS6A 1NIPA 1XJQA 3CPJB 4B75A 4D82A 5CM8B 4R2HA 3ZLJA 3ECCA 1XP8A 4P4SA 2AX4A 4PANA 4AKIA 1G21E 1KI6A 4M1WA 3UG6A 1CS4C 4P4SB 5FFMA 4IHQA 2EVWX 5KUTA 3DM5A 4KVGA 2CLCX 4DSUA 4MGYR 2ORVA 5FUYA 2VIIA 4WAUA 5L3SB 1E9DA 4TYPA 1NL3A 4DB4A 3PCRB 5EE3A 1J8MF 2FU5C 5GJVC 2ZSFA 2WJHA 3Q5DA 4NE2A 3IGFA 2YJTD 4JL8A 3U3JA 4ZKDA 3U4QA 2O8DA 3K0SA 2RGXA 1HEIA 1UKVY 2XAUA 4CT5A 2AR7A 4GFDA 1VYTA 4LV6A 3VHXA 2VSFA 3HYRA 2YNMA 1CR2A 3P20A 1FMLA 1XJ0A 1ZC4A 4W5WA 3C16C 2VP6A 1XMVA 4L4UA 3TAHA 2C98A 1O87A 1IAQA 3L0SA 3AH8A 3W3AA 1YR8A 4LJYA 4WVFA 4ARZA 4UXIA 3CRVA 3M4YA 2Q9CA 3FKSD 1A82A 3B78A 5FPYA 4M4SA 1YZLA 1I2DA 3B1XA 3DMNA 4Z51A 2IXFA 2QP3A 3GEHA 4L9SA 3THOA 2EWVA 3MLEA 3JZMA 2CJWA 1Q1BA 3RNLA 4DBLC 5FUVA 1WRBA 2CDNA 5EP1A 4IVRA 1T5LA 5KDOA 4HZUB 1XX6A 2VHUA 1LF0A 3FGNA 5KNCA 3OEEA 3GMTA 2N46A 4I1OA 1IN5A 1X8KA 1JR6A 1E9SA 4URZR 4G5QA 4XVQA 3P4XA 4NH0A 1NSFA 5BQ5A 5GJBA 3R9IA 1SXJA 3QIAA 3L82B 5HPYB 1N3BA 2W2VA 4OK6A 4A82A 2ZAMA 1EWQA 3AKEA 4LX0A 1N0VC 3QNUA 3B6EA 4IXMA 2AK2A 3VNVA 2A30A 5LDDC 3GD7A 3I5XA 1OKKD 5GVRA 1OH8A 1TU4A 3C15C 3AV0B 1BMFA 3K9GA 4AYXA 1GILA 3BAFA 3OZXA 3FWYA 2HCBA 4M21A 3HR7A 2WHXA 3QQ5A 5JJLA 4M0LA 2F6RA 1IY2A 4LWZA 1ZVQA 1JXOA 1A5TA 4GMXA 3W5IA 5BN3A 1X1RA 2IYRA 3QEJA 3O8RA 4L5BA 1N25A 1ZNWA 1E9AA 3TR5A 2ZR7A 4DLWA 1KO5A 1E9BA 1KK3A 1AQUA 1G3RA 3MMPA 2P2LA 4B3BA 4Q5IA 1OXUA 4BECA 1QVRA 1W47A 5LD2C 3L8ZA 1XTSA 4NCHA 2AK3A 2HEIA 3P26A 1EFRD 3CIOA 2ANCA 4JLOA 3EXAA 4D81A 2JATA 1C1YA 4K8OA 1R7RA 3DKPA 1G7CA 2VQSA 3U2QA 2OCAA 4LUCA 3NHBA 3ZH9B 1IHUA 1JXMA 2PBRA 1LS1A 3QF7A 4MKGA 1KY2A 2KBEA 2NQ2C 3U7FB 1XNJA 3ADKA 1RC8A 1Q3HA 4IXNA 2N42A 4BASA 1SXJD 2KJQA 4JLPA 2YC2C 2WWHA 4PPGA 4Q02A 2QM8A 1SVKA 4LBZA 5CIWA 1VIYA 2F3RA 1ZD9A 4Q19A 5IRCD 1VPLA 5EQTA 2FPMA 4GDFA 1M1YE 3V4FA 3EW9A 4ITRC 5FTNA 3WMFA 3IKJA 4ASUD 2EYQA 1NKTA 4ILEA 1QZXA 2BOVA 5D3MA 2D2EA 4TYQA 3TGPA 2ZUBA 5K8IA 5JFGA 3U44A 5KTYA 1KZ7B 1E2QA 1SGWA 1JR3E 2QSZA 1LF5A 3LX8A 1KMHA 1OW3B 1W48A 3BC1A 4KBGA 2GK6A 4ZCMA 4ZDKA 4N1AA 3K9LA 1NVUQ 1KMHB 4O0MA 1JEEA 3GLIA 3ZS9A 2PJRA 1IN8A 3RVBA 5FTMA 4PAQA 4OBEA 3OFND 2REBA 5CJPA 4RZ3A 4Q4JB 2H7VA 3SEAA 2W6JD 3GLIB 3U3RA 5JMTA 4PC3A 2DFNA 1IN6A 2IBMA 2XXAB 4IEEA 1BYIA 2IA5A 3BXZA 3DOEA 3U60B 1ZJ6A 3FE2A 4RVCA 4B3FX 4B6EA 2FSFA 2NPIA 1Y63A 4EKDA 1DAKA 1XCMA 2OO7A 2PX3A 4ZO4A 4CW7A 2J0VA 3KUCA 2IHYA 3ZQ6A 3ZVRA 3W34A 2PH1A 4PO9A 4I1VA 1W2GA 1RRFA 1VG8A 2PL3A 4NTZA 1FP6A 1RRCA 4Q21A 3CKLA 121PA 2CK3D 2PEYA 3O8DA 4NPHA 3AVWA 2CLSA 3TVTA 2CNWA 1W5TA 1AS3A 4FCVA 4TL6A 3TR0A 5K8LA 3CRMA 4WZAE 1CKEA 3ZDQA 2WJJA 4MKFA 2FJUA 5DSZA 1D2MA 1FFHA 3EX7C 2Z0MA 3CO5A 2F55A 2QTVB 1P6XA 3MGCA 1Z2AA 1XMIA 4WBSA 5HKKD 4D6PA 4Z1MD 1T4GA 4OQXA 4P4TA 4QM6A 2DYKA 2IF2A 5EE0A 1Q1QA 3I62A 2A7QA 1XF9A 5DE3A 4FCWA 1TNDA 3H1TA 1R5OA 1TX4B 1KSGA 5LB4A 2J1LA 3ND9A 5CDFA 1AZTA 1DAHA 1H8ED 3EARA 4LV5B 1G16A 1CJUC 3X1XA 1P9WA 3VX3A 3C5HA 2RKOA 2EFDB 4QM7A 2XTZA 5EZ5A 2QPOA 2B8TA 2Q6TA 4JVNA 3RLFA 4Z8XA 4Q4HB 1YZUA 2CHVA 2QAJA 4G5SA 1TL7C 2ZSEA 1CJVC 4TTPA 2WIBA 4LJ8A 4POAA 3HWSA 3K8YA 1GL9B 4U02A 3SBEA 4QFMA 1Z63A 3DMDA 5EP3A 4TTRA 4QGHA 4BFXA 2OBMA 3S1AA 3FKQA 1VIAA 4OHXA 2QGNA 3BFKA 2GXUA 3BFVA 4MKIA 2I4IA 3W9YA 3EAQA 4X8MA 2QMOA 3A1UA 2DWPA 3PIRA 1OPXA 4JIMA 4C2TA 2H18A 1EX7A 4FXPA 1FW6A 4CDGA 1JNYA 3I8XA 1NG9A 2GJ9A 5EUQB 3TMKA 4DLYA 4JZKA 4EJSA 4R2IA 2QENA 3W6PA 3THXB 1ZD8A 2FG5A 3LY5A 2ZE8A 3SJCA 2CEAA 2IYSA 2GJKA 3Q85A 4A0HA 2F9MA 3E2IA 1D5CA 4DCUA 3IQWA 3R20A 1FUUA 3WP1B 2NZJA 3IDQA 3B9QA 3OIYA 3LAWA 3LVRE 4YDHB 2V6IA 1E79D 5FOUA 5KNBA 1SKYB 3K70D 2ZITA 3QEOA 4KV9A 1J2JA 1YZGA 1SVWA 4U5XA 2OG2A 4F7WA 2WSSD 3IO3A 4TSFD 1YZQA 3NWJA 2J7PD 2QAGB 3C14C 2JDID 4A8JA 4AG6A 3NH6A 1EFHA 4K46A 4WW0A 1E94E 1XMJA 1CF4A 3C7KA 4JSYA 4RD6A 1ZINA 1T91A 2CCJA 3A1WA 3WYAA 1G64A 4YMUA 4KLNA 2R6FA 5KDLA 1Q12A 4YXWD 3EPJA 4LPSA 2FH5B 3UWOA 4CGZA 2QTFA 1ZMXA 2Z4RA 2B6HA 1E32A 1DADA 1TPZA 3QF4B 1NLYA 2NPFA 4HATA 3ADCA 1BO6A 1DAFA 4EPYA 3B9PA 2HUPA 4RKFA 3JVVA 5EE1A 1Z0DA 3T15A 4G0NA 4XSHA 5JS7A 4YMTA 4HB3A 2XTMA 2ECKA 3Q72A 3ASYA 3T34A 5HCIA 5DHAA 4QRHA 2QI9C 4XTRA 2C95A 4RD4A 4UJ3A 3BBPA 2J0UB 3AVOA 1CLUA 2FZLA 2J7KA 5B57C 4IDNA 5IK2A 1HURA 1N6OA 3FTQA 1GOTA 4XOIA 4QJ3A 5JRZA 3ZVNA 2ZPTX 1L8QA 2BEKA 3P1JA 3PV0A 4DCVA 1OHHA 2CMKA 3D7MA 1ZUIA 1ETUA 1G8FA 1CBUA 2IUTA 1QHIA 2HT6A 3B1ZA 5TARA 5KO2A 2W83A 1Z47A 1NY6A 1NN3A 3C4JA 2IUUA 4A0GA 3A1TA 2V8OA 2YWFA 4M9XA 4M53A 4LBWA 1W49A 4X8HA 2ZRFA 3AF4A 5DI3B 1SHKA 4GSYA 2J0QA 4GZLA 1W4CA 2X2FA 3QJYA 3VR6A 4LYFA 4UXHA 1TF5A 2B92A 1HE8B 1P72A 4HEJA 2X77A 1IN4A 1G3MA 1NSTA 2OBNA 4V0OA 3RDPA 2BJWA 3MAAC 4RD1A 2VP5A 1G17A 2R9VA 3TAUA 2ZREA 2ZE6A 3N2EA 1ZIPA 2FWRA 1CULC 2QMEA 3GLHE 4PHGA 4DWJA 5JJIA 2QEQA 2WV9A 4C3ZA 2IYYA 3LW8A 1JALA 1A2BA 2O8BA 2ZRCA 2ZU0C 2BBTA 2NGRA 1UDWA 2QORA 1BOFA 2REXB 3GJXC 4GP7A 5HZKA 