2JASA

Structure of deoxyadenosine kinase from m.mycoides with bound datp
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
200
structure length
194
Chain Sequence
MKIAIFGTVGAGKSTISAEISKKLGYEIFKEPVEENPYFEQYYKDLKKTVFKMQIYMLTARSKQLKQAKNLENIIFDRTLLEDPIFMKVNYDLNNVDQTDYNTYIDFYNNVVLENKLSFDIVIYLRVSTKTAISRIKKRGRSEELLIGEEYWETLNKNYEEFYKQNVYDFPFFVVDAELDVKTQIELIMNKLNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Function Analysis of a Bacterial Deoxyadenosine Kinase Reveals the Basis for Substrate Specificity.
pubmed doi rcsb
source organism Mycoplasma mycoides subsp. mycoides sc
molecule tags Transferase
molecule keywords DEOXYGUANOSINE KINASE
total genus 66
structure length 194
sequence length 200
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.1.113: Deoxyguanosine kinase.
pdb deposition date 2006-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01712 dNK Deoxynucleoside kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2jasA00
2QT0A 1UBFA 2JGNA 3LBNA 4M1YA 3SHWA 4HLUA 1MRSA 3EWSA 5BW8A 4F4CA 4QHTA 2FFHA 2QP3A 4FN5A 2QENA 5M04A 4Q9JA 1IXZA 2QL6A 2VLIA 2B21A 4KO8A 1GFIA 3HJNA 3CRRA 3R9XA 2OXCA 1E2HA 2JCSA 4JYBA 5KSPA 3MWLA 3AVWA 4RCZA 3FFBA 4JT4A 4QM7A 4TT3A 3GFTA 4EQ6A 5HR5A 1ZNZA 3RSOA 3BIFA 1F60A 4I99A 4TSFD 1Z0JA 1Q1BA 3P32A 1R5BA 3MSXA 3W6NA 1UKZA 4I81A 2VO1A 2FOLA 3VR2A 4P4UA 3P20A 1JECA 3DEFA 1GRQA 2Z0MA 4NHOA 4BLTA 3ONWA 3EX7C 1J99A 5LPNA 2QAJA 4IDPA 1CEEA 2AKYA 1AZTA 4KCGA 5HTKA 2E9SA 4IEEA 1NLYA 1EX7A 4LPKA 4M0LA 4B3BA 2PH1A 1RYFA 4HYYA 3PEWA 2CHGA 1MO3A 1E2PA 2WKQA 5B2ZA 2HCJB 5KYKA 2AD5A 4NDZA 4JSTA 2FFBA 3L0SA 2VRWA 5E3HA 3OEEA 3KFXA 2J3EA 1XJQA 4OJKA 1YZGA 3E5HA 3IILA 1R6BX 1E9SA 3NBZC 5BWMA 3MCAA 3CNLA 1PLKA 4WW0A 1SZPA 3L2OB 1E2EA 2GVZC 3TVTA 3A6PC 1R5OA 4PC2A 1OSNA 4PHFA 2Q3FA 1R7RA 2WJHA 3I8XA 5L3VA 2GJ9A 3EZ6A 3LBHA 1JEEA 2IYXA 4YXWA 4MITA 4LGMA 2ZR0A 1NSTA 3LA6A 2BBOA 4NMMA 1F2UA 1NP6A 3THWB 2V4ZA 4AYXA 1F5NA 3GLFB 4TSFA 4ZV4A 2O8BB 1QHYA 2F3TA 4XOIA 5L3SA 1E9AA 2PJRA 1P60A 1DADA 1D9XA 1GL6A 2D7CA 4HSEA 3QBVA 2IC5A 4DLTA 1RRGA 4MYHA 5DIFA 1F2TB 1ZP6A 2WZQA 4S35A 2CXXA 3GLGE 5CDFA 2QAGC 4IKEA 4BZPA 5FPKA 1NSFA 1BO6A 2O0JA 1ZU4A 5AJXA 5LD2C 4GT1A 1VKJA 4Q18A 2IX3A 2GZDA 3C4JA 4Z51A 2ZYWX 4TMWA 4RZXA 3TR5A 2N1BA 2CNWD 2WPDD 5EJEA 4GRAA 1N6HA 4ZDWA 5DNYB 2V55B 4NP6A 1E9EA 1N0VC 1ZYUA 3P1JA 4IFBA 4QC2A 3TE6A 4LHWA 2WOJA 2DBYA 3PENA 3FGNA 1DG1G 3ND9A 3OIUA 3U4QA 2CLSA 4D0LB 2WJGA 3B9PA 4Z54A 2AX4A 4FD2A 4TLBA 2GCNA 4OQMA 2F1RA 3AVPA 3GEEA 3ZVRA 4Q00A 3U61B 2ZROA 5TXGA 2ZU0C 1Q44A 1H8HD 2R44A 1EFCA 3CRQA 4P31A 4UKDA 3R8CA 1U2RA 4GOJA 4N1AA 2EU8A 1UBCA 3BH0A 1YR7A 4K46A 5J5CA 2RHMA 4RD2A 1W2GA 1FL9A 2OCBA 4M1OA 5IHPA 4MDEA 3KUDA 2BJVA 3QG1A 3HPQA 4M9ZA 3U60B 1PLLA 2QM7A 3VHXA 1TNDA 1E1QA 4MRPA 5DHAA 3L0IB 2PX3A 1VIYA 4AKIA 2FV8A 1ZM9A 3G82C 4I1VA 1PVOA 2YKGA 2FDCA 3KQNA 1GAJA 3QKTA 3VR1A 3DOEA 4QHSA 1XCPA 2FN4A 2GKSA 4HUQA 1U0HC 4B43A 1TUEA 1SXJC 2N42A 4L8GA 5DN6A 1Z6TA 2O8CA 4Q1BA 3CF2A 2PEYA 2E1RA 1GOTA 3V4FA 3UK6A 2ERYA 3E1SA 3NHAA 4W7SA 3RWMB 3GJ0A 3AF1A 4A82A 1J7KA 621PA 4RSGA 4LJAA 5AR1A 2GXQA 1P62B 2DCUA 4D2IA 5HE9A 3SYLA 2UZIR 4V0NA 3W5IA 2GZHA 3VQTA 3RRYA 2VSOA 5C4GB 4JL8A 3ADCA 2VP9A 1W5SA 2XTNA 2FE4A 2RGCA 5CJ2A 2FNAA 4TQ9A 2DPXA 1SVIA 2JLYA 2J0UA 4JBXA 1E0KA 3W3ZB 1T8TA 3UMRA 1KK2A 3RRNA 4LOAA 3FMFA 3IQWA 1QVAA 2OV2A 2KBEA 2W0MA 1OIXA 4LRWA 3CLVA 3U3KA 4CYMA 5A5GA 3WHLA 5JECA 4TYNA 3U44A 1QDEA 4LPSA 3KTAA 5IK2A 1E9DA 4JJKA 4RKFA 3LO5A 2YJTD 2XITA 4NCNA 4A6PA 3NIBA 4NCJA 4LBVA 1FQJA 2F1HA 1Z6GA 1NVVR 1KI2A 4DDUA 3A4NA 2VHUA 2TMKA 2IS1A 4TLCA 2WWHA 3RS2A 4W5WA 3TSZA 1E9FA 3OIYA 2IYQA 1CR0A 3B2EA 3BFVA 2PMKA 5GJVC 5SZHB 1KOFA 4LSGA 3TQCA 4M9QA 3H86A 4QBIA 1XX6A 2ANBA 4ASUD 1F3OA 1H65A 4YMVA 2FZLA 3SJCA 1KDTA 2J1LA 2VF7A 4OHWA 3Q9LA 2R6GA 3GJ5A 2DY1A 4A0FA 2XZLA 1DAKA 4W9MC 2WV9A 1F6BA 2DB3A 4X8MA 2XEXA 2V54A 3EC2A 2KE5A 4MRRA 2ZE5A 5EXTA 3V9PA 1OH8A 4KU4A 2WAXA 2ANCA 4TYQA 1TF7A 4R2HA 1ZNWA 3T34A 1WA5A 2H57A 3ADDA 2CLCX 1GNRA 1Y3AA 2P65A 3DZDA 2RKOA 5FUWA 2ZRDA 3SBEA 1JPJA 4FINA 4ACAA 1LF0A 3EZFA 4CEIA 3DO6A 2FJUA 2PT5A 1KO1A 1YVDA 2YOGA 3IEUA 4ON9A 4R98A 2GVDC 5EZ6B 3VHLB 4JLNA 1COWA 2FA9A 1XPUA 3KXIA 5FTMA 1YKSA 3I72A 2JJ8A 5J40A 2C78A 1ZD9A 1P2VA 5LD2B 2C8VA 3LLMA 1ESNA 3GCGA 5GJWC 2O8BA 5G3YA 3T1OA 1EFHA 121PA 1SHKA 2J0QA 4HAVA 4EPYA 5C2JB 4V0MA 4Q1AA 2W00A 2B7BA 1HT2E 1US8B 3A1UA 2RGAA 3CO5A 5CIQA 4YLGA 3GJ8A 1XB2A 2YWEA 2BCJQ 3FTQA 1Z0IA 4LYHA 5H1YA 4PQFA 1AS3A 1MKYA 3ZJYA 4D26A 1E2MA 1HH4A 1UM8A 1XMSA 4D4MA 3CKLA 1E6CA 3V4RA 3KTAB 3OHMA 4TYYA 4QNMA 1KDOA 4MYTA 1NVVQ 4XWAA 1E1QD 1PV4A 1US8A 3R20A 2ZJAA 4WBSA 2X2FA 4B6EA 1OFUX 4QKQA 2KJQA 3AVUA 1JEDA 2ZXUA 4KLZA 3LV8A 1II8A 4MQBA 4KI0A 2IYTA 1YZUA 4PFSA 4KJZA 4TZ6A 2OBMA 1OKKD 4JLOA 1RRFA 2VSXA 4H9GA 1SULA 4MKIA 4PZLA 4ZCIA 4A8JB 2HYIC 2ZSBA 5TMPA 5E7IA 3U6KA 4CF7A 4D4JA 2CK3A 4ESVA 2ORWA 1CKEA 3CNNA 2WIAA 4IDOA 2GNOA 2JLQA 1LNZA 5EP1A 1WBDA 1CBUA 1II8B 1TF5A 2P5SA 1OH5A 4PC3A 2AFHE 4BEJA 1J8YF 1RPZA 1EESA 4D82A 3K9LA 2XXAB 1OHHD 4NBSA 4LI0A 4TQUS 1XFAA 5EUQB 4RD6A 1KSGA 2A5GA 2QA5A 3X1YA 