2JASA

Structure of deoxyadenosine kinase from m.mycoides with bound datp
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
200
structure length
194
Chain Sequence
b'MKIAIFGTVGAGKSTISAEISKKLGYEIFKEPVEENPYFEQYYKDLKKTVFKMQIYMLTARSKQLKQAKNLENIIFDRTLLEDPIFMKVNYDLNNVDQTDYNTYIDFYNNVVLENKLSFDIVIYLRVSTKTAISRIKKRGRSEELLIGEEYWETLNKNYEEFYKQNVYDFPFFVVDAELDVKTQIELIMNKLNS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DEOXYGUANOSINE KINASE
publication title Structure-Function Analysis of a Bacterial Deoxyadenosine Kinase Reveals the Basis for Substrate Specificity.
pubmed doi rcsb
source organism Mycoplasma mycoides subsp. mycoides sc
molecule tags Transferase
total genus 66
structure length 194
sequence length 200
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.1.113: Deoxyguanosine kinase.
pdb deposition date 2006-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01712 dNK Deoxynucleoside kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2jasA00
4IOLA 1XEXB 3GLFE 3EPHA 4EDHA 1IN6A 3C16C 2ZRIA 4AKIA 5DGXA 1COWD 1FQKA 2OCBA 1CJKC 5DHFA 2AFIE 4C0BA 1QVRA 4G5QA 2NIPA 2NO9A 1HQYE 4PQYA 4AI6A 2ZRBA 2XNDD 1G7TA 2FOLA 4RFVA 3WHKA 2D7DA 2IXEA 2REOA 2WWWA 4BLTA 1KAOA 2FGKA 1W0JD 3K0FB 4OQLA 3L82B 4JBXA 4DIEA 1JQLB 2DWPA 3OEEA 1RRCA 3GJ0A 4B74A 2J46A 5JFGA 4UNPA 1DPFA 3THXA 1GWNA 4G5GA 3B8HA 1PUJA 5DHAA 1NVVR 4W5HA 3FYHA 4W7SA 3UIEA 3AVTA 1YZUA 1EWQA 4B3BA 4D0NA 4E22A 3LRPA 1HUQA 3TR5A 4KODA 2VP0A 2UZIR 1WP9A 4BZXA 5CITA 1OE0A 1G7SA 3NC0C 3VR5A 2CVFA 2GILA 1KI1A 2ZETA 3TAHA 1NSTA 3QBVA 1HT1E 3SFZA 1GFIA 3NIBA 2Q0HA 2RH5A 3AKCA 4OQNA 1HEIA 4LX0A 3TK1A 1SKYE 5G3ZA 1N2CE 4UNRA 4CVNA 3E2IA 3KFVA 3K0CC 1ZM7A 2VF7A 5FPYA 2IF0A 3SOPA 3T06B 4IVPA 4YMUA 2Z6VA 1XEWX 1XJ0A 1Q3TA 3E70C 1ESNA 4R71A 3UMFA 4AYXA 4LHYA 4BLSA 821PA 1FTNA 2WJJA 2VP4A 2GZDA 5KSYA 1BMFA 2J3EA 3LQQA 3NDBB 4S2EA 2Q9BA 2QPOA 4B43A 1Z6GA 1ZMXA 2XX3A 3X1DA 1OFHA 1KI8A 2ZRHA 2YINC 1Q44A 2CDNA 3EG5A 3T5GA 4GP6A 3LBHA 2O8CB 3CWZA 3IUYA 4EPVA 2EFDB 4NDZA 2RGAA 2GCOA 4CRWB 4M1WA 4HUTA 4PAMA 2CHGA 1CR0A 5FOVA 2R6CA 1ZU5A 4EPXA 2P5SA 2ZVQX 1MOZA 2ZI3A 1YZTA 4B32A 3ZS9A 1G19A 4C2TA 1W2HA 4TQ9A 3NKVA 4JT4A 3ADDA 1X6VA 3SNHA 5TXGA 2G77B 1CP2A 4LK2A 3TR0A 3B60A 2IYLD 4TYNA 5F98A 1NLZA 3MAAC 2RHMA 4URYR 4W5JA 4KO8A 3UG6A 3GPLA 2FV8A 4QJ4A 4OKSA 2WOJA 1Z3IX 4DLTA 4ESHA 2H57A 3U4QA 1F48A 3P20A 1I4TD 4K8OA 5AJWA 3KUDA 5DLQC 2YJTD 1XPRA 3PUXA 5JEDA 1R0WA 2O8DB 3T34A 1K8RA 3OE7A 1NG9A 1D6JA 1TF5A 4HDOB 4BE7B 2GRJA 4QC2A 1UBGA 1DAFA 1MO4A 5JMTA 2WHXA 3IIMA 3EXAA 2F1HA 1E99A 2FSHA 1RJ9A 5L8VA 3LLMA 2P0EA 2P6NA 3KZ1E 5JI2E 3A1TA 3IIKA 2PJRA 2XTZA 4HLUA 1OH6A 4HZUA 2AFHE 3NWJA 4LWZA 1P7CA 1Z6YA 1KZGB 3QKTA 3B1WA 3C15C 4F91B 1KMHB 1G1MA 1II8B 5HCIA 3LW8A 5KUTA 4JLOA 1W4AA 1GDDA 1RIFA 2GTPA 2AN9A 4QOSA 1ANKA 2OLJA 4PHFA 1CR4A 1M8PA 3TJZA 4CEHA 4TYQA 4GOKA 2CCGA 4ZIRA 5F3WB 4WOPA 4Z51A 3WBJA 1E96A 3IILA 1U99A 3OEHD 5P21A 3I92A 5JI3E 3PJRA 4JLVA 4E09A 1NRJB 5EE0A 4G5OA 2ZSAA 4EPWA 5K8IA 1HE1C 3L2OB 1ESMA 4OJQA 5CDFE 4L5BA 5JJIA 1N6KA 1E79A 3K70B 3AP1A 3NH9A 3K8YA 1EWRA 1G17A 1TF7A 1FP6A 2VYFA 1GRNA 4IVRA 1FX0A 2QEQA 4YXWA 2IUUA 1Y3AA 3GJXC 4BFXA 1E32A 1M7BA 4IFBA 3B5JA 3VFDA 3I62A 1CJMA 3EZFA 4QGGA 3THXB 1J90A 3D31A 4R2HA 2IS2A 5AJZA 4KFSA 3ADCA 2BEKA 2IXGA 3MGCA 5CLQA 2YV5A 1W4CA 4QNMA 4DXAA 3GP8A 4UKDA 5HCNA 3AV0B 3KJGA 4IEEA 2J7PD 1WMSA 4PANA 4AWXA 1R6BX 1T8UA 3QF7A 2DR3A 3TNFA 3O47A 3UATA 4DJTA 2C77A 4B44A 4KLZA 1GIAA 1NBMD 4D81A 3B1YA 1N6RA 2HJGA 3MLEA 4P4SA 3RRYA 1X8KA 1YZGA 4MKHA 5C4MA 2RGCA 3K9LA 4IRUB 5IT5A 4DSNA 3NBXX 4LJAA 2CK3A 3Q8XB 5FL7D 4TTRA 2ZYWX 2GJ9A 1G5RA 3G0HA 2P67A 4QBHA 1KNXA 4ZV4A 3TKLA 1QHYA 5TV2A 2WSSA 4DBLC 2NZ8A 5BW8A 4B6FA 1UEJA 1IQPA 2QAJA 3BB4A 3NBYC 1E0KA 1OSNA 4M53A 4YMSA 3SR0A 5LDDC 1DAIA 1TMKA 4XD7D 4ZDWA 5JWOA 5FR1A 3OZXA 1SGWA 1XMJA 4C0SA 2I4IA 2V6JA 3PFIA 2QZ4A 3KXIA 2YHSA 1I4DD 1YVDA 2OUKA 4CF7A 5F9FA 3PEYA 1U98A 4BUJA 4PQRA 4Q9HA 2GCOB 1XEWY 3AP3A 2D2FA 3AKDA 2AD1A 3KXLA 2GAAA 2WKQA 5JCZA 2ANBA 3VKGA 3QENA 4MA4A 2WAYA 1UJ2A 2RGXA 4HSEA 4HZIA 3B9PA 1CTQA 1SVSA 2EFHB 2KJQA 3KL4A 2ZU0C 2CCKA 4A15A 3U3OA 3BJIC 2P3SA 2FE4A 5LD2C 1WA5A 4IDHA 2JDIA 2IUSA 2ZREA 1XTSA 4CEJA 2H18A 2EFGA 4A2QA 1TTTA 3U4QB 3KXKA 3BB3A 1CKEA 1J8MF 2JLUA 3BK7A 5C1BA 4B34A 3B1ZA 2PH1A 2AXNA 3RC8A 4HDCA 1Z0JA 3K9GA 4E5UA 1SXJA 2VO1A 2ZI5A 3MSXA 3GLGA 1S8FA 1Q1ZA 4N0DA 4AYTA 2GZAA 3BH7A 5FPHA 5HE8A 3ICEA 3MFYA 1RJ9B 2F1RA 4B3DA 3ZS8A 3EW9A 4NMMA 5K8LA 1KDPA 4HZUB 4EFNA 5IK2A 2IW3A 1JALA 3S1AB 4LV5B 2QROA 3H0KA 2PCJA 1XCPA 5JLJA 1J70A 2P5TB 2WJGA 3F0TA 3OHMA 4LHXA 5CIWA 2OSBA 3CRRA 1ZNWA 4CEHB 2W6JD 4IDOA 5E7JA 4ZIRB 4O2RA 2YZ2A 1T4GA 2DHRA 3NBZC 4PAQA 5EZ6B 1S4QA 3B2EA 2FU5C 2GF9A 1N6OA 1M34E 2OFOA 2YYZA 4F38A 1OXSC 4DEXA 5JBQA 3EA0A 121PA 1R0YA 1Z06A 3BC1A 4HI0E 4XVQA 2ZJ8A 5A4JA 5KSZA 1NVXQ 2CNWA 1ZNXA 4U5XA 1XPUA 2WWIA 4RD6A 3QG1A 1NN0A 5DO9A 3VR6A 3HR8A 1FX0B 1QG2A 3BFXA 4Q01A 1R2QA 4LRWA 4NHOA 1Q12A 3NTUA 2ZANA 4HEJA 1TL7C 4FCTA 1JJ7A 2KBEA 2BV3A 1NKTA 2QP3A 3AF3A 3W3ZB 2ORIA 5CLLA 5FUWA 4HAUA 2IHYA 4L16A 2JEOA 4AG5A 4BLQA 4RZXA 5ANRB 