2JASA

Structure of deoxyadenosine kinase from m.mycoides with bound datp
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
200
structure length
194
Chain Sequence
b'MKIAIFGTVGAGKSTISAEISKKLGYEIFKEPVEENPYFEQYYKDLKKTVFKMQIYMLTARSKQLKQAKNLENIIFDRTLLEDPIFMKVNYDLNNVDQTDYNTYIDFYNNVVLENKLSFDIVIYLRVSTKTAISRIKKRGRSEELLIGEEYWETLNKNYEEFYKQNVYDFPFFVVDAELDVKTQIELIMNKLNS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DEOXYGUANOSINE KINASE
molecule tags Transferase
source organism Mycoplasma mycoides subsp. mycoides sc
publication title Structure-Function Analysis of a Bacterial Deoxyadenosine Kinase Reveals the Basis for Substrate Specificity.
pubmed doi rcsb
total genus 66
structure length 194
sequence length 200
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.1.113: Deoxyguanosine kinase.
pdb deposition date 2006-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01712 dNK Deoxynucleoside kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2jasA00
3VMFA 1G8GA 3LLMA 2ZAOA 3W5IA 2IYLD 4CT4B 3BS4A 3F0TA 1KK0A 4B3FX 3WRYC 4IW3B 1KOFA 5JI2E 1Z63A 3G0HA 1DTSA 5JRJA 4LJ4A 2AXNA 4Q9KA 2XSZD 2ZRGA 3C7KA 3OIYA 4C0LA 2VLIA 1KZGB 3OE7A 4M9SA 1E9EA 3DL0A 3QKUA 4EQ6A 4WVFA 1Z0DA 4GFDA 3RSOA 2PZFA 3AVTA 4ZCLA 1N6LA 2QMOA 3IPYA 2VP5A 1ZM9A 3K8YA 1VHLA 5CLLA 5AJXA 5EE1A 3VR6A 2G77B 3W6OA 4EPXA 2H17A 2WVJA 3K70B 2W58A 1T8TA 3I5XA 3EAQA 2ZS9A 3WY9A 1J8MF 2BKEA 1SKQA 3OZXA 3IQWA 4JVNA 3K9GA 4F4JA 3NBXX 1AIPA 4V0KA 5DO9A 2BMFA 3BIFA 3OFND 4KJZA 2XJ4A 5FL7D 1F5NA 4F91B 1Q1EA 1KO1A 721PA 2EYUA 1JEEA 2A5FA 2DFKB 4TQUS 4LV5B 3O8RA 2IWHA 2WAXA 1CR2A 1QG2A 1SGWA 3IQXA 4ZIRB 3THWB 1V43A 5FUXA 5KNCA 2H57A 4FMDF 2OO7A 1T3LA 1CJUC 1ZIOA 2HLDD 2NO6A 3EPJA 4JLOA 4HB4A 3IEVA 4C0BA 2A9KA 3KKNA 2YWGA 1OW3B 1S96A 4FCWA 5SZJA 2V7QA 3F5FA 1JAHA 1J90A 3HYRA 1NN0A 2JLYA 3R9IA 4A82A 4O25A 3SFVA 3AP1A 2JAQA 2XX3A 4HDCA 2HEIA 2XOKD 4OK5A 4CEJA 5AUQA 5BN3A 5EE3A 4DB4A 3DPUA 2R2AA 2ZROA 3E1SA 3Q7PA 2B7BA 1IN4A 2KE5A 3OESA 3C4JA 1G8PA 4DCNA 3AVXA 1RRFA 2BJWA 1G7CA 3FMPB 5JBQA 3QEJA 3CPHA 4RFSB 4TYPA 1OE0A 5HE8A 4PC7A 2HLDA 3KZ1E 1DAGA 2PLRA 1D2MA 4PO8A 1E79D 1J70A 1NKSA 2DB3A 1UDXA 1KI1A 2W0SA 5B64A 1HH4A 2VQSA 3SHFA 2HYIC 3KXIA 1NVUQ 3G5UA 1UEIA 4WZ6A 3VTKA 2ZVQX 1BOFA 2CK3A 2ZRMA 3DM9B 4BQSA 3UMSA 4YQFA 4DKXA 1COWD 2EFGA 4LSGA 3I92A 1X8KA 1AM4D 1UBEA 3CRVA 1JB1A 5FPYA 4V0OA 1IJEA 4QBIA 2OAP1 2JLUA 2QAGA 1N25A 3FHCB 4PTLA 2GCOB 1GWNA 4G5RA 2G83A 4UNRA 4CEIA 2O5VA 1YZTA 3MWLA 4OK6A 1XF9A 2R6GA 2Z83A 1NMXA 4A0RA 1B23P 4W5JA 2VRWA 4AI6A 4JBYA 5FTKA 2V4ZA 1TEXA 2WJYA 1FP6A 1W4BA 4PHHA 1EFCA 4IDQA 2QRZA 2D62A 2QT1A 4PC1A 2ZRAA 3K70C 2O0KA 3RS2A 2BKUA 3FKSD 3PR1A 5L3VA 4P33A 1AN0A 3AF4A 3RNLA 4IFBA 3VAAA 2NOAA 4V0MA 1W0KD 3WMGA 621PA 1WB9A 4DSOA 4FINA 3BB1A 3VX3A 5KPJA 3VR1A 2IS1A 3B82A 4Q1DA 2PZGA 4DLWA 2WJJA 2DHRA 4NCHA 3TBKA 2F9MA 2PX0A 3SOPA 1E9SA 4MRRA 2DFLA 2NMVA 1NLFA 3QF7A 4Q00A 2IEZA 3KQHA 3RRZA 1PUJA 4V0ME 2GDJA 1TL7C 1UBCA 1QZXA 3CONA 5CLQA 3P4YA 3QIAA 4JLAA 1A7JA 1NIJA 3GLHA 4JVMA 5KOYA 5DI3A 5FR2A 2CMKA 2P65A 2W2TA 5G3ZA 1M1YE 8OHMA 2ZYUX 1W0JA 2O0JA 2VO1A 1KMHA 4M1YA 4JS0A 2QQEA 4DSUA 1JECA 1ZJ6A 1ZNZA 2QBYA 2UKDA 4DDWA 1DOAA 1DADA 2UVQA 1ZINA 1DBSA 3QPUA 4DHEA 3FTQA 4RY2A 4U00A 1YE8A 1NLZA 1XD8A 3A1WA 4W7SA 5JZVA 3PEWA 1ESMA 2DFNA 2V55B 1Z2AA 3EZ7A 5FOWA 3RRNA 4BEJA 4FW9A 1M74A 1I4LD 2ZJ5A 4OHVA 1NL3A 1ZD1A 1MT0A 4C0HA 4NDZA 5GVRA 2FSIA 4A8JB 4ZV4A 2IUSA 3OAAD 2C78A 1VG0B 3A1SA 4Q1AA 4WIAA 4BFYA 3NEJA 1IY2A 2GHIA 1G7RA 1RKBA 4NTZA 2X8AA 1VCNA 1F3OA 1XEWY 3U2QA 2OCAA 4E03A 1HURA 5K8IA 1N5LA 3U3OA 3QXXA 4XWAA 1CXZA 4Q7JB 2Z43A 2D3WA 2F7SA 2IX3A 5AJVB 4PC2A 1KNQA 1BYUA 1P3JA 2R6DA 2QEQA 5D3QA 3MRSA 4M1TA 2RGDA 1DE0A 2ERYA 2AL7A 2H18A 3NDPA 1BH2A 2W6JA 4TYQA 1PVOA 4EQ6B 3IGFA 4PPQA 4B33A 4BFUA 1N6KA 1ONBA 4RCZA 3SJZA 4Q19A 3CX7A 2BVNA 4EFLA 3IDQA 2IK8A 2BBTA 2RH5A 4ZKEA 5BW8A 3TK1A 3BOSA 3A6PC 1OFUX 4M53A 2N1BA 1AZSC 1BYIA 4N3NA 1XX6A 5FUWA 1MO6A 2P3SA 3K0SA 4OHWA 4ZIRA 2ZRJA 2EFCB 3H0KA 1XTRA 1D8TA 2N42A 4I1OA 4Q48A 1ZRHA 2FF7A 3H84A 1OLOA 4HUTA 1AA9A 2IS2A 4PPNA 2PH1A 2ZS7A 3NKVA 1EXMA 5KHOC 2C03A 3B6EA 5J4HA 3IIKA 4BLQA 1GNQA 1GNPA 5J4LA 3L0IB 4LDJA 3M6AA 3UMRA 3NHBA 1S2MA 3U44A 2JA1A 1E2PA 3LXXA 1NY5A 3WNCA 2QMUA 4FMDB 4DDUA 5FPSA 2ZI6A 5TY0A 1CJTC 1DG3A 1G64A 2OFXA 4U5XA 3AV0B 4PHFA 3T12A 5DHAA 3S1AB 2D2FA 4Q47A 3I72A 1Z0JA 4N0EA 4HLDA 1GG2A 2VP6A 1YRAA 5KSZA 1RE0A 3AUYA 1J2JA 3CW2A 3L43A 3PUWA 4HZIA 4RCYA 4TMWA 3PG5A 4X8MA 4D2IA 2CL7X 2OHFA 2ZIAA 3I62A 3TJZA 2J0VA 1T6NA 1AGPA 1NRJB 3H2YA 2FJUA 1QRAA 5CITA 5BWMA 1SHZA 3TH5A 2DBYA 3RVBA 4BZXA 4DT1A 3TW8B 3E5HA 3VQTA 2QAJA 1RPZA 4LHYA 1JXMA 1K6MA 5D3MB 2NPIA 2G88A 5JHHB 3P20A 3CKLA 1FPMA 2BCJQ 2FFQA 2PJRA 3MG9A 3THYA 4OI0A 3B7GA 5J5CA 3SBEA 2PLFA 4LV6A 1VCIA 2FGJA 2BCGY 3LQRA 4BLSA 1GTVA 2FSHA 1ETUA 3LNCA 3RC8A 2RMKA 1KI4A 1EK0A 1N2CE 1XD9A 3K1JA 4O3MA 2J46A 2WIAA 3O8BA 4OI4A 2QRNA 4IDHA 1JQLB 1OXSC 1E2JA 5DYGA 2VF8A 5JCZA 1LF0A 2GK7A 2QE7A 2WM9B 1UKVY 3W90A 1UBFA 3T34A 1G6HA 2WIBA 4LYAA 3OEHD 3I8SA 5TMPA 4MKIA 1ZVQA 3MAAC 4LZZA 2ZI7A 2PZEA 1QVAA 2Z6VA 1IN7A 