3SFZA 1M1YE 3SU8A 3P4YA 3BGWA 5JI3E 4IOJA 3AF3A 2BHRA 1KI4A 3IIJA 1X1RA 3KKQA 1N6KA 3M4YA 1UDWA 1EWQA 5DI3B 2W6JD 3BERA 3ASZA 5AK0A 1N6RA 5L3SB 2JAQA 1F2UB 3THWA 1XTKA 2ZJYA 3FHOA 2ZRAA 3QXCA 4MGKR 1G19A 2G77B 1EXMA 3GLIB 1DVRA 4TMTA 3FKQA 1J70A 2FSIA 5L3RA 3R8FA 4PQRA 1LS1A 1ZUIA 4PZYA 5JWRA 2EVWX 1EFRD 3I4LA 4IFEA 4D6PA 3I5XA 1T9HA 2CMKA 2DWOA 4JBYA 4DBLC 1W36D 4B2PA 3ZS9A 1XXHE 4ITRC 2VHJA 3AH8A 1BYUA 3TJZA 3CRMA 3ZVLA 1XF9A 4BFZA 2W6IA 5KO2A 1KAOA 1JAIA 2QRZA 3TBKA 3WMFA 1DO0A 2F9MA 4HAUA 1NKTA 3LBIA 4DT1A 1W4BA 4QGHA 4DLVA 3CH5A 4LHVA 1CJUC 2QTFA 4D0GA 1W7AA 2BMJA 2JLUA 4B44A 1P9NA 2ZR7A 3I1FA 4GFDA 4JLVA 2CJWB 4P0TA 1TPZA 2EYQA 3R7WB 2QTVB 1N25A 2OCYC 4JJZA 3K0FA 3GLGB 3GJ3A 2NPFA 2H18A 2PJZA 5FTJA 1M7HA 2WAYA 1IQPA 2WJIA 2F43A 4Z8YA 2QMOA 2HUPA 2NZ8A 3TGPA 1XMJA 1XTSA 2Q3MA 2REXB 2WJJA 3K70B 5C1BA 1R8SA 4Q7LA 2AR7A 2GXUA 2BMFA 3BD9A 4NPHA 3KZ1E 3LLUA 1Q0UA 3KB2A 4HLDA 4YMUA 3GLGA 2FSGA 4PR0A 3QKRA 5FPYA 2WOOA 4LV6A 2I1QA 2Q9AA 4LY6A 4O25A 5IDVA 3CUEF 5KPJA 1Z0DA 1XNJA 4KHZA 3OAAA 4RD0A 2A2ZA 1GUAA 5FL3A 2XNDD 1K8RA 4JIMA 3T5GA 4M1TA 4TL6A 1AQYA 2QBYB 4RFSB 2XGJA 3AVVA 3FDIA 5JRJA 1IBRA 3TKLA 4LBYA 4WXPA 2H7VA 1FP6A 3LNCA 5JMTA 2XX3A 1FMJA 2WPDA 1E1RD 5L3QB 2V8OA 3GQBA 2QBYA 2C2HA 3BBPA 4L15A 4C0BA 4URYR 4GBMA 4MYCA 4QFMA 2OZEA 3AEZA 3CX6A 2RGEA 2WWIA 3H4MA 1AZSC 1TL7C 1DG3A 4PPFA 4C7OB 2H1LA 4UNNA 2PL3A 2ZJOA 1CTQA 4B32A 3KKPA 5FPSA 2HF9A 2YWHA 1GRRA 5J4YA 3MJRA 2QMUA 3QJYA 4AK9A 5EZ5A 5DN6D 2IHBA 3RABA 3ZDQA 3RS3A 5FOWA 1QHNA 4CVNA 1U9IC 4BFVA 1ZNXA 4K81B 2CVFA 1T3HA 2CJWA 2VPPA 3AF0A 1VYVA 3BB4A 2D2FA 2YV5A 4U7DA 4PO1A 5JSZB 1Z3IX 2GDJA 3CX8A 2IYWA 1DBSA 1R0WA 3WRXC 4QNRA 3EASA 2IA5A 2GHIA 1SVOA 1BH2A 2G1JA 4JVNA 1GNPA 2H5EA 3D7MA 2ZQ5A 1B0UA 5HZHA 3BWDD 3EARA 4KBGA 2WBLC 5FL7A 3KFVA 1ETUA 1VYUA 1FPMA 4FW9A 4N3NA 1G6HA 4MKFA 3QKRB 3WY9A 4XWOA 5LB4A 4RD1A 5HE8A 1ZRHA 3LW8A 1DAIA 2ZRLA 4KVAA 1XP8A 4X8OA 2YHSA 5JRZA 2SHKA 1YRBA 3KQHA 4DSNA 4BFWA 1W4CA 2OBNA 2IF2A 4LJ6A 3WYAA 5KHOC 3A4MA 3VNUA 4BPBA 2BM1A 2DYKA 1KGDA 3ICEA 3GLIE 3HWSA 2ZRMA 3B9QA 4C9BA 4ZIRA 4EFLA 3Q7PA 3JZMA 2OG2A 4WZ6A 3KKNA 3SOPA 1O87A 1K5GA 2EWVA 4OK6A 2ZJ8A 2ZRIA 4URZR 1VG0B 2B8WA 2W6ID 3KXLA 5FBQB 4DEYA 2F7SA 3CWZA 5FPHA 2ZREA 2WSSA 3CPJB 4AI6A 2ZRGA 5F3WB 2VHCA 4A9AA 4I4LA 4IVQA 2XSZD 1EX6A 3LDAA 1HE1C 1MR3F 1LF5A 1QF9A 3ZQJA 3TSOA 5HPYB 1II0A 1DEKA 2X1VA 2CCGA 2XTMA 2HT1A 2GJKA 2GAAA 2O5VA 5KSZA 3U7HB 2NMVA 1TAGA 1YR8A 1JB1A 1R2QA 4JLMA 3KQUA 1DPFA 1A2KC 2CBZA 2QY9A 1CR1A 3N2EA 3TSWA 2IXFA 2GK7A 3GJ6A 2D62A 4YMTA 4A0RA 1T8UA 1CRPA 3TAHA 1HE8B 2VF8A 1E9CA 4UNPA 4C0QC 3QXHA 2PBRA 3ZS8A 2BOVA 1GVNB 2ZVQX 1CJMA 3LRPA 4DWJA 3JVVA 4I1SA 3RS4A 1IJFA 1ZU5A 1XZPA 2CCJA 3QI2A 3SDZA 1KNQA 3W8NA 3GPLA 4DLYA 4QJ4A 5HZKA 2VSFA 3FE2A 1LW7A 1V5WA 1T0JB 1QG2A 1NG1A 3W3AA 1T5LA 5FOUA 1TEVA 1L4UA 3AVQA 1XMVA 2GETA 5C46F 2ZS9A 1X3SA 4TTQA 1CP2A 3IO5A 2PZEA 4EPXA 2KB0A 1KMHA 2XSZA 4LK2A 2HXSA 3N70A 2GK6A 2R2AA 2NIPA 4JZKA 3HYTA 3BS4A 5TDHA 5JJKA 4OQNA 2AWOA 5B30A 3AVOA 3L0PA 4FCWA 1GTVA 2XXAA 5DO9A 4OQXA 1DAHA 3K0SA 1PZNA 3EA5A 4LX0A 1JJ7A 3U2QA 2QAGA 4POAA 1W4RA 3GEIA 5KTYA 1GNQA 4AG5A 4JL5A 2D74A 1VG8A 4N0DA 1IONA 5C4MA 2MMGA 5EP2A 1OFIA 3PEVA 3SZRA 4DLSA 4GL2A 5JJLA 3UWOA 1M34E 3MAAC 5KDDA 1S96A 2AXNA 1IXSB 5CYOA 5G53C 3OFND 3ETLA 1NKSA 3T15A 2IEYA 3ZGXA 4XWKA 3K8YA 1G3MA 1W49A 2NO7A 3AKDA 3PG5A 1N0WA 5HKKD 3ASYA 1A7JA 5EE1A 4HLQB 4C0KA 2PEZA 2J59A 2NO0A 4EFMA 2UVQA 4V0KA 4JLJA 3HP1A 1E99A 3QVUA 2A5YB 3PUZA 3GLFA 4D80A 1JR3E 1RVDA 1E3MA 4AKEA 5JHHB 2ZI7A 3C15C 1T91A 1W44A 2BMDA 2ZETA 1TQ6A 2EFDB 5DE3A 3W6OA 3AUXA 3U44B 5G40A 2ODWA 2HLDA 4I1OA 1W0KD 4NKRA 3FMOB 4ZDIA 3MG9A 1F48A 2ZI5A 4XD7D 3QPWA 1U90A 4IW3B 4A92A 3MUFA 4W5HA 2QU8A 1CJTC 5FUYA 3REFA 4BASA 5JI2E 3EA0A 3G0HA 1YZLA 2F43B 2J45A 1XEWY 3BB3A 1IN4A 1D9ZA 3K9NA 4NTZA 3WP0A 1C4OA 3IBYA 2AKAB 1Z8FA 1DELA 3QE0A 2OT3B 2CEAA 3K9HA 4PZZA 1D2MA 2GCPA 3IEVA 5DISB 4DHEA 4NCIA 4CZ2A 4DLWA 2YINC 4TYPA 3K53A 3GP8A 2EWWA 4TMXA 3PUWA 4JS0A 3IPXA 221PA 5FOTA 3DVLA 3EIHA 3QSYA 2C5LA 3BK7A 1ZUNB 5A0FA 4IOLA 1OYYA 2IUTA 1XD2B 1ZC4A 5EXPA 1Z2AA 5J47A 1I4TD 4QJ5A 1N6NA 3NC1C 5K8LA 3ZD6A 2IW3A 2CHVA 4BLRA 1OYWA 1HEIA 4P4SB 4E07A 3EWAA 5BN4A 2WSSD 3AP1A 2O8EA 4G5GA 2LWIA 3CH4B 5AUQA 3SQWA 1ZIOA 4DB2A 2R65A 1SKYE 4GMDA 4Q21A 5L3QA 3FKSA 3A1WA 1NBMA 4LWZA 4HUQB 1E98A 2W2TA 3FHCB 3IO3A 5EP3A 1WMSA 3SJZA 4DLZA 1JR3D 3RDPA 3TRFA 2R6FA 4P4SA 3QXJA 1C1YA 1OIVA 1Q20A 2OE2A 1K5DA 4OKSA 1W2HA 4RZ2A 4UNQA 1MV5A 1DS6A 3GLHE 4MRNA 3B7GA 4ZDJA 721PA 4QL3A 5JS8A 3K1JA 4B3CA 1NN0A 1S3GA 1N5KA 2I3BA 1SVKA 3QPVA 1AN0A 4F38A 3KDSE 4G1UC 4US1R 3QNUA 5EXXA 2RHDA 3RAPR 2XB4A 3QKUA 2ATVA 5BYKA 4MRSA 5JBQA 3O8RA 5LB2A 2LCFA 4Q1CA 3GD7A 2VP2A 3DOFA 2EFEB 2UZ3A 3RVBA 5BN5A 3C14C 1BS1A 3OZXA 2KBFA 1DTSA 1OE0A 1AIPA 2BVNA 3QF4A 3BXZA 4RZ3A 4B33A 2JATA 2HXYA 3AVXA 4BUJA 2ZANA 4ZKEA 5JSZA 1OXUA 4O0MA 4CRWB 3X2SA 1P9RA 2QP9X 2ZAMA 4A2PA 4ZDKA 1G20E 3PUXA 3EPKA 4CEJB 1FOEB 3HYRA 3ZYCA 1G8YA 5JZVA 4RVCA 1XCMA 3LW7A 4A15A 4Q03A 4Z1MD 2ZE6A 5CB6A 4AY2A 2CCKA 2VBCA 4AC9A 1Q22A 3IHWA 4B75A 1VMAA 2B6HA 1Z83A 1G3RA 