2QSYA 2O8EB 2LWIA 5DN6D 4HZIA 3AVPA 2E1RA 2O8BB 4A2WA 1YVDA 4FMCB 2D74A 2L0XA 1BKDR 3AP2A 4HUQA 4GL2A 4IOJA 3LH5A 4WA7A 1WBDA 3NEJA 1KSJA 3IQXA 3CF0A 3TK1A 2ERYA 2LKDA 4OK5A 1E9RA 3FYHA 3I32A 4HSEA 2BCJQ 3PXGA 4XSGA 3KQNA 521PA 3K70C 5BW8A 1E1QA 2ZE7A 2C99A 4AC9A 4XWOA 1OFTA 1VDZA 5JCZA 2IC5A 1XWIA 3R7WA 5BYKA 1GM5A 4PSAA 1D2EA 2XTNA 4IDPA 4MRRA 5FUWA 4C0AC 2QTHA 1KDRA 3KB2A 3KXLA 4PTLA 2X2EA 2JA1A 2OT3B 2D7DA 4DLTA 4HLDA 2ODNA 2EFHB 3NHAA 2UZ3A 4N3NA 4LJ6A 4M9ZA 2O8FA 1II8B 4AD8A 3FPAA 1PV4A 2JIZA 4TT3D 2ZS9A 4MGZR 1B23P 1D2NA 1DG3A 5B2ZA 5BWMA 2O8FB 3K0EA 3THWA 1GDDA 3CF6R 4PSVA 4EIWA 4WZBE 1JR3A 3CF2A 2NMVA 1COWA 1KDTA 3TSWA 3NC1C 1HYQA 4QL3A 1E0SA 5AK0A 4D26A 3Q8XB 4DUGD 2ZI5A 4ZDJA 2GVZC 3DEFA 1S96A 1HT1E 4LYAA 4TL8A 3CB4A 4YMVA 2RCNA 3K1JA 2CL7X 2VSOA 4HLUA 2GF9A 3ASZA 4MA4A 1KK1A 2O8CA 2ZI9A 3AUXA 1CR1A 2ORIA 1AKYA 3U7GA 3BB4A 2O8CB 1XU4A 1R6BX 4GNKA 1P9NA 2BCGY 2ZJYA 5FOVA 5FUXA 3B13B 1MABA 3EZ6A 2QMUA 2NO6A 3AKCA 4KFTA 3GLGB 1L2TA 4G1UC 4V0LA 4TYWA 3FB4A 3PFIA 3IUYA 4JLMA 3N2IA 3TQFA 3EIQA 4O25A 5E95A 5F2EA 3CUEF 4O2LA 3NKVA 3HU1A 5FPHA 1CTQA 3J81k 3KXKA 3EC2A 3X1YA 2YINC 1OV4A 1G7TA 3CZQA 4PHFA 1G4AE 4P31A 1NBME 1N5IA 2D06A 4OKSA 2WAYA 2ZQ5A 2XNSA 3BJIC 5JJKA 1YRAA 1T3LA 2XNDD 1KSHA 4MDFA 3TE6A 4Q1EA 2FEOA 5DYGA 4YQFA 4D0LB 1JI0A 2A2ZA 4TLBA 3TIFA 3GLFE 1S1CA 1YZKA 2C77A 1GTVA 1W36C 3BH7A 1JR3D 4JLDA 4R9UC 5IHPA 3I5YA 2FEMA 1QHHB 2ZRLA 3MUFA 3EZ2A 4DT1A 1XRJA 2A5GA 2DBYA 1N6PA 2RHDA 4Q4LA 4KFUA 1R5NA 2WWXA 3SN6A 4DT1B 1P2VA 2HDNB 4CVNA 1KI7A 3X1ZA 1U8AA 1E2LA 1S9HA 2W0MA 2YWEA 4MGKR 3TVDA 3LXXA 3DPUA 3KTAB 2X19A 2A5YB 2R6AA 1EXMA 1X1SA 4KFSA 4Q47A 1AKEA 4QHSA 4TZ0A 3EWSA 3KL4A 4Q7LA 3LO5A 5JHGB 1Q1EA 1K6MA 2V9PA 2O0KA 1PUJA 1N6KA 2OSBA 3FMOB 2OE2A 4AI6A 4IFBA 1P2UA 2WTUA 2X1VA 1XXHE 2F9LA 1A7JA 1JJVA 3PEVA 1FP7A 1B0UA 2DFKB 2G83A 1T0JB 3VU9A 2XZLA 1W4RA 2Q0HA 3ZZUA 1KJWA 4LDJA 1GG2A 1UJ2A 3SU8A 2JLSA 2Z4SA 1D6JA 1JB1A 1K5DA 1G8GA 4FW9A 3T1TA 3I4LA 4HUTA 4HYYA 2F43A 4U7DA 3WHKA 4ABYA 1KY3A 4LJAA 1IXZA 3TUJC 4KJZA 4EUNA 1W7AA 4C7OB 3MWLA 4I99A 4A2PA 4BRWA 4IVQA 3AF0A 1XTRA 2QBYA 4RFVA 1ZM4A 4QNRA 3NVAA 4QBGB 3GJ8A 3QY0A 3ND8A 3W6NA 4BLOA 4GBMA 3FKSA 1FUKA 1XD2A 2QBYB 2GHIA 1N0UA 3AF3A 1KMQA 1FPMA 2WJGA 2NG1A 3WBJA 4BLQA 2IF0A 3HU2A 4AG5A 4FWIB 2BKUA 4GOKA 1M7BA 2BBOA 4Q9KA 2FFAA 2GZAA 4JVLA 4A9AA 3QVVA 3ICEA 4Q1AA 2DR3A 5J4HA 4UKDA 3FHTA 2GBLC 3UMSA 4MYTA 1W4AA 1OFUX 5AUOB 3R9WA 4JKIA 4CZ2A 3OE7A 5L3QA 1OXSC 2FSGA 3PITA 3EPHA 4R98A 4NDZA 2ZRAA 5JHHB 2DY1A 4TZ6A 1KI6B 1S3GA 4C4PA 2BMFA 4D2IA 1T0HB 4Q4AA 2IK8A 1L4YA 3K0CC 4JLVA 4TMWA 2XB4A 5DIFA 3KB1A 3WNBA 3BB3A 3QXJA 4D4LA 5DH9A 3NDPA 2CLDX 2YWGA 3UMRA 2QROA 1MO6A 1OKKA 1W0KD 4EPXA 3SFVA 4Z54A 4S2EA 2O8DB 4Z8YA 3U4QB 2ZSDA 3T1QA 1U98A 4L15A 2GNOA 4TL9A 1R0ZA 4QHTA 1Z06A 2QPAA 2RB4A 1FQKA 4JLKA 1X3SA 1RW4A 2EQBA 3QOFA 3TW4A 4A6XA 2FSHA 2FPKA 1VG9B 1WA5A 1JPJA 1W1WA 3MCAA 3F8TA 3WHLA 4ARZB 621PA 4KCGA 1VG0B 1VCNA 2GZDA 3B7GA 4EQ6A 3QE0A 3CWQA 4Q48A 1DO0A 3EASA 2ZIAA 1MO5A 2AD5A 5C46F 2PMKA 4TTQA 4EQ6B 1EFRA 2H8KA 2ZRIA 3SR0A 2CJWB 2GETA 4BFSA 4US2R 1U0JA 2H57A 2BM1A 3NBYC 3BFXA 1OLOA 1OIVA 1E2MA 1N6RA 4LCBA 3OE7D 4B3CA 4PO1A 2JEOA 1OYYA 4B2LA 1U9IC 4QHYA 4NL4H 1QHGA 2W58A 3V4RA 4KLZA 1NJFA 4RZ2A 3UXMA 5EZ6B 2Q9BA 2R6CA 5CM9C 4OI4A 3RSOA 4JJZA 4BLSA 2NO9A 4BWYA 2CVHA 1UKYA 2MMGA 1Z2CA 3FHCB 5J4KA 1AS2A 1IONA 1UF9A 4JT4A 1SXJB 4B3XA 2RGEA 1E96A 2R8RA 1T9HA 4DKXA 3KQHA 3AP1A 3GP8A 4QGAA 1DAEA 4MRSA 5JS8A 2FPLA 4OHZA 1F48A 4HDCA 3NBXX 4JVMA 2XB2A 1P7CA 2VH5R 1GAJA 1XJCA 5A5GA 4ASUA 5TB5A 2W2TA 4WOPA 2IYUA 2PT5A 1M74A 3CX8A 3U3MA 3IEVA 1XPRA 3EZFA 3G5UA 4C30A 4JL5A 2JJ8A 5D3QA 5CK4A 4PC1A 1R8SA 2VP9A 3AF1A 4L16A 3PG5A 5EXXA 2I3BA 3W5JA 2SHKA 1NNEA 1QF9A 5AJVB 2VP0A 2JJ2D 4EFLA 4DDUA 3OFNA 1GL6A 2OAP1 3IHLA 2WWGA 2W6JA 3N70A 4NP6A 5AUQA 2W00A 4KVAA 3FHOA 1E2NA 5FOWA 1PZNA 3EIEA 5AJWA 2ZAOA 5G53C 2VPPA 5GJWC 2BVNA 4CYMA 5J47A 2F3TA 4RD2A 5JEEA 4ACAA 2VEDA 4QKQA 1E9EA 1G3UA 1ZM2A 1MT0A 4G5GA 1LV7A 2XJ9A 4DLSA 1H65A 3KXIA 1UPTA 1XTIA 4WXPA 4BFYA 2AWOA 1Q21A 2WZQA 1CJTC 5CYPA 5K8TA 3BK7A 3BH0A 3UANA 2CK3A 3QPVA 1KKMA 2Q3FA 4OQFA 4LYHA 2DHRA 2GTPA 4IRUB 1DBSA 4KSBA 4NYJQ 4B35A 4AYWA 1SHZA 3E1SA 3IIMA 2QQEA 3AF2A 3R8FA 3AM1A 2P0EA 4Y0VA 4LV8B 1OF1A 5H1YA 4P32A 4NONA 1WB9A 1GRQA 3GFTA 2H1LA 4MRNA 1GITA 3EZ9A 3X1DA 1G7SA 2IL1A 5KSZA 2YV5A 1M2OB 4GOJA 5HKKA 1E9CA 4TMVA 4Z1MA 2OBLA 5D3MB 1G4UR 2G1JA 3QI2A 4FD2A 4YMWA 4UNNA 1AK2A 4CT4B 1WCV1 3U44B 3A4MA 5A0FA 2WICA 2JLRA 2GAAA 2J45A 5FTJA 4NYMQ 2IUSA 2DPXA 3EA5A 3FMPB 4ZKEA 4TMTA 3ICQB 2ZYUX 4B47A 3CR8A 3OIVA 1H8EA 3UATA 2WSMA 3DZ8A 2OCPA 4LSGA 3VX4A 5TY0A 1Q57A 4IOLA 1UADA 2ZRHA 1VHTA 1OXTA 2IWRA 5HZHA 4BLTA 2GVDC 4GI7A 1GZSA 3BS4A 3DDCA 4TLEA 3Q9LA 4EAQA 5B30A 4DLZA 3QKRA 4KO8A 2IYQA 3BD9A 4V0MA 4EFMA 3PEYA 3IIKA 