2F1JA 4FMBB 4MH0R 4BRWA 3R7WA 1OFIA 3EZFA 3M1IA 1YVDA 4L9SA 4HLUA 3OEHA 2ATVA 3GEIA 3MCAA 1K5GA 3KXLA 2G0NA 2O8DB 3RLFA 5KUTA 2ODNA 2HCBA 3HWSA 3PQCA 1EG7A 3KXKA 5AR1A 3TE6A 3WP1B 2QPTA 3ZDQA 4LBZA 4JT4A 3RS0A 1W36C 1AJEA 1KJYA 1NBMA 3QKRB 1WDTA 1RYFA 2VSOA 1D2NA 3MFYA 2BBSA 2PEZA 2AKYA 4X8LA 4HB0A 4EPRA 5LD2B 2GJ8A 2H7VA 2YC4C 2JJ1D 1KKMA 1FMJA 2Q9CA 2QAGB 3ZLJA 4GZLA 4CGZA 1CF4A 3MUFA 5DN6D 1CBUA 3RANA 5JEDA 2EU8A 2FV8A 3FGNA 5KSOA 4LX0A 5EUMA 3CPJB 1P4SA 3DOEA 3KJHA 1U0HC 4OKSA 1KSHA 1AKEA 1Z0IA 1Z8FA 1W2HA 2OM2A 3AGQA 3CB4A 5DSZA 4ERNA 2JLXA 1X86B 4B35A 2WBLC 3DMDA 3THWA 3CX8A 3CZQA 2QM7A 1Y3AA 4WXPA 3RS4A 2CEAA 3TR5A 4PSVA 3BFVA 3A58B 3UATA 4ZI2A 3IO3A 4LBYA 2G1KA 3VNUA 4EIWA 5EXSA 1WMSA 1E2DA 3K0CC 5JWOA 1D9ZA 2OFOA 4CYMA 1G3IA 2FSFA 3O8CA 1P9WA 3G82C 1X1SA 1KI6B 1FUUA 4FXPA 1RFLA 1XMJA 2VEDA 4IOMA 1Z0KA 4D6PA 2R62A 2ZR0A 1ZNYA 3A1UA 2ZRHA 3GJ3A 1F2TB 2Z4RA 2HT1A 2OESA 2ONJA 3CBQA 4Z1MD 3I1FA 4KFTA 3L82B 2J5XA 3K0EA 1TUIA 4OQFA 3KTAA 3IHLA 1GDDA 1JR3A 2JIZD 2W6ID 5HZHA 5AK0A 3EPHA 5JJIA 2GXQA 2C2HA 4YXWA 1XPOA 3WBJA 4EJSB 1FX0A 2GVZC 3CNNA 4C30A 4HDOB 2BEJA 3R20A 3VKHA 1KAGA 4A8JC 1SXJC 4NZYA 4CW7A 1Q22A 3LLUA 3AKDA 1WF3A 2J0UA 4HLQB 2NGRA 1Z28A 1T0HB 4XSHA 3AQ4A 4E22A 1S4QA 1VDZA 4KFSA 1Z22A 3TW4A 1W4AA 4G5GA 3WHLA 2CL6X 3GPLA 1JJVA 1BMFD 1J99A 2KJQA 2Z0MA 3BORA 3C14C 1G4AE 3KUCA 3ADCA 1OH5A 2GXSA 5CM9C 1W44A 1II8B 3IILA 3GLIB 2XAUA 4KAXA 1OIXA 4TZ6A 2VHTA 2YWEA 5L8VA 2BM1A 3BFKA 1M2OB 4EFNA 1E9DA 5E7IA 1H65A 2AFHE 3IIJA 4X8OA 3EG5A 4D0LB 2OBNA 1ZIPA 2QG6A 3K53A 2AKAB 3TUIC 4EAQA 4NPHA 4PHTA 2FGKA 2ZJOA 2IUUA 5FOUA 4URWR 1GKIA 3ZQJA 4QNMA 4ASUA 4OL0A 4DCTA 3OIWA 3LV8A 1CRPA 3OAAA 5HCIA 1KTVA 3QKSA 1VCOA 2C99A 3OEED 4OJKA 2JJ2A 1U0JA 1T9HA 3IEUA 1YR7A 2Q3MA 3T5DA 1SXJE 1ZU4A 3QPWA 2L0XA 4Z8XA 5TDHA 5BXQC 5E7MA 3B1ZA 1NIPA 1VYUA 4QXAA 3W8NA 4MKHA 4JLBA 4JT2A 1ZM2A 2ZAMA 2FN4A 3PEVA 3SHWA 1XDBA 4Q4JB 4OK3A 3LY5A 4PSAA 1ESNA 4XD7D 2OV2A 4M1OA 5FBLB 3GLHB 4A1FA 2ORWA 1E2HA 2QMHA 2CCJA 3D6TB 3K9HA 5FFMA 4ZCIA 4EPWA 2JLSA 1N6PA 3GJXC 3GD7A 4M9ZA 4MYTA 4DT1B 4Q9IA 4N0DA 4OJQA 4QRHA 3M0EA 1W48A 1XTJA 4GDFA 1OXUA 3HPRA 1XCGB 1OFTA 1JR3D 1EX6A 2W6IA 3W5JA 5J4KA 2QUZA 3CLVA 5EP1A 2EFDB 4B2LA 1XEFA 1EFTA 1I4DD 2BMEA 2BOVA 3J81k 2REOA 2J41A 2J3EA 5C1BA 4TYWA 2RGAA 4NYMR 4BLPA 3PITA 4B3CA 5B2ZA 3SU8A 2W2XA 3DZ8A 2H8KA 2GA8A 1KO8A 1ZD9A 1GRRA 1GITA 2WWGA 3BXZA 3D7MA 4B43A 2WICA 2AFIE 1UFQA 4US0R 1KAOA 1WP9A 4FN5A 1SXJA 4MUBA 1NKTA 2JJ2D 2DWPA 4PO1A 1E0AA 2QP9X 4MITA 3VKGA 5L3SB 3DHWC 1U98A 1VIYA 3C5HA 1OJLA 3ND8A 3Q5DA 2XTZA 5JEEA 1ZP6A 2EWVA 2VHCA 5AWFC 4Q1CA 3BH0A 5LB2A 2V6JA 2ZS8A 4KSBA 3N2EA 5KNBA 1KZ7B 2ZANA 4LRWA 1GFIA 2V54A 5KDDA 1E94E 4RD4A 1X8LA 3KJEA 2GAAA 2JLVA 4OQMA 1P62B 4QHYA 2CLCX 3D31A 1U94A 3AH8A 3BB4A 1E98A 4UQOA 2K5UA 1Z2CA 2P6UA 3LX8A 2J0QA 3HYTA 1TEVA 4GOXA 5EE9A 2BJVA 3HR8A 3K0CA 5EQTA 1UKZA 1KNXA 2B6HA 4YMVA 1MABA 2IS4A 3CRMA 1AQYA 2ODEA 2P5SA 3E2IA 3VHXA 2JATA 2IYXA 3ADKA 3EA5A 5AJWA 5UKDA 1II9A 5C2JB 2ZRNA 3OIVA 1SHKA 2AWNA 2P5TB 4D4JA 4W5HA 4MDEA 4AKEA 3KQNA 4A6XA 1KIMA 1Z08A 3UANA 1DVRA 2FSGA 2GTPA 1M7BA 1P60A 1O3YA 1WA5A 3LX5A 4GMDA 3MLEA 2WKQA 4C0AC 2WZQA 1Z07A 1Z6GA 1IY0A 5KO2A 2G3YA 3DKVA 1FZQA 2G6BA 1MO3A 1X3SA 1A4RA 2CE2X 4KO8A 1E2MA 3ASZA 2OG2A 1PLJA 3HJNA 3KX2A 3SNHA 4MUAA 4B44A 3B1YA 4DEYA 1GUAA 3QJYA 2GETA 3FOZA 4ESHA 1OH8A 1FQKA 3U7HB 1IHUA 2WJGA 3JVVA 2W6JD 2QM8A 3QKSB 3D8BA 2QGNA 1F2TA 4Y0VA 3SYNA 3UG6A 2VP2A 4A2WA 3ZZTA 3THOA 1G16A 3I32A 2F43A 5DI9A 1Q1QA 3B5JA 4WXRA 1VYTA 2CJWB 3ND9A 2WTUA 4TMKA 5B58C 4D26A 4DZZA 4HI0E 2WWFA 4GRAA 4CIDA 4GBMA 2HJVA 4JVSB 3QG5A 1CJKC 4HATA 1HEIA 1UM8A 2E1RA 3B9PA 4N1AA 4M8NE 4P32A 1G4UR 1ZUIA 2IHYA 1GSIA 1MH1A 2ZQ5A 4AYTA 1LS6A 2RGNC 4TZ0A 5KDOA 1E0SA 1JXOA 4H1VA 2IXFA 1VECA 3LBHA 4JBWA 4LK2A 4OQNA 4PPGA 2V9PA 4AKHA 4KSCA 1FW6A 1XXHE 2RAPA 4UNPA 5HKKA 2LKDA 1QHYA 3OFNA 2CJWA 3TVDA 5LPNA 1JPNA 3ZZ0A 1P6XA 3A1TA 4TWZA 4KBGA 2B8WA 1NI3A 2GJKA 1NBMD 2WAYA 1DPFA 3LAWA 1BMFA 2GVDC 2HJGA 4DLYA 3I73A 3T06B 3TQFA 1E4VA 1XEXA 4B76A 3WYAA 4BWYA 4JJZA 4JKIA 3OE7D 2F3RA 2VSXA 4BLTA 3CZPA 1HE1C 1G21E 2PX3A 5H8WA 2ZRBA 4R9UC 3ZD7A 1LS1A 4MA4A 2VYFA 1OKKD 2CCKA 4Q1EA 1MRNA 4DSNA 3U61B 5GJWC 1OSNA 1ZAKA 1IN6A 1XXHB 4BE7B 4QJ4A 2ZRPA 1IAQA 3LXRA 2WV9A 3C41J 3C16C 4KVAA 1PLKA 2FDCA 2QGZA 2QE7D 4Q7KA 1UADA 5F98A 3X1XA 3GMTA 4GPTA 4TMVA 3B1VA 2GNOA 3EZ9A 3FE2A 4M9XA 3TVTA 5JJKA 3EASA 3MWJA 4JYBA 2J0SA 4ZI3A 4L16A 1I4TD 2GCNA 4ACAA 1EX7A 2FEMA 1XJCA 4LJ8A 2IL1A 5A4JA 2VP9A 3WNDA 3WXMA 4D4KA 3FHOA 4GOJA 4DDVA 5CM8B 1R0YA 4JLKA 1FTNA 1AZTA 2NTYC 4IDNA 1EGAA 4KV9A 4QNRA 1PUIA 3HU2A 1LF5A 2H16A 4G5SA 2QZ4A 2VBCA 4K8OA 3BFXA 2X2EA 4PANA 3UWOA 3X2SA 3QY0A 4KFUA 2LWIA 3U7FB 1BIFA 3EIEA 3HR7A 4L15A 4LY6A 2Q6TA 2FPMA 4NU0A 4Q7MB 4V0LA 3PEYA 4C0SA 1HUQA 4UKDA 4CEHA 2NG1A 1AK2A 1QHIA 2G0TA 2NO1A 5G3YA 4W9MC 2ORIA 4I81A 1T4GA 4YMSA 3MJHA 4Q18A 3A8TA 1DO0A 4LJAA 1E1QA 3LVQE 4UNQA 4URXR 4LJ6A 4A0FA 1U2RA 3NBZC 4JZKA 1R7RA 4WAUA 3A4MA 4DUGA 3QXJA 4PPFA 2C9YA 5BQ5A 3QPVA 3GEHA 3NHAA 4Q1FA 4C4PA 4LHVA 2CVFA 2ONKA 1D9XA 3AF1A 2ZE8A 1KSJA 4G1UC 1KY3A 1CKEA 