1HV8A 4TTRA 4E5UA 4UNRA 3GFOA 3RS7A 2IBMA 1FFHA 2VP6A 1H8ED 5ANRB 4D81A 2PT7A 4QXAA 1LB1B 4XH9B 1R0ZA 2QEQA 1NG9A 2A30A 3FFAA 1E2DA 1P5ZB 1NY5A 4FMCB 4M1KA 4TZ0A 3EXAA 1YR6A 1E2IA 1GITA 1PJRA 3ZZ0A 4LHZA 4P32A 1P2SA 3E2IA 4C4PA 1UEJA 4FCVA 1XJCA 4EPTA 1LY1A 5DI3A 3PQCA 3A1TA 1ZM3A 1DOAA 2FGKA 3A8TA 2A7QA 3IIMA 2CLDX 1KJYA 2AL7A 1N3BA 2ZS8A 3AKEA 1FZQA 4XVRA 3GLIA 4H1VA 1FP7A 2C9OA 4QGGA 3SE0A 1YZQA 1ZCAA 1MH1A 2DWQA 2IXEA 4JLDA 2YOFA 4B2IA 4DCVA 1I4DD 4OBEA 4CT4B 1B23P 5FOVA 4NE2A 2WICA 1IM2A 1ESMA 2V7QA 4LYJA 4DXAA 4P4TA 2OLJA 3KX2A 2CVHA 1IN5A 2GCOA 3PUYA 2QGNA 4CEIB 1KK0A 4IXMA 2O0HA 1E9BA 2W83A 2KI5A 3VX4A 4B3GA 3QEJA 4G5QA 4DCNA 5IT5A 2J41A 3EG5A 4HAYA 1N6IA 4DC9A 4TYWA 2JLZA 1TU4A 1KJWA 3QUSA 4OYHA 1A5TA 2VYFA 4UXHA 2XB2A 1YZNA 3PIRA 1L7VC 4NZYA 4LBWA 5AUOB 4LYAA 4PO8A 5DHFA 3MFYA 3C5HA 3QENA 4E09A 4ERNA 3R7WA 3TQFA 4URWR 1AS2A 3A36A 3TUJC 2O8DB 2GCOB 2QGZA 4YDSA 2H8KA 4S2EA 4HEJA 3QY0A 4DCUA 4IDNA 4JBWA 5GADl 1BOFA 3CIOA 3I92A 1FQKA 1QHGA 1T5IA 1UBEA 3DPUA 1TTTA 5TVKA 4K8OA 3SJBA 5KU1A 4NL4H 2JLRA 3ZIAD 1KYIA 5DGXA 3T06B 1UKEA 2WVJA 3LVRE 2EFGA 1KZ7B 1AGRA 5AJZA 1HA3A 4JLBA 4UNSA 2JLVA 5FUXA 5A4JA 1OPXA 5EE0A 4A2QA 3WXMA 1QHHB 4MA4A 2IEZA 4JKIA 1KO7A 4BWYA 1E94E 2F6RA 3HR8A 1KNXA 3OIWA 3HPRA 3SS8A 4TL7A 2QTHA 3L8YA 2HJGA 4LC0A 1L4YA 3QBTA 3RS5A 1L8QA 1SVMA 1G8FA 4I1UA 3EZ2A 3AVYA 5CJPA 1P61B 2XOKD 1OFHA 1ZMXA 3MLEA 3AM1A 3FKSD 4LV5B 4OQLA 4M8NE 3U3MA 2Q9CA 4DUGD 2QAGB 1QHHA 1II9A 2FX3A 3CF6R 3NEJA 4NYIQ 3QXSA 3RRZA 3B78A 2NPIA 4BLSA 5CM8B 2ZUBA 4EFNA 5CB8A 2DFTA 3W6PA 3VKWA 1P2UA 4LJ8A 1ANKA 2JDID 1JALA 3GJ7A 5BYJA 5JHGB 2D7DA 4JSYA 2IL1A 2O8CB 2BEKA 1CF4A 4LBZA 4C7OA 2Q6TA 3S1AB 3U3OA 3K0CA 3P27A 4O3MA 1H8HA 4TT3D 3I62A 4EPWA 1E32A 1XTRA 5L8VA 4JVLA 4L5BA 5AWFC 5KDLA 3QXXA 2HT6A 3FMPB 4B6FA 4AURA 4GZMA 4U02A 2MSEB 1P4SA 1A1VA 5FTKA 3B5JA 3VR5A 1TUIA 1KI1A 2BWJA 2ZYUX 2RAPA 2ZUDA 1U0JA 1NIPA 2QPTA 2XJ4A 3D3QA 4Q01A 4Y0VA 1XD9A 3QPUA 4BGDA 2IS6A 2H17A 2ZRCA 4KLNA 5UKDA 2PX0A 4WOPA 1XTIA 3TLXA 5FBWB 3L82B 2ZRPA 5E7MA 4HAZA 2ZJ2A 3F8TA 4Q4JA 3C41J 2VTKA 3LX5A 3VKGA 3SYKA 1MABA 4ASUA 4PPNA 1J2JA 4JVMA 4AG6A 4OK5A 1NVXQ 1MT0A 4AD8A 1W46A 2EFCB 1ZJ6A 3BFKA 1YJ5A 3FYHA 2CNWA 3ZH9B 3LXXA 2K5UA 4C2TA 2G6BA 2FEMA 3H1TA 4Q4JB 3RYTC 1JXOA 1HY3A 2IT1A 3UG7A 1NLZA 5TARA 1WDTA 2D3WA 2AK2A 4OI1A 1XXHA 5KPDA 2IHYA 1UJ2A 1U94A 2RGBA 1DO2A 4HB4A 3B82A 5FTLA 3RANA 4NCKA 2JIZD 2ZRHA 3PV0A 5JS7A 1N5IA 5DYIA 1KI3A 1C9KA 1SGWA 4ZIRB 1R0YA 4U00A 1E0AA 2WIBA 1G21E 2XZPA 2YNMA 1AKYA 4B74A 1VCNA 4DLRA 2ZSEA 1KSFX 1E9RA 5C18A 3U7FB 5FL7D 4PSVA 3CF0A 5BXQC 5DYGA 1YHNA 3THYB 3I61A 1EWRA 3K0EA 5TY0A 1OFTA 1Z07A 2VIIA 1ZIPA 5G41A 2D2EA 2RCNA 2MSDB 3T1TA 3VNVA 1E79A 2QQ0A 3C16C 1OHHA 1UPTA 3SJAA 4CGZA 2Z83A 4JT2A 3LD9A 4YC7A 3MWJA 1SHZA 4GOXA 2P3SA 1KIMA 1ZD8A 5KOYA 2IXGA 2JLSA 5F2EA 1Z29A 5BQ5A 1Q1QA 3CR8A 3UANA 1NY6A 1SVSA 3M0EA 2Q3HA 3EAQA 1KAGA 4M2LA 1GIAA 2V7QD 3JVUA 6Q21A 1BMFA 2QN6A 1R8QA 4FMDF 2FH5B 3PEUA 2NQ2C 4B48A 3SHFA 1KI8A 3FPAA 5EQTA 4DSOA 5D3MA 4Q7KA 3U3RA 3VAAA 2I4IA 1X8LA 2NGRA 1OT3A 3WMGA 4B47A 3GLFE 3B60A 1NF3A 4PANA 2BV3A 521PA 5DLQC 1KMQA 3IBGA 4CEJA 1KSHA 1YZTA 2ZTSA 3K9GA 2O0KA 4DVGA 2C03A 3B6EA 4OHVA 1ODFA 4B3FX 3HR7A 3WBJA 1GM5A 5D3MB 4KODA 3QEOA 5KUTA 4IDQA 2GEUA 4MUBA 4Q4HA 1XXHB 4PXAA 3NWJA 3KJIA 4C0JA 3IGFA 1VIAA 4G3XA 4QOSA 3EC1A 3SN6A 4M1MA 3AP2A 2L0XA 5DSZA 1KTVA 4Q1FA 2O8FB 1CLUA 1G8GA 2CDNA 1WRBA 4EJSB 3A37A 3BB1A 3D8BA 4A1FA 3MRSA 2OFXA 1ZM7A 4PAOA 5EE3A 1SXJB 5E7JA 1IY1A 4PHTA 1ZC3A 2WWFA 1KO5A 3HU3A 1MOZA 1HYQA 1HTWA 2X8AA 4DDVA 5E95A 4CT5A 4DKXA 4BZQA 4GSYA 4YMWA 1E69A 2OBLA 1TQDA 1QZXA 4B71A 3MWKA 4D25A 1OB5A 3W34A 1G7TA 5FI0B 1NN5A 4Q9KA 3WNBA 2IUSA 1RC8A 4RCYA 2FMXA 3TW8B 1E2GA 3FHTA 1UDXA 1FX0B 3F5FA 2NO6A 4Q4LA 2B8TA 1IJEA 2BM0A 5FH9A 2RGDA 4DIEA 1KI6A 4PHHA 4E22A 1RFLA 4MH0R 2QROA 4B34A 4Y0AA 3K0CC 3F0TA 4QRHA 4OI0A 2IYVA 1X1SA 3SEAA 1RRPA 1VTKA 2JEOA 1P6XA 2QE7A 2X2EA 3CM0A 3EPHA 2OCPA 2WHXA 2F3RA 4YQFA 2F1JA 3AF2A 2YZ2A 3KKOA 2C04A 4FMCF 4HZIA 2R8RA 2O8DA 1AK2A 2B7CA 3CZQA 4MGIR 3EZ9A 2FWRA 1FNMA 4HB0A 4A36A 3RSLA 2F1IA 4Q4AB 2IUUA 1KY3A 1EGAA 2MSCB 1U8AA 4Z8XA 5K8IA 2QMEA 1YQTA 1QVRA 1DE0A 1W5TA 1TEXA 4YDHB 2Z43A 2A5FA 3K0FB 1YU9A 1Z22A 2ORIA 3A58B 2P67A 2QUZA 2ZRNA 4NONA 4DJTA 2J7PD 5HCNA 1MABB 2REBA 3KKMA 4NYMR 3MMPA 1NVWQ 3DKVA 3R9IA 2QSYA 2QT1A 2VEDA 3T12A 1A4RA 1OV4A 1M2OB 2RGGA 2OEPA 5JEDA 4Q4HB 2VH5R 4QGAA 4Q1EA 1XTJA 3FMIA 3TVDA 2R6CA 5FI1B 4X8LA 2GXSA 5KNBA 4LYFA 2ZAOA 2HEIA 5B58C 1GRNA 4RD3A 2C95A 4BZXA 2IS4A 3R9WA 2QPOA 3TH5A 4RFSA 1W47A 3Q8XB 4HAWA 4C0SA 3U6BA 4UJ3A 4LUCA 4KV9A 1T3LA 1VHTA 2I1VB 5SZIA 4F4JA 3S1AA 1VECA 4DDWA 3ZVMA 4G01B 3RWOA 4YXWD 4KVGA 3I5YA 1CIPA 4PC7A 2XAUA 3REGA 1KDRA 3DMNA 3NVAA 3RC8A 1G9XA 1LS6A 5KDOA 1S9DA 2BC9A 1X8JA 4QBHA 1XEWX 4EDHA 1E2LA 3KJGA 4M22A 1HQYE 1ONBA 4LJ4A 1KI6B 3OEED 3LFUA 1XPOA 2AD1A 3PITA 5AUPB 2QE7D 1CXZA 4FMDB 1GKIA 4BFUA 1QG4A 1G18A 3UWKA 2XNDA 1GP2A 1OH6A 2OAP1 4M4SA 3OIVA 3QF4B 4LDJA 4P33A 5CM9C 2ODNA 3WRYC 3NBYC 3AKCA 1W0JA 3SFVA 4LJ9A 2YVUA 5DI9A 2ZI9A 4Q4AA 3KXKA 5JFGA 2YWGA 1YR9A 2AWNA 2IYZA 