2FZ4A 3BD9A 3K0AA 2JLSA 4ZPXA 1GKIA 5KTYA 4EFMA 4CT5A 2XJ4A 5KOYA 2C95A 1IXSB 2ZTSA 1XMSA 1SVMA 221PA 1CBUA 3NHAA 5E7IA 1J7KA 1VG0B 2HXSA 3FDIA 3WYGA 1FUUA 1W48A 1E9SA 4P4SB 4L15A 4A4DA 2KI5A 2QG6A 3Q9LA 2RGGA 5FOUA 4RD0A 4M9XA 2HLDA 1G6HA 3NEYA 4JVMA 4NCJA 1FZQA 4AURA 2JIZA 4KFUA 3AVYA 3SJAA 1SHKA 5FOTA 4DDWA 1XPOA 3W6NA 1UF9A 2GJ8A 4CYMA 4W9MC 621PA 3AVWA 4A8JA 5K8UA 3R7WA 4Q02A 2O8EA 1RYFA 1AS0A 2QPTA 1RZ3A 4LBVA 4HLCA 4ZKDA 2JASA 4MGYR 3LY5A 3I32A 2O0JA 2V3CC 1OJLA 1Z29A 2ZITA 4A6PA 1E98A 4A82A 1W5SA 2G0NA 4O25A 1K6MA 4QXAA 4KITB 4LC0A 1QHXA 1TQDA 3PUVA 1CJVC 4I1SA 4XWOA 1H8ED 4B48A 1KGDA 1FPMA 3Q5EA 4EIWA 1P75A 4BEJA 1UEIA 4WIAA 2FZLA 4DCVA 5L3VA 2BC9A 1DELA 1TEXA 2ZJAA 4DSOA 4U02A 2WIAA 1PLLA 3QEJA 2ZEJA 1OKKA 1SVIA 3T35A 2AD5A 4LJ6A 1WRBA 2GXUA 2VIIA 4OI2A 4CEJB 3GD7A 2R8RA 4MUAA 4A9AA 1ZU4A 4GPTA 1AGPA 1Q20A 4B33A 1HY3A 4ON9A 1KY3A 3AP2A 1DO0A 4IKEA 1X8JA 4US0R 5BXQC 4OK3A 2JJ1A 3LWNA 1FP7A 1SXJB 3GLGB 2EQBA 1U81A 2QENA 2TMKA 1E2FA 3EWSA 4LHZA 4F4IA 3U7GA 4XTCS 2IYTA 4QNRA 4A92A 2QP9X 3CPEA 3MWYW 1QBKC 2QI9C 1ZAKA 1ZD9A 3ADBA 2VBCA 4DHEA 3W8RA 3O8DA 1IXZA 1IONA 4ZI2A 2ZUDA 3FHTA 3EASA 4G1UC 1N5JA 2D06A 3TUJC 1D2MA 2XZOA 2F9MA 2YKGA 4IJMA 1EX6A 4GMDA 2QGZA 1IN5A 1YR7A 3NHBA 1U0JA 1U0HC 1RYHA 1Z6AA 3H4MA 4JBWA 3RNLA 1T9HA 1EFRD 3THWB 1EFCA 2FMXA 4QBGB 1GNQA 2A30A 2J87A 5EE9A 2WBLC 4EPTA 3TLXA 5CJPA 2QPAA 1RRPA 2AKAB 2HEIA 2G1JA 3KJEA 2XSZD 4JSYA 5JRJA 1U8YA 4HYYA 1LF5A 5BYJA 3T1OA 3EPLA 4Q18A 2PZGA 5BQ5A 3QQ5A 4ZI3A 1PVOA 2JAQA 1W36B 1BO6A 4IXMA 4OQMA 1E9BA 3OF5A 4V0LA 2QL6A 2A78A 1NNEA 4Q48A 1DADA 3DO6A 2OEPA 2QU8A 3SQXA 3I72A 4Z1MD 3ASYA 1ZUIA 4JJKA 4YC7A 3OESA 1VHLA 2Z4SA 1Z6TA 2BBTA 2RGDA 2ZRGA 3KKPA 1SXJE 3CNNA 3K0AB 4JLJA 3GLGE 2EVWX 4C2UA 3N5CA 2CL6X 3A4MA 1F2TA 2AL7A 4EJSB 1JEEA 3JVUA 3OFND 3IPXA 3EWAA 4EJSC 3C41J 1SULA 4GL2A 1GSIA 2CE7A 1L4YA 4PHTA 3EAQA 2QQEA 3M0EA 1JECA 1N0UA 2QSYA 2QBYA 4OK5A 4C0LA 2W2XA 2ODNA 1IN8A 2WMOB 1DVRA 1XJCA 1IJEA 1KI6A 1U9IA 2ASEA 3CONA 3RLFA 3TSOA 1Q1EA 2ZRLA 2LWIA 3CH5A 3WNBA 4I99A 4URVR 3TBKA 4A8JB 1E2JA 2C9OA 4PX9A 2L0XA 3R7WB 4B75A 2NQ2C 3G5UA 3L43A 4QKQA 1E0SA 4FI3C 4ERNA 3SHFA 5G53C 1H65A 2BIFA 1JXMA 2QORA 3KX2A 2FPLA 1NLYA 3KQHA 4C0AC 5B30A 1XTRA 5CK4A 3U44A 3T1VA 1ZNYA 4DT1A 2V54A 3GLIB 2GF0A 3EARA 3N2EA 1YR6A 5KHOC 5FOWA 4DUGA 4DEYA 1Z2CA 2ZUCA 1G5TA 1KI3A 4ARZA 1EGAA 1T3HA 4HB3A 4QBIA 4NKRA 3BB1A 4LJ8A 4Q9LA 5CM8B 4DRZA 2ZRCA 1FW6A 1YHNA 1XB2A 2D4HA 2YC2C 5GJVC 5L3RA 3IEUA 3M4YA 4PPFA 3EC2A 5A0FA 5J4VA 3QKSA 4D25A 1KOFA 1E3MA 1N6LA 3RRMA 1QG4A 2PX3A 4TQUS 1QRAA 1ZM9A 3CF6R 2R6FA 1PJRA 1KK3A 2XTNA 4B35A 4LJ4A 2NGRA 2E9SA 4FXPA 2XAUA 3GJ6A 721PA 3UMRA 3CBQA 2GCPA 5EZ5A 1KSGA 4BFUA 2IYWA 4NYIQ 3I1FA 3KJHA 3W34A 2IT1A 2QTVB 4S35A 3IBYA 2C5LA 2E1RA 5SZJA 3M6AA 3BFVA 1S3GA 3W8NA 3W6PA 2IYYA 4JLBA 4NONA 4TMKA 2CVHA 5HPYB 3CPJB 2IYQA 4P33A 3TIFA 5JS7A 4NYJR 5AJYA 3D3QA 5KPJA 4TT3A 1CR2A 2BBOA 3GEEA 1G3QA 1TU3A 5AUNB 2ZVPX 1E2QA 5C18A 3VNVA 2OE2A 3FGNA 5CYPA 1HE8B 2HV8A 1C4OA 4B2IA 2KBFA 1NIPA 4YLGA 3L0SA 2B21A 1MABA 3LVQE 1KSFX 4MYHA 2UZ3A 2IA5A 1JI0A 3KB1A 1G21E 4TWZA 3REFA 5AUOB 5GADl 3VTKA 2CEAA 2I3BA 5BYKA 3T12A 5HR5A 4NCIA 2A7QA 2Q3HA 2GETA 1XD2A 1MT0A 4Q66C 3FHCB 4ITRC 1VIYA 3OIVA 2IYVA 4L4UA 1NN3A 4B6EA 2R2AA 1E4VA 5FOXA 4MKFA 1EESA 1VYUA 3JZAA 3H1TA 2QN6A 1F2TB 1HURA 3AGPA 5KNBA 3IIJA 2O0HA 1CJTC 4RZUA 3SJBA 2CMKA 2BJWA 4LYJA 2ORWA 421PA 2REXB 4BWYA 3UANA 5FBVB 1FMJA 3RWMB 3EZ2A 4PQFA 5CYOA 1E9FA 4A1FA 2IS4A 2ZS8A 2JJ2A 2Q9AA 1SVWA 4B2LA 2LKDA 3ZIAA 3LV8A 1KO4A 4HLDA 3HWSA 2QBYB 1KK1A 1N25A 3WYAA 5F9HA 3M1IA 3PCRB 2RAPA 2V55B 1P6XA 4KYUA 2QE7A 3RVBA 3UWOA 3QXCA 4CGZA 2ERXA 1KI6B 4AK9A 1E1RD 5CJ2A 3BBPA 4C0HA 2JLRA 2ZRAA 1Z2AA 1L2TA 2ZI6A 4BFSA 3OIYA 5FI1B 2J7KA 2O8FA 2A5JA 1KSHA 1J99A 1Z63A 3FPAA 5DIFA 1A4RA 1CRQA 5IRCD 1GKYA 2F43A 3MD0A 4LV6A 1DAEA 1L4UA 2XOKD 3F5FA 2FG5A 4F4CA 1UBEA 3FOZA 2DCUA 3U44B 4WBSA 3N2IA 4DT1B 1SQ5A 3TW8B 4BFVA 1Z0IA 3ZLJA 3EC1A 1YZLA 2B7BA 1KK0A 4HLQB 1E2IA 3VAAA 2ATVA 1CEEA 2W0MA 3A58B 2NOAA 1YKSA 4PC6A 1PLKA 1AKEA 1ZCAA 4I1UA 2GXQA 4ARZB 4BZQA 3QJYA 3KJIA 2GBLA 4WXRA 1IY2A 1P2TA 1DAMA 2Q9CA 4Q4AA 3A36A 4CZ2A 2G1KA 1ZINA 2PMKA 3MCAA 4PC1A 2V9PA 4RKFA 3ZDQA 2B92A 3VR4A 1OIXA 2GJKA 4TLAA 3WXMA 1ZC3A 3GJ5A 3QKSB 4M8NE 4TQAA 4C30A 4PSVA 2ZRKA 3SJZA 5FTJA 2A5FA 1E94E 1YZNA 4FCVA 4DLVA 1JR6A 2A5GA 5SZKB 1SVKA 3EPJA 1XFAA 3W90A 1U0LA 1DARA 3BIFA 3B85A 3OAAA 1DAGA 3FHOA 3KTAA 1DG3A 5TVKA 3MJRA 3ZZUA 3K70D 5EUMA 2ZE8A 4MUBA 1NMYA 4PR0A 1Q22A 4OI0A 5CM9C 4M1SA 1P5ZB 1LY1A 1QHNA 4M1TA 3OEED 2JLXA 2V1XA 2WWHA 3FTQA 5EXTA 1GL6A 2X8AA 3W5IA 3PUYA 1NLFA 1PUIA 2IEZA 4J0QA 3GMTA 4NYMQ 1OB5A 1VYVA 4H9GA 2X2EA 1UPTA 1YE8A 3S1AA 4EQ6A 3KQLA 1XP8A 1IBRA 1ZM3A 2QRNA 1H8HA 1JR3A 3OIWA 4ACBA 2PZEA 3CRQA 2WPDA 3RDPA 2PBRA 5KSOA 1Q3HA 3LLUA 4QGAA 3DMDA 3QPUA 4DCNA 4A6XA 1WBBA 2XZPA 1GTVA 3HU3A 2KB0A 1MABB 1N6IA 1T6NA 4PHGA 2G0TA 2WWFA 3PEUA 1D9ZA 4ZDIA 3QKRA 4YMVA 2WJHA 4M4SA 1AQYA 1A5TA 2V4ZA 3IO5A 1OYWA 3HDTA 5FI0B 1Z08A 1XD2B 4HAWA 2ZYUX 4OL0A 1NMZA 1EFUA 4RSGA 4QG7A 3A8TA 3FKQA 1NL3A 3AVOA 3THOA 1ZD1A 4QBFA 5GJWC 4E03A 