4A8JA 4PQRA 4ZO4A 4B3XA 3TAUA 3KJIA 4UJ5A 1KHTA 4OHXA 2C5LA 3E70C 4M1KA 3ZVLA 3UXMA 4MRPA 1S3GA 4L5BA 4PZYA 1UKYA 1VG9B 1DEKA 1N0UA 1Q21A 1SVIA 2J45A 4NH0A 2ZRFA 4P31A 4MRSA 3U60B 2ZSAA 2V1UA 5D3MA 4TL8A 4EJSA 5JWHA 1XZQA 2D7DA 2JASA 1YQTA 4I1VA 2GCOA 1T3HA 3PXGA 5G53C 3AVWA 4WA7A 3WMFA 2ZE6A 4H1UA 1LVGA 2NZJA 1IJFA 4XTCS 1ZM7A 1XEXB 2Q21A 1UEJA 4TTPA 3QXCA 1SKYB 2XEXA 3NG1A 4K46A 2FNAA 1YR8A 3L8ZA 4RD2A 1GZSA 3B13B 4RZUA 4HEJA 1XTIA 1OH6A 2QP3A 2IC5A 4RZ3A 4F4CA 2EW1A 4XWKA 4PAOA 1Z83A 4IHQA 3SYKA 3K70D 1E2GA 2HXYA 2X2FA 3FDIA 1RRPA 4DC9A 2X1VA 4II7A 3ZQ6A 2QORA 1UAAA 4HZUB 1ZCAA 4ABYA 2FE4A 3GLGE 3Q8XB 5DGXA 4R7ZA 5FL7A 1R0ZA 4KVGA 5TB5A 3TIFA 1BO6A 2FFHA 2VSFA 1XFAA 4JMPA 1C1YA 4LUCA 1YRBA 1UDWA 1XXHA 2IYWA 3U4QA 1J7KA 1PLLA 3FFBA 1XP8A 4YDSA 5HPYB 1KI9A 5SZIA 4L8GA 1LB1B 1T5LA 2ZSEA 2A5GA 2WWIA 2A5JA 5DIFA 2ZYWX 2AK2A 3U7GA 3KKQA 4I99A 1DAMA 2A78A 4US2R 3SYLA 2C9OA 1O87A 1C4OA 2FFAA 2DY1A 1E69A 2XSZA 5EP4A 3OIUA 2GBLA 1KJWA 3Q85A 3SZRA 5JS8A 4C0QC 5FTJA 2R44A 1ZM3A 4GP7A 1OIWA 3THXB 3PUVA 1E2QA 4RJLA 4IEEA 5JHGB 3ZVNA 2ZUCA 1HT1E 1RZ3A 2WMOB 1SULA 4AY2A 4BFSA 4H9GA 1PV4A 2ZTSA 2XNDA 4QGHA 4FD2A 4B48A 1CS4C 4FMCF 4I1UA 1E2FA 3BGWA 4EKDA 1Z6YA 3ONWA 4UXIA 1D6JA 3NWJA 4PXAA 2YYZA 4RD0A 1XJ0A 3VHLB 4PC3A 4P4UA 3RSLA 1NBME 2HF9A 1T3SA 4HAYA 2OE2A 4CRWB 3AB3A 1RVDA 4PR0A 2FFBA 1EFUA 4BASA 4JLDA 3VFDA 1GM5A 2KWIA 3B60A 4RFSA 1XMVA 2OCBA 1R8SA 2WWHA 1GL6A 3S1AA 1JQJC 3MWYW 1TNDA 2ZRCA 3PV0A 2J1LA 3QVUA 1GVNB 2N46A 4QC2A 4EPTA 4Z54A 1GILA 1E2IA 1S1MA 3AVUA 2ZJAA 4I1SA 1GL7A 4IXMA 1F2UB 2BDTA 4CVNA 3UPUA 2PCLA 1NN5A 3B1XA 3MJRA 4O2LA 1AS3A 1XPRA 1CULC 1YR9A 2IYQA 1JR3E 1NN3A 4LHXA 1MKYA 2WJHA 3ZGXA 3THYB 3AF2A 4C2UA 4DSTA 1G3MA 4OI1A 5CJ2A 3NH9A 1T5IA 4XJXA 4LOAA 4GL2A 5FTLA 5JMTA 1LW7A 2PJZA 2E9SA 4PAQA 5IT5A 2P6RA 2V1XA 5IK2A 3N2IA 1ZUHA 2J59A 1M6NA 4F38A 2GZDA 1KDOA 3QKRA 3I3SR 3CF0A 1W46A 2IF2A 1CLUA 4QHTA 4JLVA 5E3HA 5JCPA 2QTFA 4ILEA 4AK9A 2J87A 1UBGA 2OBMA 1N0WA 3TUZC 3O47A 4DLSA 3GLIE 2FMXA 1A1VA 4R2IA 5IRCD 2F1IA 3TMKA 1R2QA 2XNDD 1Z0AA 2YOGA 4QOSA 4QGFA 2GEUA 1X8JA 2ZYTX 3Q9LA 4QGGA 3RHFA 1OF1A 4ITRC 2ODBA 3Q72A 2VIIA 4BZPA 3THXA 2OEPA 2WMNB 4UNNA 1U99A 3O8DA 2IW3A 4AURA 2ZRKA 1E9RA 4LBWA 3CNOA 2GKSA 1HQYE 2EWWA 2YOFA 3H86A 3FVQA 4DXAA 3EC2A 2A7QA 3HPQA 2J9RA 2VP0A 1Z6XA 4KI0A 3VR3A 4NMMA 4XOIA 221PA 1R0XA 1OYYA 5DI3B 1G8HA 4IDOA 1CR1A 1M7HA 1OYWA 3CIOA 4KLZA 3NIBA 4J0QA 1Q0UA 2CLDX 1R10A 2O8FA 4CF7A 4M1MA 3SJBA 1L4UA 1VMAA 4US1R 2GCPA 1GRQA 1XMIA 2GESA 4M0LA 2FOLA 5F9FA 1E9BA 2OCPA 3U3JA 2YKGA 1EESA 1QF9A 1KO5A 1W1WA 3W3AA 5G40A 4JJKA 1CTQA 2IXGA 4DLVA 1EFRD 1IONA 3DKPA 1E0KA 4JL5A 2QSZA 1SQ5A 2JLWA 2UZ3A 2HDNB 3UWKA 4URYR 4QJ3A 1P7CA 4OHZA 4QG7A 4ZCMA 5GJCA 2FZLA 1LFDB 3EWSA 1QHGA 2VF7A 4HYYA 2PT7A 1NVWQ 2CCGA 5FOXA 1TPZA 1Z3IX 2KBFA 4JLNA 2A30A 3L0SA 4R2HA 1GIAA 3K0FB 2F3TA 4OI2A 1XRJA 3Q3JB 4RZXA 1A82A 2FPLA 1CP2A 5DN6A 2OLJA 1F48A 4PQYA 2O8BA 1E79A 1FTSA 1KMHB 5FOSA 4P3YA 1VG8A 4QM6A 3L0OA 4A15A 1CU1A 5CYOA 1WQ1R 4LHWA 2EQBA 1B0UA 3KFVA 1TUEA 2Y8EA 2GEVA 4FI3C 1US8A 3WHKA 4BZQA 4XH9B 1GAJA 4HLUC 1ZC3A 3Q5EA 4GNKA 4Q9HA 4AWXA 3SQXA 3BC1A 1II0A 1P2UA 2Z5FA 1MO4A 5L3SA 4FIDA 4NBSA 2O8EB 5L3QB 1L2TA 3ZVMA 1IM2A 1U0LA 3RABA 4A36A 5L3RA 1G3RA 2F1RA 4JLJA 1NG1A 1Z6AA 3KUDA 5CK5A 3SEAA 1OB5A 2C95A 2YZ2A 3PEUA 3LQQA 3VR5A 4QL3A 1G5TA 5P21A 3RS7A 2XB2A 2GK6A 2W00A 3QXSA 1MR3F 4URUR 2ZE7A 3ZIAD 3V00A 4UNSA 4M21A 4DWJA 4B75A 1JR6A 5FTNA 2GILA 1LV7A 1KI3A 5BN4A 3ZD6A 3FMIA 1P75A 4AC9A 1E1QD 2GXUA 4QBFA 1NMZA 2GJAA 4C2TA 4G3XA 4I4LA 4E07A 4D25A 4KFRA 1ZU5A 1Q44A 1I2MA 1DS6A 1KY2A 5FBRB 2D7CA 2I3BA 3NVAA 3R8CA 1WXQA 1R0WA 1Q1ZA 4B3GA 1TX4B 1U81A 5BN5A 1EWQA 1DARA 1CR4A 1G1MA 2AN9A 1S0UA 3BAFA 3MSXA 3OEEA 2MMCA 1DAEA 1QBKC 1RIFA 1Z5ZA 4MYUA 1G18A 4Q21A 3CO5A 2IYYA 1Q1BA 4B2IA 4ZKDA 3EZ2A 3AM1A 4DB2A 1H8HA 2XZPA 1NMYA 2A3RA 4HDQB 1SVSA 2QBYB 2F9LA 1E1RD 4UXHA 1N6OA 4Q9JA 3VKWA 4BUJA 2BBWA 2FPKA 3LRPA 2WOJA 4ZDIA 2FX3A 1SXJD 4LJYA 4A92A 4NCKA 1DAIA 3MWKA 3HDTA 3KTAB 4YLGA 2GF9A 4JL8A 1Z0FA 4ON9A 1MRSA 4PAMA 3CWZA 3CF6R 3CPEA 3QF4B 4TLCA 4URVR 3TUJC 1IXZA 5DNYB 1CJMA 4C0JA 1TF2A 1W4RA 3B1WA 2CBZA 5HE9A 2VHJA 1N5JA 4X8HA 1OXVA 3U6KA 3RDPA 2GJSA 3B8HA 2YNMA 4OQXA 4AG5A 2P0EA 1JPJA 1A2KC 2P6NA 3IBYA 2FEOA 4PFSA 4WW0A 1DAKA 3A36A 2RHDA 5H1YA 3RAPR 4AYWA 3CRQA 2Q0HA 2IYVA 3CH5A 5FPKA 1M7GA 4TL6A 1MOZA 4IOKA 4GSYA 3SBDA 4NYMQ 3CR7A 1G8FA 2F1HA 2FG5A 4TMXA 2ZRIA 3FPAA 1UKEA 4Z51A 3U5ZB 5J4YA 3KQLA 4Z1MA 3BBPA 3REGA 3VR4A 4A9AA 4P4SB 4GMXA 3A1VA 2R65A 3PJRA 2WSSA 4OYHA 4PZZA 1JJ7A 1FP7A 2H1LA 3KJGA 3U6BA 5JFGA 4D4MA 4BFWA 5C46F 5F9HA 1ZC4A 1T91A 1W4CA 4AKIA 5H68A 1MO5A 4Q4AB 1F2UA 1US8B 4HB2A 1E96A 1TQ4A 1Q57A 2RGBA 4CZ2A 1S3SA 2PCJA 4TT3A 3JZMA 3V4FA 1XTKA 4C7OA 1VHTA 2BV3A 3IIMA 3QXHA 4M1SA 1G3UA 5FPHA 3QBVA 1W36D 3T1VA 3BB3A 2BHRA 2OBLA 4ASUD 3TSWA 5K8UA 3BE4A 4KLNA 2C98A 4G5QA 3SI7A 2R9VA 4NYIQ 2XTMA 3KL4A 2YWHA 2GAOA 4JYCA 5ELXA 3W9YA 3X1WA 5L3QA 2OAQ1 4BFTA 2ZPTX 2IT1A 5FUVA 4MYCA 4Q4AA 2XB4A 1RRGA 3U7EB 4M9QA 5GJVC 3AVYA 2WWWA 1XTQA 1YZUA 3KKOA 4YMUA 1KK3A 2J7KA 3UIEA 4B73A 2PL3A 1EFHA 