1PUIA 2RB4A 2OAQ1 4US2R 1Z5ZA 4BLQA 1JPNA 2A78A 2RGNC 2PLRA 3OFNA 2ODBA 3HU1A 1BKDR 3A4LA 1P2TA 1IAQA 1Q21A 1D5CA 1Z08A 3NEYA 3Q85A 1V43A 2FFAA 3VTKA 4PC6A 3W8RA 2DHRA 4O2RA 4TLDA 1NN1A 1S1MA 2W0SA 4TLAA 3Q72A 3X1XA 1ZBDA 3D6TB 5HCIA 2QMHA 4IHQA 4GP6A 2P6NA 1XCGB 4NU0A 1EFTA 3B1ZA 3LXRA 4RD4A 1IN8A 2VA8A 1A82A 3NH6A 3H2YA 5KNDA 4RFVA 3WNDA 2FEOA 1E0SA 5EE5B 1KHTA 2V1XA 4CEHA 5F98A 4NYJQ 1OH7A 2E87A 4G5SA 1ELOA 4NYJR 1JBKA 3U4QB 1XD2A 1BMFD 3GMTA 2XOKA 1KO8A 5D3QA 1LVGA 2NZJA 3KJEA 4DRZA 2OFWA 1KKMA 4NCHA 3SR0A 1FMLA 4CDGA 1SXJA 2O8EB 1N5LA 1VPLA 5TB5A 3RRMA 1AQUA 2NG1A 4F92B 1WP9A 3KB1A 4HB3A 1Q12A 1OLOA 1XDBA 2ZS7A 2ZI6A 4TTPA 1NBMD 2GRJA 4UQOA 4A2WA 3SYNA 3E70C 1JR6A 1HURA 4V03A 3EIQA 1G3IA 2N46A 1G6OA 3WBKA 4R7ZA 3HDTA 3X1ZA 3AVTA 3LY5A 2J9RA 1E96A 1MO6A 4BRUA 4Q9IA 3PJRA 3IPYA 3FOZA 4MKHA 3B1XA 2G88A 3K0AB 2GJ8A 4LJ5A 2JLXA 4KSCA 2DWPA 4FMBB 4XSHA 1W36C 4L9SA 1VCIA 2V6JA 3AGPA 3UG6A 2BBTA 1Z06A 4OK3A 1COWD 3AB3A 4QBFA 4DUGA 1S8FA 1XJ0A 1RKBA 1U0LA 5FOSA 5TV2A 1EG7A 1JQLB 2GJSA 4JLAA 2G0TA 4X8HA 3RLFA 2QORA 4QGFA 4FWTA 4R9UC 3B85A 1XZQA 3QKSB 3TMKA 4EPVA 3IKJA 1Q57A 3K0AA 3LAWA 4PSKA 4Q7MB 2FFQA 2ZSDA 2CL0X 4C0AC 4HLCA 1W0KA 5EE9A 5BN3A 1MO4A 4Q9LA 5F9HA 2IYYA 1G3UA 2G83A 5H70A 3ICQB 2HYDA 4CIDA 2Q21A 2GF0A 3PCRB 5B57C 4Q66C 2J0UB 1J8MF 2GEVA 5J4HA 2ZRJA 4JVSB 4EJSA 1OW3B 2AHOA 5H68A 2RGNA 1GILA 3UKDA 1W48A 1CJVC 1SKYB 1XU4A 2JJ1A 3QG5A 3GJXC 3NHBA 1J90A 5KSOA 1LFDB 1BIFA 2ZEJA 3C5CA 4GOKA 2ZRFA 1QHIA 4J0QA 5SZJA 2VQSA 3GJ4A 5K8UA 1Z6YA 4II7A 2EFHB 1T3SA 4FXPA 3CRVA 5JJIA 5JCZA 3JZAA 4EAQA 4Q7JB 3T61A 4AKGA 4HATA 2GWHA 3M6AA 1KKLA 2JASA 1FNNA 4JL6A 5FBLB 1AM4D 1X6VA 2OO7A 2WWGA 1W1WA 5CLLA 2C98A 3IIKA 4Z1MA 4B73A 3UXMA 1QBKC 2ATXA 5FBRB 1U8ZA 3W9YA 2RMKA 3X1WA 4LZZA 2G0NA 2DFLA 1NMYA 1RJ9B 5EUMA 4AIIA 1K6MA 2JLWA 1S2MA 1VCOA 4XIGS 821PA 3B8HA 3RHFA 1E4YA 1ZINA 3OEHA 1CU1A 4EPRA 4A4DA 3NKVA 2Q0HA 4G0NA 3WYGA 2P6RA 1OXXK 2QZ4A 4FCTA 3ZLJA 1E2JA 3BE4A 1X86B 1SKQA 1ZUHA 4Q19A 4LJ7A 3F3YA 1RJ9A 4OI4A 4N0EA 4HZUB 1N0UA 3UIEA 1AS0A 2YWFA 1AA9A 1ZVQA 1D2EA 4O2LA 4XVQA 4JLKA 1GZSA 2UKDA 4V0OA 3KUCA 4FI3C 4G5OA 3PEYA 5CITA 2CL7X 2BCGY 4IOKA 1NN3A 4ZKDA 3BRWD 2P2LA 3TR0A 4QBGB 2JA1A 4UXJA 1FW6A 2AFIE 1AGPA 2AK3A 4LCBA 4QG7A 4RY2A 3CX7A 3LQQA 3PR1A 4GZLA 4MRVA 3UMSA 4GNKA 5J4KA 2FPKA 3TUZC 1M7GA 2XNSA 2YOHA 4HZUA 2B92A 2IS2A 1XD8A 4AYTA 3IUYA 4URUR 1N6LA 1CJKC 2D06A 2PMDA 3U5ZB 1OJLA 1NBME 1T4GA 3L8ZA 1SQ5A 2IYRA 1OB2A 1IHUA 3OF5A 3ZQ6A 5K8TA 3ND8A 1G291 1E2KA 5GJCA 4PSAA 2IYUA 4WZAE 2W2VA 4MYUA 4PHGA 1QRAA 3RS0A 3LX8A 4EUNA 3THYA 1KI7A 4GDFA 1CULC 4OJQA 3CNOA 1W0JD 3CBQA 1TMKA 3FVQA 4DEXA 3J81k 3ZIAA 4GPTA 3VR3A 3CPEA 4L16A 4RZUA 5JLJA 1KJZA 2VL7A 1R4AA 2ZITA 4DCTA 3SQXA 4M9SA 3U3JA 1NVUQ 4TWZA 4QM6A 1GKUB 3BJIC 3M1IA 2ORVA 2ZSAA 4XVUA 2A5JA 2JIZA 1LV7A 1WBBA 2QM8A 4M21A 4EKDA 2A9KA 2PLFA 3VKHA 1XPRA 1GDDA 4JLPA 4UXIA 4NH0A 2ONJA 2F9LA 2QP4A 2ZR9A 3T35A 4FIDA 3KJHA 1A2BA 2WM9B 3BH7A 4BFYA 1MRNA 1EFUA 1N6OA 1TU3A 1G1MA 3LH5A 4DSUA 4BLPA 1OF1A 3ZZTA 2X77A 3T1QA 5GVSA 4URXR 1NIJA 2ZRKA 2G3YA 1BYIA 3NTUA 2V6IA 3AQ4A 4XJXA 1N2CE 1CR4A 2P5TB 1XRJA 3DM9B 2NO1A 1DARA 2WJYA 3KQLA 1P73A 4B3DA 1G17A 4UJ5A 4C0HA 4HUTA 4KITB 3I3SR 3QOFA 3MWYW 2C99A 5JWOA 1UKYA 3K09A 3CPHA 3TW4A 5EP4A 3FB4A 4IVPA 4KBFA 1JR3A 4WZBE 3VR4A 2OHFA 3BC1A 4A0GA 1CRQA 4ZCLA 3UPUA 2WMOB 4JKYA 4PX9A 1G8PA 2H16A 2ZJBA 1G7RA 1ZM4A 1OXSC 1WQ1R 2RGXA 3QKSA 4ILEA 4Q48A 2NOAA 4TMZA 2GILA 4TL8A 3TIFA 2EW1A 4QJ3A 3BORA 1VYTA 4DB4A 4US0R 1F2TA 1OXTA 4P3YA 5AUNB 2WTUA 4Q5IA 4CEHB 3NBFA 3UMFA 1SXJE 2C9YA 1RW4A 2QPAA 5FTNA 3RC3A 2HV8A 1TQ4A 3ZD7A 4JYCA 2H92A 2JDIA 4IVRA 2QQEA 1D2NA 3AUYA 2BIFA 3I73A 4GI7A 5J4VA 1VG9B 4URVR 5KSYA 2ERXA 1XMIA 1KSJA 3B1WA 1G5TA 1ZM2A 1NNEA 2J46A 1UF9A 2C96A 4LV8B 2FSFA 1EFRA 1M8PA 3WHKA 3AV0B 1GL7A 3VX3A 1M7BA 4PQYA 1OIWA 3ADBA 4DLUA 4KAXA 1IY2A 4HAXA 5EXSA 1S4QA 1R10A 1G5PA 1RYHA 3ZVNA 5AJYA 2WKRA 2XZOA 1TQ2A 1G7CA 2PZGA 5LDDC 3EZ7A 4HDOB 2OILA 1W36B 3L0OA 1UFQA 3Q5DA 1I4LD 5P21A 2VHTA 3TK1A 2X19A 4OHXA 4GMXA 3HU2A 1WF3A 4F7WA 5LBIA 4IJMA 4HDCA 5FR1A 2BKEA 1UEIA 2HLDD 4WAUA 4G5RA 2CK3D 2WWXA 2R6AA 2A5DA 4TMKA 1I2DA 1G8HA 2VP0A 3K70C 4IEIA 1NJGA 4ARZB 2V3CC 1G4AE 2WMNB 5CYPA 1PLJA 1JXMA 1S0UA 3CZPA 1RIFA 4KFTA 4Q1DA 4B2LA 3GEHA 4LHYA 1SVLA 1E2QA 1P75A 2OESA 4ESHA 3Q5EA 2ODEA 1G64A 1R0XA 5CLQA 3CWQA 4HB2A 1NMZA 4BFXA 3GLHA 1JQJC 2GF9A 5IF9A 1VCMA 3K70D 5CK5A 2CHQA 2G9NA 2W2XA 2ZUCA 1G5RA 3AF4A 2QI9C 1JI0A 2YC4C 2FPMA 1AJEA 4D4LA 1QHSA 3SNHA 3NBXX 4HI0E 4H1UA 3ZZUA 2IK8A 2J0SA 1TX4B 3AP3A 3CW2A 421PA 2BJWA 3GFPA 2LKCA 1ZW6A 1I2MA 3EPJA 2J87A 4ZO4A 1HT1E 3DKPA 1S3SA 3DM5A 5FR2A 2ZI4A 3BOSA 3O8DA 4IOMA 4XD7A 5G3ZA 3NG1A 1Z63A 3TUIC 1GSIA 3L43A 4W5JA 2FG5A 3H84A 2VP5A 1FTSA 4EIWA 2O8FA 1IN7A 1X8KA 1SVWA 4TN1A 3VMFA 1ZCBA 4CW7A 2IYLD 3TNFA 1E79D 3X1DA 1S1CA 2IYSA 2Z4RA 5FFMA 4ACBA 3WNCA 2FF7A 5JEEA 5IK2D 2ZM5A 2QRNA 4GP7A 1UBGA 2ZJ5A 4FWIB 3LVQE 1LTQA 3NDPA 3DHWC 4EQ6B 2YYZA 2FPLA 5GVRA 4DDTA 4A8JA 1YZKA 2ZI3A 5B64A 1N5JA 1N6PA 4XTRA 2FU5C 3OESA 1NL3A 4Q9HA 4JMPA 4KFSA 3QVVA 5IRCD 4BFTA 3EPLA 4LHXA 4DCSA 1UAAA 1E4VA 