1BMFD 3W9YA 1XBTA 4U00A 3ND9A 4KBFA 1ZRHA 2IBMA 4X8HA 3QNUA 1N6NA 1NY6A 3P26A 4Q7KA 1FQJA 4YMWA 5DI9A 1A2KC 3I8SA 4RKEA 4AIIA 4GP7A 3KDSE 2BMJA 1Y63A 2CHVA 3K0CA 1II0A 4PC7A 1SHZA 2YWGA 2G88A 4TMXA 4KVAA 4TL7A 4NPHA 4D4JA 1E9RA 5CB8A 3QSYA 1P3JA 4B2PA 1XMIA 2ZE6A 3THYA 1T3SA 2WZQA 2QP4A 4MH0R 4LHVA 2PEZA 2O8FB 2YOFA 1II9A 3GJ8A 5HKKA 3AF4A 4RCZA 1RKBA 2VSFA 4DVGA 2F43B 1R5BA 2BHRA 4JVNA 2WJVA 1E9EA 1HQCA 4YMTA 4L8GA 3LA6A 3SQWA 3OE7D 2ZSDA 3V4FA 3Q5DA 5JWRA 4JSTA 3ZZTA 1KMQA 4JLKA 4BQSA 4JVSB 2PT7A 5C46F 4XSGA 2Q21A 4QM7A 5GJCA 4O3MA 3RRNA 2FF7A 2VSXA 4K46A 4MYTA 1UKYA 4PHHA 4CW7A 2IS1A 1T0JB 4M0LA 4ZKEA 3AM1A 2FPMA 3T15A 2G83A 4Q4AB 3UG7A 1SZPA 2IYSA 1WF3A 4FN5A 3QXHA 4ASUA 1SVOA 8OHMA 1OXXK 2AWNA 1XMVA 2BMEA 4EPYA 3MG9A 2BM1A 2W6IA 1XD9A 1P72A 4KAXA 4LYFA 5FBLB 4II7A 1H8HD 3P32A 3RYTC 4DDTA 1R7RA 4C0KA 1TAGA 1QHIA 1AKYA 2NZJA 4PO1A 1VYTA 3HU2A 4TMZA 2BJVA 1X1SA 2FEMA 3RWOA 1UM8A 2W2VA 4PO9A 1GILA 2EFEB 3CRW1 3U6BA 1W0KA 4Z8YA 3EZ9A 2AHOA 3A37A 3GQBA 4RZ2A 4LJ9A 1K5GA 1ZIPA 4GOJA 1MO6A 2BMDA 3SYKA 2QT1A 3KTAB 4MYCA 3I3SR 1E79D 2VF8A 1XU4A 1IHUA 3WBKA 3LD9A 4BECA 3U7EB 1NG1A 1IN4A 1GRQA 4URWR 4YXWD 3RS3A 4BFZA 1CLUA 4US1R 1DG1G 1G8PA 4FW9A 4HUQA 4ZCMA 1CXZA 4C0JA 2IK8A 4DDVA 6Q21A 5L3QA 2ONJA 1AZSC 3TGPA 1PZNA 1XZPA 4Q4JA 4XVUA 4BGDA 2GKSA 1N0WA 5D3MA 4XIGS 5KYKA 2FX3A 4TLBA 3GFTA 3ZVRA 4EQ6B 2J41A 4B3FX 4FINA 2C96A 2J0UA 1IJFA 3FMFA 4DZZA 3VHXA 2BDTA 3SHWA 1C1YA 4IDPA 3LFUA 2ZXUA 3DVLA 4XSHA 3THWA 5JWHA 1NMXA 2VSOA 5UKDA 2EYUA 2X19A 4LYAA 4PZLA 2F3TA 1HV8A 2Q6TA 3AKEA 1Z5ZA 3QKRB 3ZJYA 2P6RA 2HF8A 3PIRA 3RS0A 1IAQA 3QXXA 4V0OA 4XH9B 2YWEA 5HZKA 3TVDA 3FE2A 2CK3D 2WSMA 2IXFA 1UAAA 1FFHA 4OYHA 4C0QC 1XWIA 2OBNA 4LCBA 3LO5A 4OK6A 1XRJA 1YJ5A 4URZR 1NJGA 3MRSA 2ZROA 3KFXA 1X3SA 2V8OA 2WSSD 4TYPA 4PPGA 4TSFA 3R20A 3Q7PA 1JAIA 2BKUA 2ZJYA 4UXJA 3D8BA 1Z8FA 2ODEA 4YDHB 5TMPA 4JL6A 2GEUA 4D4MA 3HPQA 4FWTA 2K5UA 2BMFA 2YOHA 4BFWA 4DLXA 4V02A 2R44A 4ZO4A 2VPPA 1I2MA 1GAJA 1UKZA 2H7VA 5FPTA 2HT6A 1EXMA 1BIFA 3W5JA 4D0LB 4ZDKA 2ORVA 1TNDA 4BLOA 3THYB 3AF0A 5CIQA 4I1VA 2WWGA 3UPUA 1FTSA 1JR3E 3BH6A 4OI1A 4POAA 2O8BA 3CWQA 1OHHA 2JDID 3QG5A 4MRSA 3U3KA 4XJXA 4NL4H 1JPJA 4B3XA 1OLOA 1G8GA 2W00A 4MQBA 3FMOB 3MWLA 2DBYA 3V00A 5LPNA 1MRNA 1VG1A 3QIAA 1OH5A 1VG8A 1SXJD 3IKJA 4DLUA 3BWDD 3P4YA 4F7WA 1NP6A 2YC4C 3U3JA 2WM9B 1IM2A 1ZD8A 2DFTA 2R6GA 1N5IA 4AY2A 1XTIA 4Y0AA 4OI4A 5JJKA 3SBDA 2DPXA 3C14C 3DKPA 2WICA 4NCHA 1BH2A 2LCFA 4RFSA 5C2JB 3GLIA 3K1JA 1G291 4OQFA 2JLWA 1ZNZA 2B8TA 5JCPA 5J4KA 3AVPA 3U2QA 3LNCA 2WMNB 1P9WA 1MV5A 1OFUX 3KKQA 3B1XA 1KI2A 3C5HA 4IDQA 5IK2D 2ZS7A 2WWYA 1EK0A 1KYIA 4V0NA 5IF9A 5KU1A 1IY0A 1L7VC 1U9IC 1G5PA 1NJFA 3P4XA 5E4FA 1KDOA 1VG9B 2IWRA 3FMIA 4A36A 3T61A 4LGMA 4JS0A 4LC1A 3FFAA 1YZQA 1Z28A 2HF9A 2B8WA 2ZJ5A 4Q47A 4R2IA 5JZVA 2QTFA 2WIBA 3T1QA 1KK2A 4XTRA 1QHGA 1W44A 1G18A 3GLFA 1GKUB 2GDJA 3IBGA 3CW2A 2CNWD 4TZ6A 3I5XA 1KO8A 5DN6A 3ZD7A 1KNQA 4UJ5A 3PEWA 2NMVA 2CE2X 3HPRA 3PV0A 4ACAA 2QSZA 1W36D 2OAP1 2J45A 4HUQB 3R9WA 2QAGA 2XEXA 5GVRA 4ESVA 5L3QB 3RS5A 4GT1A 4Q4JB 1G20E 3DMNA 4M22A 4TSFD 4V0MA 4MGZR 5D3MB 5JRZA 2A5YB 4HATA 4RD1A 3SEAA 4AD8A 2J0UB 5HE9A 2OHFA 5FUVA 3BS4A 3TH5A 3L0OA 2AR7A 2FWRA 4CEIA 1G6OA 3BXZA 2OCYC 3SI7A 2Z43A 1G4AE 2OXRA 1Z0KA 3A1UA 2VLIA 4O2LA 5H8WA 4D0GA 2CL0X 1K5DA 4LZZA 1ZYUA 4EKDA 1XZQA 4OHYA 3DEFA 2FPKA 4UNNA 4BFTA 2HLDD 3QPVA 5IDVA 2O52A 2PLFA 4PO8A 1E1QA 2JIZD 3HYTA 4NCNA 4BZPA 1OHHD 3CR8A 4OQXA 3RSLA 4K81B 2IYUA 5JJLA 1N5LA 2ZAMA 2AK3A 3K09C 1YR9A 2NO7A 3SU8A 1RVDA 1TU4A 2GVZC 4TMTA 4N0EA 3HU1A 1TADA 5KDLA 4X8OA 4C9BA 2ZSFA 2NG1A 4D82A 3VR1A 2HCJB 2B7CA 4EAQA 521PA 1E2DA 2VHQA 4Q1BA 4LHWA 1OIWA 2ZE7A 1Z83A 3AB3A 3BERA 4PPNA 4US2R 2JLYA 3TE6A 1F3OA 5DYIA 5FTLA 1DBSA 1UADA 4H1VA 4P4TA 3PXGA 2GXAA 1GM5A 2W83A 3RS2A 3QVVA 3TUIC 1W2GA 4NZYA 3SFVA 2GK7A 5JS8A 1ZUHA 3T1TA 3E5HA 4AKEA 3CKLA 3QXSA 4KVGA 4RD2A 3CO5A 3UWKA 4XWAA 4I81A 2Y8EA 4JKIA 1OKKD 1XJQA 4DLSA 5EP4A 2O8BB 2ODWA 2C9CA 4D4LA 2NTYC 3K70C 3FKSA 1LFDB 4Q7MB 1CR1A 4XOIA 1GL9B 1KAGA 1D9XA 4QRHA 1F6BA 1I4LD 3SYLA 4DLZA 1KDTA 3LAWA 2JJ1D 1ZCBA 3QUSA 5B58C 2W0SA 3QXJA 5J40A 4B3GA 2ZJBA 4PZZA 3FMPB 5EP1A 1AJEA 1X1RA 2JATA 1TPZA 4MKIA 1U8ZA 4BFYA 5DI3A 4MRVA 3TUZC 1LB1B 5DNYB 4PXAA 4RFSB 3RSOA 1A7JA 1PLJA 3B82A 3WMGA 2EFCB 5LD2B 2VP6A 3X1ZA 1JB1A 5B2ZA 3GFPA 4OJKA 4OHZA 4TLDA 2MSEB 4HAYA 3I61A 1G7RA 2XNDA 4IXNA 4M9QA 4KLNA 4TL8A 3VX4A 1W0JA 2WKPA 1EX7A 1T3LA 2QQ0A 2F55A 4HB0A 2CBZA 4LJ7A 2J9RA 2ZUBA 4DLYA 2QMHA 4IHQA 3LW7A 1W5TA 1GRRA 3AUYA 3FFBA 4DCTA 4FMDF 4KFTA 1MKYA 4Y0VA 2C04A 3F8TA 4GNKA 5EUQB 5E7MA 1E4YA 4TTQA 3QI2A 3AF2A 3GLFB 4G5RA 2ZRFA 3B6EA 2NPFA 2BWJA 4G01B 1ZC4A 4I1OA 5JEEA 3AVVA 1IOZA 3U5ZB 2AK2A 1VMAA 3GLHA 2HXYA 1HTWA 3JVVA 5H68A 5SZHB 1MO3A 4ZDJA 4R98A 1M2OB 3FB4A 2QAGB 1NIJA 5BN3A 2VP2A 2XJ9A 4M9SA 1C9KA 4NU0A 3CB4A 1ZW6A 3FWYA 2OFXA 1WDTA 1TUEA 4TLCA 2GBLC 3DOFA 4NTZA 4OHWA 4JKYA 4LI0A 3SN6A 3NBFA 4V0KA 1ELOA 2CL7X 2OM2A 1FUKA 4RD3A 1MRSA 2WAXA 4CEIB 5FPKA 3E1SA 2ZSBA 3WRYC 2VHJA 4NP6A 5K8TA 5KDOA 2YOGA 3W6OA 3L8YA 2MSDB 4NYIR 2GAOA 3I8XA 2F6RA 2GHIA 3VU9A 5CK5A 