5KDLA 1FFHA 4CEIB 4Q66C 1VIAA 4NYIR 3ZYCA 4D80A 1Q3TA 2WSSD 1W0JD 2WKPA 3P1JA 4M4SA 4M22A 4FCVA 2QTHA 1W49A 3X1ZA 4B3BA 2BM0A 2CLSA 5HTKA 4XVRA 3GFOA 4RD1A 3UKDA 1IY1A 3B85A 4Q4JA 4XTRA 1U9IA 1W5TA 3RC3A 4F4IA 3TNFA 4HAVA 2JDID 3GJ7A 3FMFA 1FNNA 3HP1A 2EVWX 3WYGA 3GLHE 1IOZA 1G8YA 1U90A 5DH9A 5DYIA 2JJ8A 5JRZA 1E32A 4AIIA 2D74A 5BYJA 2QPOA 4IOLA 2Q3FA 4IDPA 4UJ3A 1E2LA 4EDHA 2R8RA 4NONA 4M1WA 5JLJA 1S1CA 4RVCA 2OCYC 5JSZB 2ZU0C 3FWYA 4LYFA 1N3BA 3I8XA 2CHVA 2X19A 1W2GA 2RGXA 2DFTA 5FI1B 4R98A 4IVRA 1CJVC 1OT3A 1Z06A 2ZUDA 2RB4A 4PHGA 3AUXA 3T1QA 4ARZA 5BYKA 4EUNA 3TGPA 2O8EA 2WOOA 4CEJB 2QI9C 2RKOA 4PC6A 4IVPA 5A5GA 4EPYA 4C7OB 3QENA 2C9CA 3QG1A 4OHYA 4A2PA 2QU8A 1W5SA 1XD2A 4V0NA 4YDHB 3RRYA 1I2DA 1P72A 3P4XA 4QGAA 1OV4A 1E3MA 2QP4A 1G3QA 1E0JA 2AD1A 4JSTA 2CL0X 2CXXA 5J40A 2B21A 5JS7A 2HF8A 4DIEA 3DO6A 2IEYA 3RWMB 2RHMA 2AK3A 4B74A 1RRCA 3BERA 3EX7C 1M34E 3AP3A 4ARZB 4B3DA 4HAUA 2GZAA 3SDZA 1KKLA 4HSEA 3WBKA 3W3ZB 3CRRA 1ZMXA 3GFPA 1HT2E 5SZKB 1QHHB 2RGCA 1YU9A 1OFHA 2GJ9A 4PZLA 4TTQA 5DLQC 1G6OA 5DHFA 2YJTD 5C18A 5JJLA 1QHNA 4LGMA 1NJGA 1UPTA 3TSZA 3GLIA 1QG4A 2MSDB 4B2PA 3AVPA 4S35A 5EJEA 3TRFA 2ZJBA 5CB6A 3ZVRA 1K8RA 3DOFA 3QVVA 1NVVR 3U4QB 2XOKA 2PMKA 5TXGA 3ICQB 1WBDA 3SC3A 4LBVA 1NVXQ 2AHOA 3BJIC 2B8TA 1BKDR 4Q1BA 1E2NA 3CX6A 3KKMA 2XXAA 3MMPA 1XNJA 1N6IA 4BEBA 2NPFA 4FMCB 4F7WA 3ZJYA 1IN8A 1HQCA 2NO0A 4BFVA 2OZEA 1XZPA 4MKFA 4D0GA 2VH5R 3AF0A 2ZSDA 1OB2A 5EE5B 5CB8A 1G20E 4FWTA 4D0NA 4KODA 1ZUNB 2DWOA 5CJPA 4XIGS 2ANCA 4TMTA 421PA 3LW8A 1DAHA 2P67A 1M8PA 5TVKA 1R5OA 4BLRA 3JZAA 2XXAB 2DPXA 521PA 1GKUB 1KI8A 5FI0B 4EFMA 2OXRA 2IUTA 4GZMA 3QUSA 4U02A 2Q9AA 2X77A 3N70A 3VU9A 1N6RA 4HAZA 4EPVA 4XVUA 3NBYC 3PVSA 2VTKA 4BECA 1P2SA 1Z29A 1VKJA 3B2EA 2ERXA 4NCNA 4RD6A 1XWIA 1TAGA 3DM5A 3UMFA 1XCMA 4Q7LA 2BWJA 5J4VA 2HCJB 3T35A 4O0MA 4RKFA 4DLZA 2KI5A 1P9RA 4Q5IA 2QQ0A 3ECCA 2H5EA 2W0MA 2IBMA 3DZDA 1QDEA 1P2TA 3GLFB 4DVGA 2OLKA 4HAXA 3NBFA 5B57C 1A5TA 3C15C 3AGPA 4TLAA 1HY3A 3KB1A 5CIQA 3C5CA 1VTKA 3K9NA 1J8YF 4JBXA 1FL9A 1U8ZA 4QHSA 2Q3HA 5JI3E 3LW7A 5FR1A 4KBFA 4TLBA 3EPLA 3TSOA 2IYUA 3L2OB 1L4YA 1R6BX 2FZ4A 2J7PD 4HAWA 5C4MA 3GFTA 3ZH9B 2NO7A 1U8AA 1E9AA 1T8UA 2ZUBA 5IF9A 1NVVQ 3EIQA 2F6RA 2ZRLA 1AQUA 3LH5A 4QKQA 1G17A 2IYZA 1GNRA 5TV2A 2G9NA 1XPUA 1F60A 1GP2A 4NKRA 1G19A 3V9PA 4O2RA 3GLFE 2WHXA 4IVQA 5IHPA 4AKGA 1LY1A 1NP6A 4JKYA 1XJQA 1T0JB 1R8QA 2F55A 4YONB 5AUOB 4TN1A 2YOHA 2ZITA 4JL6A 1CEEA 3EWAA 2IHBA 4CDGA 4C9BA 4LV8B 2CE7A 2OT3B 4PQFA 4RKEA 5EE0A 1EWRA 1SVWA 4HLCA 1C9KA 3AF3A 4R71A 2QSYA 3A4LA 3K0AA 1Q12A 1SZPA 1KI7A 1PJRA 3GJ5A 3AVOA 3GJ8A 1TADA 2EFHB 1G9XA 1E2EA 4RFVA 1U9IC 2ODWA 3TLXA 1YJ5A 1E9FA 1NY6A 4DLRA 2GWHA 4EJSC 1KDRA 3V4RA 2ZREA 5EZ6B 5GJBA 4LWZA 1BS1A 4XSGA 1ZM4A 5KPDA 2CNWA 3LWNA 5J47A 1MV5A 2YV5A 1S8FA 3QI2A 3FMOB 3AEZA 3ICEA 1VYVA 1NSTA 1G7SA 2V8OA 2ZEJA 1CRQA 1KK1A 5H70A 3T1OA 3RS5A 3R9XA 3LDAA 1AS0A 1KYIA 1W7AA 1Z47A 3GCGA 2QROA 2MMGA 2LCFA 4A0GA 1NN1A 4NL4H 2HXSA 2OUKA 2MSEB 4XVQA 4YC7A 4DIDA 4Y0AA 1YZKA 2WPDA 1ZNXA 1XD2B 3F3YA 1RYHA 4TL7A 5EP2A 4GT1A 5M04A 3Q7QA 2LKCA 1VG1A 3MGCA 1TMKA 3QBTA 4P4TA 4RZ2A 1SVKA 2QMEA 2ZSBA 5K8LA 3L8YA 3PUXA 1KSFX 3W6PA 4TSFA 4G01B 5KYKA 4GP6A 1SVMA 4UXJA 4Q4LA 4BPBA 4HUQA 3GLGB 3RWOA 1RC8A 1W0KA 3FB4A 1GKYA 3VU9B 3LVRE 2ZR9A 1VPLA 4MGKR 2RCNA 4FWIB 5IDVA 4B6EA 2DWQA 2ZJYA 2JDIA 2QN6A 4V02A 1OKKA 5EXTA 2GXAA 1YZGA 2QL6A 3WP0A 5AUNB 4TSFD 2C04A 4D82A 4L9WA 4M2LA 1IXSB 1DAFA 2IYTA 3X1YA 1ZD8A 2BBOA 3H4MA 4MGYR 1ZW6A 3R9WA 3WYFA 1OH7A 4RSGA 1L7VC 4IJMA 4PX9A 1Y63A 2ZI9A 4E5UA 2VA8A 4XD7A 2AD5A 1ODFA 5EP3A 1AKYA 2ZETA 1KMQA 5G41A 2O52A 4URZR 1ANKA 3LFUA 1E2KA 2A5DA 3FYHA 4NYJR 5HKKD 2ECKA 4B6FA 2CK3D 2HYDA 1TQDA 3KB2A 3NTUA 1NG9A 2IS6A 3CM0A 3SE0A 4LYHA 4C3ZA 5AJZA 2XJ9A 2JEOA 3QQ5A 1U8YA 2AR7A 3NXSA 1OXXK 1TQ2A 3P26A 3EA0A 1P5ZB 3SR0A 3WRXC 2HT6A 3L0PA 4D4LA 5GADl 3QF4A 4E09A 4A4DA 4HB3A 1XU4A 2E87A 3N5CA 4LC1A 1XBTA 3A37A 4CT5A 2QPAA 3M4YA 1HE8B 3CWQA 1P73A 1P9NA 2YHSA 4TT3D 3A4NA 1P61B 4IKEA 3KQKA 4DEXA 1ZCBA 1A2BA 2GBLC 3PIRA 3CH4B 3HU1A 5F3WB 2ZI3A 1N5IA 1IBRA 5FH9A 4C0KA 2QA5A 3RYTC 1FNMA 4GI7A 5KSYA 2V7QD 4CEHB 1ELOA 4Q4HA 2BMJA 5FBWB 2ZI5A 1JNYA 2C8VA 4LJ5A 4OBEA 2J0UB 4Q01A 1NNEA 2O8FB 1CIPA 2ZRDA 4B34A 5EXPA 4LYJA 3W6NA 3NC0C 1X6VA 3ZS9A 5F2EA 1Q3HA 2O8CB 2O8BB 2ANBA 4TL9A 5E7JA 4HUQB 3GLGA 1N0VC 2A2ZA 2IYRA 2QENA 2J7PA 3GQBA 3KDSE 3TQCA 4YXWD 1D2EA 3CRW1 2JLZA 4Q9LA 2ATXA 2IF0A 4MYHA 2G1JA 2PEYA 3CNLA 3IUYA 5FUYA 4PSKA 3R8FA 3FHTA 1Z6TA 4AYXA 5K8TA 4ZDKA 5FOTA 1SXJB 4A6PA 3OF5A 4DJTA 4Z8YA 3SJCA 3K9LA 3AKCA 4AD8A 2BEKA 4GOKA 4ACBA 2O8CA 2RGGA 3AVQA 3NC1C 1WE2A 3X1DA 5JSZA 4ZDJA 3REFA 5CIWA 1SVOA 1FQJA 4WZAE 3DDCA 1E9CA 1G5PA 1DG1G 3U3MA 1QHHA 3IKJA 2WWYA 4KCGA 1H8HD 4MQBA 1G7TA 3AKEA 4LHZA 5EZ5A 4D81A 2XZOA 3KQUA 1JAIA 5IK2D 3WNBA 1NJFA 2ZJZA 2IYSA 3T5GA 4S2EA 1N6HA 4LJ9A 3D3QA 2GRJA 2WJVA 4JSYA 1D5CA 3AP2A 5DISB 4K81B 2SHKA 4QFMA 3ZS8A 3GEEA 3B78A 3CR8A 1FOEB 1XMSA 5AUPB 4BLOA 1G5RA 2MSCB 5FPTA 1F6BA 1G41A 2JJ1A 1TF7A 4NYJQ 1YKSA 2HV8A 2VHUA 4NHOA 1ZNWA 2KB0A 3ASYA 3K09A 2ZI4A 3LA6A 5E95A 5CDFA 5TARA 5B30A 1KJZA 