1UADA 2OSBA 2CE2X 1FX0A 3A1VA 1UKVY 3OE7A 1G3QA 4PO9A 1XWIA 4ZCMA 1GG2A 4TMVA 4TL9A 4M1WA 2Q9BA 1NI3A 2V9PA 4KYIB 4D0NA 1VHLA 5AJVB 3K09C 2OUKA 2PCLA 2ZU6A 4MGZR 4BLOA 4XTCS 1WB9A 3VFDA 1CS4C 4ARZA 4A8JC 4IDHA 2P6UA 3D31A 1HUQA 1EK0A 1PUJA 4ZI3A 4BFSA 3EW9A 2CE7A 2J5XA 4LC1A 2ONKA 1E2FA 3A1SA 2GAOA 4DZZA 4OHYA 4C3ZA 3BAFA 2ZYTX 2BBSA 2RH5A 2ECKA 2WWYA 1U9IA 3U7EB 2GXAA 1ZAKA 3BH6A 1Z0KA 2OFOA 4BRWA 1FUKA 1XBTA 2GBLA 2D4HA 3PFIA 2NO9A 4KFRA 5CIWA 4OHZA 4MGYR 3THOA 4PC1A 4L9WA 1XEXA 1E1RA 2BDTA 4QHYA 4DT1B 2QG6A 4OQFA 4YONB 4OL0A 2R62A 3UATA 3B13B 2FGJA 3I8SA 4DSTA 8OHMA 4YMSA 1H8EA 2OM2A 4C0LA 3PUVA 5FBVB 1GKYA 2WSMA 4L4UA 1KK3A 3IQXA 3CB4A 1E2NA 2GA8A 5SZKB 3T1VA 1XEXB 2XJ9A 2YC2C 3RNLA 2JJ1D 2IWHA 3CR7A 2ZIAA 2GTPA 1Z6AA 5JWHA 3IDQA 4IRUB 1D8TA 1Q1EA 4IXNA 1WCV1 2EQBA 1KY2A 3NDBB 2Z4SA 2O52A 5FPTA 1S9HA 2QSZA 2W6JA 3NH9A 1Z28A 3BFXA 3WYFA 4WA7A 3NC0C 3LWNA 1KMHB 2BBWA 4C2UA 3NXSA 3ECCA 4KXFB 2R6DA 4F91B 1OKKA 4WVFA 1U8YA 2AXPA 2Z5FA 4A6XA 2ZRBA 1Z0AA 4KFUA 1TADA 4V0ME 5J4LA 3WMEA 4OI2A 1DAGA 3U7GA 1KZGB 2OLKA 1WXQA 3G5UA 2J0VA 3DZ8A 2CL6X 1SXJD 1Z47A 1D6JA 2V1UA 4HDQB 3I32A 3SI7A 1T6NA 2NTYC 5DH9A 4AYWA 3THXA 1IXRC 2XTZA 3OEHD 3MJHA 1P3JA 1Z6XA 1KDPA 5CDFE 1ZD1A 4B3XA 1Y63A 1P72A 3QIAA 3O8CA 2HF8A 2REOA 4MKGA 2IF0A 3N2IA 1JNYA 1IOZA 1NMXA 4PAMA 1JJVA 2C9CA 5F9FA 3OE7D 2GEDA 2JJ2D 1MO5A 4XSGA 1NLFA 2C77A 2ZE8A 4PTLA 1T0HB 1HQCA 5KNCA 4U5XA 1W4AA 3THXB 1G41A 2R9VA 1U81A 3MGCA 1XTQA 3TAUA 3PVSA 1E0JA 2VP4A 2GESA 1G7SA 4RKEA 4MDFA 4Q02A 4KYUA 2BKUA 3W5JA 4AKHA 2PCJA 1VDZA 1U99A 1Z2CA 4KSBA 3VU9A 3Q3JB 1DAEA 1P7CA 1RZ3A 4R71A 4F93B 1G4UR 1M74A 2J7PA 1DAMA 1ZNYA 3AGQA 3DMDA 3WP1B 3N5CA 5HKKA 3V00A 2IWRA 2BMEA 2WJVA 5H8WA 1U98A 2FSHA 3DL0A 3Q7QA 5E4FA 1TF2A 3P4XA 2GZAA 4C30A 4PAQA 5JCPA 4TQAA 2F55A 4ZPXA 4AWXA 4BQSA 4Q47A 5CK4A 2MMCA 4RJLA 5FOXA 3VU9B 4BECA 3W90A 3O47A 2HDNB 4HLUC 1DAFA 3C7KA 2J7KA 1CR2A 2VHQA 4NYIR 4WIAA 1G16A 2Z6VA 2AN9A 3EIEA 1VG1A 1KO4A 2G1KA 3IHLA 4V0LA 3QQ5A 4ZI2A 1YE8A 1GWNA 4EJSC 2BEJA 1NRJB 3SC3A 1WE2A 2ZE7A 3QF7A 2KWIA 3CONA 3FWYA 4M1SA 4LJYA 1P9WA 1KK1A 1FTNA 5FUVA 1IY0A 2WWWA 4A0HA 3CRW1 1OXVA 3AKYA 3C8UA 2ASEA 4MUAA 4DIDA 1GL9B 3P26A 1R5NA 1Z0FA 2GJAA 3KQKA 2EYUA 3VR6A 3H0KA 2DR3A 5AJWA 4BE7B 1KI9A 5GJBA 3B1YA 3LQRA 4WXRA 4B76A 4M9XA 1AKEA 1FUUA 1Q3TA 4R2IA 2FZ4A 4E03A 2ZPTX 4PPGA 2KSQA 2OXRA 4NYMQ 2OCAA 5ELXA 4ABYA 2P0EA 1Q3HA 1O3YA 2WKPA 3DDCA 2JJ2A 3ADKA 3GLHB 2A3RA 2ZSFA 4PPQA 1M6NA 4B35A 2QNRA 2LKDA 2HJVA 2Y8EA 4TLEA 3MD0A 4V02A 1Q1ZA 2GBLC 4BEBA 4D4KA 3KL4A 3T5DA 1L2TA 1YRAA 4F4IA 3B1VA 3O8BA 2ZVPX 2ZYVX 3PXGA 2W58A 2ZJZA 1RE0A 1XEFA 3OAAD 2DFNA 2DFKB 1IN6A 2HCBA 4DLXA 1RRCA 1JAHA 1NJFA 1QHXA 2PZFA 3SBDA 4M53A
chains in the Genus database with same CATH superfamily
2A4MA 4MHSA 4YLYA 3K1TA 2ZB2A 3LBNA 1FLNA 1QG0A 1NTRA 4IKPA 4MRAA 1CW2B 2OP0A 5FXMA 1SAYA 4AS2A 3ADOA 4WCFC 4CM8B 1MRSA 2YVLA 4HRAA 4ZVRA 2HMSA 3ZI4A 2ACWA 3ONEA 4MP6A 2FFHA 3ESBA 3GT3A 1DDGA 1YRQA 4ND7A 3ROZA 1Y8QB 4LXHA 1IXZA 1QFMA 3Q0TA 3ZWXA 4QT4A 2B21A 4L74A 3DTVD 3HJNA 3M3HA 5KYXB 3R9XA 1HX7A 1WU7A 4JYBA 3TOXA 3MWLA 4J7CA 3KAJA 1M5UA 1FPQA 4PXYA 1GYPA 4H31A 3UBMA 2J4FA 1OFUA 1QIEA 3I9MA 1MENA 3NNSA 1BJRE 3OVMA 1ZNZA 2V7EA 3PHBE 2O3TA 4L7VA 4LCEA 1ADGA 3ESQA 3TM5A 3T4PA 4I99A 1T1EA 5HX7A 3GYGA 3P32A 4FYWA 1HDYA 3W6NA 5J59A 1XAHA 3ZHBA 2BGGA 4MB0A 4XR9A 4YDRA 3V8VA 3C3YA 2DLCX 4YP7A 3UAWA 2GBFA 2P9TA 2QRQA 1GT6A 3BT7A 1TD1A 3ONWA 4KGXA 3S28A 1J99A 5LPNA 5LMUB 2ZT7A 1BJKA 4QU9A 2P9FA 5BSVA 1EFPB 5IWCA 3HB1A 2EBFX 2NV0A 2O3QA 4TWBA 1QF6A 3FVRA 4HDRB 2E9SA 1AUXA 4J9UE 1TAHA 4IEEA 4PCLA 5FLKA 3UYLA 4LPKA 3O90A 3Q10A 4KWIA 1JILA 2EKBA 5L6LB 3H97A 2RHTA 5C3UA 3UQZA 4CI0B 5I4CA 4BTLA 2ODPA 1G4HA 4IX1A 1GSAA 3NBAA 3VR6D 3FUVA 1P9OA 3ZK8A 3K1ZA 3NDIA 1AK1A 1R6BX 3AX6A 5TS2A 1Y81A 2JG3A 8LDHA 2ZG6A 2XMGA 3P9RA 4MRMB 2Y27A 2FP4A 2JL1A 3SIPA 2E82A 3ONDA 3LC1O 3QELB 3AR7A 3KJFA 2COKA 2EZUA 3JD0A 1OWLA 4D6YA 4C7JA 4OH7A 3RYCA 3VH3A 2JIDA 3GUVA 2GJ9A 3GCWA 3WL7A 2RJNA 4YXWA 1M1UA 4MITA 4XWWA 1HNWB 2QOEA 5C34B 5HQJA 4RF3A 1NSTA 2IELA 5EAIA 3L7KA 4NMMA 4URHA 3G0CA 4FSDA 1F2UA 4JUFA 2GRUA 3W79A 3QEMB 1WMBA 3GLFB 4ZV4A 5J9FA 3AFOA 4Z5XA 5TQ2B 2F3TA 2B4AA 2C7GA 2G4LA 1DADA 1QUEA 2D7CA 3AR9A 3E7XA 2P3LA 2VDUE 2IC5A 3QBVA 4DLTA 2BGJA 5DIFA 5E1DA 1F2TB 1M8KA 1ZP6A 1YR1A 1Y7LA 1YDFA 2CXXA 2WZQA 5CDFA 4PYJA 4IDGA 1TK2A 3ZV6A 3CVXA 2JB9A 2OD2A 2Q4OA 4LQ4A 1NSFA 2VF5X 1ZU4A 3FLMA 1E6UA 1H0HA 1R5JA 1XKXA 4Q18A 4MWZA 4WKOA 3GYBA 3O2JA 3C4JA 3SYRA 4B35A 4D41A 4D98A 3HY6A 3KLMX 1E1CA 1OLSA 3DQQA 4DMFA 1YQWA 1VIMA 2CNWD 1BSVA 3HP4A 2ZWPA 3FG9A 1QYVA 4MKRA 1DC7A 1CUCA 2AE1A 3U4HA 3CE9A 3I2FA 1MN6A 3WMRA 3PUIA 5AW0A 2EEPA 1B6SA 4IFBA 5LP6B 1KOGA 1LW6E 1RTKA 2CYAA 4LHWA 2YMPA 3PENA 4KX3A 3RS9A 1DG1G 1Q0HA 4UU0A 3ND9A 3A27A 3OIUA 3BTOA 1J5EB 2AIRA 1VRCA 3KJZA 1EFLA 2GYYA 2HQRA 2XUHA 3DTYA 1G20B 4FD2A 2V7TA 2JIMA 3GA5A 3GCXA 4TLBA 1AMUA 3HJRA 4XRRA 1ZGHA 2Y0DA 2FKAA 4OQMA 3I9JA 4K9KA 3BWYA 4D9FA 4B6OA 1FRNA 2OO5A 2QLJA 2ZROA 4FGUA 2ZU0C 3VTFA 1Q44A 2R44A 1EFCA 4Z99A 4RGYA 4BTEA 4N47A 4AJKA 3BH0A 4JLSA 3ZGOA 3JWPA 5M2QA 