3GLIE 4AKGA 2C9YA 1AM4D 3IO3A 4YONB 2J1LA 5KDDA 4DSTA 2R65A 3H2YA 3X1XA 3U61B 1NY5A 3AKYA 3B9QA 4MDEA 2WJIA 1VCOA 4MRRA 5FTMA 2G6BA 1OW3B 2PMDA 4JIMA 2X77A 2XGJA 1JEDA 2EWWA 4JYBA 1UKVY 2CHQA 2HCBA 3FKSD 1M7GA 1SKYB 1YU9A 2QM7A 3UXMA 2VTKA 3ICQB 2C98A 3CX6A 2MSCB 3L0IB 5SZIA 3CNOA 4FWIB 1S1CA 2ZPTX 5EXXA 3A1WA 4OHXA 1Z22A 4AG6A 1E0AA 4KCGA 3KQNA 4JLNA 5EP3A 3A6PC 2NO1A 4KV9A 1R5NA 4HLUC 2ATXA 4JLAA 1DOAA 1XTKA 1Z07A 4KSCA 1NVVQ 5DH9A 4ABYA 1KIMA 4QM6A 2IF2A 3IPYA 1YRBA 2P2LA 2QA5A 3PENA 1XX6A 4R7ZA 2JLQA 1V5WA 2OCAA 4X8MA 3HJNA 4DUGD 4DDUA 4PFSA 1F5NA 2YNMA 3TAUA 2Z4RA 3AF1A 3CLVA 4HAZA 1R10A 3UKDA 2A9KA 2AWOA 2VHTA 3C5CA 4V0ME 3G82C 2O0KA 1R4AA 3RANA 4JVLA 3O8RA 2RGNA 3VHLB 4M1KA 4KXFB 5EXPA 2BKEA 2H92A 2RKOA 4MRPA 2FA9A 4F92B 3U60B 2N42A 3Q72A 2IUTA 1S3SA 3K9NA 2ONKA 2ZIAA 2CXXA 2PEYA 3PG5A 5FFMA 4A0GA 4BPBA 3RS4A 1W4RA 5B57C 3EX7C 1X86B 1AN0A 5BN5A 3W3AA 4R9UC 1Q21A 3OEHA 4LYHA 1E0JA 4Q1DA 4C4PA 1DO2A 4LPKA 1AA9A 4PC2A 1HA3A 4KU4A 5DI3B 3A4LA 3ZVLA 4DWJA 1P2SA 3WNDA 2DY1A 2OG2A 2ZYTX 1AIPA 2PCLA 2J0SA 4H1UA 1NN5A 3LXXA 5GVSA 5EE5B 2ECKA 1AK2A 4I4LA 4TLEA 3KUCA 5D3QA 2QM8A 1T0HB 1ZM2A 5FOSA 2DB3A 4TYWA 2Z83A 3TSZA 1B23P 2OLKA 5C4GB 1Q0UA 1KJYA 4N3NA 1G8YA 2FGJA 2VP5A 2NO0A 4TT3D 3UMSA 4WZAE 2W2TA 4G3XA 1QF9A 3BFKA 1A82A 3BRWD 1M7HA 2HYDA 3BAFA 3K9HA 5AWFC 1S1MA 4PC3A 3ONWA 1JXOA 3IQWA 2UKDA 5EE1A 1Q1QA 5AK0A 1HT2E 1NN1A 1ZVQA 2WKRA 1WB9A 4TYYA 2NPIA 1W4BA 2J7PA 5KO2A 3MUFA 3VR3A 1P60A 5AUQA 1HH4A 3GLHB 4TL9A 2CJWA 4BEBA 2V7QA 4D80A 3IHWA 2QGNA 3DHWC 1NBMA 2G3YA 4KI0A 1VCIA 3IGFA 4Q00A 4X8LA 4BLRA 3A1SA 3QPWA 5JHHB 1CU1A 4DSUA 5H70A 4KYIB 3DM5A 1OXUA 2ZR7A 5FL7A 2D2EA 2CLDX 2FFQA 2OO7A 4UNQA 5EXSA 4A0FA 3VKHA 1UKEA 4TN1A 2Z0MA 4Q1EA 2IX3A 2FFBA 4FMCB 4JLPA 4JT2A 2FSGA 3QF4A 4TL6A 1Z0AA 2DFNA 3X2SA 3EIHA 3VU9B 4P4UA 3LVRE 4XD7A 3CRVA 1E69A 2MMCA 1TQ2A 2ZQ5A 2JJ2D 3F3YA 5CB6A 3R8FA 2F3RA 1LS6A 3PQCA 5EQTA 3ZIAD 1OFTA 1R0ZA 3KB2A 3NC1C 1TF2A 4LBWA 1UFQA 2QE7D 2RGBA 2IL1A 2V6IA 1RW4A 1UDXA 4B76A 4XVRA 2B6HA 1QHHA 1SXJC 4Q1AA 1WXQA 4NYMR 4CIDA 3ECCA 1XEFA 5M04A 3AEZA 1OXTA 3NG1A 5E95A 1W49A 4GOXA 3KQKA 1A1VA 4G5SA 3CUEF 3KKNA 3BORA 5FUXA 2ZAOA 3H86A 4C3ZA 4M21A 2PX0A 3CX7A 5TARA 4D4KA 4CT4B 3ASZA 2FFHA 4P31A 4PTLA 1VIAA 4RVCA 3DKVA 4TMWA 4F4JA 3DL0A 1WBDA 1KI4A 3GLHE 2VA8A 4Q4HA 3SDZA 3CX8A 1GNRA 1Z0DA 3EPKA 5TDHA 3B13B 3RC3A 1RC8A 4MRNA 3CPHA 4PSKA 3GCGA 1XNJA 1MO5A 2GCNA 2VHCA 1QDEA 1KI9A 2ZRMA 4M9ZA 1G3MA 1Q1BA 4PPQA 5AJXA 1VCMA 3V4RA 1LV7A 3RS7A 1DAHA 1DEKA 4GRAA 5JHGB 1KO1A 2J59A 1KO5A 1P2VA 1VHTA 5AJVB 1GNPA 2N46A 4UQOA 1OT3A 4URXR 2VRWA 3CM0A 4IFEA 1KI7A 2D3WA 4Q5IA 2AKYA 1F2UA 4IOJA 1W36C 3CIOA 3HYRA 2W6JA 3K0SA 3SS8A 4Z54A 3EA5A 2QT0A 4FMCF 4GBMA 3QEOA 2Z5FA 3PEVA 4WZ6A 2RMKA 3OAAD 3O8CA 5H1YA 3X1YA 1QHSA 2V7QD 3MMPA 1G41A 3ZGXA 4HDQB 1KHTA 2HT1A 1S0UA 3GEIA 5FBWB 4QJ3A 2C2HA 2EYQA 2ZRPA 3ADKA 3C4JA 3T5DA 2H5EA 3J81k 2KWIA 4QHTA 3DPUA 4MGKR 4WZBE 5EE3A 3NH6A 2EWVA 3HR7A 3ZVMA 2JLVA 2QMOA 1G7CA 1B0UA 1JAHA 4IOMA 2ZE5A 2XB2A 2REBA 2VHUA 4KBGA 1BYUA 1EG7A 1JR3D 2PT5A 1LTQA 3WHLA 4JLDA 2WPDD 5DSZA 1RPZA 3LQRA 3FVQA 4KFRA 1G16A 3ZH9B 2FDCA 5J4HA 3UK6A 3DM9B 5JSZA 1GOTA 3B1VA 2SHKA 1KDRA 1KJWA 4P32A 4A8JC 3AVXA 2J0QA 2LKCA 5FTKA 1OIVA 4QHSA 3RRZA 2I1VB 1DTSA 1G3RA 2ODBA 3QKUA 2CJWB 4JL8A 2ZM5A 1CF4A 3SC3A 4Q7JB 2DFKB 2GA8A 2GJSA 2A3RA 3VQTA 2H1LA 1P9RA 2MMGA 1FOEB 4UNSA 1S96A 2QTHA 1L8QA 4OBEA 1N5KA 2ZRNA 4LY6A 2OESA 2KE5A 2ZJZA 2ZJOA 4AYWA 5E3HA 3LXRA 3U7FB 1LS1A 2EW1A 3RAPR 1T5IA 4RY2A 1FMLA 2VEDA 3ZZ0A 2HUPA 3ND8A 3U3MA 4QHYA 4DKXA 2YWFA 2ANCA 3GJ3A 3QF4B 3PUZA 3VKWA 2R9VA 4A0RA 4LJ5A 4A2PA 3CH4B 4FCWA 3H84A 5DYGA 4UJ3A 2BM0A 1X8LA 1ZM4A 2XZLA 3HP1A 3P1JA 3A1VA 2FEOA 3MWKA 4JZKA 4Q19A 1QHHB 1H8EA 2R62A 1GUAA 4O0MA 1NKSA 2ZRDA 2X1VA 3B7GA 2BOVA 2G9NA 4ZCIA 1BKDR 1M74A 1MR3F 2QMUA 4BRUA 4EPRA 4D6PA 4DCUA 3Q7QA 3SZRA 4KHZA 4GZLA 4JJZA 3IDQA 4QGHA 4ZCLA 5ELXA 3AVUA 2OT3B 3QBTA 4MKGA 5HKKD 3KKOA 4RZ3A 3U6KA 2RCNA 1S2MA 4PZYA 2CLSA 4B73A 2QAGC 3AGQA 3N70A 2JJ8A 5G40A 4DC9A 3D7MA 3QE0A 2FFAA 2DFLA 2GVDC 2QNRA 3TMKA 1GL7A 1US8A 4EFLA 1N6PA 1WE2A 4Q7LA 4Q4HB 2IYXA 2ZR9A 3ZVNA 2FJUA 3REGA 2BBWA 2V1UA 3TQFA 3KQUA 1BS1A 1NBME 3BOSA 5DE3A 3CF2A 4PSAA 5KPDA 1D8TA 2X2FA 1NI3A 5LB2A 3LH5A 4AKHA 1OXVA 4ASUD 4F93B 1N0VC 2C78A 4MYUA 4DB2A 4A0HA 2XNSA 2D7CA 2DWQA 2I1QA 3MWJA 4Q1FA 2W6ID 4QJ5A 5J47A 1VDZA 2XXAA 2XB4A 1AGRA 4TMVA 4WW0A 3O8BA 5FPSA 4NCKA 5KNCA 3GFOA 1F2UB 4GFDA 5JECA 4B71A 2OCPA 1E6CA 2IC5A 1W0KD 2CLCX 2OBMA 3WY9A 2O5VA 4Q9IA 1G9XA 1CJUC 3V9PA 5B64A 1EFRA 3ZQJA 2BBSA 2VL7A 3DZDA 4JLMA 3L8ZA 3C7KA 2IYRA 1LF0A 2A2ZA 1U90A 5FBQB 4WXPA 5G3YA 3QY0A 3I5YA 4M2LA 3R8CA 3B78A 2OILA 2H8KA 1P61B 2OV2A 4GSYA 1ZJ6A 2ZI4A 4L9WA 5J4LA 2WVJA 3TVTA 2R6AA 1FNMA 2XSZA 1VKJA 2CCJA 1N3BA 1OF1A 1UBFA 1P62B 4FIDA 1KKMA 4N1AA 4P3YA 5LBIA 5TY0A 5IHPA 4JL5A 4V03A 1CIPA 2KSQA 2E87A 1IN7A 1EFHA 2D62A 2ZS9A 3I4LA 4FD2A 2DWOA 1OFIA 3EIQA 1GITA 3KKMA 1OH7A 1G64A 4Z1MA 3SYNA 4NBSA 4BRWA 2OZEA 4B47A 3R9IA 3PUWA 3OIUA 3EIEA 3WMEA 2FN4A 3WMFA 1R8SA 2PLRA 3GEHA 2OAQ1 2ERYA 5JSZB 1D5CA 1U94A 4LJYA 2A5DA 1A2BA 4HAXA 1GP2A 