1R0XA 4MUAA 1XZQA 2GCOA 4NYJR 5AUNB 2ZRJA 4UNSA 4GT1A 2O52A 2FX3A 3RS0A 2ONKA 1R5BA 1Z22A 5FR2A 3U7EB 4PZZA 1IXRC 2OZEA 4HDOB 4BLPA 5FL7D 5JWHA 4DJTA 4FWTA 1E2DA 1TQ2A 5FPKA 3U6BA 1E2JA 5SZHB 5DI9A 3RRYA 1IXSB 3K0AA 4UQOA 1FNMA 3KKOA 1YRBA 3U6KA 1OJLA 4AY2A 3GLGE 1E6CA 1KSFX 2N1BA 3SJBA 1SVMA 1E2GA 2ZU6A 4ESHA 3LA6A 1P2SA 2V6JA 1DTSA 2H5EA 1R0YA 3QXCA 2V7QD 2XX3A 4X8LA 2IWHA 4NYMR 1OFIA 3VKHA 1DS6A 2AXPA 4QBIA 4MGIR 2NO0A 2RGCA 2W2XA 3CRQA 4JVSB 4CF7A 2JLXA 4E07A 3U3OA 3AGQA 3CH5A 2H17A 3HU3A 2WWYA 3GJ4A 4GPTA 5KSPA 1JPNA 2KSQA 1IM2A 4LC0A 3HYTA 1E79A 1RE0A 3LQRA 5KU1A 3LWNA 3CX6A 4N0DA 1FMJA 2WM9B 1P61B 2O5VA 3M6AA 2WSSA 4TSFA 5HE9A 3VKWA 2CVFA 2ZYWX 1UBFA 421PA 2BV3A 2J7PA 2KWIA 2JDIA 3IO5A 3DVLA 2WOOA 3NBZC 3R8CA 2E87A 3AVQA 3IPXA 4Q9IA 4Q66C 4DRZA 3BERA 3T5GA 4LHVA 4KITB 2RH5A 1KDPA 3PR1A 5FTKA 1T6NA 2ZEJA 3S1AB 1RYFA 2ZRNA 4YXWA 3DL0A 1AM4D 1W0JD 1F60A 4NKRA 2JLYA 3SBDA 1VCMA 2A5DA 1E69A 1U0LA 1AJEA 1GP2A 1NBMD 2JJ1D 3CPEA 1WBBA 2GJSA 4C0HA 1Z0FA 4MYHA 4WIAA 3RC8A 3QXHA 4FN5A 2WBLC 4EJSB 1MOZA 3I3SR 5H70A 4B2IA 2DWOA 4OHVA 2B21A 5SZJA 3T35A 3TNFA 1CJKC 1KIMA 2GAOA 2OFWA 2VYFA 3WXMA 1G5PA 4Q9HA 2AFIE 4XD7D 4C0QC 3SJAA 2XJ4A 4UXJA 2ZSAA 3NDBB 1TUIA 1E9FA 4BZQA 1YU9A 2R44A 1T8UA 2OHFA 1G6HA 1EX6A 2WMOB 3SOPA 2NZ8A 4JL6A 4TLAA 1TUEA 1VYUA 2RGNC 3PUXA 4N0EA 1TEVA 2ZRMA 4PSKA 5FBWB 2AKYA 3PENA 3PQCA 5FBRB 4G5OA 5CLLA 2JGNA 3TJZA 2JASA 2Y8EA 2ZI6A 4M9SA 4B2PA 1HTWA 2WMNB 1ZNYA 4BE7B 4EDHA 1OYWA 1Q0UA 1TMKA 3L43A 1Q3TA 2X8AA 2C03A 3VR4A 2IS1A 3GFPA 2CCKA 1M7HA 3LNCA 2QQ0A 3OEHD 5FOXA 5DLQC 5UKDA 1FNNA 2WOJA 3EZ7A 1ZC3A 3OAAD 1MRNA 821PA 3ADBA 2ZS8A 2GEUA 3DHWC 4DB2A 3BORA 1Z07A 4ZI3A 1XBTA 1Z0KA 1G3QA 2AXNA 1RRPA 3WBKA 3A8TA 1E2HA 1ZUHA 1A4RA 1JQLB 3W8RA 2Z5FA 4JLNA 3W8NA 2ZXUA 5FBLB 2CBZA 1VTKA 1TF7A 2BMDA 3CH4B 1WXQA 5DNYB 3BH6A 3LBIA 4RCZA 4BEJA 3A6PC 1KO4A 1XEXA 2DFTA 2OV2A 2PZFA 1FTNA 2FFBA 3SS8A 4A6PA 4G5RA 3U61B 4C0LA 4DSTA 2OLJA 1XEXB 1W5SA 1Y3AA 3LDAA 1MKYA 2VTKA 1XFAA 1Z0JA 1H8HD 3QPWA 4O3MA 2YWHA 4TMXA 5DN6A 5BN5A 2C96A 4KFRA 4ESVA 1E3MA 1FL9A 2ZRPA 4KI0A 1NLZA 4URXR 2QL6A 2CHGA 3AVVA 4OI0A 4LC1A 4FI3C 1NMYA 1TEXA 4PZYA 4PPQA 1VCIA 3B2EA 1HE1C 3FFAA 2H16A 2ZROA 4LGMA 3TSOA 4FMCF 1P2TA 4P0TA 1RIFA 3CRRA 2YYZA 4QC2A 1OFHA 2AKAB 1G1MA 1XCGB 3CNOA 3VTKA 3O8CA 4HAXA 2XSZA 4BQSA 5L3VA 4NHOA 4ZCIA 4I1UA 1T3SA 2GRJA 1XTQA 4C2UA 3QVUA 1IN7A 3VR3A 4LZZA 1GKYA 4KYUA 1RKBA 1CR4A 2ZUCA 4C9BA 3B1VA 1GNQA 2G77B 1EFTA 1G18A 4IJMA 1M8PA 3G82C 4D4JA 2OFXA 2R6GA 1UM8A 2XZOA 3CX7A 1F2TA 2ERXA 2PCJA 2RGAA 1W36D 4B3DA 2KBFA 4BFUA 1FZQA 3NXSA 3RRMA 4TT3A 5L8VA 2VHJA 4LJ4A 3X2SA 4A0FA 1PUIA 2JLVA 1OSNA 2EW1A 4KAXA 2RHMA 4IKEA 4Q1FA 3WMGA 4ZV4A 1T8TA 1YR7A 4JKYA 1ESNA 1MRSA 3CZPA 4P4UA 4RSGA 5BYJA 4XWAA 2HJVA 2KI5A 4B34A 1XPOA 5JLJA 1QRAA 5FPSA 3ZS8A 1A1VA 3CBQA 2ZS7A 3RANA 4DUGA 1OB2A 4F92B 1P9RA 4V03A 3QXSA 1E0AA 1VKJA 1G41A 3MG9A 1KJZA 1JEDA 2FGJA 1ZD1A 1S8FA 1TU3A 2IX3A 3F5FA 4CIDA 1KI1A 4OQNA 3SE0A 1AA9A 3TQCA 1AIPA 2J5XA 3REFA 5GVSA 4QGGA 4HUQB 3B60A 1N5LA 4DDTA 2FFHA 1W4BA 2XSZD 3HJNA 4BFZA 4IOKA 4B71A 2GEVA 1CRPA 2JLUA 3BOSA 4M8NE 3V9PA 1GWNA 3B85A 3TKLA 2RAPA 1ZM3A 3FMIA 3R7WB 3SJZA 2Z43A 1E2KA 4PO8A 2VBCA 2IEZA 2GXSA 2R2AA 2RMKA 4B33A 2GXAA 2G3YA 3PUVA 5J40A 5JI3E 3Q3JB 1W44A 3SDZA 4DHEA 1BS1A 5BN4A 2XNDA 3UK6A 3M0EA 1MH1A 5KOYA 4E22A 4HB0A 1HUQA 2MMCA 4U00A 3ZGXA 4TWZA 2WAXA 2I1QA 1E2IA 2QG6A 3KQKA 2GXQA 3NTUA 3VFDA 3LRPA 1RZ3A 2ZJAA 3THWB 2QE7D 2JLQA 4DZZA 1G7RA 5ANRB 1R0WA 4TL7A 1W2HA 2P6RA 1JAIA 2C9OA 4ZCLA 5C4MA 1XZPA 3LLMA 2QT1A 3AB3A 3NBFA 3GJ7A 4HB4A 2QY9A 3PUYA 4DDVA 2VO1A 5ELXA 4B3GA 3K0FA 3OF5A 1N6LA 2QN6A 3TLXA 1LTQA 5FBQB 1C9KA 1EWRA 2D3WA 2F1JA 4Q7MB 3RRNA 4NCKA 1OH7A 1OB5A 3K9NA 3GQBA 1DEKA 1E99A 3WYFA 1KI2A 3I73A 5JEDA 3GLIE 1KYIA 4URYR 1DPFA 3PUZA 3L8YA 2W6ID 2E9SA 3IPYA 4GP6A 2CE2X 1AN0A 1I4TD 1N6NA 4C0KA 1Z29A 4OK3A 1MABB 2FA9A 3RAPR 1U8YA 4BZPA 3ZVLA 3PUWA 4DIEA 4LHXA 3E70C 1HQYE 4A92A 2GJAA 2JAQA 721PA 3K09C 1KO7A 3Q7PA 4RD0A 3KFVA 4D80A 2WWFA 2VP4A 5HTKA 4LPKA 1LVGA 3IBYA 2WJIA 4JT2A 2QAGC 2Z6VA 2G9NA 3AGPA 4RD3A 4DXAA 4TYNA 1EG7A 2IYWA 3O8BA 2ZM5A 1QVAA 2OXCA 4CEHA 5FR1A 1W46A 4XVUA 3AVXA 3Q7QA 4F38A 3KZ1E 2H92A 4CEHB 2VF7A 4XH9B 3H0KA 1LY1A 4DSOA 3TBKA 1KI8A 2FGKA 1SZPA 4M1TA 1YJ5A 1US8A 2UVQA 3WYGA 3CONA 5B58C 4C0BA 4QBHA 3SYKA 1G8YA 4F91B 1ZU4A 4JBYA 5CB8A 3EPLA 1US8B 1TQDA 4Q7KA 4E09A 3QG5A 5LBIA 3RS2A 3SZRA 1P60A 3WMEA 4DLXA 3E5HA 2P6NA 1N5KA 1KJYA 2DWQA 4LBVA 1Z6AA 2ZJ2A 4ZI2A 1VMAA 5G41A 2CL0X 1AS0A 2VRWA 1G19A 1QHXA 1D9ZA 2WKRA 1NN1A 3DOFA 5TMPA 5CDFE 4LY6A 2OXRA 4YONB 1WQ1R 4LI0A 1OT3A 4NCIA 2OEPA 2B8WA 3NG1A 5FOTA 4Q1CA 5C18A 4EPRA 3SNHA 3M1IA 4Q1BA 3HPRA 2GCPA 1MR3F 1CIPA 3A58B 3OHMA 4O2RA 4FMDB 2K5UA 3VHLB 3VU9B 1W0KA 2P3SA 3OIUA 2G88A 2ZJBA 1M7GA 4PQYA 1F5NA 1KK2A 3A4LA 3DO6A 