1YR7A 2HMWA 2RHMA 3B51X 1Z8DA 1M2HA 1XNGA 3ONNA 2HPVA 4RHCA 1C1XB 1XRRA 2YZGA 2BJVA 1LJLA 1W1UA 3QG1A 4IWNA 4PZDA 1ZGJA 3HPQA 3L8MA 3O26A 4KWTA 1EVZA 4MRPA 3NFRA 5DHAA 5I3ZA 1VIYA 3PE3A 5BVGB 1DJLA 5JAMA 1OASA 1C8BA 2NAFA 3HRHA 3JQ9A 4QG7A 4BMYA 4H27A 4JI3B 1PVOA 3HY3A 3UQYS 1GAJA 3QKTA 5FUBA 4EY5A 4YPOA 1ZK0A 1X7YB 3O9MA 4HWSA 3ESDA 3FH0A 2BGNA 4RA9B 1RXUA 4FI3F 4FOPA 4NBUA 4GAEA 5DO9A 3UF0A 5L53A 1W73A 3L8HA 1TUEA 1SXJC 10MHA 5DN6A 3N0TA 3F3MA 4LXQA 4P34A 2PEYA 1JFSA 2R7MA 4CCWA 3ZGZA 2ZT5A 2C7BA 1GTL1 2JZNA 3JSXA 2ERYA 4JFRA 3AJ9A 4L4XA 3V4FA 4E5SA 3AF1A 4EY3A 2CDBA 5LJIA 4K26A 4RA6A 4QDZA 4S0ZA 5AR1A 5DM0A 1U8CB 3IQGX 2DCUA 2QZ9A 1RLTA 3ZXIA 4P3XA 3SYLA 3BVPA 2UZIR 4N9WA 3BREA 3HYLA 3LECA 3VQTA 3RRYA 4GKBA 4B5KA 3P9NA 2P27A 5C4GB 3ADCA 1K7EB 2AYZA 2II6A 2FE4A 4TQ9A 3EXHC 4EITA 5LA6A 2BAGA 3DMTA 4PLVA 2WTAA 4QQFA 5DGDA 3JASB 5IPFA 4R40A 3W3ZB 2GERA 3NJ4A 1H94A 4F2WA 3ZHVA 4Z7JA 2I87A 1KQ3A 4KN8A 2OV2A 1R3DA 3TQOA 2AOWA 4IUDS 4LRWA 1TW2A 1X0VA 1H1LA 1QDEA 3LGSA 4JBLA 3OKAA 5LMZA 2GR9A 1D1QA 2XCOA 2OCDA 1E9DA 4PLGA 3NJRA 2XBLA 2XITA 3NIBA 4NCJA 5HFNA 3R7DA 2F1HA 3RW9A 1V35A 2NNWB 2WP0A 3MINA 3A4NA 4R6WA 1QGUA 4AMGA 2VSQA 3EXHB 2TMKA 4WZAB 2B30A 3CLHA 4WGGA 3KL2A 1J24A 4TTAA 2WWHA 2HC9A 4E6PA 5CXSA 3DW3X 3INNA 5KJ1A 5AW4A 1GQRA 3TSZA 2WM2A 4H08A 4OY3A 1E9FA 4E2YA 3OIYA 1PS9A 4FYIA 1CR0A 1HL7A 1AY0A 4K1LA 3TWOA 3MWEA 4OUDB 1JSZA 2PMKA 1MJGA 3JR7A 1QP4A 3R44A 1VBKA 1PR0A 3G6KA 5J2UA 3H2HA 5EPEA 4BX2A 3A3KA 1GR0A 1X7ZA 1QC5B 2CVZA 2CKDA 2ZYHA 3H6KA 4H1WA 3NTQA 1CFJA 2FZLA 3SJCA 1G42A 2VF7A 1RFGE 2R6GA 3GJ5A 3EGDB 3WKBA 1YH3A 4YCCA 3ZKWA 1I7NA 4A0FA 5BUZA 1ND6A 2AR0A 1TAQA 1T2VA 2BISA 3NHJA 4IXDA 1RAFA 3PIIA 4IQGA 2GN0A 2AVDA 1KWKA 1NQUA 1NYLA 1AH2A 1YCHA 3OX2A 3EC2A 4P80A 4RH3A 3R0QA 4A7PA 2FR0A 4KU4A 4TYQA 2OZLA 2GZSA 4JBHA 5DLEA 4WKBA 3UUEA 2RC5A 3EGWA 1IWOA 2EFYA 1L5LA 3PICA 1EA7A 2OQ2A 2P65A 2XDYA 2RKOA 2J6IA 3NIGB 3P0FA 2R8ZA 4CCSA 2P2DA 2EJCA 1VBFA 4I4CA 2E5FA 4UZFA 3GOHA 3W2TA 4HPJB 3AU8A 1RRVA 4ZYXA 5ALTA 2GVDC 3GNLA 2YCBA 3TLGB 4EKGA 5D2CA 3SWWA 4M60A 1UJ4A 4IQ0A 5K3SA 4C7KA 1ZRSA 4ENTA 1F7VA 4B7CA 1PGQA 1N78A 3OKCA 1UM9A 2C8VA 1UOEA 5C37A 3L7BA 2ZIZA 3GCGA 4UUOA 4ZARA 5G3YA 2Q29A 2R6ZA 3T1OA 121PA 3RVOA 2OP1A 5C2JB 2W5UA 4Q1AA 3TQIA 1US8B 1MB0A 1Y7IA 3CO5A 1JIIA 2PJUA 3NT5A 2IDKA 3GJ8A 3FTQA 3LWZA 4LMAA 2AX3A 1Z0IA 1BRTA 1JFFA 5H1YA 1SD2A 2CVPA 4S1WA 5LLSA 1KVUA 4ZJZA 2LNDA 3ZJYA 5CTJA 2ECPA 3HSSA 1REQA 2IV3A 4FILA 1HH4A 1T4DA 5ALOA 1YKGA 1OREA 4RJTA 1CIJA 4AUEA 4JUDX 3GFVA 3F98A 2OFPA 1LBHA 3V4SA 3A1FA 1ZEJA 2R8BA 1TYEB 2GSWA 4FM9A 4KE9A 1X9HA 1HI9A 5ICEA 3DNMA 5HFJA 4B6EA 3GJZA 5ES4B 1CB7A 2FMUA 3O2NA 5BR1A 5D7BA 2CLLB 4LZAA 1II8A 5FWDA 3VSDA 4J16C 3T5AA 4MQBA 1Z62A 3DDNA 4KH1A 4KI0A 3NMUF 1YZUA 1QZ3A 4KJZA 3BXFA 1M6EX 1KVQA 4UTRA 1OKKD 1RRFA 3Q7TA 4H9GA 2X22A 4DMHA 1VL0A 4ZCIA 2O59A 4BMOB 3PYMA 1GLVA 3A9VA 1L4GA 1J0DA 1IY8A 1L6RA 2HL6A 1AO0A 4ESVA 1BEZA 2CK3A 3L6CA 3WDSA 1CKEA 4IDOA 4LXGA 3NIWA 4QPPA 1OH5A 4PC3A 2AFHE 2COEA 1F0PA 4MHOA 2AMFA 2A33A 4D82A 5HKBA 1EESA 3K9LA 5IXYA 4TQUS 4F8YA 5HYVA 2VBGA 3PC2A 1KSGA 4GBED 4Q3LA 1OXBB 1NE2A 3SFZA 1NXQA 4PLFA 3SU8A 4B4WA 3BGWA 1Q7EA 2GMWA 3WHIA 3AF3A 5U1PA 3BF7A 3IIJA 1N6KA 2WIJA 3QMPA 3P0RA 5KREA 1JG7A 1T36B 4N6GA 5DI3B 4K5QA 1EWQA 2GX6A 3ASZA 4ZOBA 2JAPA 3DOHA 5ALQA 3G2IA 1F2UB 4R05A 5BQXA 1YAJA 3F7NA 1K27A 4MGKR 2Q2QA 3DUWA 4JOBA 1EXMA 2JGEA 2WAAA 4LRSB 3VHQA 1DVRA 2YWBA 4B40A 1ENZA 2FSIA 4OGWA 5DTJA 4ALIA 1PZHA 5IT9A 3A4TA 1XQYA 1LS1A 4PBRA 1AGXA 4OJYA 2WIFA 4U7PB 4PLWA 2GM4A 1ZIXA 4NF2A 4P0PB 4JJGA 2KW5A 4D6PA 5I7OA 4JBYA 2CMKA 3MK31 3HN6A 2QVBA 1FC0A 1XXHE 3UKJA 2VHJA 3ZS9A 1BYUA 3CRMA 3KHUA 2Q3EA 1E92A 4EW3A 5KJFA 5KO2A 2OK8A 4DMMA 2CMGA 2QRZA 1HYEA 2VLBA 4JI4B 4RY0A 3ENQA 3WK8A 4TV8F 4KUGA 1UMKA 4DT1A 5NLLA 4RDIA 3W5HA 2C61A 4MR7A 3RVJA 2ZYGA 3CH5A 1KJ8A 4LN1A 4D0GA 5FWNA 3NAQA 2BMJA 2WB4A 2Q5JA 4G0OA 4NWIA 4JLVA 1GJRA 1TYCA 1DTWA 3N75A 4RPKA 4EP1A 1P1BA 5E6SA 1PGNA 1T4CA 2QI9F 3R7WB 4UBKA 1WZEA 3FRIA 4JJZA 3GJ3A 3Q9NA 3NOVA 4HK4A 1B15A 5K0ZA 1WZIA 5D85A 4EENA 4ZCRA 3ROFA 2QD5A 1A77A 3AMVA 1ZA1A 4TKMA 3G13A 1P77A 3ACBA 3F3SA 4FU0A 1ZJ4A 2HUPA 2QMOA 3TGPA 3DOOA 1QH9A 1FRVA 5T67A 2ZIVB 3LNTA 4BZZA 1GAWA 2WJJA 4NBWA 3J80A 3BCUA 4IIYA 2WD7A 2X1LA 2JIPA 2OGTA 1Y42X 1VXOA 3SSAA 3BD9A 4KIFA 1NW3A 4NPHA 5FV7A 2GPTA 1CZOA 1Q0UA 3AHFA 3KZ1E 3LLUA 3JVEA 4AT1A 1NVDA 1RLUA 2FSGA 3QKRA 4PR0A 5BSEA 1U0OC 4LV6A 2V6FA 3PJDA 1QS0B 4L85A 4U6SA 3RVLA 1E7QA 4KHZA 4UAUA 1A69A 4IQFA 1XWWA 3Q3VA 3D6MA 5LZ5A 1WABA 4PYKA 2QN8A 3E9RA 3OPYB 2XNDD 5FL3A 4C6TA 4JIMA 3PRHA 2GO1A 4JXJA 5JDIA 1NHWA 3NUGA 3PFHA 3QOXA 4Z2YA 5GOZA 4ZAYA 4QU5A 1MIHA 3CGGA 1PP4A 2QLFA 3KU4A 3PJEA 2QBYB 1P1IA 1QDUA 4AVYA 1DV2A 1KYQA 2PVCA 2BTEA 3FDIA 5JRJA 1IBRA 2E85A 3ZBTA 1G98A 1E18A 4HGZA 2F8LA 1BDJA 1UFOA 1UL1X 2H7VA 4ZOLA 1XVUA 2P9CA 3LNCA 2C7QA 4DV6B 2DMRA 4NZ9A 4CTNA 4MOWA 4EGQA 4B3MB 1DDOA 2C3YA 4GZ3A 4P7GA 5D8DA 5E6RA 1JT2A 4MDHA 3GQBA 4E51A 5K5EA 1NP3A 3HNRA 2QBYA 3ZWMA 3RKSA 1QGZA 1U2PA 3AEZA 5CPBA 3GHHA 2GOYA 1QK5A 1CIVA 5KI6A 4QZVA 4DR1B 1NW7A 1ODJA 4KXUA 