2C99A 3OFNA 2D74A 5FBRB 5L3SA 1E2KA 1YRAA 1FL9A 4NH0A 4LSGA 1QZXA 1CULC 2VH5R 1XXHA 3X1WA 2ZI7A 1V43A 3IEVA 2F1IA 2P6UA 4EUNA 1JBKA 4LBYA 4Q9KA 5FR2A 4IVQA 1M1YE 2RB4A 3SJCA 3I73A 1J8YF 1AS2A 1KTVA 3WNCA 3BE4A 2ZSEA 2J5XA 3WP1B 2R6DA 1QVAA 3PITA 4UXIA 5FTNA 1W7AA 2OBLA 3LX8A 3R9XA 4PAOA 3LX5A 1XTQA 2JCSA 3LDAA 3P27A 3Q3JB 4WAUA 3NVAA 2AX4A 1P9NA 2WWXA 2GXSA 1P4SA 4QGFA 3D6TB 3U7HB 2GESA 1VCNA 5J4YA 1IXRC 3WP0A 2JA1A 1E2GA 4C7OA 1AQUA 2WTUA 1W46A 2PZFA 5LB4A 1NF3A 5TB5A 3MJHA 5FH9A 2GNOA 5KSPA 2W58A 1Z6XA 1OPXA 4LV8B 2FH5B 1VECA 5A5GA 4IEIA 2Q3FA 2HYIC 3SBEA 2BVNA 2OFWA 2J0VA 3AQ4A 3C8UA 3LBIA 4G0NA 4BLPA 4MGIR 4BASA 1TQ6A 3CZQA 5BWMA 1RE0A 3EZ7A 2F1JA 3CNLA 1T8TA 3AVQA 3DOEA 1CRPA 2WJYA 4RCYA 1G4UR 1XCGB 3U3RA 5EJEA 1LVGA 1E2EA 3ZQ6A 4IDNA 3RHFA 4FMDB 1US8B 1BYIA 2HDNB 1HYQA 3TSWA 4WA7A 1W1WA 1D2EA 2BCGY 2N1BA 2GEVA 4CDGA 1R8QA 1XEXA 1YR8A 2H17A 2VP9A 5AR1A 3ZYCA 2IWHA 3BGWA 2EU8A 1KZ7B 2ZR0A 1M6NA 1RRGA 3L0PA 4U7DA 4MDFA 1ODFA 1TUIA 1U2RA 1U8AA 2H16A 3NDPA 4WVFA 1I2DA 1RFLA 2QUZA 2C8VA 4KJZA 4IOKA 3QVUA 1KSJA 1LW7A 1Q57A 1JQJC 1OH8A 1CS4C 4M1MA 3Q85A 2XXAB 1KKLA 1S9DA 2DYKA 2PL3A 2Q3MA 3ETLA 3K0FA 4A2WA 4DIDA 3K0EA 4YDSA 1W47A 4HAVA 3VR2A 1LNZA 1D2NA 1TQ4A 3JZMA 3IQXA 4Q03A 1AZTA 1BOFA 4GZMA 1ZBDA 1G8HA 3RABA 1AS3A 1OB2A 1OV4A 1EFTA 1VPLA 2WOOA 3CZPA 2FSIA 4DCSA 2WV9A 4E07A 1F60A 2ZI9A 1Z0FA 1JNYA 2ZRJA 1S9HA 2ZU6A 1ZIOA 2YVUA 5DN6D 4DB4A 4TTPA 4DLRA 5G41A 5FL3A 2FSFA 4M1OA 1E2LA 3GJ4A 2OXCA 1COWA 2F7SA 1E2HA 4UXHA 4LBZA 4AC9A 1XDBA 3TQCA 2GZHA 4LUCA 1RRFA 1G3UA 2IEYA 2UVQA 2YWHA 1UBCA 2O8EB 3AH8A 1T91A 4QFMA 2BCJQ 1IY1A 2RGNC 1P73A 2QY9A 1TX4B 1KJZA 3TRFA 3WRXC 2GWHA 4ILEA 2BEJA 5EP2A 1SVLA 1NVWQ 4URUR 2C03A 4LOAA 4IW3B 4GMXA 3K53A 5FUYA 4TZ0A 1WQ1R 4P0TA 1XCMA 5L3SB 1J2JA 4D2IA 4Q1CA 2QRZA 4DLWA 2GK6A 1XXHB 2QMEA 1DAKA 1O87A 1OYYA 1R5OA 2HJVA 2XITA 4Q4LA 3PVSA 4LPSA 5KNDA 1XF9A 4OHVA 2PJZA 3NXSA 4Q21A 4MITA 4B3CA 1ETUA 1E1QD 1G8FA 1JPNA 4W5WA 2O8CA 1DS6A 1E9DA 1YZKA 1P2UA 3VMFA 5CDFA 1E2PA 4JMPA 1UDWA 4KSBA 1E1RA 5BN4A 1R0XA 4RD4A 3SE0A 3WYFA 1E9AA 2IHBA 2P65A 4GI7A 3LBNA 3CF0A 1ZP6A 1MH1A 1KO7A 4HB2A 2GJAA 1GG2A 1E2NA 4C7OB 1TEVA 3ZD6A 3DDCA 2NO6A 5HZHA 2RGEA 1E2MA 2ZJ2A 4NYJQ 1DE0A 1XD8A 3GJ7A 1FNNA 2XOKA 3A4NA 2RHDA 4RJLA 5DISB 2XTMA 4GDFA 4FMBB 2O8DA 1KY2A 1E9CA 5J5CA 3DZ8A 1GZSA 4YQFA 2IS6A 1ONBA 1SKQA 4NE2A 1XTJA 1NSFA 3BH0A 4HB4A 1YQTA 3K09A 4JBYA 2IYZA 2GEDA 2JLZA 1PV4A 1NVUQ 5HTKA 5F2EA 2JGNA 3IHLA 4M1YA 1T5LA 3CRMA 3TW4A 5GJBA 2VQSA 4JYCA 4Q9JA 3AUXA 2ZYVX 3PR1A 3EZ6A 4XWKA 4LDJA 1GVNB 4QL3A 3CR7A 4Z8XA 1WCV1 3NEJA 2F9LA 1KMHA 1II8A 1Z47A 4D26A 1JJVA 1G3IA 4EJSA 1O3YA 2AXPA 3QOFA 1N6HA 5AUPB 2FNAA 1VTKA 3VNUA 4L9SA 1ZUNB 3VX3A 1XXHE
chains in the Genus database with same CATH superfamily
5CT4A 5D5QA 4EDHA 1T10A 2ZRIA 2DUWA 4UAGA 1JN0A 4YIKA 2PM8A 2OCBA 3UQYS 3E22A 4DM7A 1SUBA 3AESB 3NASA 1QVRA 1PZFA 3MEQA 4G5QA 1FLVA 2NO9A 2Q41A 4Q37A 5FO0A 5B3JC 1HNXB 1K4KA 2ZATA 2W5UA 3DBLA 1DU4A 3EXHA 1RM3A 2QLNA 3OHSX 2JIBA 3M70A 4PQYA 2ZRBA 2XNDD 4MDFA 3NTRA 4N8SA 4YPVA 1YQUA 3URKA 1FPQA 3IEXA 5C51B 1DRVA 1O9GA 2BW0A 3L82B 2FEXA 2P6PA 3N0VA 4JBXA 3OEEA 3V48A 3WX0A 5HSGA 3GJ0A 1BDJA 3IALA 3T99A 2YW9A 3CE6A 3M9XA 4IUYA 4RVFA 5BWOA 3AKZA 1O94D 4UHHA 2GVNA 1U6JA 3VVMA 3K2BA 5JFGA 5G02A 1DPFA 1H2RS 3W5AA 5EKTA 4ZXPA 2WSYB 2QNBA 1PUJA 2XE7A 2CJPA 1MTOA 1MXHA 3EOAI 3F5SA 3FETA 4M88A 4W7SA 5DHAA 3V8NA 3VPSA 2IFTA 4GSKA 4DEVA 4MI1A 2ZJ1A 4ZO9A 3E48A 4CUJA 4D3FA 5CITA 4IV0A 4NICA 2H2WA 4CMIB 3DO8A 5KYWA 1V35A 2IOQA 3E53A 1J0XO 1SB9A 4H15A 2CVFA 2GILA 3CLSC 1E2BA 2I62A 1R4ZA 4U7HA 4F12A 2KW5A 3VGJA 3QBVA 3SFZA 3WV4A 1GFIA 4A8TA 3DOOA 5J1SB 1CT9A 1QH0A 2RH5A 4FFMA 1GUDA 1I30A 3RG2A 5DNDA 2TECE 5G3ZA 4H6WA 4DBVO 4PZEA 4R1MA 3KFVA 1E1NA 3ZZMA 2VHEA 4B7AA 4Y6GB 4DMHA 4YMUA 1TTPB 3T06B 4IVPA 2Z6VA 4AJIA 2VAXA 2Z1MA 2ZBEA 4K6CA 5JAOA 1Q3TA 3ZCXA 3S4YA 4U2EA 4BLSA 5KKCA 1Q92A 1IXYA 2GZDA 5KSYA 3NDBB 5B7QA 4S2EA 2Q9BA 5BNWA 2QPOA 5K01A 1UOPA 1OFHA 4ZOLA 5H16A 4UTPA 3KJNA 3AXTA 4HNRA 1ZH0A 1YMUA 3UMMA 4GI2A 1Q44A 3ZGNA 4AKTA 5FV4A 4KAAA 4UM9D 1MQAA 3I04M 4ZYVA 3U19A 3WL4A 3HKCB 2EFDB 1ZD5A 3D54D 4CRWB 4JR1A 4QA9A 5FUMA 3VH4A 5AH0A 1Q7TA 1ZU5A 2ONZA 2P5SA 5DSXA 1MOZA 3BSSA 3MHPA 5J9FA 5DM70 3K3PA 3ZS9A 2UUPA 2DPMA 2FRVA 3JTMA 5BN4B 5CFMA 4C2TA 4Y6OA 1SEPA 2XA9A 3NKVA 4WSOA 3FSJX 4ZT5A 4Z7QB 5JMOA 2AZTA 1SVUA 4DR3B 4BQPA 1JT2A 3LT4A 4ME6A 3GDGA 1Y3BE 3TR0A 4TYNA 3NAQA 4IBOA 3FD8A 1EDZA 1YDMA 3F5MA 2BR5A 2HL6A 4OKSA 3VC1A 1O9BA 2ATEA 5JYEA 2G8NA 1L0BA 4ZHQB 4QQ8A 3ORHA 3P20A 3S7ZA 3JQ9A 1L7MA 4B4VA 2RG7A 4R7TA 5AJWA 1U2TA 4QOFA 2XZDA 1R0WA 5JEDA 2O8DB 1N1EA 1FMTA 4RF5A 1LK5A 3KJFA 3L79A 1TF5A 4QC2A 1UBGA 5KNBH 2FJ0A 1V39A 2BFDB 3HJFA 2WHXA 1SQGA 1UP6A 1E99A 1RJ9A 1VJ1A 5FWDA 5HCUA 4ZGGA 3IYLW 3A3NA 3KZ1E 3TLZA 4CV1A 3R0QA 1F0KA 2PFKA 3IIKA 2XTZA 2FUCA 5A3JA 1R16A 4HZUA 1J21A 1PYOA 3IVGA 3NWJA 3BWEA 2WNIA 3QNWA 1DWOA 1NOKA 1RABA 2B61A 4OP2A 5BUQA 3EEFA 1GZDA 3GZNB 3MAGA 5KUTA 4WX2B 1RIFA 1G0OA 2AN9A 4EJSB 1M8PA 4CEHA 2FUKA 3OA0A 5AKIA 2CCGA 5ES4B 3TZKA 3TQSA 2XCTB 1VQ1A 4RA9A 3IILA 1U99A 3KQOA 3ENVA 