2VPPA 4IOJA 3FKQA 1YR6A 1QHSA 3LBNA 4G0NA 1KO7A 2ZXUA 2YVUA 4TYYA 3W34A 2H92A 2P2LA 5CK4A 4DRZA 2Q9BA 5FL3A 3NDBB 1X1RA 4KXFB 3GJ0A 4B71A 1DELA 5JECA 4F92B 1GL9B 4A0HA 3ZIAA 2TMKA 3VR2A 4MRVA 2BIFA 2I1VB 3EZ6A 4DLXA 1KI6A 4IEIA 4TQ9A 5FOVA 1AGRA 1TQ6A 3RS3A 4LPSA 1KDPA 2Z4SA 3GJ4A 2IXEA 4QM7A 1W36B 2PMDA 1R5BA 5LDDC 4TLDA 5DE3A 6Q21A 3DEFA 3PUYA 3W8RA 1ZYUA 2WSMA 1OHHD 1PZNA 1HA3A 4BRUA 4NE2A 5KTYA 4JLPA 2O0HA 1SKYE 4TQAA 3LD9A 4DDTA 1JI0A 1SVLA 2C77A 1R4AA 4IXNA 5SZHB 2ZR7A 2OILA 4MRNA 4POAA 2KSQA 2QY9A 3GP8A 4KITB 1UJ2A 1YZLA 1FX0B 3C8UA 4G5OA 2JGNA 5CDFE 3T1TA 3WMEA 3QEOA 2AX4A 2XITA 2D2EA 5ANRB 2QNRA 4P0TA 2EFEB 5CYPA 2ZM5A 4MDFA 1COWA 3IBGA 2DCUA 1YZNA 3GLFA 1GRNA 2WJIA 3BH6A 3UG7A 4FCTA 4YMWA 2FWRA 3SN6A 4JLMA 1XB2A 3EW9A 2IWRA 4A2QA 1HTWA 3SQWA 2FU5C 3LO5A 1NSFA 2W2VA 4BFXA 2W83A 2JLQA 4P4SA 4Q03A 2JCSA 2XNSA 4YMTA 1Q20A 1P2VA 2ZJ2A 3GJ6A 4MKGA 1KO4A 1HYQA 4PO9A 3PCRB 1S9DA 4KYUA 5C4GB 3TR0A 4MGIR 4HZUA 2JLRA 1MABB 4QBGB 1TTTA 4LC0A 4BFZA 2B7CA 3P32A 5EXXA 2I4IA 3QOFA 3DMNA 4IFEA 2OSBA 3I61A 1E6CA 2WWXA 1AS2A 1EFRA 3T61A 4BGDA 1QHXA 4WOPA 1OIVA 2EYQA 5FBQB 3ZZUA 3VX4A 3CUEF 4LPKA 3HU3A 3IO5A 2CVHA 821PA 3OHMA 1OHHA 2ZJ8A 1H8EA 1WCV1 2NZ8A 3I4LA 4W5WA 3VNVA 2YWFA 1R5NA 3K09C 4MGZR 3KKPA 3U3KA 1LTQA 3BRWD 4Q02A 2VP4A 3T15A 2OFWA 1NF3A 1KDTA 2AWOA 1LNZA 1H8ED 2DYKA 3QKTA 3NEYA 2OXCA 3IPXA 2YINC 1WBBA 5JWRA 2IA5A 1JEDA 3TAHA 1IXRC 3BD9A 3KFXA 3UK6A 1KGDA 3U3RA 3IHWA 3I5YA 4DCUA 2ZU6A 2JIZA 2RGEA 1WRBA 3EC1A 1JBKA 4DCSA 3AVVA 3MD0A 2BC9A 4LJ7A 5KNDA 1VCMA 5LBIA 3P27A 3DVLA 5GVSA 2CHGA 2ZSFA 2ZYVX 4DBLC 4NP6A 2REXB 1G291 2ZE5A 4DCVA 4QBHA 2KBEA 3PUZA 2QAGC 1TU3A 2GF0A 4ESVA 5LD2C 3BWDD 4LI0A 3SFZA 5HZKA 4U7DA 4LCBA 2WPDD 3BK7A 4NCIA 2ZVPX 2FA9A 4B32A 5KSPA 2NIPA 1UF9A 2WKRA 3CF2A 3ADBA 4DUGD 3K0AB 2BMDA 3F8TA 1K5DA 1CR0A 1DO2A 1FMLA 1E4YA 1E1RA 1YHNA 2GZHA 2REBA 2DR3A 1XCPA 3PFIA 5FBVB 2HUPA 2QT0A 5FTMA 2R6CA 3BH7A 1RJ9A 3U44B 2C96A 3EPKA 2R6AA 3ADDA 2F43B 3ETLA 3EIHA 3EXAA 1GOTA 4KYIB 2R6FA 2VL7A 3EARA 1W47A 1S9HA 5A0FA 3SS8A 2XZLA 1KSGA 3LBIA 2VHQA 2CNWD 2D06A 4KU4A 1TU4A 1L8QA 1KI2A 1XEWX 2XTNA 4L4UA 2GEDA 3QE0A 4XWOA 3JVUA 4JVLA 1V5WA 3RRMA 2XGJA 1KK2A 2B92A 3PENA 4JIMA 2YC2C 4Q4HB 4F93B 2ORVA 5AJYA 1OPXA 2V3CC 2ASEA 1RJ9B 3SJAA 2UZIR 4ZDWA 2PT5A 4OQLA 5KU1A 2I1QA 1NLYA 3AKYA 2D4HA 3TKLA 1IN5A 2AXPA 4QJ5A 1HV8A 2RGNA 2CDNA 2CHQA 1II8A 2QTVB 1XTSA 2O8DA 1RW4A 2A5YB 2NQ2C 1TF5A 1YZQA 4DLTA 5LB4A 121PA 4KHZA 3B9QA 1FUKA 2FH5B 3NH6A 1JALA 3R7WB 4NCJA 3H1TA 4TMZA 4ZPXA 4RD3A 5HR5A 1N5KA 4DLUA 2NO9A 3K0FA 1N6NA 3FFAA 1E99A 4WBSA 2V6IA 4AG6A 4WZBE 4TTRA 1IQPA 4V03A 3QNUA 5E4FA 4TYNA 1OXTA 2PBRA 4IRUB 1QVRA 3QSYA 5EUQB 1ZBDA 3FKSA 4B47A 5HCNA 4TLEA
chains in the Genus database with same CATH superfamily
4GGPA 4B3IA 3EODA 4RQBA 1T4MA 4CT4B 1B41A 2YQZA 3WRYC 5H9WA 5JI2E 5EWMB 3QU9A 3JD4A 3QNWA 3G0HA 2AXNA 2FZEA 5D87A 4B83A 2XSZD 2ZRGA 5IS2A 3WIVA 5F12A 1DX9A 1CZOA 3OE7A 4M9SA 1MMFB 2Q46A 5HIKA 4GR5A 1F20A 5DHQA 4NE9A 1DBRA 4L50A 3VNQA 5LL6P 3V80A 3HHPA 3IPYA 4FFLA 3K8YA 3M6IA 3N0VA 5CLLA 5EE1A 3D5QA 3VPFA 2G77B 3W6OA 2Y1GA 1Y1PA 2H17A 4S1NA 2HBQA 4YCLA 4M55A 3M9XA 5IKOA 1BVUA 1X7YB 1SKQA 4HXEB 4YPOA 5BSWA 5HTOA 3EXHC 3DP7A 3D3WA 4JVNA 4MR9B 4RH3A 4NVRA 2VWPA 1K4KA 1U04A 1AIPA 2C54A 1J2UA 3FXAA 3IERA 4ZGBA 4WNAB 4KJZA 4IZHA 2B35A 2CFSA 3A9UA 4XE5A 1Q1EA 1KO1A 1WV0A 2EYUA 4Z4HA 1KIFA 5MF6A 1U5BA 4LXHA 4UM7A 3VPAA 1RJGA 4E12A 4Y1GA 4NCBA 4G4SO 4FGJA 4LV5B 3HH8A 1L5GB 3ABZA 1JEYA 4CKCA 3V55A 2HA6A 4FGKA 5ARDA 1QG2A 2Q7DA 3ZCTA 3EEOA 2C2GA 4XGKA 3IT2A 1LQTA 1RYDA 3OOSA 4KXQA 4PM4A 5AW1A 5AW2A 1CJUC 5JADA 2QD5A 4GVPA 4CBVA 1KP2A 3VR3D 3OURA 3UH0A 4E7PA 2W11A 5BV1A 1J2TA 1MZVA 3LOUA 4JLOA 2RC5A 2ZBRA 1PDOA 3IAM1 2NUTA 5GTDA 1AVTA 5A5DA 4JQOA 4O8ZA 3A6HA 2LNDA 3CEPB 4F2WA 1N78A 1B6TA 2WSBA 1S96A 3PFCA 3HYRA 5SZJA 4MR8B 3R9IA 3ZHVA 3PLAE 1WO8A 2TMDA 2Z09A 3AP1A 4O4HA 5H80A 4HDCA 2HEIA 4H7JA 5D00A 3IXMA 3M5WA 3OPVA 4DR7B 2QL7A 5BN3A 4IJ5A 4I4NA 3D64A 3E1SA 1JLKA 5I51A 4F9TA 5KTRA 3HKCA 4ZVNA 2HJ9A 2QRHA 3G2NA 4A16A 1IUKA 1H9AA 3C4JA 1K4YA 2P2GA 4P53A 3V4VB 5K0NA 4AT1A 5TVGA 4DCNA 2BJWA 3AVXA 4B8WA 1E62A 1G7CA 3EH2A 4ZT4A 3OQNA 4IUBS 1U9ZA 2QZPA 4IJWA 1IBCA 2R00C 3U7QA 3JZDA 4MULA 3ABQB 5HE8A 2ZKLA 1HMYA 3UK0A 4HADA 3KZ1E 1E7RA 3M6UA 2CLEB 4IIGA 1C0PA 5CDGA 1YT5A 1HSOA 1J70A 1EQAA 4MVJF 4WHMA 1PJ4A 3KETA 2DB3A 5MFZA 3QVOA 1Z8DA 1QIKA 2DQ4A 3CVOA 3P52A 5BSGA 4KAAA 2AV6A 3KU1A 5AVVA 4A1OA 1MDBA 1YC2A 1A5BB 3G5UA 3HCPA 3VTKA 3IOMA 1Y33E 3AR8A 2VJBA 4JI8B 1T2EA 1ICEA 1MORA 2CK3A 2ZRMA 5WRFA 2OYRA 5CBPB 3UMSA 3GELA 1TEHA 1TM4E 3AEKA 2VPIA 2O4UX 4BNDA 4HPWA 5JSQA 3EGDB 1X8KA 3I9LA 1VMDA 1UBEA 3H2JA 4GPIB 2IZ1A 4V0OA 4H7IA 1N5DA 3IH5A 2ZIFA 3DP9A 3FHCB 3TB6A 1DKNA 3ZXYA 3E8XA 4WPGA 2L69A 3V3KA 2RCYA 4N3CA 4ENVA 5TS3A 4MWGA 3OWHA 2ZTLA 1REQB 1V96A 3MUNA 4FOLA 3ZY6A 4BX8A 1W1IA 2G83A 3UXEA 2XQFA 4GX2A 1RRVA 2PQ6A 4OLJA 2O5VA 3B6JA 3MWLA 4OK6A 4WCFB 4GYWA 4WSOA 2GHQA 2Z83A 1NMXA 1E3SA 1B23P 3DLPX 4MPTA 3FCEA 3TRHA 2VRWA 1I3KA 4KZPA 3I53A 1NJ2A 2JJMA 3EXG2 1I4WA 2JFFA 2E89A 4XPZA 4YRTA 3R7FA 2QT1A 1U2DC 