2F43B 3L0OA 1E4VA 1JECA 3SYNA 1E98A 2G6BA 3LXRA 1YZTA 1E0KA 5CJ2A 4DCSA 2F1RA 3BRWD 4XTCS 1KO8A 1XD9A 1QG4A 1U0HC 2QP4A 5AWFC 4B74A 3LBNA 1X6VA 2IS2A 2FV8A 2JCSA 3ETLA 1XMSA 2G0NA 1XD2B 2HXYA 3HPQA 5BXQC 4MRPA 1MO4A 5E7IA 3TUIC 1KK0A 1OXXK 2QMHA 2HYIC 1RJ9A 2OAQ1 2ZANA 1PVOA 1GVNB 4PQFA 2AHOA 3C8UA 2KE5A 2C04A 1NVWQ 1RJ9B 2XOKD 2J59A 1X8LA 5J5CA 1S0UA 1GKIA 2GESA 2FSIA 3KQUA 4B73A 1KNQA 1SULA 1SKYE 1SVOA 5L3QB 5L3RA 1AGRA 1X86B 2Q21A 2EYUA 2YZ2A 4Q4AB 3RABA 5FPTA 2QNRA 1UBGA 3UKDA 4AKEA 1N6IA 1S3SA 4URVR 2HLDD 3LLUA 1SVLA 2A5JA 3SI7A 4G3XA 1JBKA 1G5RA 1KDOA 2WPDA 3CNLA 3W6OA 1OIXA 4B76A 5L3SA 3BGWA 4YDSA 2HT1A 2J46A 3KJGA 3A4NA 3JVUA 1U81A 4CEJA 1ZUNB 4UNQA 1G291 3UG7A 2D2FA 4GRAA 2C9YA 4CEJB 1Z6YA 1XB2A 4HAVA 4H9GA 4M1KA 1ZCAA 4WZ6A 2BWJA 3F0TA 2J41A 2ODWA 1II0A 1HV8A 4D0GA 2JJ2A 5FBVB 1DARA 2GEDA 2IYTA 1G20E 2BBWA 5C1BA 2EWWA 2AL7A 3ADDA 3GPLA 3UPUA 3MFYA 4DIDA 1KI3A 2HF8A 1YQTA 1Z6GA 2HF9A 3NEYA 2FN4A 1KO1A 1PLKA 2QPTA 1KI4A 1N6HA 2YOHA 3DKVA 4HI0E 2YOFA 1UFQA 5KNDA 4B48A 2FDCA 2YKGA 1E2EA 4OYHA 1UEIA 3BB1A 2DB3A 2OILA 4CRWB 5F9HA 5DISB 2VHQA 1ZU5A 3EG5A 1HH4A 1FQJA 4LYJA 3UMFA 1I4DD 1Z08A 4GZMA 2TMKA 4HZUA 2RGDA 4M1OA 1ZRHA 3ZIAD 4BUJA 3RS5A 3VR1A 3IBGA 1ODFA 4IDHA 5C2JB 2R6DA 2ZJOA 2PT7A 4L8GA 1XEWY 2FOLA 3ONWA 2WPDD 4MRVA 3GJ5A 4QJ4A 3VAAA 4HLUC 3TSZA 2QRNA 3B5JA 2J3EA 2ZI3A 4E03A 4MKHA 4DLUA 4L9WA 3QENA 1KNXA 4QJ5A 4TLDA 1UEJA 1V5WA 4DLVA 4TMZA 2JLWA 2AD1A 3GLHA 2J9RA 4V0KA 3UIEA 4ZDWA 3THYB 1NMZA 2IEYA 2BMJA 2RGNA 2UZIR 3FFBA 5AJZA 4URUR 5F3WB 3GLHB 2ATXA 4PAMA 4RCYA 1OH5A 5KDDA 3CW2A 2VL7A 1CXZA 1GNRA 4XVRA 4ZPXA 5FTLA 3I61A 2XITA 5JWRA 4PR0A 1M34E 4J0QA 5KSYA 3MWKA 3LFUA 4FINA 1ZIOA 2ZUDA 1NKSA 4QNMA 1OH6A 2ZJ5A 1NF3A 5FL3A 2O0JA 3AKDA 1KOFA 3RRZA 1MO3A 2YC4C 2QM7A 2YOGA 2IYZA 1GIAA 5FL7A 1Z6TA 1LB1B 1NG1A 1HY3A 3WRXC 1QHSA 4M1MA 4CEIA 1OIWA 3MWJA 3OESA 1U2RA 5EJEA 4S35A 4KXFB 3ZD6A 4CEIB 1GSIA 3L0PA 3OEED 3BE4A 4ON9A 4PFSA 3WNDA 2GF0A 1TTTA 2WVJA 1FTSA 4I1SA 2V7QA 4I4LA 4EPVA 1Q44A 4OHWA 4RZUA 1Z5ZA 1DG1G 2KB0A 4MDEA 4RY2A 5SZIA 4R71A 4EFNA 3D31A 3RC3A 2GZHA 3L2OB 4A1FA 1CP2A 2WKQA 5IDVA 4AYTA 2A5FA 3QSYA 3C41J 2V55B 1S2MA 3QBTA 5KPJA 1YR6A 3U7HB 3A36A 2ORWA 2PZEA 1BIFA 2ZYVX 3SFZA 3T06B 4NU0A 1VHLA 1XCPA 3R9XA 3EPKA 3C5CA 3IEUA 5AR1A 1BYUA 4A4DA 5P21A 1EFUA 2JLZA 1BMFD 1I4LD 2EFEB 2WWWA 2MSEB 3GCGA 1WP9A 1MV5A 1YHNA 3LVQE 4HAZA 4UNRA 5G3ZA 4BGDA 2PJZA 4M1YA 5EXPA 3KJEA 4KHZA 2I1VB 5H68A 1NLFA 5TDHA 3SQXA 4UJ5A 2WWIA 4W9MC 2V4ZA 2ONJA 2QA5A 2REOA 4MQBA 3U3KA 3GFOA 4Q4JA 3MJRA 1LW7A 2D62A 3QKRB 1IOZA 3GJ3A 2BKEA 4IW3B 4FCTA 4JJKA 1KHTA 2VSXA 4JBXA 2GCOB 2RGGA 4W5HA 3KQLA 2P6UA 2XXAA 1Z8FA 1P4SA 2V3CC 4Q18A 2B7CA 2B7BA 3A1VA 1VECA 4Y0AA 5GADl 1W0JA 4JYBA 1L4UA 4MUBA 4Q9JA 1C4OA 1HA3A 1ELOA 5K8UA 3FVQA 1NN5A 3K0AB 2OCBA 2QZ4A 4RFSA 1U90A 5IT5A 3IHWA 1NBMA 2JJ1A 1ZM9A 4IFEA 1TQ6A 2P67A 5JECA 1D8TA 5EUMA 4RFSB 1OE0A 4BFVA 1AZSC 2CL6X 4US1R 3TH5A 4FMBB 1DVRA 1DAIA 3EA0A 1XEFA 2G0TA 4YC7A 3KJIA 3GLFA 2ZYTX 1P73A 4B43A 4HLQB 1X8JA 1P3JA 3B1WA 3CR7A 1ZM7A 4YMSA 2V1UA 4KBFA 3GLFB 4RJLA 4KU4A 4XD7A 1J70A 221PA 2CXXA 4A0RA 5JBQA 2ZI7A 4JYCA 3SC3A 2PZGA 4D25A 1R4AA 4HLCA 3SQWA 3VR5A 3ZD7A 5C4GB 3P4YA 4ZIRA 2WIAA 4LOAA 2F1HA 3K70B 2HYDA 4NCJA 4ZIRB 1ZW6A 2ZJZA 3MJHA 4BLRA 4LK2A 1OXVA 3GEEA 1LNZA 3HP1A 5CB6A 3OEHA 3AVTA 1D9XA 3VQTA 3WP0A 1IJEA 3A37A 3OAAA 4P3YA 2D4HA 3TUZC 1XXHA 2PEZA 1E0JA 3ZZ0A 3PVSA 4Q7JB 3H86A 2C5LA 4Q4HA 5CK5A 2D7CA 2C78A 5AJXA 1XXHB 2ODBA 4LHYA 4DLRA 4HAYA 2FZ4A 1WMSA 2W0SA 3CM0A 5JCPA 3EIHA 4FIDA 5FI1B 5JZVA 1I2MA 3AUYA 3IILA 5JSZA 4F93B 1IBRA 3MRSA 4LHZA 1GRNA 3RSLA 3HR8A 4D4KA 1HT2E 2IHBA 4BEBA 5JSZB 2LCFA 3D3QA 1R2QA 1K5GA 2QP9X 5DYIA 1A2KC 1FOEB 1NRJB 4JLBA 1LFDB 5G40A 3KJHA 2CNWD 2AWNA 3L0IB 4I81A 2V54A 4QG7A 3RS7A 1H8HA 1TQ4A 4OL0A 1ONBA 3A1SA 4DEXA 1SXJC 1YR9A 3JZAA 2HJGA 4D4MA 4OJKA 3THXA 1GL7A 4PXAA 1M6NA 4Q9LA 4BFWA 1ZCBA 3DM9B 5G3YA 3QUSA 5F9FA 1S9DA 2Q9AA 3NC0C 2FMXA 2PCLA 2NOAA 2GWHA 4TMKA 1V43A 3MSXA 1P75A 3H2YA 4AK9A 5F98A 2ZRGA 2BEJA 1F2UA 3AQ4A 4LBYA 4V02A 1XDBA 3KKQA 2ZRDA 3RS3A 4AKGA 3WNCA 3K09A 2O0HA 4E5UA 1JAHA 1F2UB 1KAOA 3LX5A 1IJFA 1J8YF 5LB2A 2Z83A 3N5CA 3D6TB 4A2QA 5HCNA 1ZNXA 1NVVQ 4PPNA 4TN1A 8OHMA 1ZNZA 2C9CA 2QAGA 4BFTA 3X1WA 1UKZA 3PEWA 4TQ9A 1Z6XA 2FE4A 2R65A 5TV2A 2GDJA 4PC2A 2WJYA 4KYIB 4RZXA 4XJXA 1W36B 5SZKB 2VHCA 3KDSE 4ZDIA 5KYKA 3KKMA 4JS0A 1RPZA 3LQQA 5AUPB 1ESMA 1QDEA 1S1MA 3B82A 4NCNA 4XIGS 5CLQA 3LBHA 3EC1A 1QHNA 2GJ8A 1QBKC 3QF4A 2C2HA 4NZYA 4US0R 1WDTA 4KSCA 1E1RA 1QG2A 4LJ7A 3WRYC 3B8HA 4OI2A 1DAGA 5DHFA 1R10A 3QG1A 2VHTA 4GOXA 4A36A 3GJ6A 3P32A 1J90A 1T3HA 2ZRKA 2Q3MA 3AP3A 3MD0A 2IS4A 2QU8A 1UBCA 1SKQA 5B64A 1SQ5A 2FFQA 4MYUA 5FI0B 3O47A 2BM0A 2J0UA 4OQMA 3QPUA 1P5ZB 1IY0A 1NVVR 3KFXA 2OCYC 3LV8A 4M22A 2ZVPX 3VMFA 4C0JA 4ERNA 3QKUA 1G8HA 