2QD3A 1P4JA 2B3TA 4KIWA 4FJ1A 2HI0A 4JLVA 2BHLA 3GO4A 5ALWA 2HBZA 3K5PA 1M2VA 3OLQA 1GFWA 2VUUA 5EE0A 4CLOA 4WK6A 1AHIA 2IUEA 3SAJA 5B1EA 2C57A 1PAUA 4CU2A 4HDKB 4KOEC 3NCTA 4EJ2A 1GN9A 3TG8A 5JJIA 3ORFA 1E79A 4Q3EA 1TW2A 4GR5A 1HXHA 4I55A 3JATB 5I7VA 2UUBB 1EWRA 3KEOA 1G17A 1TF7A 1VBNA 2IYAA 4IVRA 2VYFA 2FI1A 2XLBA 1MMFB 3H9BA 4YXWA 1LI4A 3EDQA 4FUQA 2IUUA 3U62A 3W4KA 5A3RA 1U7HA 4BFXA 4EMUA 1RBQA 2WJ3A 2Y71A 3R3VA 4QDXA 1WKBA 3OJCA 4B7XA 4EA8A 5FPPA 2O2DA 1IM5A 1FFCA 3G0BA 1Q0ZA 1NM5A 1FYFA 1N5MA 1U2DC 1ZKMA 4KFSA 3CQ9A 5DOVA 3SQOA 5JUWA 3MGCA 4U2DA 2QZPA 2P5YA 2AX3A 1TK2A 4OSOA 1W4CA 1Q6ZA 1IEQA 3JWIA 5D00A 2PUBA 3AWIA 3RFTA 2ZIVB 2BGMA 4BMZA 4KPYA 3SM3A 1UMBA 2J85A 3PFGA 4IEFB 4MO2A 1LBIA 3AV0B 1UQUA 1WMSA 2J7PD 3VR3D 5EIBD 1XZKA 5BV2P 3OBIA 3L02A 4E21A 4E5PA 3HUUA 3TNFA 1ESCA 1JG7A 1JDBB 2J5RA 2X86A 3IUJA 4DJTA 3A9CA 3K31A 5I7OA 4NHEA 5KZMB 1UKCA 1W19A 3PC8A 3AEQB 3UMYA 1U0FA 1EGQA 2XT6A 1TTQB 4ZOCA 3K9LA 3QPBA 2GM9A 4FCCA 1X1CA 4IRUB 4AJPA 4TVKA 1M8FA 2FYTA 4EKGA 1DC6A 1A97A 1SC9A 2GMWA 3BDIA 3NBXX 4C2BA 1VL5A 2I34A 1Y7TA 5WRFA 4E32A 3Q8XB 2GEKA 2PVSA 3SHTA 1IWPB 3JQAA 5J2UF 5A9RA 2GJ9A 2NW6A 2BE7A 2HA7A 3FOBA 1H3NA 3HI4A 2E4UA 3I6MA 4G67A 4NCXA 4N6OA 3T7EA 4RYDA 4ZV4A 3TKLA 1M6WA 1C3XA 1PKEA 2MHCA 4GZ6A 4LKOA 1FDRA 3OSUA 3HNOA 4PCVA 5BW8A 2QAJA 3DAGA 5LNK1 1T9ZA 4G0VA 1PIWA 4XX0B 4F46A 5LDDC 2JBHA 4CG3A 1GARA 4CV0A 4H1HA 1JLLA 1TMKA 1QLWA 3A0RB 3JQ8A 1SCBA 3D6VA 3OZXA 3RTDA 4C0SA 4TKUA 3DMYA 4LF5B 3H9EO 4K9SA 3PFIA 3PUIA 3KXIA 2YHSA 5IKEA 1I4DD 2QXUA 2NUPB 3FSRA 1BNCA 1LDBA 2KMLA 2PL1A 1T3ZA 2R1VB 2B1JA 3ZI4A 2F8TA 3RSZA 3AP3A 3H2SA 5BVHB 2AD1A 3WK9A 2GAAA 1AZLA 3V6MA 1IOVA 2G82A 1M72A 3KR9A 3L7MA 1R9GA 2RGXA 1YK0A 3O0DA 4HSEA 4RWZA 2PZ8A 3PWSA 1N5DA 4ZFNA 1SU7A 1EJ2A 1JBQA 2WILA 3OQBA 4NJMB 2KJQA 3DEZA 3U1TA 2ZU0C 2CCKA 3UMVA 3U3OA 4A15A 4W1RA 1RWXA 4GICA 1P0QA 3GLKA 4PG6A 1NC3A 1O57A 2YXDA 4YXFA 1RLTA 3HJCA 3WFZA 1C9NA 4RZHA 2ZREA 1QZZA 2NZYA 5GV8A 4XEHA 2MYUA 2QTGA 3CEJA 1FJ2A 3KXKA 4QYIB 1J8MF 4HDRB 4OUDA 4XJSA 2PS3A 5THQA 1FRZA 4U7WA 3USZA 3KAPA 2P4EA 3AJRA 4NAVA 4X1IB 3B1ZA 5ALYA 4JOBA 4B34A 4ENSA 3K9GA 4NG5A 4K9MA 4UU7A 3GLGA 1NYRA 1DEAA 3QEMB 4IJ6A 2GTHA 1MEOA 1QZ3A 4N0DA 4AYTA 3CS3A 3ER6A 4NSNA 1HSZA 2OKCA 3MFYA 1I6WA 5T8KC 3U3XA 1E62A 3P97A 1IBMB 4TTJA 5IYZF 5EJ8A 2B35A 4QO8A 1EUQA 1M76A 1WG8A 3ZS8A 3EW9A 4YUWA 2FX2A 1M2WA 1PUXA 4EFNA 1SBCA 1P29A 1WPRA 5IK2A 4XQ0A 1JALA 3GCWA 3H0KA 3MYYA 1FDWA 1CJCA 5AHKA 1E3LA 2FKNA 4BMNA 3EWNA 3OHMA 3U56A 1MBZA 1WOMA 5CFQA 4U7GA 1XRNA 3FX2A 2GAFA 1OU4A 2NAPA 4V2UA 1DIBA 5C0OE 4DILA 2YZ2A 2DPLA 3OPQA 2FZCA 3AUSA 3UICA 2DHRA 4JLWA 1S4QA 3PGXA 1JKXA 4HVAA 3TSYA 3ESCA 3E0QA 3RIEA 1PO7A 5BRNA 1QVZA 1RJGA 4DEXA 3EA0A 4M0UA 4CUKA 121PA 4XVQA 1QQ5A 5KSZA 3JASA 3WK8A 1C2YA 2QL7A 3B53X 1NVXQ 1X9GA 2WWVD 3ETNA 5KOIA 3E7DA 3OIDA 1QOPB 4K1LA 4RD6A 2IPMA 3S7TA 4QUDA 4X1YA 4M0KA 1BA2A 2HRZA 2IIVA 2JG3A 1GR0A 3MELA 3PNSA 1QG2A 3BFXA 2FWMX 2RHTA 4GX2A 1R2QA 1G63A 4G56A 4WV3A 3OZDA 4YV0A 2YCLA 2IY9A 4YHBA 3VAYA 4YCNA 1MVOA 1TL7C 4FCTA 2Q4TA 2QP3A 5DNVA 3AF3A 2JARA 3VNAA 1UJ4A 2A1UB 3RAGA 3W3ZB 4WK0B 4Q15A 4UHDA 3T7IA 4CM6A 1NVTA 3U49A 1JKMA 1QGED 2VT6A 4XUEA 2BJHA 4BX2A 4RZXA 5J1TB 1OUMA 3TW6A 1V4NA 2JLSA 1GKIA 2ZTVA 4PBRA 5EZSA 4BO4A 1FF9A 5MDHA 4CT5A 3EDOA 6NULA 4L85A 2C95A 2BFEB 3GN2A 3MERA 4ZVQA 2ZWMA 4A0QA 4NATA 1XMSA 3WV5A 4C1BA 5JY1A 2EW2A 1HLDA 1JU4A 3VSCA 5DTRA 3MPOA 2NWQA 1FUUA 1W48A 4A2CA 1HNNA 4YCJA 3Q9LA 9MHTA 2RGGA 3EGVA 1CZHA 5DHRA 1EK2A 3I37X 2PKEA 4M9XA 3TLCA 1G6HA 1V71A 2PMCA 4L0CA 4EAAA 3ZOKA 4NCJA 4DLNA 4M7OA 2PKYX 2XRMA 4R1QA 5TGZA 1VI5A 3R77A 4B85A 2XCRB 4IQFA 4JC8A 4LXXA 3OJLA 4GYKA 4W9MC 4NBTA 2CLLB 3LZ6A 2OOSA 1Z0UA 2XIQA 3BUSA 3KV3O 5AI6A 2O8EA 3IAEA 3K0KA 3PPIA 3KOXA 3KZCA 4N12A 3EPJA 1JIUA 1J23A 4BMSA 2I55A 5TRTA 5H82A 2JASA 2MYPA 1QIMA 4MGYR 4Z9FA 3IX7A 3LC2O 5H3CA 5C1PA 1R88A 4BNYA 1GPWB 1CP3A 3CEAA 3JYHA 4X1KA 3UUEA 1Z29A 4GU5A 1WCWA 2I4RA 4DPKA 1L6IA 1OD6A 1NQAO 1ZN2A 4H3HB 1E98A 1NXQA 1UT6A 2Q50A 1T5HX 3RK0A 4CN8A 2F9FA 2XA1A 4J29A 4O25A 3GT7A 4D9GA 5B2FA 4IWXA 1QHXA 1SZCA 1WMEA 1XN4A 2DKOA 2UZ1A 3GFQA 1SUWA 3N59A 3PUVA 1UBTS 4P93A 5K0NA 4OHBA 3WGHA 5G0SA 5IBRA 5LQRA 1H8ED 1QQAA 3M9WA 2VFAA 1FPMA 1M1NA 3AOGA 4EIWA 1D7OA 3PDUA 2GLXA 1UEIA 5EOVA 4DLBA 5MF6A 2NSDA 4DCVA 3L8CA 2IHVA 2BC9A 2WA1A 5CURA 2PWAA 2ZJAA 4X95A 1DBIA 1RQPA 2PSFA 2WIAA 3TSCA 1PLLA 1WB5A 1UK9A 3QEJA 1SVIA 1DBQA 1PJLA 1SKBA 3I2FA 3L41A 3PFWO 4RHFA 2C5FA 4C14A 2IZ5A 4C7MA 2GXUA 2VIIA 5LMNB 3CEHA 1C1DB 3GD7A 4AS3A 3K1TA 5LZ8A 2R8RA 2DT8A 4GBGA 3DMTA 4JJ4A 4MUAA 2E5FA 3DF9A 3TQQA 2IBTA 4DMKA 2DLCX 5HF5A 3GRUA 2C1ZA 3LTEA 1KJNA 4JFRA 2I8CA 2JJ1A 1T3TA 3QVWA 1SXJB 2X8BA 1X3LA 1QMPA 3DE5X 4KE7A 3T95A 1EHYA 3OA2A 4M1EA 3HV0A 4DCCA 1OI4A 3HDQA 3TQRA 2H8GA 4U4AA 2X5KO 4WOBA 4LHZA 4RV5A 4TVSA 1R50A 1Y5MA 4XTCS 4AJ2A 2IYTA 4F4IA 3ZU4A 1GQYA 3JQRA 3CPEA 3O8OA 3WBFA 3MWYW 1HDXA 1ZAKA 2JVJA 1F8UA 1ZD9A 3D4LA 3DHVA 4L0QA 4W7HA 5ALDA 3NT4A 1XLUA 3FPEA 3LOQA 1M0WA 3O8DA 1IXZA 1IONA 2OYRA 2ZUDA 1KOGA 3DMPA 4LDAA 2DTEA 1KYQA 1S89A 2FFRA 4BCDA 2D06A 3ZE2B 2XB8A 2TRSB 