4PC1A 3UT5A 3KR2A 3ZTWA 4J2HA 5JAOA 2HLNA 3FKSD 3IAM6 3QNMA 3RNLA 4ZYYA 4XFDA 1FDUA 4FIZA 1TTQB 1JA0A 4WQMA 1A7KA 3NFYA 4NOLA 3BIXA 1S2LA 3L40A 3AB7A 3UWPA 3AJEA 3WMGA 4L5YA 4OG2A 621PA 1VMIA 5TX7A 3BB1A 3JU3A 5CDUA 3VX3A 1BJRE 4X3OA 2RHLA 3P0EA 3NBUA 2BY4A 4P08A 4Q1DA 1L4FA 3LCRA 1N2IA 1NQAO 3EDRA 2O1EA 2DHRA 2QNBA 2WJJA 3N8NA 4WLOA 2F9MA 4YREA 2YX1A 3TBKA 4QUIA 1MDFA 4RQUA 1T8RA 3LYHA 1PT8A 4I4CA 2NMVA 1T9AA 1JSRA 3UKJA 4RTNA 1SVUA 2PWAA 1PUJA 3CZCA 2ES4A 2OMEA 4UTRA 3LHFA 4BO4A 2GDJA 1TL7C 2YHAA 4K6CA 4RHXA 4QICA 1KZHA 1TI7A 1XRMA 3QIAA 4EHFA 1PL7A 2XHEA 3GLHA 4JVMA 3B12A 3ZV6A 1RM0A 4BVGA 1M1NA 1YTUA 2RONA 8OHMA 2ZYUX 4HDMB 3ERCA 2VO1A 1VLQA 4DSUA 4JS0A 2K87A 1EXVA 1JECA 1ZN9A 1ZJ6A 3MZ0A 1YDEA 4EVQA 1DEXA 4DDWA 3C4QA 3WY9A 1T6BY 5IBRA 3W4KA 1UZAA 4GBJA 3WGQA 2P2NA 1AXEA 2C9BA 3OTHA 4IXWA 4RY9A 5DMHA 1XTPA 3KPJA 3AESA 4FFSA 5BT9A 1Z2AA 5TR9A 4BWFB 3R3YA 2O54A 4FW9A 1LJUA 1LH0A 2ETXA 3QITA 3ZGNA 1Y5MA 4HBGA 3KWLA 1J9EA 3OHPA 5C7YA 5KQMA 1NL3A 3L1VA 2OQVA 5JISA 4CNBA 1EBUA 4ZV4A 4A8PA 3D3EA 3FOFC 3OAAD 5L4SA 5JXHA 2CLMB 2WAAA 4Q1AA 3RC2A 3I1IA 4BFYA 1KYQA 4LDZA 4EA7A 4O4IB 5A1JA 2BR3A 3FYUB 5CNIA 4LOKA 3OU2A 1R50A 3F96A 3OPQA 1VCNA 4LZNA 4EZEA 1XEWY 3WKAA 4BC0A 2HM7A 4BX3A 1HURA 4EQZA 1QYVA 1AGYA 3T0IA 4YAGA 1K0FA 1PT6A 3FUUA 1DJLA 5DBFA 1S2DA 5JY1A 4AWBA 2RK6A 4UW9A 3AUSA 4PC2A 1ESDA 1SEPA 1KNQA 1P3JA 3GUHA 2QEQA 4O4IA 1PV1A 3MRSA 4M1TA 3R7DA 4AJNA 4IV8A 3SEQA 5AXDA 4U0JA 3U19A 1M3SA 3NDPA 3PX3A 4ZAVA 4H7EA 3F5DA 2W2PA 3ZY3A 4BE4A 4QE3A 1QVVA 1EFAA 2MINB 2P9HA 2WFAA 3IB3A 3G2JA 2WSYB 3AHGA 3MBIA 4DV3B 2Q3CA 2HHLA 2GAJA 3INTA 3VSEA 4DVJA 2WB2A 1X94A 5AJHA 1L5LA 1FDSA 4EFLA 3M8KA 3IDQA 2IK8A 2BBTA 4JP3A 5E8JA 4GHWA 1Q74A 5TQ2B 3TN7A 3BOSA 3WGGA 5IG2A 1OI4A 3E58A 3RYFA 3LO8A 1AZSC 1BYIA 2OECA 2WR8A 5FUWA 1MO6A 1C4WA 2D54A 4GU5A 5TGZA 3RU9A 3NVDA 4K9QA 3VPBA 4ZEVA 1AHPA 5BY2A 4OHWA 3IP8A 4PHCA 1CY7A 3ELUA 1SQ0A 1DSSG 4I1OA 4OHFA 5LOVA 3VNAA 1QIIA 1ZA1A 4HUTA 1AA9A 2AJCA 2Z2XA 4FBMA 4KN5A 4ND8B 3MS2A 4V24A 2UYHA 4S12A 3B6EA 2P1RA 4BLQA 3HB1A 4LDJA 3M6AA 2RC6A 4PYKA 2JA1A 3UBMA 5KKNB 4UVHA 3VDNB 1KMNA 2QMZA 4DPMA 3KEGA 3LXXA 4HVCA 4JI2B 3S8MA 1TZJA 2YJ3A 2J4CA 3E9NA 1BD3A 3KSMA 2HBZA 3D3JA 5BUQA 1M1XB 5DNUA 2OXEA 1P4AA 1MJFA 3IXLA 4PHFA 2D2FA 3TKYA 4HGPA 1Z0JA 3IEPA 2FFRA 4KWCA 1ZOLA 1P1BA 1T29A 3PVZA 3Q6NA 3AI2A 1RE0A 1SQGA 4YRQA 2AGVA 4RCYA 3HBMA 1A4XA 1YCGA 4LHEA 2ZFUA 2LGJA 3PG5A 4BAZA 5DTQA 1T5TA 4KTVE 1EVEA 3HNRA 3ANNA 4OL9A 1VGVA 3ER9A 4RA6B 2UV8A 3ENKA 3HKEB 1T9KA 4RMJA 5IAGA 1PK9A 1SOMA 4NMXB 3TJZA 5AVRA 3TG2A 2C57A 2VYCA 2BTQA 3M82A 3OPXA 4D3DA 5CITA 1QIMA 1E18A 1KEEA 5ALSA 1TM7E 2YTZA 3JASB 3WGOA 4BZXA 4FEGA 4CG2A 2F3SA 3TW8B 3E5HA 4ZREA 1OV6A 4YROA 5JZBA 1OR8A 1JXMA 4EYSA 2ZB8A 1KC3A 4LJKA 2G88A 4F4DA 1I9GA 1P5JA 5FAXA 1CUJA 3PC8C 2BCJQ 3E1GA 2PJRA 3MG9A 3TX6A 2AW5A 5J5CA 3DEYX 1UM9A 4RYLA 2H0QA 1PWXA 1VCIA 3IR7A 5KHAA 3WL8A 1GYQA 2FGJA 3LQRA 5JFOA 5LYJF 4M8IA 1QAQA 2V0CA 1ZIYA 1I5EA 2FSHA 4BNDB 3AYXB 3RC8A 4UQPA 1N2CE 1XD9A 3K1JA 5CX1A 3ZHYA 4C3VA 3O8BA 4KP7A 4AIRA 1Z34A 2RK3A 1H22A 2PPVA 4DC1A 1OFUA 1B42A 2QRQA 2EP5A 4HN9A 3GGSA 2J9FA 1YR2A 3I4FA 3O8QA 2QE7A 4PS1A 4BRSA 1YK1A 1UKVY 1UT5A 3OSUA 3A9CA 3T34A 2VK4A 4RHEA 3RS8A 1X80A 3S28A 4ER7A 2FW7A 5ADHA 4UUAA 2MR5A 1YJQA 5IFLA 1ZY2A 4D02A 3LQYA 3BCSA 2Z6VA 2Z2IA 2DQYA 4BRWA 4C2AA 3EZFA 1N9ZA 1HSZA 1JDBB 1H2XA 4UUMA 4HLUA 2J9FB 3I6ZA 3OEHA 3DFZA 1ODSA 5JARA 3VR2D 3GEIA 3QPAA 3I6IA 1A8IA 2C83A 4NBKA 5CA1F 3HWSA 3KXKA 1AT1A 2G4CA 3IQEA 1TT5A 1G20A 1K2WA 3WP1B 3ZDQA 1I36A 1JG2A 2I4TA 4ZVRA 1X7WB 4JT4A 2ZT8A 4QXQA 4TKVB 1F0NA 2I6QA 4N82A 1KJYA 1NBMA 4MKRA 3HE3A 1KJ8A 1RYFA 2J5BA 3HYLA 1ECJA 4RLSA 3FAZA 3NHUA 5IC4A 5HNKA 1RQ2A 2GJ8A 1FRVA 2JJ1D 2Q9CA 2QAGB 1ZG3A 1EUCB 4UHJA 4IR7A 1JDNA 1KFKB 5JEDA 1L5QA 2DCMA 2FV8A 2IEAA 3FGNA 4N6GA 2M9MA 3SPXA 5KSOA 3DOEA 4IYRA 3KJHA 1CRLA 1XJWA 4NJEA 3LFTA 3G17A 4DZRA 1BSVA 1AKEA 4JB8A 2JKYA 5DM0A 3VVCA 5IJAA 3TGWA 4TZKA 4CFZA 5DBIA 3TCNA 1JFFB 3FM9A 3K1AA 4GC9A 3U40A 4B35A 4AULA 3THWA 1JU9A 2HU2A 1Y3AA 2HLHA 4REMA 5LZ2A 2CEAA 3TR5A 4TLLB 3UATA 4BU0A 1OTYA 4ZYTA 3UJ9A 1S6YA 4LBYA 2LR0A 1J0EA 1P5FA 2G1KA 3NJ8A 1L7NA 4CV3A 4GZ6A 4LXIA 1YDHA 1ZN7A 2QZSA 1JX6A 4OFXA 5C81A 1E2DA 4O08A 1VIVA 3K0CC 3Q7IA 2OFOA 1C1XB 1N5RA 1H2EA 1KVTA 2CXSA 2QTNA 4LJLA 4CLOB 1ZIDA 2C3PA 3L02A 1P9WA 2WU8A 2Z2JA 5LCXA 1FUUA 3ZGOA 1B0AA 5K3OA 2ON6A 2VEDA 3BULA 4IOMA 4D6PA 1D03A 1ODLA 4ZALA 1HM5A 4GKBA 3WLAA 1XDGA 3GAAA 1JFLA 2Q5LA 3A1UA 4EOGA 5BW6B 3V4LA 4MQ6A 2TS1A 3NT4A 1F2TB 1ONSA 2HO5A 1DMRA 3ZIUA 1N9KA 2IV2X 2WT8A 4BYMA 2P1DA 3OJCA 4KFTA 3GRYA 3OQ1A 1XDSA 2PL1A 3PKZA 3IHLA 1GDDA 1K3TA 3MERA 4OXYA 3W9SA 1FYWA 3MT0A 1KEKA 5JJIA 4YXWA 1UBLS 1NBEA 3JQ9C 2FPPB 2BMAA 4HBZA 4NBWA 1CUZA 3VYSB 2QV7A 2R4QA 5HILA 2IV3A 4HDOB 3OI7A 2F8LA 4ID9A 4AY3A 1IZ8A 3EQ8A 3NW9A 3W0LB 4A8JC 1SXJC 3F4BA 1XWWA 3Q7TA 4EKIA 1JHYA 5CD1A 2PD3A 1B7GO 2N3ZA 3AKDA 3H1FA 1VKHA 3K5IA 2J0UA 1INLA 3H2SA 4HLQB 5JG7A 4GWKA 4XSHA 1GAQA 1S4QA 4GRDA 4P7JA 4UE6A 3L8CA 5AOCA 2OBXA 3MMNA 2RJOA 2Q9UA 1V8FA 3KPYA 3LPLA 4TROA 5KYVA 1W4AA 4XM2A 5I7SA 4NWIA 2CL6X 