3W90A 2PMDA 4IDOA 4IEIA 2P5SA 3T61A 4A8JB 4V0NA 3CWZA 4B6FA 1E2PA 2XGJA 2C8VA 3DZDA 2QUZA 3K9HA 4TQUS 2GCNA 2ZR9A 1XD8A 2ZVQX 2PX0A 3B1YA 3LD9A 3EWAA 4TYYA 1CJMA 1JQJC 3WY9A 4PC7A 1U99A 1UBEA 2QT0A 5DI3A 1F2TB 1SXJE 4DC9A 2QGZA 1P62B 1XTKA 5HE8A 3Q5EA 1CR0A 3I72A 5JRJA 1YE8A 4GMDA 3NH9A 4Q1DA 1KTVA 3AEZA 2F7SA 3PEUA 2QE7A 1K8RA 1ZYUA 1DELA 2GBLA 3I92A 3VNUA 4OQLA 5KSOA 4F4JA 4P33A 2IYXA 2BBSA 3UWKA 1E1RD 2VF8A 4MH0R 5DO9A 6Q21A 1AGPA 1WE2A 1SVIA 1J99A 2BC9A 3KUDA 3REGA 1KKLA 3H4MA 1PJRA 1VG1A 2A3RA 1EESA 4DCTA 4QXAA 4HAUA 2IYLD 2Q3HA 3K0CA 5EXSA 2EU8A 1DOAA 2LKCA 4M1SA 2O8EA 1JJ7A 2IYVA 3BWDD 1NMXA 3OIWA 1L7VC 4PX9A 2W6IA 2OLKA 4LHWA 4F4CA 4PAOA 4II7A 2WKPA 1EGAA 1RYHA 2ZR0A 4PHTA 2PLRA 5IK2D 4XWKA 3ZQJA 3RYTC 1BH2A 4QOSA 4W5JA 1OHHD 1WF3A 2IW3A 4Q03A 4IOMA 5AJYA 4MYCA 2BJVA 4PPFA 3T1OA 2NIPA 1EFCA 3RWMB 2GK7A 4F4IA 2GA8A 4URWR 1DAMA 1J7KA 4H1UA 4RKEA 1NP6A 1PLJA 1ANKA 4HDQB 4WXRA 1TAGA 2G1KA 5EE9A 3MWYW 4DDWA 2QRZA 3NIBA 3RS4A 3ZJYA 4JSTA 5KHOC 5DGXA 4IDQA 2A78A 4C0SA 3QKTA 1IQPA 3CPHA 4BPBA 4AWXA 1F3OA 1II8A 4KODA 5A4JA 3KKPA 1IY1A 3ZZTA 5EXTA 2NTYC 2V1XA 1EK0A 5EP2A 2BMEA 5LPNA 2IXGA 3P27A 1E2FA 4Q01A 1N5JA 1ZBDA 1TADA 1U9IA 2F1IA 4BRUA 1GUAA 2HXSA 3GEIA 5E7MA 4MITA 3K0FB 2GKSA 4K81B 5J4YA 2MSDB 1Q1ZA 3AVYA 4EJSC 2IS6A 4JLJA 1KI9A 2UKDA 2AFHE 2PLFA 3THYA 1N0WA 1G8PA 2VP2A 1RVDA 4IVPA 3QXXA 2OUKA 2ATVA 5GJCA 1NN0A 2NO7A 3TRFA 2OFOA 4TQAA 1UAAA 2FNAA 4UNPA 3T12A 1UDXA 5FOSA 1U8ZA 2HV8A 3RHFA 2XZPA 4V0ME 1G9XA 1NIJA 1NJGA 3GLGA 2ASEA 3BIFA 4G01B
chains in the Genus database with same CATH superfamily
5EPUA 5L7YA 4W7SA 2OA0A 4C1BA 3GLTA 3K96A 1ZMBA 3PA8A 1ESCA 5CA0A 1ZP6A 4X8OA 3ZZMA 2XVAA 2XGOA 1ESZA 4IIHA 3GH3A 3I4CA 3S6JA 2ZJ4A 4UBLA 1E4YA 3W3AA 4EHBA 5IN4A 5IM4A 3FMFA 5J4LA 2VJOA 3LCMA 2BSQA 1CFZA 5HK8A 1F9EA 1ES9A 2I3GA 3ZVMA 1JLMA 4KX5A 3G13A 1EFDN 1F0NA 3T94A 4C5BA 3DMPA 4L0QA 5ALOA 2EFGA 5TMEA 2AI2A 1UJ4A 2A0KA 4AKHA 2Q4EA 1SMKA 3CJQA 5K0ZA 5T8KC 3ZI7A 1AN9A 2YHSA 2PAFA 1SKBA 5FHRA 3SNKA 2EKBA 4K88A 4GKJB 2WTXA 3WO0A 1WZEA 1FX0A 1TU0A 1QHHA 2VA8A 3LA8A 1HYBA 2VK1A 4Q00A 2FG7C 4COOA 1IZ8A 1GV0A 3CX4A 4KXNA 5THKA 1O96A 4F5EA 2ZI4A 4AQDA 4O59O 1WJGA 1LFAA 4Y9TA 5C34B 1Q22A 1AC5A 1RP7A 2QV7A 2BDTA 2EFCB 3KSRA 4C04A 4PHHA 3U5ZB 2HKIA 2VQDA 1C8LA 4UU8A 4JR2A 4RAOA 1IATA 1LLFA 3O03A 3IP9A 3UHOA 1KXJA 2G82A 3KTAA 4AF8A 5IF9A 5BSGA 3KZVA 3I1FA 1XMXA 3B89A 3U1TA 2P5TB 5AVZA 1GRRA 4YAKA 2B1QA 1RM4A 3JD2A 4MROA 4CMHA 4DVGA 1TK3A 3IJRA 3ICCA 4FE3A 4H7IA 4RVFA 1K9SA 2F00A 1UWLA 1JHQA 5CVCA 1DO8A 1JSRA 1YD7A 4MW6A 4O4HA 2GKGA 1Q20A 3B9RA 1UOQA 2INGX 4HAWA 4KRXA 4RPCA 2DECA 2GILA 3AKYA 1B3BA 4QGFA 5SY6A 2D0DA 1Y0BA 4B44A 3W1EA 1O9GA 4DQKA 4JLAA 4TZTA 2RHTA 2YV3A 2ZYHA 4LRWA 5SY9A 3WDMA 3CNNA 3MILA 3PZBA 3JQGB 1GFIA 4FONA 3PKJA 2VK2A 4BLUA 4D0NA 1KVUA 3DQQA 1QCZA 3WGMA 1PT5A 3LK7A 1VGVA 4AIIA 4G1BA 4NYIR 1G5TA 4BN4A 1L0BA 1G3IA 3PGJA 4LN1A 2JLBA 2DFLA 1SBHA 5LBTA 4AP6A 1TECE 4RANA 1RRKA 2C1XA 3VVCA 7ABPA 4Y0NA 1RRGA 3KKNA 4JYPA 1KP2A 3K53A 3KL2A 4RXUA 3ZLVA 4XX0B 4ZYYA 3HRKA 4K9RA 1G2IA 2ANBA 4DR4B 1JZQA 1BHQ1 3RFUA 2WA2A 3N8GA 5DHTA 3RC1A 1CDEA 1NR5A 3SQOA 1PX0A 3AUUA 3SHFA 3V46A 4ACBA 3TLEA 1OYOA 4FFMA 3ED5A 1U2QA 3AUTA 3BCUA 5IMSA 1U6JA 3SDSA 1XNQB 1R6AA 5HJEA 3FCAA 3L7OA 4CTJA 4ALNA 3H84A 1EVYA 3H8VA 2ZE5A 4KPUB 4XD2A 1N2CE 3BSFA 3PJRA 1E4EB 3E7PA 5THXA 2B9VA 1T8PA 3SZ3A 1JIXA 1II9A 4OJQA 3ZJVA 1NIPA 2ASVA 1XJQA 2E4AA 4B75A 5ALSA 5CM8B 3AXTA 5FWYB 3QUAA 4KREA 3L6DA 3FPKA 3ECCA 4P5PA 3F6SA 3R6WA 4YJ2B 1WF6A 4REQB 4E2WA 4PANA 1MB2A 2Q2WA 1QWSA 1Z7YA 3I1JA 3AK4A 3UK1A 1OA0A 1Y7LA 5CDSA 1RRMA 1O58A 4OQPA 4OSEA 3PXEA 4INPA 1HBJA 1ZGGA 5FFMA 1E64A 4IHQA 3V8EA 2EVWX 4KGVA 2C4WA 3DPSA 3EEIA 1F8FA 4CMEA 5LXTB 4G0VA 4ZK2A 1U0OC 2PSDA 4TYPA 4EY7A 3F3SA 5AXCA 3DBVO 3WLPA 5KMGA 4DB4A 4B45A 2PGXA 1MMFB 2QTMA 5KAMA 1Y4SA 3Q5DA 4JVOA 1YUNA 3IA7A 1HRDA 3OX3A 3K0SA 1NGSA 1FYXA 4WUVA 5DWVA 1HNNA 5KQPA 5JNLA 3UV7A 2VSFA 1IBLB 5DLYA 1MX9A 1NYQA 1B16A 3T7JA 1UT8A 1GN9A 1SA0A 2R7KA 1KIAA 3JQAB 2A9RA 2C98A 2FW7A 3F71A 1IAQA 4XIIA 5JT1A 2PUCA 2BFEB 4Y9UA 1XAHA 2ZVDA 4X90A 5G1NA 3M4YA 3ZV7A 1CETA 2Q9CA 5LNK6 5LU8A 1R66A 1TW2A 5IPFA 3PFFA 1H4TA 1X7WB 5FPYA 2JIPA 2CMFA 4QDXA 2D5CA 3DMNA 1CEQA 4KE7A 2IXFA 1RR6A 5H59A 2QP3A 2WJ3A 3KQVA 1C50A 2CXNA 2I67A 4RTPA 1SUFA 3RF7A 4L9SA 3THOA 2UUBB 4GOOD 5ALWA 3F74A 1NXQA 4BTEA 1Q1BA 4DBLC 5IX8A 3TF5A 1WRBA 1IVYA 1L7PA 2CDNA 1T5LA 2OYSA 2QRVA 5EP1A 4WECA 2XADA 1VZ2A 1CWUA 1O94D 1XX6A 4UZSA 4YWHA 2VHUA 1A27A 1J23A 2GN1A 3D7SA 3OEEA 4I55B 2PSFA 3GMTA 1IWBB 3EFHA 4PBRA 2WJPA 4TV8B 1X8KA 5F76A 3E9EA 5ULLA 3UK2A 3ZK9A 4I4TB 4KC0A 2A4KA 4NBVA 4ZAZA 5ELLA 4M0EA 4ZT7A 3IJEB 4KXMA 3FOBA 2E4YA 4G5QA 2B5VA 3GPBA 3P4XA 3WG9A 3M4XA 2WWRA 1FDRA 2QIOA 5GJBA 1Q0QA 3R9IA 1B74A 2GFQA 4EHIA 5LXTA 1N3BA 2W2VA 3B2NA 