3P9KA 3Q3IA 4AZTA 5JISA 3L7NA 1K9SA 1KDYA 5KNCD 3S70A 2WE7A 3K9BA 3UWPA 2F9MA 1AQNA 4QVGA 1EX6A 2XZOA 1QP0A 2QN2A 3AFHA 8ADHA 1LPPA 3NQ41 3DMGA 3A6JA 3NHBA 1MUUA 3L46A 4LFBB 1U0HC 4PRKA 3JY6A 3H4MA 2VTBB 4FT4A 1PV4A 2FF5A 3HO1A 1T9HA 4J90A 3THWB 1UXHA 1EFCA 2AT1A 2J4FA 2FMXA 4QBGB 4F2HA 4Y2GA 1TFRA 5EE9A 4JC4A 1V16A 4G9GA 3WGUA 1M1UA 3O2JA 3TLXA 4D56A 3K05A 4EPTA 1ZR2A 3REOA 1GG8A 4DHWA 2AKAB 3OH8A 1JPVA 3MBIA 4C05A 3KJEA 2XSZD 4JSYA 3O3CA 4OGKA 3DW1X 5ETJA 5YASA 4DFDA 4DWOA 1ECJA 3A9SA 3QQ5A 5BQ5A 4ZI3A 3QVSA 1BO6A 5KVCA 3EXEA 1IJKA 2OP0A 4DV7B 7MDHA 3S1AA 3OEWA 4Q48A 3DO6A 1F6DA 4AZ0A 3SQXA 2JGIA 1KEEA 2GUGA 2DHQA 1KC3A 3G9ZA 4AY4A 4HG2A 3ASYA 4PLFA 4ZALA 4IIBA 3E03A 4JJ8A 4RNDB 3KKPA 4CGYA 3GLGE 4BMVA 1YB6A 3GMSA 3N5CA 2CDAA 3KDAA 4QXOA 2AL7A 4YK7A 3JVUA 1FFEA 4MS4B 4BAUA 1YS9A 1Z5PA 5J2TB 1E1CB 3EWAA 1EDBA 4QTUB 2BGWA 1IY8A 4GL2A 4MPDA 3ITNA 1GSIA 3HACA 1J1ZA 3QYJA 4PHTA 4IDDA 4R2XA 3DE1X 2FW9A 3KSMA 2ZAGA 1QVVA 3JD2A 4J0HA 1Q74A 2WHPA 3QKWA 5ALGA 1QC5B 3U4HA 2HWKA 2JZNA 3CX4A 4OSEA 4J2TA 3ND6A 3CONA 1P1BA 5A71A 3RLFA 3TSOA 2VPYA 3HBNA 3H5IA 4KN9S 1ZI8A 1PQUA 3T3PB 3LXMA 3UM9A 1L5QA 1PP4A 4F5WA 2GBCA 2LWIA 3N6XA 3CH5A 2YYYA 3Q0TA 4LIPD 3WNBA 2YFYA 3TBKA 1E2JA 5JADA 4X3CA 1NVBA 3DCYA 3HXPA 3G5UA 1NJSA 1E0SA 3AT1A 3D6JA 1GGFA 3HABA 5HFNA 3FIUA 1SBTA 1AURA 1IC6A 3SHFA 4II3A 1H65A 1JXMA 1CUHA 2P2ZA 3VU1A 3GGDA 1C3OB 2F17A 2FPLA 2VDOB 3KQHA 3R4CA 4AJNA 1A8HA 4L8YA 1KORA 3K15A 3T1VA 3AHIA 2C9DA 5DX1A 3TW8A 4C88A 3RYCA 4OXKA 5FJJA 2Y0BA 3NJ8A 1GQFA 2HFKA 4ZRNA 3AHEA 3KQWA 1WEKA 1XZDA 4DUGA 1EQ2A 4XYLA 3KEMA 5JXIA 1QCYA 1C81A 1Z2CA 4Y2QA 1G55A 2G5PA 1G5TA 1KI3A 3E0XA 3TWOA 5C9ZA 1QF6A 3HV2A 1OFGA 3BB1A 4GBED 2I4OA 2A1TS 2R79A 2JHFA 1YHNA 5HRCA 3O7WA 1IU9A 2D4HA 2HMYB 2WZCA 2YC2C 1CLEA 3CSUA 3M4YA 2LR0A 5A0FA 1QH1A 2GGSA 3K5HA 1H2EA 4S1WA 3I9KA 3UCEA 1QG4A 3PHGA 4TQUS 3KZXA 1QRDA 4LZAA 5KWEA 4JDPA 3OPNA 4UU0A 3CF6R 2ZJ3A 4BKRA 2VYCA 5K3SA 5LN1A 3TFOA 1SELA 4HQ0A 2IGBA 4OP3A 3OE1A 2HA5A 4FXPA 2XAUA 2IW1A 2X5OA 3MQ4A 1T2EA 4RV9A 5HMMA 4R1UA 1CUIA 1CUBA 2GCPA 3CBQA 1P74A 4DUYB 5FWXB 1A98A 2IEBA 4NYIQ 2NXNA 3H1PA 1J2TA 3WG9A 4Y3UA 4PNEA 1RIIA 4MWGA 5CD9A 1ZX1A 4OHCA 2QL5A 2XBUA 3IERA 4XASA 3RLIA 1KFCB 2E1RA 3BGSA 2GD2A 2GTIA 1OTYA 1VJ0A 4I50F 2A9OA 3P9NA 3CZ9A 2DLDA 5ADHA 5J3JA 1P7YA 3FGOA 3B2QA 4NONA 4O1HA 3W6PA 2I6XA 4TMKA 2CVHA 3P9RA 3ZC3A 1Z8NA 5HPYB 2L2QA 2IYQA 5J2UA 4L7VA 5ED4A 4GF5A 5BSEA 4UTNA 3KYCB 1XJ5A 3NV9A 5LOVF 4WA8A 3ZXUB 4G65A 1VLZA 4ZMBA 1OLXA 2ZWIA 3T8YA 1F0PA 1XDDA 1G3QA 1PS0A 4RF2A 2O2YA 2W6PA 5AUNB 1I6LA 1V8PA 1YOVB 4F7DA 4YJ2B 3MBOA 4IILA 5AKHA 5JSHA 1F7UA 4DPLA 5CR9A 4B3IA 3IOYA 2XUZA 1VHDA 1NZJA 3L0SA 3OQ1A 4H59A 4GAEA 4NENB 5LC1A 3E5NA 1MEEA 2CEKA 4N65A 3BBLA 5C5DA 5C5EA 1GGVA 2UZ3A 3Q0IA 3UAYA 2JW5A 1KPIA 2DPYA 1BGVA 2X5XA 3CUUA 2YZMA 3FTCA 5G2OA 5AI4A 3VTKA 3ZKWB 3RI3A 4FYHA 1PZEA 4YRAA 5BYKA 2ETVA 1N75A 3P9ZA 5JS6A 1ORRA 1XD2A 2XKJE 4EY6A 1VIYA 4M55A 3Q15C 4GOLD 4B6EA 3O4GA 2GLUA 4YP1A 2Y1DA 2BGUA 2RI6A 1YUMA 2UDPA 1XZAA 1VBMA 4X90A 4RTRA 1H2ZA 1Z2OX 1ENPA 2DR0A 1T1IA 4I0WB 1U9ZA 1HURA 4QYXA 1QYXA 4U0JA 4WZAB 2TS1A 2O0HA 3O2QB 1ENYA 1CJTC 1M5UA 5B4TA 2I7VA 4RHTA 4ONEA 4Q24A 4J94A 5I9LA 3FHJA 1IEXA 2I2AA 1E9FA 3JRWA 3EDYA 4IV5A 4TUYB 3SVZA 3AETB 4X24A 4YR9A 1AT1A 5AOBA 1KO4A 2QBYB 1ZNQO 1WNFA 1BWRA 1B6TA 3PGLA 3PCRB 3RVBA 4D4HA 1T2DA 5C35A 1BCSB 3QXCA 4AK9A 1F0NA 2AJTA 5F1YA 4PCLA 3IOBA 2XCIA 1CZUA 3JYLA 2WQ6A 1ZY2A 1Z2AA 3I01M 2ZI6A 2P2SA 3I12A 1OX5A 4JENA 2JD1A 2Q4RA 3PX3A 2HBRA 1JHRA 4G97A 3D1LA 3I30X 3WL6A 2DM6A 3CF4G 3LPLA 3GOHA 4EJ6A 4PZAA 4QDKA 1LKZA 1CDEA 1MGPA 1NNSA 3DZCA 2HSEA 3VH3A 5K7SA 2F43A 1KDVA 3CE9A 3MD0A 4IUBS 4ZCQA 5H3LA 3WIOA 2PKWA 3FCEA 4LV6A 5DSTA 4GPAA 3WLRA 1L4UA 2XOKD 3F5FA 5I9BA 1T9GS 4KACA 4B4WA 1V7QA 5K3BA 1TXGA 4DT1B 2W90A 4NNOA 3DNMA 1Z0IA 2R0QC 3A1FA 1YZLA 1T43A 2FWJA 4RIFA 4HLQB 3OZEA 3VAAA 2ATVA 4Z99A 1QQBA 1OY1A 5A62A 3BICA 3GL9A 2VSNA 1YKSA 4PC6A 4D9FA 1JTVA 1AKEA 3HA2A 1M66A 3AI2A 1N2HA 3C3PA 4NV1A 2YQ4A 4B3HA 3PFHA 1XKQA 1A7KA 1DAMA 2Q9CA 4S1PA 2E89A 5DIZA 4JITA 3A36A 3IV6A 3K73O 3N0WA 2HH9A 4YJ3B 5AM1A 4RKFA 1ZINA 1I3OA 3O1LA 4HGOA 5JRDS 2B92A 2JAXA 1OIXA 3DCJA 3QM1A 4HEHA 1T4CB 1ZZGA 1U7PA 3GBPA 1ZC3A 2IY7A 2LXNA 4MS3B 3IEMA 2VH2A 3GDHA 3DKRA 4TQAA 4RTMA 3ZCVA 3LQKA 2A5FA 5U4QA 4ZJYA 3SXUB 2ST1A 5JZ9A 4DLVA 2XUDA 1ATZA 1HTTA 3GUYA 1SBNE 5D5PA 5SZKB 4TV8A 3A7EA 1SVKA 3Q8MA 4IDEA 5C7OO 4P22A 4R1PA 4GXNA 4UASA 5BW4A 4MEBA 3I4FA 4BNFA 2YXNA 4BO2A 2GWRA 5HQ3B 1LRJA 1W1UA 2OAGA 4QXMA 5JDIC 1JHYA 1APBA 2X8JB 2A94A 4NRDA 3B85A 1DAGA 3FHOA 3UHJA 3WJ7A 3KTAA 1DG3A 1IK6A 1TJYA 3PFBA 4JMLA 4NEHB 5TVKA 3TXAA 4AN0A 4CCYA 2BKLA 1V5GA 1PFGA 1H0KA 2E7ZA 2H11A 2OZPA 5EUMA 5LKRA 1NMYA 2W6NA 4PR0A 4MWTA 5DXFA 1KH2A 4OI0A 1L7EA 3UJAA 2OBXA 1FDOA 4M1SA 4YAJA 1QONA 2QG4A 1QHNA 2GHQA 4M1TA 3FG9A 3FZNA 2PIAA 3OEED 5LD2B 2VCYA 4CN9A 2WWHA 2O7NA 2YWJA 2MSKA 3FCUB 3II6X 5SYMA 5CFNA 1GL6A 4AN1A 1VLVA 3JARA 3WSVA 4NABA 1GV1A 1P0IA 1PUIA 1ZI6A 2IEZA 4L57A 1E4EB 1NT2A 1SIOA 3CG0A 2X1LA 3GGJA 2QIPA 4GR9A 4W1SA 4XJVA 3T9CA 5GONF 3WGLA 2FR0A 4CR6A 3KQLA 