1B7GO 1AXEA 1VHWA 1PKEA 4UHJA 1G8JA 4BQOA 4C5AA 4CM6A 1Z7GA 4B32A 4NZZA 3KKPA 3E5NA 2HF9A 4QODA 5J4YA 4A0QA 2C42A 4Q0MA 3S2EA 1I1NA 4ZC1A 3QJGA 4KB5A 2ETXA 3ET5A 4O4IA 3USCS 3VSAA 3RJ9A 1YRLA 1CY0A 3GV0A 5EZ5A 3UMVA 1X1TA 3JV7A 4XWGA 1P7WA 13PKA 1T3ZA 2HQOA 2RAUA 3A7DA 5FOWA 3STTA 1U9IC 4NJOA 4KIUA 1H6AA 1XT6A 1WQ3A 1S2NA 3J7TA 1Z3IX 2GDJA 4U4AA 2W2QA 3CX8A 4QOFA 5AH0A 4YQZA 4A2CA 4YHBA 5EXDA 2PKCA 1IC6A 3K30A 3VISA 3JS5A 2IPOA 2GHIA 4LQLA 3SFTA 5GIPE 2G1JA 2ZM6B 4UPDA 2YHIB 5CNIA 2CHEA 5LUBA 3C7DB 3EFEA 3LF1A 4GPZA 5HZHA 4IICA 3BWDD 3IL2A 4QXPA 5ICFA 3TG2A 1YS4A 5A71A 1EK6A 1RMYA 2VPQA 3DXFA 2R8EA 3COWA 2R00C 3OWHA 5BORA 1TCCA 3CN7A 1Z2PX 2V0CA 4RD1A 3VPCA 3BTUA 1Q5PA 3Q12A 2G17A 2XDWA 3PD7A 1UDCA 2I5PO 3AF5A 4HVAA 4JYZA 2XEDA 3IMCA 5LZ7A 8MHTA 3GDHA 1H23A 2BFEB 3PWKA 4G24A 4DSNA 1SUIA 3G8CA 2OPHA 2FW6A 3FMVA 2OBYA 1E3SA 4LJ6A 4OHRA 2C4KA 3RODA 4QJIA 1ZOSA 1AKQA 3T7AA 2B99A 3GLIE 2PL5A 2ZRMA 4GX1A 3LQFA 4HWTA 5HKOA 2UYYA 1U0BB 1NXXA 3DEHA 8ADHA 1Y1PA 1Z17A 1KP9A 1D2AA 2ZUVA 5FX2A 1CYDA 2VWGA 3KKNA 3H0EA 3SOPA 4OK6A 4KMMA 5KNBH 2G8NA 3EB9A 3EVBA 3G17A 2JD1A 4KUEA 5FBQB 4ZJPA 3CF4G 4M98A 2X6TA 2F7SA 4C08A 4JI2B 4EHFA 4RK5A 4CMGA 1RBMA 4BKMA 2ZRGA 3B3FA 4A9AA 3K4HA 3SVTA 1FUIA 4JT9A 4RTNA 1EX6A 3E5RA 2CUNA 3EGOA 3R0JA 3H5NA 1HE1C 1UM9B 3VJRA 3SMVA 1XPJA 1CEQA 2WHRA 3GQVA 1G2QA 1PYGA 2XTMA 3QXGA 4K7JA 2VXBA 3U7HB 1TAGA 1EEHA 1E3LA 3GA7A 3E23A 2VZLA 3KQUA 3QV1A 1QYCA 4ZQBA 4BVKA 1TE2A 2DE0X 4CMEA 2IXFA 3GJ6A 4HRYA 5ESDA 1REQB 1U6IA 2R4QA 2YIVX 2ZIFA 4AZTA 1QE3A 3NXKA 3PGVA 3S1LA 3WZLA 1CUJA 1E7SA 4HDNB 3USES 3VYVA 3MBOA 4YT2A 3BD8A 4RLQA 4XX1A 4BMSA 2ID9A 4CMKA 5EUCA 1SC6A 3KHKA 2FWNA 3QI2A 2B8JA 1KNQA 1A9QA 4R2KA 3FLEA 3SDZA 1V8BA 3KLBA 3W8NA 4OXYA 2P9YA 3GPLA 1C8LA 5HZKA 4CBVA 2FSPA 4B46A 2Z9CA 4GQIA 1H2XA 4R3WA 1QG2A 1BDBA 1NG1A 3W3AA 2VXCA 1DV1A 2WINI 1UDBA 4J0DA 1L4UA 2GETA 2PH3A 4OP2A 3FOCA 3PU6A 4YRQA 5C46F 3E9EA 1CP2A 2Q4RA 2PZEA 3IO5A 4A1OA 2UXDB 4EPXA 4LK2A 2BZ1A 1K7FB 1G2OA 2JGRA 4XE5A 3UJNA 3NIFB 2GK6A 1BE8A 3RR2A 4ESOA 4I3FA 2PDAA 4KL8S 4MHTA 2ZYAA 1B00A 1GPDG 1QGYA 3SF0A 1DWQA 1E7WA 3A3OA 4DE5A 3DE4X 4K9SA 1PZNA 3U2QA 4LX0A 4M1ZA 2WRZA 4IRXA 3C7TA 2HCTA 4POAA 1EH5A 1SBNE 2V4UA 4UUPA 5B4UA 4BC0A 3ABZA 2R8XA 4JL5A 2HJSA 4F45A 4IBOA 1W52X 4AB1A 5ECGC 1AMNA 3B6MA 4ZYWA 3PEVA 1I6KA 1GCAA 4GL2A 5ALEA 1NBAA 3MQ2A 1JSXA 4WFKA 1T6YA 1LLQA 5ABPA 3MAAC 5EJ4A 5HRAA 2AXNA 1QGAA 3MWDB 2XCRB 5DYTA 3D6AA 1IXSB 1T2NA 3DNFA 5AHOA 1SKUA 4LRTB 1E3EA 2IYAA 3ZCSA 1W5FA 1G3MA 3AKDA 4RETA 1QTIA 1USUA 1N0WA 1QOQB 4P93A 2SICE 2VPTA 3TPZA 4ECEA 4HLQB 3II6X 4M76B 2XAAA 4V0KA 4MV9A 2G1AA 1HFWA 1SBQA 2V5VA 3TRJA 4BNKA 3QMVA 1TMYA 1ISIA 1JR3E 3A2KA 1E3MA 3M9WA 4AKEA 4YBZA 3N2KA 1ZLXA 5LNK6 1W44A 4IJWA 2WWVD 1KFKB 1B6GA 2EFDB 2Q5LA 3AUXA 3U44B 1BXRB 1EDOA 1I36A 4XQ9A 4HCJA 4EI2A 2VHVA 1YBMA 1ESCA 3FMOB 4WA8A 4UM8B 2PZJA 2CXUA 3AHEA 1MZPA 1U2DC 1BD4A 1OI7A 4Y9UA 1Z0UA 1PK7A 3ANXA 3BMXA 3JQEA 4A92A 4W5HA 1IB0A 3PKZA 2QU8A 1JXAA 2VPYA 1OLXA 5AI5A 3L7AA 3ZWQA 2B6NA 1UR5A 2QLBA 3CVOA 1EUQA 1C1HA 1DG9A 2O2GA 1C4OA 1UWVA 2WVAA 2P9ZA 3HY4A 2FUNB 3IBYA 3NHRA 3WZ2A 4DIFA 1C7QA 1OCEA 1Z8FA 2CEAA 2FCAA 2NVBA 4L51A 1GTZA 3SMQA 1LH0A 1BFDA 3BL6A 5K8JB 1SWWA 3HKDB 3C8DA 4M0UA 4CZ2A 3K53A 4UEWA 1JHDA 1LPAB 3O4GA 2WNHA 2RE8A 3ZX4A 1BCSB 5FOTA 4DAEA 4L5AA 5K6RA 3QSYA 1L8AA 1NOJA 1ZUNB 2J9XB 3BK7A 1P5HA 2RKBA 4QUKA 2NUTA 3SAJA 3T99A 4IOLA 3ZOKA 2XYVA 2JGDB 3EE6A 2JHCA 3RROA 4BO8A 2WJ6A 3GBPA 4RK7A 5KWJA 1IG3A 1USGA 1X7GA 2A9QA 2QD2A 3KEQA 4QJ5A 2G04A 4LFBB 1FFXA 2P7IA 4RMIA 3LPMA 4C05A 5K8LA 1UPXA 1JIQA 2IW3A 1GZDA 4PBSA 4HWOA 4Q9DA 3EK2A 4YDQA 4P4SB 5AHXA 2QRVB 3DWEX 3FYUC 3SC6A 3D4NA 1Y0BA 3MUOA 2H5LA 4P1ZA 2F2TA 4WECA 3W5VA 2QZJA 2IHKA 3SQWA 1JR2A 1ZIOA 4N4AA 1GARA 1MCZA 3OIGA 5L3QA 4JR1A 2CMHA 1CG6A 1XKQA 4FFVA 3DE2X 1XWFA 4LWZA 3KDPA 1OC2A 4HUQB 2B5WA 4DLZA 4GGOA 2X4DA 3CSDA 5DIZA 5KTKA 2R6FA 3ZY4A 1BHJA 3EFBA 3GGGA 4PFQA 4YASA 2OE2A 1Q20A 2E89A 1JBQA 4EMUA 2EERA 3WI7A 1Z5OA 5DMHA 2I2WA 4QL3A 3CUTA 2JZOA 3EWIA 3ISTA 1SVKA 3VU8A 1AN0A 3BWMA 3O82A 4US1R 2PKQP 3B5IA 1LNSA 3GK3A 1XDSA 2XB4A 4RH0A 5D5QA 1I2ZA 5JBQA 4PNPA 2XKKA 5B1IA 1I6MA 1PL0A 2UZ3A 5BN5A 1LUAA 1BS1A 1OE0A 2FCRA 3ED1A 4HVTA 5E9JA 3U0BA 1IQRA 4RF4A 2FZEA 4B33A 4R5HA 1Z2NX 2GVNA 3NVKI 2ZANA 3BZWA 3H2SA 2R47A 2XTJA 3B9BA 2R7KA 2FUG6 5BWOA 1EIZA 4BNZA 3TKYA 3TTTA 1S8NA 3G1WA 2Y3IA 1E1LA 1IEVA 1NF9A 3LHDA 2WAOA 1FOEB 3HYRA 3RIHA 4PIVA 3S4YA 1K8YB 4I14A 3ZGYA 5IKEA 4BV9A 5JZVA 4OQPA 1TZJA 3WRXA 3OJCA 4AG3A 1L3CA 4A15A 4YJFA 2M32A 1DHTA 2GPAA 1RM0A 3ABRB 3VOTA 1E3WA 1J5PA 1C0KA 1YS9A 3G85A 3WV4A 2Q46A 3WA7A 3STUA 4B9AA 1Z83A 3HACA 4RS3A 4UNRA 3RS7A 5A4AA 2IBMA 1ESEA 3LOUA 1H8ED 2NVOA 2IIBA 4LVUA 3JWEA 1LB1B 3H4IA 1R0ZA 4P3NA 2A1UB 3RLIA 1P5ZB 2PT6A 2BRUC 4M1KA 1YR6A 4EARA 4S05A 4TS4A 2CDAA 3EY9A 1ST2A 1RBZA 4QYXA 5GONF 4FCVA 5JSYA 1MHPA 3ZD9A 4DPKA 1X7ZB 1LY1A 4JXZA 2BY4A 3AR3A 3I6MA 3PQCA 1DPGA 4WACA 2CLDX 4X84A 4OSOA 5F77A 4DCCA 3H4VA 5DGHA 2XCSB 5JSUA 3MCWA 4XVRA 3JAMA 4H1VA 3PBKA 1NR1A 3VO8A 5E9WA 2FSVA 1RPTA 4QGGA 3SE0A 2N0SA 1M1YA 1YZQA 2VDQB 1ZCAA 