4CCYB 3UOWA 2IVFA 3IVMA 2ODPA 3L7NA 1D6MA 2WG0A 2YZGA 2V7WA 4LX0A 4XM0A 1P17A 5C7IO 4B6QA 3B6EA 5FCDA 1TK9A 2AK2A 3RVMA 5LP6B 1X7GA 1WL8A 5EMLA 4ENPA 5LDDC 4EZIA 3VNVA 1TUBB 2PKQP 3I5XA 5IYZB 1OKKD 4QPCA 1CCWA 5K7SA 3PD0A 2HDHA 2JCGA 3D6UA 3D0OA 2QI9F 2XGGA 3N07A 4X7BA 5KJ6A 5A5DA 1EDOA 1FFXB 5CEEA 1GTRA 1R4NA 1NQWA 3P9IA 1C9NA 4IBOA 2J6HA 2QXTA 2V7UA 5ALNA 4AJ2A 4DR3B 4LWZA 4EI7A 3LDFA 1A5TA 3G9XA 2KS6A 4GMXA 3UMYA 1KYXA 1O2DA 3K72B 1H2FA 3OCZA 1X7YB 4IV8A 4OFBA 1ZNWA 2BFDB 2P3LA 1KO5A 3P2OA 2O3SA 1MF7A 4M7RA 1ZOIA 3DEKA 2BFBA 3MMPA 2ZBGA 1Q7GA 3VU1A 4M9CA 2O9JA 1K4MA 3BXOA 5TF4A 1W47A 4PSDA 1P0IA 3CG4A 1CUXA 2DPGA 3CMCO 4HWGA 4LOKA 4EX7A 3P9KA 2W2LA 5KC9A 5BMVB 4F5YA 4EJFA 3MINB 1GGEA 3NO4A 2AOTB 5EIOA 5FO0A 5C3UA 4A26A 3VTFA 1HQDA 2EG5A 1EP3B 4ZAGA 1LS1A 3QF7A 3Q1LA 4QSMA 4AECA 2O1WA 2NQ2C 3U7FB 1EQAA 1XNJA 3ADKA 2G4VA 1Z4QA 4FHEA 5GZ6A 1UM9A 1Q3HA 4H7HA 4IXNA 3GQVA 2FPUA 3H4IA 2CYBA 5DHSA 5DW3A 5HFNA 1CS0A 2AF4C 1T8WA 2YC2C 3V8BA 3RKSA 1D2RA 5EFOA 4Y2GA 3PX3A 1W85A 5CIWA 1VIYA 4DIOA 5KB3A 4FB4A 4MW2A 1B26A 2ZJ0A 2Y4NA 1MB9A 3AR7A 3LKVA 1DEXA 4GDFA 1M1YE 1PZGA 2BL4A 2GN9A 2ZJ6A 4QPJC 3R3SA 1ODCA 5AK4A 3V4FA 3ZCVA 3OFKA 4YJGA 2BOVA 1IRXA 4TYQA 4AJIA 4MVJP 4WBNB 2WU4A 2YHUA 1U63A 3A1CA 3OZBA 5F2KA 1KZ7B 5FEMA 2ZKLA 3SXJA 5IJ9A 3U37A 4MUXA 2X6TA 3K5IA 3R5JA 2C4HA 4AMBA 3EY4A 4EYKA 1FMFA 4GLJA 4M76B 4ZQFA 2IKSA 2Y0DA 4PXSA 4TROA 1IN8A 1Z25A 1EGHA 3RVBA 4C6HA 1SXQA 3OFND 1IK4A 3RRJA 1N1MA 3NYIA 4DMGA 4D3YA 1T6ZA 2QG4A 3Q1KA 4P38A 5EHZA 4PC3A 2W2KB 1W35A 3CFYA 5KTNA 1IN6A 4WLUA 4IEEA 4QTXA 3OX1A 2AE1A 2OQRA 3WB2A 5GTDA 2G17A 3ZWBA 3PWZA 1IUPA 2QG9A 2DY0A 4B3FX 3HUFA 2WKSA 3I0MA 2D1SA 1I6LA 1Y63A 3GGOA 4KE6A 3L7DA 1XCMA 2P75A 3FTCA 3FRJA 4LY3A 4U2BA 1K6XA 2DQ4A 4ZO4A 3EXFB 3ZY6A 4CM1A 4Z49A 2HNBA 3WGOA 1MG0A 4XWGA 1NHGA 3T4UA 5A3SA 3WK5A 1BC5A 5ENDA 3T9DA 4HT3B 1ZGCA 4QXQA 4NTZA 5J1SB 4G89A 1RRCA 5LP1A 2ZPUA 2PX8A 121PA 2HXGA 4FQ5A 1PL8A 3ZYZA 1TLTA 1PSDA 3L4EA 5ICGA 2XHEA 1XYVA 3QUCA 1KEKA 1ID8A 1X1EA 2RH4A 1AS3A 4FCVA 4G0OA 4TL6A 5G4KA 5MN6A 4WZAE 3S99A 4HWKA 3THRA 4EA7A 3TZ6A 2WJJA 4ZOCA 3FDJA 1F2DA 4YY3B 1E1DA 3PPYA 5DSZA 5BY2A 4A6DA 1FFHA 2HHCA 3MWFA 3O1JC 2W8ZA 4FHCA 3N8HA 3FIUA 1GZ6A 4IM7A 4UM9D 2QQFA 2QZ9A 1XMIA 2I54A 4GVXA 4WBSA 5I9TA 5T4BA 5TQJA 3RVPA 4CM9A 4D6PA 3PFKA 2WF8A 4QM6A 2Q5LA 1OAAA 1JKJB 2DYKA 1V7PC 2ST1A 3B3QA 2XT0A 2IF2A 3GNSA 1Q1QA 1U3VA 4O4IA 3PDUA 2CEKA 2FQXA 1U2GA 2A7QA 4HNAA 4Y2VA 4F3KA 1TUGA 2IODA 3SPXA 3WWEA 3D1VA 3H1TA 1F4VA 1R5OA 4YHBA 4BJ1A 1MRZA 2Q49A 2V74B 3BJEA 2IU4A 3N8KA 1EAYA 3IRUA 4PS1A 5CDFA 1AZTA 2RDMA 3JS5A 5JS2A 3ULKA 3PX7A 2QAIA 2PXHA 1JG1A 2Z1NA 4QYIA 2QZJA 1PP4A 1GRVA 1P1FA 4BCDA 1T8YA 3OEYA 5H83A 2Q27A 3TOZA 2ZUTA 4DYDA 1R15A 3MEQA 4CR8A 3DUFB 3OCXA 5EZ5A 4F04A 1Z5WA 2O6HA 2E4ZA 3AR8A 2Z6QA 1T9BA 3IBSA 4YB8A 1U7ZA 3RGWS 3ROEA 5JQGB 4BO1A 1UPUA 1CIVA 4POAA 1GL9B 1BHO1 1LGYA 3QI7A 3ST7A 1FJ2A 3QVSA 3UC5A 3ZV3A 1BCSB 4H3SA 3FKQA 3WC4A 1J0AA 3RT1A 2Z56A 1LQTA 4II2A 2GXUA 2H4FA 4PCAA 5DM4A 4MKIA 3LPMA 4D3ZA 3PSAA 2HTEA 3WL6A 4E30A 2B37A 1PTJC 2DWPA 2E4VA 1WVGA 2Q99A 4HYQA 4J4HA 4Y2PA 2DLDA 1Z88A 1H5UA 2H6EA 4EA6A 3U80A 1BXRB 1GY8A 1EX7A 3RVDA 1BRMA 1VBNA 4GICA 2WUWE 2D54A 3D7RA 3NW9A 3OZEA 2ZBUA 4LX8A 1M8KA 2VDPB 4UDNA 4UE6A 1U8TA 5I7SA 2GJ9A 1PUXA 4XJSA 5EUQB 3QFFA 4A2CA 4TVOA 4EUSA 4IMPA 1ZD8A 1L7BA 3SJCA 5ICCA 1DRWA 5I5GA 3OQPA 1XA4A 3QLUC 1NBOA 2GJKA 1QLWA 4EYSA 1Z2PX 2ATEA 2FMFA 4A0HA 4JB3A 5HQ3A 4NWIA 4LYGA 1TZJA 2TMDA 3OIGA 3NV9A 2Q0XA 1Q7TA 3IQWA 2CNKA 4IQFA 1A2QA 5U4QA 2PQMA 3IDQA 4I5IA 1Q6YA 1RJDA 2QJTA 3AFHA 3B9QA 3LAWA 3LVRE 2NUPA 3VNRA 5LP6C 5I7UA 4HMPA 2PZBA 2AEEA 2VAPA 1JIUA 1LWNA 2BT4A 5I7AA 4BBAA 3K70D 3QEOA 4KV9A 1J2JA 1ADYA 3CLHA 4LDPA 4UM5A 1WVIA 1JR4A 1N57A 1Y34E 4YACA 5F1YA 3V2HA 1SVWA 4YQEA 5I45A 5LQMA 5EIHA 2NQ8A 4X7PA 2HV9A 1LVHA 3CGGA 4P2GA 4F45A 4C43A 3P2MA 4JWKA 1G21A 1ZK1A 3UJPA 3EMBA 4ZV9A 4ARIA 3FGOA 1FNCA 2OVBA 1PO7A 3NH6A 1DI0A 3OQIA 1DXQA 4HEA1 1ZD2P 5D7BA 3ZK8A 4AZWA 1XMJA 1TVEA 1XZDA 2XRFA 3I2YX 1FYEA 3PNYA 3OTOB 2B6NA 3C7KA 4JSYA 3A10A 1AXRA 2QL9A 5BSUA 2CCJA 2YJGA 3BUSA 3KBBA 3Q9SA 4Y1EA 4AMUA 4CF5A 4ZMSA 4QT0A 3O93A 1JDUA 1YS1X 4LQLA 4X41A 4YO8A 3HC7A 5BNWA 4CMAA 2FH5B 2HAEA 3FETA 3IT2A 3QX9A 4LXYA 4UAGA 4E15A 5K20A 4L5JA 3VYVA 2Z4RA 2B6HA 1BXZA 3EQZA 3KDAA 3QF4B 1NLYA 4X1KA 1PWZA 3ADCA 4CU5A 1XQ9A 4OATA 1Q0RA 5KIAA 5T6BA 5KTPA 3IVAA 2AJCA 4XE5A 5L3ZA 4EPYA 1LCIA 3D3NA 4G81A 4O1IA 4RKFA 5T57A 4RMIA 1GPDG 4HHEA 5EFZA 5IAEA 1Z0DA 3PCTA 1HE4A 3E1GA 3HV0A 3QUQA 2VP3A 2I6FA 1GPMA 1UK6A 2BGGA 1S4MA 2ZLBA 3QUBA 3VKFA 5JUWA 1JQAA 5HCIA 4QUJA 1JB9A 3BTOA 3CUVA 5DHAA 3R77A 1P0FA 2QI9C 1V35A 2WVAA 3C0KA 2NWQA 3OJWA 5EZYF 4DXDA 3AVOA 4EI8A 4NLLA 1CLUA 2FZLA 4B46A 3CLSD 4KK3A 2NSHA 5JRZA 2YZMA 4IEFB 3FTQA 1PWXA 1JIKA 2OP1A 4EB3A 1YJCA 1URPA 