3HWX1 1ZM3A 4W1PA 2CC2A 2PUJA 3DTTA 4F60A 1CV2A 3PHIA 4IKOA 2PZEA 4JJAA 3H4VA 3CRQA 1FP4B 1THMA 3O84A 2B82A 4ER6A 1XQ9A 2UYHA 2JPDA 2CUTA 3VKFA 1JIVA 1RWPA 1ZJYA 3V97A 3A2MA 1LBTA 4A6XA 4EW3A 2IXBA 4MQLA 2KB0A 4BNTA 1MABB 1IHOA 3WHIA 4JI1B 1N6IA 4PHGA 1QBGA 5C7YA 3IFSA 4E5NA 4TXNA 5LA6F 1K7XB 1D9ZA 1NMEA 1V25A 4JHLA 3WO1A 3EQ7A 3QKRA 4M4SA 1PVDA 2V65A 2AC2A 2YZNA 3G02A 1F8GA 1T4BA 1TCCA 2V4ZA 3PQDA 3HDTA 4UD2A 1UAYA 1DEOA 1DQZA 1W25A 1I0ZA 3LP6A 5FI0B 1UDBA 2XWQA 3K9WA 3M5PA 5TQJA 2XYHA 3BA6A 3H19A 2JEYA 4AIRA 1AKWA 4Y2VA 1NMZA 3V8VA 3R3HA 4RSGA 3DLCA 1O4WA 1UMDB 4WKGA 4HWGA 2A5LA 3BZUA 1BFKA 1UBMS 3FKQA 2EG9A 4MICA 5K3OA 3THOA 1GU7A 4DMGA 3WGGA 4TTAA 1AHHA 1PSZA 3Q6IA 3NP7A 4U00A 4EOGA 1XN1A 2IBMA 2PLAA 3Q4GA 2Q46A 5T6MA 3SS7X 1NY6A 4Q7KA 1FQJA 4N9WA 1A2KC 4J1SA 2V7EA 1S7CA 1QIJA 3H97A 4O1IA 2IX9A 2F8SA 5AW9A 3KDSE 3PLAE 1WLSA 3OZ7A 5EHZA 2PPLA 1GPBA 3K0CA 4AUEA 4L2IA 5ALJA 4XE5A 1MG5A 5AQ1A 4WXYB 3VR4D 3O4VA 4D4JA 4NPHA 3Q1LA 1E9RA 5CB8A 1P3JA 1WUJS 4B2PA 4LF8B 3THYA 3ISTA 2E5LB 1Y1PA 2QP4A 4MH0R 5FOQA 3IPAA 2Y3IA 4LHVA 2O8FB 3FFWA 2YOFA 3TJMA 2BFFB 4QPCA 3DPSA 3GJ8A 4ARVA 3AF4A 4RCZA 5HKKA 4BVLA 2VSFA 5TQVA 2BLLA 5TR9A 2OM6A 4IG4A 3D4PA 2ZBUA 4MLDA 2ZWPA 1XK6A 2ENWA 4MRMA 1DJMA 3IB6A 1RAFA 2WJVA 3FCSB 1SC6A 1W6RA 2JS7A 3CLTC 4YMTA 1QKJA 3IS3A 5D2CA 2CL5A 2ZSDA 3V4FA 2Q8PA 3FPBA 4C0WA 5JWRA 2G4LA 1I7SB 2Y92A 2PU5A 5FWYA 4X66B 5JARA 1J2YA 1E3EA 2PT7A 2YUTA 1JSZA 1U8TA 4QM7A 4O3MA 3N2GB 3F71A 2FF7A 1TLLA 1T5DX 3ONFA 2DY0A 3R6GA 4G25A 4K46A 4MYTA 1C8KA 1UKYA 4K6OA 1D2HA 1YVPA 4YASA 1B1AA 1T0JB 4RYLA 3L9XA 4ZKEA 1H05A 2IYPA 1Q1NA 2P4HX 2QAIA 2G83A 2X22A 3QELA 3T15A 3G2MA 3ANLA 4FTWA 3QXHA 4J07A 4YJFA 1EFKA 2B4RO 1SVOA 4ASUA 1SURA 2FR8A 3MQFA 4QSHA 5EJAA 2AWNA 2N75A 3FGZA 5FBZA 2Q2WA 2OK7A 3EN0A 3UGQA 1ZK3A 4BO6A 1TLFA 2BM1A 3MG9A 1V11A 5C81A 1P72A 1XTZA 3IBSA 1NC1A 2J6BA 3CUYA 3UVEA 4NK5A 4MUEA 4X6XA 4EX6A 2ODTX 1QNLA 3HU2A 2FEMA 1J20A 1UM8A 4XGRA 3ZI7A 3CRW1 4WBNB 2OD7A 3TW0A 2AHOA 1Z6ZA 4AF8A 2VPZA 4KDRA 1P6UA 4XGIA 4DR1B 2QX9A 5A1TA 1W88B 2BMDA 2GSWA 1X9HA 3SYKA 2WF6A 2JFQA 2J6CA 1QE0A 2P30A 1E79D 4BMOB 4EH1A 5LU9A 1YE3A 1ISIA 1ORIA 2FPRA 2Q0XA 4BECA 5JMWA 1G59A 1NG1A 5K8JB 1IN4A 1GRQA 1KAEA 4UBNA 4YXWD 1PGOA 1VKHA 3DLBA 1ISJA 1C80A 1PG5A 3HR4A 3LPDA 3QVLA 4MULA 4EF6A 1JZSA 1J2EA 1PS8A 4XVUA 4BGDA 2BH2A 2XF8A 4XIGS 5KYKA 2FX3A 4TLBA 4ITVA 1JVSA 1O8BA 2JNWA 4FR0A 4B3FX 3C8DA 2C96A 5CYFA 4JGIA 3ICVA 2OHHA 4NXNB 3S1LA 3ZWNA 3FOFC 2HWYA 3H5AA 3SHWA 5B3LA 4IDPA 1HRKA 2EZ9A 4OGWA 4M83A 4RULA 5AI8A 3UGKA 2I80A 3P2MA 1NF2A 2VSOA 4M1ZA 1X7ZA 2EYUA 5A3QA 1PL6A 2PKXA 4KI7A 1BEZA 1XDZA 2X9LA 4REOA 3DYBA 2I2CA 1HV8A 2G9VA 3GMIA 4LN1A 4H3SA 3AFNA 1E8NA 1NJ8A 1QXSA 1XMXA 3MRXA 3QHQA 4U9HS 3TTYA 4EX7A 3I9JA 2ZWVA 2P6RA 4V1CB 3RS0A 2H4WA 1FXWA 3QXXA 4HDNB 5IBPA 5KQGA 4V0OA 5HZKA 3CF4A 2WSMA 1GPKA 4HJXA 3ZDYB 3JQAD 6ADHA 2VJCA 4OKIA 5E0KB 3EY9A 4F11A 3TGLA 1XWIA 1R0LA 5REQB 4D3YA 3LO5A 3GFGA 5BVGB 1I0LA 4IDFA 1BWSA 4O4HF 4CLEA 3HVHA 4Q05A 2B9VA 4YECA 5A03A 1X3SA 3GELA 1VE5A 3HYCA 3O21A 1O5IA 1GDHA 5L6MB 4JLUA 3THSA 1O77A 2P9ZA 1Z7EA 3D8BA 4HEQA 3WB1A 3IKVA 1YU6A 3OWXA 2WTBA 2ODEA 3KELA 4YDHB 5ALUA 5HKLA 4J6FA 1MB2A 1KOLA 2ZKIA 5FNVB 1KZ6A 1L5GB 1W4ZA 2XKKA 2I9PA 2Z08A 5JYDA 1XLTA 3I0MA 4E2ZA 1BX3A 4BRZA 1TEHA 4F97A 2WDPA 3OOJA 1EK5A 1UKZA 3D0KA 4BYMA 4HTFB 1P4HA 3QWFA 1HDZA 3DWIA 5ECDA 1EXMA 4FGWA 3W5JA 4D0LB 1TNDA 1QB7A 4LFCB 2RHJA 4S3MA 1FJHA 4K3VA 2AOTA 4I50A 1GTJ1 1Y37A 1Z37A 2WWGA 1J07A 3OM9A 3VSBA 3AY0A 1N2JA 2HO4A 1LPMA 2OCDA 4OI1A 1V9LA 3A26A 4HN4B 3ST7A 2OSVA 4OIFA 3WYNA 5A04A 3LDFA 3U3KA 2BZSA 1WZUA 2JB9A 3OOEA 4MVXA 4XJXA 2DH5A 5E1OA 5HBRA 1NYTA 3O95A 1SOVA 5ILOA 5C8YF 3JD0A 2XV1A 5LOVA 3V00A 3G9QA 1OH5A 4K28A 3GR6A 1YQXA 3IKJA 4K9DA 1UANA 2WM9B 1IM2A 2HZ7A 4C07A 2DFTA 3FPFA 4R8RA 2R6GA 1N5IA 2XYGA 3O3OB 5F12A 3ZOZA 1U02A 2QUBA 1EVZA 2DPXA 3C14C 5C2JB 4NCHA 2LCFA 3GLIA 2CD7A 1TOAA 3K1JA 3W1VA 4J3NA 2VRNA 3D0OA 1RBZA 3W8FA 2MINA 5J4KA 4RMGA 2CLKB 3RTBA 3WL7A 4RH3A 5IK2D 3B1XA 2JF0A 4NZMA 2VWGA 3HKBB 4UPVA 3KBBA 2C83A 4DJDC 2HSGA 4GSLA 4KIJA 3AF6A 4V0NA 3BMNA 3IHTA 2QN1A 2TYSB 1C7EA 4DJFC 5GM1A 1L7VC 1IE3A 1NJFA 4LGCA 2EP8A 1QX4A 3VI4B 2PQ2A 3SC4A 1YFZA 3VNSA 4JS0A 4LC1A 2NV2B 3KK0A 2XNHA 1WL8A 4Q47A 4EHAA 1XVAA 3GQBB 5BSTA 2WIBA 1NX6A 3ETEA 2Q6VA 4E2WA 5D01A 4XTRA 3TINA 2ZB2A 3BF7A 3H9UA 4D8VA 1A9QA 5A6SB 2POQX 1LPOA 2FSUA 4F6RA 5DN6A 5K0JA 3I5XA 2BUBA 4ZO8A 4FZ3A 4G0QA 3T0GA 4ZD6A 3ZD7A 1ZDMA 4UJ5A 5PGMA 2VZ8A 4ZA2A 4I6GA 2NMVA 2CE2X 2PWBA 4LDZA 3QUAA 2OAP1 4RADA 3FWKA 3T7AA 2HHHB 4FONA 1MC1A 4XR9A 2XEXA 4NNPA 5AO9A 4Z86A 1A76A 2L82A 4IX9A 4MINA 1SCAA 4M22A 4RS4A 5BR8B 4LNHA 4ZVVA 2XCLA 2A5YB 2XW6A 3AEKA 1CFZA 3JAKA 4QFCA 4RD1A 3GZJA 4BBPA 5I7HA 5KYTA 1YVUA 3TZBA 4W9NA 3VZPA 2BM9A 4Y2HA 3I52A 1XDUA 4GUDA 4L0MA 3L0OA 4KQGA 3KTFA 1T2FA 4IIEA 4YREA 3PT5A 2DR2A 1G6OA 3AEUA 2OCYC 3BXZA 5KNCH 2WFLB 2EP7A 2FEPA 2GCIA 4UE6A 5FLXA 2QRLA 2OXRA 4FFBB 2IOFA 1CRZA 3G2OA 2HK7A 1HBJA 4MGEA 4HN2A 3KU4A 4O2LA 3ZQUA 1HC7A 4EFDA 5H8WA 2VJYA 4DMRA 3MHTA 3PJDA 1SOUA 1XZQA 4EKDA 2C3UA 2PH7A 3RV4A 1JLHA 5ER6A