2DWQA 4ZZ2A 3V7WA 4A8PA 5C7YA 1B23P 5FOVA 1ZOPA 4WK0B 2WICA 4I3HA 1IM2A 4OYRA 3N7TA 3OOEA 4JOSA 4KOAA 4LYJA 4UVHA 3RREA 3TMAA 4I1PA 2R3SA 5EIBD 2XIQA 2CVHA 1S3IA 2QGNA 2VPXA 2W83A 2KI5A 1SUPA 3H11A 1JQAA 5CEFA 4B3GA 3S2ZA 4DCNA 4E5YA 2V59A 3LCCA 4HAYA 2B25A 4TYWA 2HMVA 2HSZA 4O2AF 2JLZA 1KJWA 2XB2A 1A5TA 2VYFA 3REQB 3S8EA 1K9SA 5K0NA 1ZOIA 2QTMA 2HN9A 4LBWA 1ULSA 4L2IB 4CCYB 4IV0A 5DHFA 5AUOB 2C8KA 2J3HA 2HK8A 4ERNA 2R25B 4UOQA 4URWR 1IHPA 2GTIA 2YFKA 3OG9A 2ZJ0A 4V3BA 1JLLA 3QBJA 5KHLB 3C6QA 4UU1A 3NIDB 4JBWA 1BOFA 3CIOA 3I92A 4YRJA 1T5IA 1UBEA 5AK3A 5HRCA 3NANA 3DHNA 4K8OA 5TVKA 3SJBA 5KC9A 2JLRA 2WFMA 1H9CA 1RXVA 3A6FA 5G1NA 3T06B 2XMSA 1V4VA 4C1NA 3T7DA 5AJZA 1HA3A 4JLBA 1COZA 1BA3A 1T1SA 1R6TA 3EEFA 2FY8A 4UM7A 3HJCA 5A4JA 1CWUA 4JXKA 2R5NA 2IRWA 4YJ2A 2J3IA 3B38A 4DARA 2BEWB 1V1RA 1KNXA 3M2TA 3EMBA 2DU8A 3MXTA 4OV6B 4TL7A 4C14A 3AHCA 2X8JB 2B0JA 2PFGA 3PHCA 3L8YA 4TS3A 3P0IA 4H18A 2FEAA 1SVMA 5FFNA 4LX8A 4W4TA 5KHAA 3VJLA 5K0FA 4KPUB 2ZPAA 1RCUA 1P61B 4DCUA 1L7OA 1OFHA 2Y92A 4C78A 3MLEA 4BNXA 1RXSA 1ZA2A 2Q9CA 2HADA 3R0VA 2C3MA 3QXSA 4ZWNA 2RHBA 4BLSA 3K94A 2ZUBA 5CB8A 1I14A 3AV3A 3ORSA 4IUCS 3WOVA 4F8EA 4K2AA 4C22A 5GINE 5EHNA 2PRSA 2JDID 3ZX5A 1XMOB 4PLPA 3WJ7A 4ZCQA 1O97D 3TEJA 1M1NB 4WLEA 1NXTA 3K5IA 5IAKA 2BEKA 4N5HX 3WLJA 4B0PA 4FZRA 3B1FA 3S1AB 4FDAA 5YASA 1O96B 4O3MA 4GZ6A 4TT3D 4HPWA 1PJSA 1E32A 5HEKA 4WZZA 5DXFA 5AWFC 3KV1A 5C0OE 4N03A 2O2XA 4FT4A 3FMPB 4CG2A 3DYBA 4EGCB 2BR5A 1YACA 2WKWA 4LI3X 4B6FA 3K0BA 2FPPA 2JH3A 3DR5A 1KZYC 4XI9A 1QQ6A 3PD1A 3DE0X 3VR5A 3ZE8A 2W6MA 2BWJA 1AQIA 1TUIA 3AZPA 1RNLA 2I34A 2D3TA 1U0JA 2NW6A 2YBEA 4Y0VA 4BCDA 4DLVA 5BV8A 5J58A 1OBVA 1M72A 3AG6A 1N8SA 3QPUA 4J90A 4BGDA 2IS6A 2BTQB 3A2MA 1DQZA 4C7BA 1MX5A 3D0OA 4WOPA 2G9VA 5FBWB 3SEFA 3L82B 3NHUA 2ZRPA 5E7MA 1PFWA 4PGAA 2O1XA 3C41J 2XHEA 3DONA 5THXA 4PTYA 4QLBA 2O19A 2D0OB 4HBZA 2FW8A 5IDQA 1J2JA 4EYOA 2AVNA 1U7TA 1IM5A 1BH6A 1VLVA 4OK5A 4R8RA 3ZHOA 1JUDA 2P2CA 4R16A 1U1IA 1WEKA 4TV9B 3OIFA 5I8ZA 1QMPA 2H85A 2VHWA 1U5BA 3BFKA 3FYHA 3WL3A 4I4TA 1Y8RB 4BRZA 2DQ4A 3W0LB 2NSLA 2FMKA 2FEMA 1GZHB 3PGXA 2WA2A 3KALA 5IARA 3T3PB 2R87A 1NLZA 2YJGA 3PT5A 4OHPA 4PZEA 3RK1A 2P9HA 1V3TA 3UW1A 5KPDA 2IHYA 2VT3A 3DLIA 1E6MA 2G25A 2E4UA 2LGJA 4F3RA 1DO2A 3WIVA 1LBSA 4FJ0A 2WQ7A 2ZRHA 1HDOA 3PV0A 5CVEA 2AEMA 3UW3A 4QLAA 4H3VA 3B9RA 3DA8A 4GR4A 3V1UA 3IHTA 3VC3A 3DAPA 3GZTB 3GCZA 5HBRA 3A4VA 2A9FA 5GWXA 2Q8NA 4M0PA 4DREA 3IAM1 4D3ZA 1G21E 3OTIA 3OUUA 2ZCJA 4FQ7A 1NDHA 1AKYA 1ECCA 1Z39A 4ZEOA 2CD9A 4X41A 4N6NA 1KR2A 4DLRA 3L84A 3FZEA 2VEOA 4UU7A 1UCFA 3E8XA 3CF0A 4FBLA 4U7TB 5ALZA 2VK4A 5BXQC 5DYGA 2JGIA 3ZIUA 4B3TB 1YHNA 2AXEA 1DRWA 3CA8A 4JB2A 3I61A 3JWHA 1DTEA 3VYUB 4I9NA 3OJFA 1IVSA 2PANA 5TY0A 3U3DA 1SU7A 3TVYA 4E5PA 5G41A 1ZD2P 2I7XA 2MSDB 3U1VA 3C16C 4Y9DA 3I37X 3JYQA 2PYIA 4QWMA 5EFZA 3R6WA 1YGPA 5AK6A 2AJDA 2CFRA 4JT2A 3VR5D 4YC7A 3I2KA 3I5MA 1H6CA 3MWJA 3PNQA 3IJRA 4A26A 4BQQA 3AERB 1I10A 3GFQA 5JCOC 3CN9A 3ICVA 2A7XA 5KOYA 3ETNA 1IVYA 4YCMA 5F2EA 1MC8A 1Z29A 1JFVA 2Q7XA 3RS8A 1EDEA 4REQA 1GIAA 3ZWNA 1KQPA 5BP7A 1V11B 1NZDA 4B48A 2Q1UA 3WX0A 1KI8A 4IZHA 5BSHA 3NALA 5EPUA 1VIVA 2H9IA 3H9GA 1GA1A 4ZAZA 1X94A 3AILA 4R01A 4QUAA 3OPNA 2AG8A 1OT3A 1RIIA 3HA5A 4JCOA 4B47A 5CPFA 3U4IA 4PANA 3GLFE 3ZBUA 3AHJA 4D79A 4OATA 1RHQA 5DLQC 4CM1A 4ZCTA 4CEJA 4H1TA 1TGYA 1LSSA 2PV0A 2D5LA 1KSHA 1E5LA 4NPAA 1YZTA 2ZTSA 2BFFA 5K6TA 1BVYF 2O0KA 3OQHA 2JW5A 3FYCA 3VZQA 2OHOA 1ZSYA 1FFGA 1KH1A 1UK7A 5JNLA 3DZJA 3H5AA 3MCVA 2FN8A 1VZ2A 1L7PA 1SQSA 3QEOA 1LXCA 1EBBA 3C7AA 3EVFA 4KODA 2FSUA 2GEUA 2UDPA 2IDZA 3N58A 3RRXA 3QM1A 4FFNA 2O1EA 4PXAA 2ZBGA 3ZHUA 1B16A 2DAPA 1VIAA 4P7FA 3KQSA 2ID8A 3EC1A 3SN6A 4RPGA 4XB2A 4ZT2A 1ML3A 1P19A 4AW9A 2C5GA 1MNAA 5TPZA 2NU8A 3GPDG 3WHPA 3HUUA 1MG0A 4L0DA 4DWVA 1G8GA 2CDNA 1WRBA 2DQYA 4E31A 9GPBA 3A37A 4A1FA 3MRSA 4YIKA 1NPDA 3DDHA 3VM6A 2K4MA 1ZUD1 3D2CA 5EEGA 1HPLA 2WWFA 3HU3A 4S1TA 2IKSA 3EBLA 3W77A 5IAOA 1DEXA 1GQYA 1Z2OX 1HYQA 3MXOA 4BP3A 2P90A 2QV7A 2PUDA 4AWBA 1M1YB 1NV9A 2BLLA 4GSYA 3BGOS 3LVBA 4YMWA 1E69A 6REQA 5A9SB 1TQDA 4XPIB 3JY6A 1RZVA 4HQRA 2AQHA 5JAZA 1NN5A 1RC8A 2IUSA 2I4TA 1XMPA 1EP1B 2C7VA 3AR5A 4CN8A 1UDXA 4Y2VA 3FHTA 4ZFNA 3R3HA 2HSWA 1IJEA 2BM0A 1VI2A 4Q82A 2VKQA 1O77A 4OP3A 4EF5A 2UYGA 4M8KA 4DIEA 1ULTA 1KYVA 5I8PA 1C7IA 3OZTA 1CDOA 4XGNA 5A9SA 4OI0A 2W43A 1X1SA 1OAOA 1VTKA 2FWBA 1P6XA 4XGRA 3HVIA 3EPHA 3G2PA 2OCPA 2PPVA 4DDKA 2QM3A 1SU8A 2JKZA 3IELA 1OTXA 4JX8A 3JQAB 4EHDA 2PTHA 1JYEA 3A2LA 4IIJB 3KKOA 2C04A 1WKCA 3CF4A 4HZIA 5IC6A 5JAOA 1L5ZA 2P78A 2R8RA 4FDTA 2B7CA 2OD7A 2YFHA 3CZQA 4MGIR 4ZVPA 1QFZA 2HLNA 5ESWA 3S7TA 4GXTA 1FNDA 1D0SA 5K8IA 2CW5A 4HVLA 1QVRA 1DFGA 1TEXA 5P8WA 4RNDB 2A5FA 4GG1A 4MZXA 5A6SA 3K71B 2BP7A 3CKKA 3EUAA 2VK2A 3K0FB 4QUEA 3UMBA 2ORIA 2EJWA 2PRJA 3K2IA 3ZV7A 2P67A 2ZRNA 4G1CA 3NS7A 5JYCA 1HE5A 2B4YA 2PSSA 4BMVA 4C88A 2IY9A 3Q2IA 3SBOA 1J2UA 4JAVC 1MABB 2REBA 3KKMA 3N28A 3I5AA 2RB5A 2ZWMA 3DKVA 1BJTA 2FMHA 2OQVA 2C2KA 2PUAA 1T1IA 1IJKA 2V6MA 1OV4A 1W76A 2BFDB 2OEPA 3BYZA 4YQYA 3RKRA 2C4WA 1Y8RA 1GV1A 1XTJA 4OU4A 4RJ2A 4PR3A 3TVDA 2ZKIA