1P80A 1R4ZA 2DKOA 2QVXX 2BD0A 2QKYA 3KHSA 3MTIA 1ZUIA 1OC4A 2IUTA 2W2QA 3GL9A 3B1ZA 4G1MB 4OXXA 5TARA 4BX3A 4O2BB 3JPWA 3ZCSA 4M8IA 4Y6SA 4R0VA 3R7FA 1NY6A 3V34A 2R6ZA 1T35A 3KYBA 2V8BA 3A1TA 2EIHA 1FPQA 1Z5OA 3TXYA 1E5XA 5CAEB 3HGMA 2JVKA 4D4GA 5C0OE 1K2VN 4M53A 1UZLA 2LIVA 4RM2A 1Z12A 2ZRFA 3S81A 1X7ZA 1A8IA 4IFIA 1UFKA 1W4CA 1G2OA 3OLVA 5TJ9A 1T1GA 2JH9A 1V39A 2YXDA 2B92A 4RPJA 2CV1A 1T2VA 4AJOA 4HEJA 1AHNA 4WKGA 4R2LA 1C9MA 4M0MA 2SCUB 4MWEA 3DEHA 1L6RA 3MAAC 3A11A 1V2GA 3K1TA 4H31A 4RD1A 3TAUA 4BB6A 1VJRA 1TVCA 3DDNA 2NO4A 4FXOA 13PKA 3IAS1 3HZHA 3MCUA 4GPZA 1ZIPA 3ABOB 3PE4A 2RHJA 1CULC 4P53A 2YJNA 1SOWA 1YA8A 3GLHE 3I45A 4K6CA 3RS9A 3ZV5A 1AV6A 5JJIA 2RHCA 4L4XA 3D4LA 1YCFA 4K2HA 3DCYA 4W1RA 4C3ZA 2VDKB 4YI5A 1JALA 1YB6A 3AONB 3TRJA 2O8BA 1S3FA 2ZB8A 5HGJA 4HH1A 2ODTX 3BX1A 2IZOA 2QORA 3GJXC 4GP7A 5K3OA 1YTUA 4P7KA 2LWIA 2WTBA 2Y4OA 2HA5A 3AVPA 1W94A 2AVDA 4A2WA 1JV2B 3WHIA 2QUHA 2BH2A 3KWMA 1HG0A 3CYFA 1Y37A 2D74A 3EEYA 4MCHA 2ONZA 4IOJA 2FN8A 2HI0A 4FHDA 3NEJA 4IIUA 2O48X 2YHIB 4N40A 4WA7A 2CLKB 3BQNB 4WCVA 4Z9XA 1D09A 3I42A 5FPPA 1E9RA 4O08A 4EELA 2HLHA 4XSGA 4ZAXA 3BMQA 2HSGA 521PA 1PU2A 2G72A 5BW8A 1U28C 1WDMA 3BE5A 3ZJ5A 4AC9A 1MV8A 4ETNA 2O3TA 3DB1A 1OFTA 2C29D 1X19A 5KVCA 2IC5A 1XWIA 4PSAA 2J67A 4RHCA 3KHUA 3S29A 4D9HA 2PD4A 1N9ZA 4IDPA 3W6ZA 2EL7A 2BUCA 4Z9AA 4Y9DA 1JUDA 1KDRA 4I50A 3ZDCA 1RP1A 2JA1A 1PJTA 2YVQA 4N0PA 3JRXA 3S7ZA 3TEFA 4RDIA 1NYLA 2EFHB 2W8BB 3H19A 3C74A 3IBTA 5LIRA 1B8PA 4IV0A 3DF7A 4MP3A 4BLWA 3HKEB 2J9FB 3IP5A 3ZWWA 2PD6A 2P9QA 1Q6ZA 5K3BA 5B2ZA 1Q0SA 3G2IA 3T7SA 2GYYA 4LRTB 5BWMA 1NONA 1FYDA 4MP6A 5I9LA 3F8SA 3THWA 4EJ0A 4WZBE 4DREA 1Q92A 4PRLA 1H1DA 3DXFA 3SFTA 4M8SA 1YULA 2NMVA 3O2NA 1RLOA 4MR9A 4ZOBA 3HZZA 3DDHA 3NC1C 3QQPA 3TSWA 4EB6A 4NZPA 3OCYA 1LPOA 3LCUA 5HXAA 4QELA 3KZNA 5IW8A 1M6YA 1S96A 3RD5A 3T5PA 2NZ2A 3V8RA 3VTAA 3EQ7A 4DUYB 2O57A 3FYUA 3H2HA 5EUCA 5HIKA 3CB4A 4IILA 2RCNA 2VSOA 1QTNA 3EFOA 2F67A 1KK1A 2VXBA 3SQLA 3QHQA 4YT8A 1WV1A 3BB4A 3I6IA 2CMHA 5D84A 3CVXA 1VB3A 2XODA 3GRYA 1V16A 1VJTA 1AKMA 1BU8A 3IH5A 3EEOA 2HTFA 2FUG6 4DV0B 2DUNA 2VRBA 4UNIA 2HQBA 4G1UC 3N2GB 3CVYA 4EYEA 4TYWA 2GJ4A 4KNYA 3IUYA 2Z5GA 3OE4A 1RZRA 4K05A 2R66A 1FRFS 1OI4A 5DP1A 3C7AA 3TQFA 5CA0B 4MJ3A 1DJMA 3F49S 5E95A 1Y9AA 3IEXA 2YYYA 3QVLA 3ZK7A 3HU1A 1PX2A 2FY8A 3J81k 1AKWA 3DMHA 3O2QB 4PHFA 3VC3A 4NHEA 1GU0A 4BNYA 4V1CB 2JGAA 2XNSA 2B1IA 4DQUA 2X5NA 2JVJA 3D9QX 2YIJA 1YRAA 2XNDD 4NPCA 3SIRA 7MDHA 1ADGA 2B4AA 2DE0X 4Q1EA 2XQIA 3WR5A 5LD2C 2X7HA 3IPLA 3FDFA 3RUIA 3MA0A 4OQ4A 4BVBA 3GLFE 1S1CA 3BXHA 5M34A 3D02A 1W36C 3U4IA 2YASA 3IMCA 4PLGA 4BKRA 5IHPA 1JR3D 3I5YA 2FEMA 1QHHB 3EZ2A 4RIHA 4CV3A 1O96B 1T9AA 2WTAA 2DBYA 1T43A 2RHDA 3ZDBA 3FHLA 4G4JA 4KFUA 3TD2A 1P2VA 1KPGA 2HDNB 5T6MA 4DT1B 3H2GA 4KGXA 2GPYA 3LQ2A 3V1TC 1U8AA 3CZCA 4FDLA 4NBNA 3P0FA 4R3NA 2OLEA 4TQGA 3DZFA 3KTAB 3Q2IA 5FF9A 3AO0B 5CVJA 2HWWA 4QBKA 1Z8NA 1EXMA 4X1IA 2AOWA 1EX9A 1RBZA 4XVHA 3FR7A 3O8NA 5D00A 1NQTA 1PR6A 1V5EA 3FWPA 3L9XA 3LO5A 1EDDA 3OVMA 2PS3A 4GAEA 2O0KA 1GCUA 1PUJA 3W06A 1NAIA 5KKAA 2OE2A 4O4HB 2GUGA 5AKIA 1B42A 4B1FA 2F9LA 1P1CA 3LC0A 2I1LA 5I5EA 3PGMA 2GN8A 3PNMA 2G83A 2DFKB 4LZPA 4IDGA 5DOVA 4CHTA 2XZLA 1W4RA 1SBNE 3W8EA 3ZZUA 16PKA 2JNWA 4LDJA 2YUTA 5THQA 4YLYA 3KLMX 1LC3A 2R8EA 3HYLA 4N6OA 3SE7A 4YMGA 4YRDA 3I4LA 1T8SA 4YRGA 3NPAA 2FQYA 5AVVA 4TWBA 4EO4A 1GUYA 4HPWA 1W7AA 3HCAA 4I99A 2ACKA 1G2QA 3G02A 1R3DA 4JJGA 4FEEA 4IVQA 4XCQA 1ZM4A 4QNRA 3NVAA 4OLJA 4YJDA 3QM1A 2A1IA 5HK9A 2QR5A 3ACDA 4GBMA 3E8XA 3BIWA 5ECYA 4OFZA 1QP8A 1LI4A 2R8OA 1FPMA 1CUDA 3AFIA 1ZGJA 3LBYA 5JNTA 2GO7A 4M87A 3UM9A 1V8ZA 4JC0A 2ZIGA 4U5QA 2BBOA 4KWCA 1VJCA 1LDNA 4Q9KA 5BN1A 5JHGB 3QVVA 4CQJA 3ICEA 2HIMA 2DR3A 5J4HA 4UKDA 3PQ7A 3I5MA 3HR4A 2IOYA 2D8MA 2PGJA 1GAQA 1PBNA 1Z15A 5DBEX 4ZAFA 5EMJA 5AUOB 3WWYA 3R9WA 1NQVA 4RSMA 4JKIA 2VUTA 1N8KA 4RE5A 3CBGA 3K71B 5L3QA 1P1IA 1OXSC 3DV2A 3PITA 5H7XA 5J9FA 5BQFA 3ROMA 3ZHZA 4NDZA 4NNJA 5U4XA 2ZRAA 3ZHVA 3ZG6A 2A9PA 2DY1A 3OZ7A 4L78A 3NONA 1ADJA 1BVUA 3K9CA 4YAEA 1JXAA 1T0HB 3F6RA 4Q4AA 2IK8A 4JLVA 3QFRA 5AFSA 4YN3A 1QX3A 3X1KA 3CVWA 2P77A 3BB3A 3WK9A 4D4LA 3SLKA 2C3YA 5DH9A 2NAFA 3VSAA 3QWAA 1QC5A 4G0ZA 1N0HA 5DYNA 4JP1A 4B82A 2YWGA 1KZ4A 1JILA 3NBUA 1NF9A 2QX8A 2QROA 1W0KD 1SPXA 3EZLA 3GEBA 3LVFO 3G7SA 3KEOA 2FB9A 4S2EA 3VGJA 4Z54A 1DHRA 1H2RS 3G68A 1U98A 1I30A 1EDBA 2GNOA 3L6EA 3T1QA 2HO4A 3DE1X 2Z98A 4UREA 2C7VA 3BTUA 1X3SA 2V7GA 1SA0B 5M3BA 1U2DC 3TW4A 4ZGBA 1YFJA 3AB7A 1NUPA 3TSCA 4A6XA 4E12A 5EG5A 3F8TA 5KJ1A 4QE3A 3TEMA 2LW7A 4JKOA 1THTA 2VWPA 1NVTA 1JTEA 3DP7A 3CWQA 3RTDA 3ZWYA 1DO0A 4B4WA 5TSDA 3SYMA 2ZIAA 4EARA 3RADC 4B9AA 1MO5A 2AD5A 3H9CA 3D6NB 5AM1A 4FGSA 4ZQEA 3U1VA 3OKCA 3ZE9A 4EQ6B 1C7FA 2Z5LA 3MS7A 1VXRA 3LWBA 1ZXBA 2BM9A 3SR0A 2GETA 4XYBA 1U0JA 1C30A 3FWZA 3BFXA 