2IYPA 2WF6A 3GPLA 2F8TA 1JJVA 1VXRA 3BG5A 1JZSA 3OKCA 1AF7A 2Z0MA 3C14C 3KUCA 1D7AA 1MB3A 4DMGA 5AVUA 3ADCA 3RYHB 1XTVA 5CM9C 4C76A 3GLIB 2AG1A 4RPKA 2DERA 3H9EO 1JQBA 2POCA 1P4HA 1HOTA 1UXGA 2YWEA 1A5ZA 3OECA 4CETA 3BFKA 1COZA 3W78A 1FP2A 2I9PA 5BVHA 4ICIA 1RWMA 1CZKA 2RAUA 5AJUA 4MZXA 3CLRC 4PG4A 4RDIA 5GV8A 1U6KA 3SHVA 3U7JA 4AMVA 3RSQA 1JHUA 4UUNA 3GGCA 1WV1A 3CKMA 2B6NA 3GOQA 5EPOA 3SF8B 3TUIC 3A6GA 4HSGA 2ZJOA 1HR0B 4YBRA 5FOUA 2FZ5A 2HHJA 1T34A 1QGUA 4YECA 2OO5C 4OL0A 3CLTD 2ROQA 5C8XA 2HIGA 4Y6QA 4HDNA 1NASA 1P6QA 3FX2A 4YYZA 3LV8A 3RD5A 3D8HA 3IA7A 4XWWA 4WZBB 1CRPA 1F8UA 3OJWA 4XARA 5HCIA 1VCOA 3GDHA 3IBCA 1YB1A 4B4KA 4W5RA 2VK8A 5JD4A 1T9HA 3IEUA 1K5PA 1I7PA 1MPTA 2YYSA 4I9GA 1B2LA 4LK3A 3RADC 4E3WA 1JEOA 1QGUB 4WOBA 4G8DA 2V7GA 1C8KA 1ZM2A 4ARBA 3KQPA 3D54D 1U1EA 1JLHA 4PSAA 1ESNA 4KLRA 3V8VA 3S0JA 3EVNA 3GLHB 5KSZA 1GPJA 5IJXA 1GUBA 1CDDA 3BICA 4DWWA 3CLKA 3MLBA 4NXNB 5SY4A 2CCJA 2JANA 4AJJA 1FK8A 2CHUA 5TC4A 4FZJA 2BFDB 2BGMA 3JASA 3VVBA 4Q9IA 3S5UA 4QRHA 5HZMA 2HTEA 2PD6A 4GDFA 1UPFA 4LZPA 4QDUA 1OXUA 3HPRA 1JKXA 1XCGB 2P8JA 1CC1S 3GRFA 2G1UA 2Z5VA 3ZCPA 2QUZA 1DBVO 4DV6B 2Q5IA 4ECAA 2ZWAA 4A6DA 4LXXA 3KALA 2J3EA 2QD3A 5FOQA 1BQEA 1JMYA 3R3VA 6REQB 4BLPA 4WLFA 3LLCA 3PITA 5B2ZA 5B2FA 4Y2XA 1GQOA 1BG6A 4BO8A 2R751 1EZ4A 1ZD9A 2VS1A 2X9VA 4NZPA 1Y5NA 1B8NA 2WICA 4H60A 1UFQA 4WBNA 3KBBA 3WRVA 1SXJA 2A92A 1PRYA 2XH8A 1WKCA 2DWPA 2HF7A 2YN2A 3HG7A 3MCUA 3UENA 3R41A 2QP9X 2PUCA 1CWUA 1O03A 4MITA 1N2SA 4ZI7A 5BWCA 3PNSA 3F5SA 4HLNA 5L3SB 1CDZA 3H42B 4QFCA 4RTQA 1U98A 1ZJZA 2Y0EA 1Q17A 4DHEA 2CNDA 5IJZA 1VIYA 5C34B 4A03A 2P0AA 1TKAA 1I6MA 1QWSA 4GF5A 3BK1A 1NZDA 1M0WA 1BCRA 5TPZA 4Q1CA 4X1YB 3DV0A 2YJNA 2PV7A 1PS9A 3D1LA 4QUDA 4MO9A 4TUYA 2RHOA 1W9MA 3FF1A 3NHSA 4IO1A 1FZTA 3MQ2A 4G2TA 3HEMA 4O5AA 4AM8A 4HEQA 2ZANA 3A9TA 3JQ6A 5D84A 1JDVA 2X8LA 1YU6A 4E5VA 3OZAA 4OQMA 4QHYA 4BMPB 2NSJA 2OV3A 3CISA 3BB4A 3QTBA 4NEGA 2W90A 2PLNA 2X41A 4K3VA 3VNBA 5T41A 5DJ5A 3OICA 1GUZA 1S2IA 4GOXA 4OQ4A 4J2TA 5EE9A 3P9CA 2X13A 4J90A 2JFOA 5EQTA 3CZ9A 4BMVA 2B6HA 4F1WA 2G76A 3M5CA 1TIBA 2YZMA 2JATA 4WCVA 3ADKA 1ILWA 3EA5A 3TJRA 4HN4B 1GU0A 3KTOA 4IRMA 3NCHA 3OIVA 3AFOA 4FC6A 1S3IA 2HTFA 3GNSA 2EZTA 2P5TB 2NVOA 2BGTA 4MDEA 2WIGA 5TS2A 3KQNA 2E4VA 1NAIA 2GK4A 5C8ZA 1LLQA 2OORA 1KIMA 1CZRA 3B70A 4MUMA 3OM0A 1DVRA 4EF4A 1WBJB 1M7BA 1OU0A 1P60A 2VBGA 1TLFA 1KH3A 2D1RA 2H4FA 2WKQA 1P91A 1V7PC 2XUGA 2WFLA 3JPYA 4N5DA 4ZOCA 4M83A 4OQYA 5KO2A 4MQLA 3PVCA 1GPKA 1OC4A 3A7DA 5CCXA 1X3SA 4BO0A 2GHRA 3DZJA 1G2PA 3KX2A 2E1PA 3HJNA 4P3PA 4PZ0A 1S5PA 3B1YA 4DEYA 3QJYA 5TSDA 3R75A 4L0CA 1Z82A 2OKCA 2YV2A 3OPYB 3V8BA 3PTZA 2X7HA 1IHUA 3MHPA 2W6JD 3GVXA 4UBJA 4L0MA 1EK2A 3GI1A 4ZV9A 1Y3CE 1F2TA 4Y0VA 3M2TA 1P0IA 5IUKC 4RTPA 4QRDA 3ZZTA 3THOA 4HX9A 4KTTE 1XIVA 4OCZA 3SS9X 3T5PA 1B0ZA 3C3PA 1A76A 3I6QA 3HUTA 4AS1A 4UE3S 1WOYA 5LDGA 4HI0E 4GRAA 4NY1A 4CIDA 1JAZA 3JAWA 4JVSB 4J03A 2V7VA 4XZ3A 1VPEA 1ZONA 1K7XB 2XUPA 2O1SA 3H2BA 2OXTA 3ZEIA 8AT1A 2AMJA 2E1RA 4N1AA 4TXHA 4B5KA 3H5IA 1RAFA 3DSRA 4QLAA 4GPZA 3WISA 1T8PA 4NZOA 2WHYA 4PZPA 2FW1A 1SUBA 2D59A 2RGNC 4NAVA 4WWHA 2WB4A 2V97A 4H1VA 2IE8A 2WHQA 3KG2A 4JBWA 4PPGA 4F2HA 2V9PA 3IBSA 2C0QA 1XXHE 4OP2A 5F1YA 4EFDA 4R0NA 2X8JB 2LKDA 2CJWA 4I36A 1Z36A 1CP3A 2BF4A 3DT8A 4DDKA 2FKAA 3W2FA 1M76A 4OJNA 3OQ6A 1K06A 5ECGC 1AH2A 1CS0A 2GJKA 4P22A 3R76A 4EJ2A 4JI0B 4EECA 4CMAA 5JCXA 4B17A 1DPFA 1A9YA 4FT2A 1ISJA 1U3WA 1XVIA 2A84A 2J33A 3D43A 3H1BA 3I73A 4IV5A 3X3HA 1PYDA 4Q4CA 1WD5A 2NXCA 1E4VA 2PU5A 4CTNA 1HT3A 4JJZA 3V7UA 4JKIA 1STOA 2TECE 3H0EA 2F3RA 2FLKA 4ENRA 4ZJUA 5K8CA 1WF6A 4XDHA 1HE1C 2CXOA 4L0DA 2PX3A 3FDZA 2H1SA 3WAJA 5E0OA 4EL5A 3LVBA 4OHMA 2FW8A 5F1PA 4ZEWA 3OX1A 3HFRA 3T3OA 4X6UA 4Q1EA 1OKKD 1MRNA 1V1JA 3U61B 1MC1A 1OSNA 2QRKA 5GJWC 2Q07A 1JZQA 2X0DA 1IN6A 5LNK1 3E0XA 1S8AA 3KUUA 3IOEA 3PB3A 4ZZIA 4TS4A 1RYNA 3LXRA 2WV9A 1JSCA 1PLKA 4HAIA 2NV2B 2IPLA 5EQJB 3ST7A 1C7JA 1UADA 2Y1EA 4Q7KA 3C98A 3HFGA 1A2QA 1I7NA 1SCUB 4FT4A 3DTVD 2PH5A 1MENA 1X38A 4BVHA 5HW0A 4B47A 1OWPA 4MLCA 1TB4A 4BX0A 2AI2A 3KQOA 2B4AA 1T4CB 4G1CA 4M9XA 4IDDA 3ZXIA 1NWCA 5IAAA 5MGNA 4L16A 1I30A 5KTPA 1M34B 3T0GA 4JT8A 2E5LB 4G25A 4U4AA 4N65A 4RHTA 2XXAB 2IXTA 3WNDA 1BJKA 4BMSA 3IP6A 3TMAA 5MN5A 3WXMA 4D4KA 5IZ4A 2CJYA 4GOJA 4ZI7F 1I10A 2QRJA 2O2CA 3VPXA 1EX1A 2XCQA 2H0RA 1YFJA 1GZ7A 3GRKA 1X7GA 1L4MA 1JHVA 1AZTA 3G2QA 4HRXA 1LI4A 1URPA 3HXMA 4QNRA 1FDRA 1RTKA 3HU2A 5D6NA 1DV1A 4U2DA 3FGPA 1YZVA 1U8EA 5CAEB 3ROKA 1HT0A 3BFXA 4QXOA 1P2DA 3F97A 4PANA 3UWOA 1NBOA 1RC0A 3X2SA 5E4JA 3QY0A 4CQLA 4KQMA 3NRCA 2LWIA 5FA5A 2KLHA 3I9V1 3MQ4A 2W37A 4L8LA 2Q6TA 3MGKA 1X7WA 4V0LA 3PEYA 1YA8A 2Z57A 4NMLA 4UKDA 1FSGA 1OBHA 5E9QA 3ZDYB 4OBBA 4MW6A 4P7GA 3OT5A 2NG1A 1YDGA 1GTG1 1E8DA 3Q6IA 2A9JA 1F14A 2K2WA 5CW2A 1DJOA 4AO8A 3PTLA 3VISA 4UTVA 1IULA 4JX8A 4JR0A 5FX2A 1IUPA 2YZ7A 3CQ9A 1T4GA 3FDJA 2QN8A 3MJHA 1ZZEA 4BQFA 1J21A 3N8DA 3NEAA 3VU3A 4UNQA 4WVLA 1H9CA 3RT1A 3CR3C 1ZD4A 3B38A 3PICA 4LJ6A 1DX4A 5EMHA 1RHJA 3QE3A 4URXR 2A1UA 2WLTA 4EGCB 3O1IC 3DV2A 2NZVG 3MNFA 4JYMA 2FDRA 2ASVA 2JGLA 2R87A 1IWOA 1Z2DA 