3HI6A 2ORYA 3EGVA 1N6RA 3NM4A 4XUCA 4B3CA 3WZMA 1EXNA 4PO1A 1NMQA 3O4HA 1BZYA 3D2CA 1U7DA 2O6LA 4B2LA 3E81A 2HNKA 4MW7A 5KJFA 2P62A 2MT9A 2W58A 3B20A 3GFGA 1FU8A 3S5JA 2P9GA 3WXBA 4EYQA 1QAQA 1V6SA 2GCIA 2MU1A 1TCAA 4GR4A 3KLBA 4OI4A 4I08A 4YAFA 5CM9C 4IHAA 2F8LA 5CDGA 1U5BA 1JBQA 4OGFA 4JT4A 1RXCA 4F6CA 1T9HA 4QTZA 1A8SA 1MVLA 5KQRA 1KS2A 4J0CA 2E37A 1U11A 3MB5A 2YV2A 4MRSA 3GDOA 4YLEA 1X15A 2FPLA 3U4CA 4X24A 2C9MA 4Z3KA 2QLNA 3DKKA 4LTNA 1PK9A 2FZVA 2OHIA 5A5GA 4ASUA 2UYQA 5TB5A 3OZTA 3JSAA 1MJHA 4WOPA 5C1PA 3EZFA 4PRYA 1NXVA 3KOYA 1C0LA 1COZA 1UXHA 2HWYA 4JL5A 5ALQA 3O1HB 1R4NB 3OCJA 5JO0A 2UYCA 1C5KA 3AZOA 3EGDB 1B15A 3HBAA 2EHJA 3PG5A 4P1ZA 1R6TA 5EKTA 2I3BA 1LBEA 3S44A 2J33A 5DFAA 4URFA 4D92A 5IASA 3LP6A 1QF9A 1P45A 2FF5A 4H0CA 4XM1A 4EFLA 5KTTA 3ZDRA 3RUEA 1TM7E 2HIGA 3MMXA 2OAP1 3KE9A 3IHLA 1RQLA 3H1FA 3JQAD 3N70A 1XOIA 3PIDA 4KK4A 1TW3A 2ESRA 4GXNA 3IT0A 1U9JA 2BFBB 5LKRA 2C5SA 3DYVA 3GAMA 4IMRA 1PZNA 4MLCA 1NC1A 2OCDA 2ZAOA 4OSPA 5GJWC 4MCIA 4BIIA 1IYZA 2A3NA 4RPKA 4CYMA 1T1JA 2WTEA 1K9VF 4HDSA 4RGBA 1TA4A 2VEDA 5H4GA 3BWCA 1E9EA 3E5MA 3ELWA 3HBMA 1W96A 3R0ZA 5DNCA 4G5GA 2CYCA 4DLSA 1I3CA 2BGIA 1R00A 3KXIA 3ZWXA 1L4EA 2A0UA 1XLUA 3G2JA 3N7AA 4BP3A 5B1YA 4UBIA 5BRJA 3VZCA 5IWAB 3Q7SA 2VTBA 4LWOA 5CYPA 1WSBA 2HF2A 4RK4A 1UQTA 3FFXA 5KWIA 1DMSA 2M32A 3UBMA 4DV1B 1FW8A 1UM9B 4LYHA 5DXJA 1KQPA 4GR9A 2H9AA 1C1XA 3BCSA 2Q5EA 3G2LA 3JQRA 3BCRA 4NYJQ 4QUGA 1SHZA 4YV1A 1SH7A 1W1IA 3CJRA 3WNQA 1GGHA 1OBVA 1W85B 3JPYA 1OF1A 3QPDA 3OI7A 3G5LA 4JC5A 4CN9A 1QG0A 4E32A 5K0TA 3X1DA 5C80A 5KSZA 2YV5A 1M2OB 3H5IA 4BP9A 4E94A 2CFTA 1KR2A 2VRCA 3PQEA 2FWIA 1XG5A 5C8DA 1YBAA 1WXXA 2WC1A 3H8SA 4LSZA 5BSMA 5DTEA 5JH7A 3ZGZA 5JAUA 4UNNA 3HQ4O 4Q1VA 4BU1A 3A4MA 4XGQA 5IJ9B 1VA4A 2WICA 2NYUA 1DRVA 4FEAA 2QB5A 3EA5A 4ZKEA 3HHPA 2HSDA 3QU2A 4B47A 3CR8A 2AFHA 3IHKA 1MVOA 1FFDA 1YAJA 2H06A 4PZAA 3D8SA 1YDHA 2FETA 2OCPA 3UATA 3E8SA 3VX4A 4AY3A 2UVDA 1G4HA 4WNYA 1N2HA 5EZSA 1FP4B 4HRXA 3AZQA 1TEHA 3PBKA 2ZRHA 4MWDA 4BO2A 3TW6A 4O8ZA 4WLOA 3AY7A 1W9HA 3T1HB 2B0CA 4I1RA 1SQSA 2CL5A 4LGYA 4XB6B 2V6MA 4C2AA 3QKRA 4DLZA 4EAQA 2F4VB 3W4KA 3G2KA 4P7GA 4U0KA 4V0MA 3KLNA 3VSCA 3VZRA 6ADHA 1KWKA 1BE8A 1R0XA 1XZQA 3W7BA 1FXSA 4HFRA 3OJCA 1WCXA 4JA2A 2BGJA 1I9GA 1L4KA 2O52A 4CLRB 5IFLA 2FMKA 1A8QA 4PZZA 4DJTA 3VVMA 5BP7A 1TQ2A 3VI4B 5E4TA 4HXYA 4F12A 4QICA 2CNDA 3U6BA 2XCQA 2A7XA 2FEAA 3KR2A 1XZAA 2VHWA 1XUOA 4UQOA 5HG0A 2BFAA 4DLLA 4AY2A 4Q3BA 4C0WA 1VZ3A 3BHJA 2GBCA 4PGHA 2NV0A 3SJBA 4HCJA 1KQOA 4QPNA 1E2GA 3KBOA 3SX2A 4KKXB 3E9NA 4BGVA 4MARA 5G4KB 3IQEA 1YR1A 5DGIA 3M34A 1UJ5A 4N01A 4WRRA 3QXCA 1PZFA 2V7QD 1K7CA 3JQ9C 4NYMR 10MHA 1QYCA 1YOVB 2HCFA 2GM9A 1E3SA 2ID7A 1DS6A 3OZFA 4QBIA 4Y2SA 4LOJA 4W63A 4MGIR 1REQA 2X3YA 4Y1FA 1KQNA 4MV1A 3RM3A 2RGCA 2WF6A 1P1JA 3IMKA 3BIOA 4IDDA 5ILQA 5J5VA 3WLAA 4NEHB 3HL4A 2E2WA 4DBVO 2J5QA 3ACCA 3ZGOA 5KYUA 4O4IB 3LFTA 3MJEA 3KT6A 2WWYA 4CMEC 1JLKA 2E5WA 3GJ4A 4HNAB 1YHYA 1NXXA 3SF0A 3FSEA 3OIDA 5I7WA 4BGUA 2KSQA 2B34A 1I5RA 4LC0A 1E79A 1RE0A 1XL0A 3LQRA 2IPAB 1B8NA 1I01A 1FMJA 1W59A 2C3UA 2ZYAA 4IGEA 4QYIB 5HUJA 1EGVB 2YXPX 1X1TA 1S2LA 2FZGA 1C7ZA 2YZ7A 2PSHA 1DKNA 2G28A 3RVRA 1GU7A 3TS1A 421PA 3R5TA 2BV3A 2KWIA 3PGA1 4ND7A 3HNPA 5I9BA 2JDIA 2HMWA 3R0IA 4YJHA 3PC8A 2BLNA 4G2NA 2PMFA 4PINA 3IP3A 3PQ8A 3IPXA 2BF4A 4KITB 4QRDA 1GPLA 3T5GA 3KPVA 3N0VA 2RH5A 3PR1A 4UOEA 3ZE8A 2AMFA 2G07A 1T6NA 2I55A 2OXEA 1Y1RA 1ZL0A 1R6VA 4HWSA 4YXWA 2V97A 1ZICA 3ENKA 1O0CA 3DL0A 2J31A 4GG1A 5DKFA 4NKRA 3UMVA 2P0YA 2CNBA 6YASA 5DM60 3DC2A 3LYHA 2MYNA 1U0LA 1EQUA 1GP2A 1NBMD 4ZZ2A 4G0YA 3WS7A 3QPCA 4DIBA 4MB0A 2AOVA 5REQA 1VL2A 3QXHA 3TLBA 4P7JA 3QE4A 1QU3A 1MOZA 2A0FA 1OWLA 2PGDA 4CU2A 3HGTA 1O0SA 4E7PA 3NC4A 4RIFA 4L07A 3TTUA 3WXMA 5I7HA 1H9CA 5B1EA 4RKRA 1EAMA 1WCIB 4C0QC 4CMIA 5HQ3B 2VDRB 1TUIA 1HDZA 4MP8A 2MHCA 1TCUA 5BW6B 2GVNA 3NCHA 4NJEB 1N2CA 2P30A 1PJBA 3ZIUA 2OHFA 1G6HA 3GRFA 4I8XA 4X1YA 4D97A 5IKEA 4D3SA 1AMUA 4Z4EA 4N0EA 2NUPB 2HWXA 3RAJA 5EWLA 2AKYA 2IYPA 2PLAA 3EHDA 2Y2VA 1J21A 2V5UA 1I13A 2WYUA 3NTVA 3OM0A 4EHKA 1KWGA 3QIVA 2ZI6A 1HDRA 1JEOA 1HTWA 3E18A 4BE7B 4CT0A 3P2KA 4C6RA 1Q0UA 1QQBA 1TMKA 1PKXA 3AIKA 1EJ0A 2P3QA 3VR4A 1EGQA 5FIUA 3GOHA 1G21B 4WJLA 4OHMA 2X23A 2EOAA 3EZ7A 3OQIB 3OAAD 3NIWA 2QVCA 3HKBA 1OLUA 3AY0A 1GUDA 4J2HA 3TIVA 3ADBA 5JNWA 3EUEA 5JDCA 4N7RA 4Q6BA 4ZI3A 1WNTA 5CDUA 1XTVA 3QEAZ 1DJNA 2QN2A 1JFLA 1L5MA 2W43A 4QLBA 2P35A 5FUQA 4EBFA 4D46A 1BE0A 1ZH2A 4RIGA 1FP1D 1IDOA 1A4RA 4NS1A 1JQLB 1WCYA 2O2DA 3LUJA 3ZOKA 2ZXUA 2VNIA 1BMTA 4C89A 3RAFC 1RS0A 2DH6A 1VPWA 3BQMB 4KQMA 2C4TA 3ABIA 4I9FA 4NMXB 2WKWA 3F98A 1WXQA 1O03A 3F6EX 5LZ7A 4X1KB 3LBIA 3LSYA 1XEXA 2OV2A 3INGA 1RYEA 2NTNA 5AD1A 5BR1A 1Y81A 3DE0X 1PJLA 3PX2A 4A6PA 4NCXA 4HOYA 1FSPA 4XUEA 5AT1A 2VHXA 2OLJA 1MKYA 5LA6B 4NNPA 3PNLA 2I29A