2W7TA 4MGHA 1A9PA 1IY8A 5DGCA 3V8NA 4CKYA 4DUGA 5BV8A 4R3WA 2C9YA 4CKCB 2YIDA 1DDOA 3R77A 2B9VA 3WKDA 2X5KO 1QZZA 3G59A 3HSSA 3KQYA 1EUZA 4OY3A 4Q1FA 1M2HA 1GGMA 2HA0A 4UMEA 1D9XA 4W6QA 4G1UC 2GZ3A 1KY3A 5DSTA 1RMTA 1YA6A 2IFTA 3INNA 4ZO4A 4Z9XA 3IT0A 3T9EA 3TAUA 3U49A 1RQPA 3S70A 3UUGA 4UJ5A 2M6LA 4YNBA 4CMEA 3WTBA 1Y48E 3CUVA 4KOAA 4PNPA 4BIIA 4IIJB 2VT7A 3ZVLA 2D5CA 5CH3A 4MRPA 3E81A 3M5DA 3GROA 1SHUX 3U5ZB 1GV0A 1I14A 1UKYA 2P2ZA 3AJ8A 3NWOA 2XB9A 4NH0A 4PZYA 1OLUA 1UP6A 5HOEA 1SC3A 3DF7A 4MYDA 1DI0A 1G42A 2B82A 3JAKB 2V1UA 5D3MA 4RGVA 3KE9A 1UQTA 1BXGA 4EJSA 4YY3B 2FR1A 1I3CA 1EWKA 1QANA 2QV0A 4GOOD 1YQTA 4I1VA 3ZCXA 2GZ1A 2NV6A 3WMFA 1KR2A 1A9RA 3ETHA 1IJFA 4MPPA 2HU5A 2HGSA 2Q21A 1UEJA 4TTPA 1SKYB 3NG1A 4UJ3A 2FNAA 4RZUA 3B13B 2B8EA 4GZ3A 1EWTA 3UC9A 1HDCA 4G5HA 5DP1A 1J8QA 2PRSA 3G02A 4ZARA 2XTJA 4YUXA 4AMGA 4XWKA 3CLUC 3OF2A 3SYKA 4BBAA 3OP4A 4FZRA 1E2GA 5ICMA 2HXYA 3S7ZA 1U0BB 3EMBA 1NM5C 3SZGA 2X2FA 3FDIA 4YXWD 1FXSA 2OFPA 5E3JA 1IDN1 2ZBPA 3GP3A 4L8VA 1NXVA 1UAAA 4U2GA 2FPIA 4KIWA 4ABYA 5DX8A 3UTDA 4KX5A 1N1GA 1GPNA 5EKXA 3U39A 1U3UA 1UDAA 1F6WA 2R66A 2WTBA 2ZYRA 3Q11A 2C4UA 4KQ6A 4QOGA 5ADUS 3UGQA 3P9RA 4LUCA 1YRBA 4PTZA 5DHUA 1V5IA 2DSTA 2JCYA 3ZDBA 2IRWA 4YDSA 5HPYB 1KI9A 2EGGA 2WMDA 3QBJA 4PFJA 5D6OA 4L8GA 2ZSEA 1U7PA 3ETGA 3ITEA 5DIFA 3HSKA 1SXHA 1PJLA 1UBHS 4LDNA 3L49A 1JIUA 5JS6A 3WK8A 1UAGA 4Z5XA 4US2R 4XYBA 3TL3A 1XCLA 4E11A 2AOUB 2C9OA 5KX5F 1XQ9A 1ZD3A 2QMYA 4HS9A 2DY1A 3ROEA 2I3AA 3R4CA 3ZGZA 2YVKA 3ACCA 5DDIP 2JVKA 4D8TA 4AECA 5EP4A 2SICE 1WULS 2GBLA 3M4JA 3Q85A 1M8GA 3CEHA 3QOXA 6ABPA 4LXQA 2IEGA 5CA0A 2X8JA 3ESBA 4HUJA 3THXB 4TKVA 1PFUA 2H4XA 2VR1A 4LC9A 4GLLA 4XB6B 4EB6A 4KLAA 3VYVA 5M7EA 4HFJA 1RZ3A 1TTPB 2WMOB 1SULA 4KQ9A 4PONA 3WLHA 4HQ6A 1OZAA 3IDFA 4EHJA 1T6XA 2DU8A 2C3YA 3L5KA 3X2FA 1RBMA 3TOVA 1X2EA 2GLUA 4FD2A 1L5OA 2H11A 4RM2A 1CS4C 4FMCF 5ALIA 2P9ZA 2P41A 1Y3DE 4P36A 3L7IA 3ONWA 3ZCUA 2YYZA 3OOYA 3VHLB 1ZJ5A 3B3JA 2H48A 3T38A 3WZMA 3L7AA 2B4YA 3DNFA 2OG1A 4M60A 2X3UA 1R64A 3FOBA 1KQGA 1MXFA 4K6OA 2PH3A 4LQ4A 1W29A 3VU1A 1YVPA 4YI5A 4PR0A 5B3JA 4JLDA 5AXCA 4Q3NA 5DTRA 1V3QE 2Q41A 4S1OA 1OX4A 5B1SA 4FXOA 3SZMA 2WWHA 3KEOA 1S01A 1GL6A 1Z33A 2NQ8A 4IG9A 3S1AA 3ELYA 2ZJFA 4KO4S 1JB9A 1ST2A 1WB6A 4J0EA 4RCVA 2J1LA 1THZA 2N46A 1DEOA 1WQ4A 3A27A 3QV2A 3WGUA 3LK7A 4Z54A 2V65A 2JGEA 3JTEA 4NFYA 4X9XA 1W93A 3LHIA 1ESCA 3EVTA 4OX9Y 5FORA 2PCLA 2DUMA 4FKZA 4COKA 1ZCJA 5EIFA 1S7CA 1XRSB 4HGYA 3LUFA 3A2KA 1CULC 2ODQA 3PPWA 3NIFB 3IV6A 3ISJA 4LHXA 3BN3A 4U6NA 5FWDA 1FYVA 3ASVA 3HKDA 4Q3OA 5BW5A 4DSTA 2GN0A 3L1IA 3PUHA 5CJ2A 2OD7A 3LCMA 4C2UA 4MV5A 3DVAA 5E8RA 5IDXA 4LOAA 4GL2A 1T8WA 5JMTA 2BFCA 2A3NA 3C6MA 5IT5A 2P6RA 2AZXA 3MN1A 1RXVA 4BNGA 4OOEA 1XN1A 2H4WA 5MN6A 4QU9A 1R15A 1ZUHA 2O7NA 2ZWIA 4XRGA 3IESA 1RMQA 3ZWQA 2W5UA 3C3CA 2GZDA 4BX2A 4F38A 3A25A 2JPDA 3I3SR 4W99A 1L0BA 1W46A 3JQ8B 4I5FA 3HY4A 1E9VA 4ZQIA 3MHTA 3TRKA 1U7XA 1X80B 3HVKA 2PL5A 1EUDB 1P1CA 3HO1A 3BWBA 2IZ7A 1N0WA 4LTDA 3HCAA 4JU9A 4O4IF 2JGJA 2BEUA 4R1UA 3V2HA 1X8XA 2OZPA 4DLSA 5K2OA 5IBCA 2F1IA 1M54A 3MF4A 2ZZMA 4D4HA 1GZDA 2Z08A 5IABA 3SHQA 5FBKA 1OF1A 4Y6GB 4TTVA 1RLJA 1XZLA 2AFRA 3QFFA 4UNNA 1PJ2A 3IUPA 3O8DA 3Q0TA 3C7DB 4AURA 1TYDE 1E9RA 1CY2A 1M1UA 2YOFA 1HQYE 3CNOA 3H86A 2QLTA 3FVQA 3PRYA 1P9LA 3RIGA 1W87A 1Z5VA 4K9LA 1Y42X 1XZKA 3HPQA 2HA7A 2VP0A 3NOQA 4NS1A 2YRFA 3DBOB 1VQ1A 2G5TA 4DIBA 3RYFB 4I9UA 2XVZA 2OGSA 2QW0X 1R0XA 1H1DA 2IZ6A 4IDOA 4XYEA 4ARIA 1OYWA 1BW9B 3KZXA 3NIBA 4KLZA 3GLRA 1NNUA 3M6MD 4YRFA 5DTJA 5TF0A 5LBTA 3R7LA 2X9QA 3RE1A 3UPDA 1CVIA 2WUDA 3BRWA 1GG5A 3CURA 5DTMA 4JJ4A 3TNDA 4ZFNA 3R5JA 4DJEC 3WWEA 2P6PA 3PBKA 2DMRA 4TS1A 4M0LA 2FOLA 4GXRA 4N5LA 1C81A 2AN4A 3IYLW 2OCPA 4JJ8A 1N2CA 1FDTA 2JLAA 3AUUA 5K01A 2QTAA 3EUAA 4O6VA 1EESA 1WDLA 5G40A 4DRYA 5EIXA 3K2QA 5JLAA 4ZP1A 1IONA 2FMTA 2QSZA 3G2MA 4P35A 5ALTA 4ZCSA 1MBZA 4E6PA 2JLWA 1KJJA 1U4NA 3L4JA 5LJIA 2G80A 3CCBA 3W8FA 4QJ3A 9LDTA 1TDJA 2COUA 1DCFA 3H87A 4MW5A 4JAVC 5FOXA 2Z1DA 5AHOA 2DC1A 4LKOA 4IJ6A 1AZLA 2XT6A 3G9XA 1GIAA 1DFHA 3K0FB 4FC7A 4NC9A 5AHRA 1XRJA 3Q3JB 4FYHA 4LSZA 1E89A 1A82A 1FMTA 2FPLA 2B83A 2OLJA 1F48A 3I6YA 4QDOA 3VC2A 4D9GA 3M9LA 4YJFB 2R1UA 3GUZA 5CDTA 2JI6A 1E77A 3IAHA 1TEZA 2O8BA 4AROA 4ALNA 1WY5A 1G8JA 1NXSA 2C9ZA 1BGWA 4X00A 3CUWA 1A9XA 5FOSA 1YQUA 4UUBA 3L0OA 2ZCJA 1XQVA 3Q9NA 1CU1A 5C80A 2NO5A 5HOQA 4AJHA 1KJIA 4G85A 3FVRA 4NG4A 3R24A 1B0UA 1H66A 3HZHA 2G82A 4FI3C 3V9AA 1WMEA 3DBRA 1Z4JA 2DTDA 2Y1FA 3IALA 4HLUC 4Q9HA 1A8SA 1JPUA 4EZBA 1C30B 1Y6RA 2GZMA 3BC1A 4WERA 2YV1A 5JVDB 3ZDCA 2YWJA 4HZGA 4ZVLA 3RQIA 1P2UA 3NBAA 4EELA 5L3SA 1W5EA 3OFJA 4J29A 3L6CA 4LS3A 4PN7A 1EH5A 3FUWA 1YAJA 1L2TA 2PGNA 1U0LA 3HJCA 1CF2O 3KZKA 4LZLA 3WGJA 4KRFA 3IUEA 4JSRA 3USES 2FPRA 3KUDA 5CK5A 1FS6A 5DTEA 2YZ2A 4DCMA 1TZMA 1UMBB 3LQQA 4JEUA 4PRKA 4QL3A 5P21A 2CFTA 2J9ZB 1FP1D 2IDMA 5AKHA 4U3JB 3S7TA 1Q0TA 3VC1A 2H4JA 2GKGA 4UNSA 2XQKA 3C8DA 4F84A 2O06A 2OV1A 1MA3A 1RACA 5G4KA 1JR6A 2DQSA 2GILA 3SSMA 3PQDA 3R3HA 4KNVA 3SVLA 2Y92A 3IOYA 4N6OA 4AC9A 3DXFA 4M6WB 4GRIA 5JC8A 1ZUWA 3SICE 5HK9A 3HMQA 2CHFA 4G5YA 4CGYA