2JAZA

Crystal structure of the mutant n560d of the nuclease domain of cole7 in complex with im7
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
85
structure length
85
Chain Sequence
ELKNSISDYTEAEFVQLLKEIEKENVAATDDVLDVLLEHFVKITEHPDGTDLIYYPSDNRDDSPEGIVKEIKEWRAANGKPGFKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COLICIN E7 IMMUNITY PROTEIN
publication title The Conserved Asparagine in the Hnh Motif Serves an Important Structural Role in Metal Finger Endonucleases.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/inhibitor
total genus 28
structure length 85
sequence length 85
chains with identical sequence C
ec nomenclature ec 3.1.-.-:
pdb deposition date 2006-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01320 Colicin_Pyocin Colicin immunity protein / pyocin immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.20 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Colicin E immunity protein 2jazA00
1CEIA 2GZJA 1MZ8A 3GKLC 2GZIA 1IMQA 1AYIA 1ZNVA 3U43A 2WPTA 2VLPA 2VLNA 5EW5E 4QKOA 3GJNA 1UNKA 2GYKA 4UHPB 2JBGA 2GZEA 2ERHA 2GZFA 1GXGA 2K0DX 2NO8A 1IMPA 2VLOA 1BXIA 1EMVA 1FR2A 7CEIA 2JAZA 1UJZA 2JB0A 1GXHA 4F37A 2K5XA 2VLQA 1E0HA 2GZGA
chains in the Genus database with same CATH superfamily
1DNYA 5DCKA 3GKLC 1IMQA 1VQ6P 2Z44A 2FQ2A 3DS3A 4BPFA 5KP8B 2VLNA 2KG6A 1UNKA 5I4TG 1L0IA 2K0DX 1S72P 3G6EP 2PEMA 2FQ0A 4IPYA 4PWVB 3Q20A 4COCA 1GXHA 1AF8A 3CMEP 2LIUA 1VQMP 2XXMA 1K30A 2K0XA 2KWLA 5F2KA 1Q82Q 2FVEA 2GZJA 2KGDA 4M0IA 4COPA 4U0FA 2AFEA 4U0AA 1Q86Q 2MF4A 3HZQA 1BXIA 1EMVA 4H2YC 1T8KA 2FADA 1UJZA 3G1GA 2KR5A 2QEXP 5F2OA 4WYMA 1YHQP 2MY5A 2XZ0D 3M1MA 2KW2A 2AVAA 1K73Q 3H47A 4XFXA 1IUQA 1ZMBA 3LMOA 3CC7P 2L22A 2DGYA 2N5HA 3DTJA 2CWOA 5CZDB 2JB0A 2K94A 1VQ5P 1RNIA 1E0HA 2CGQA 4PH0A 1KC8Q 4U0EA 3LRYA 2FVAA 1QVGO 4BPHA 2LTEA 2QNWA 2BUOA 2Z45A 1NJIQ 1VQ4P 1M6NA 1OR5A 1Q81Q 2BHVA 2FAEA 1MZ8A 2PY8A 2MR7A 2LPKA 2M8NA 3CC2P 2EFJA 5HVCA 1FR2A 1F80D 2GDWA 3B5IA 1EIAA 2PEIA 4XFZA 1M6EX 4BPGA 3G71P 5HGLA 2FQ1A 2PEJA 2XV6A 2FACA 5JPAA 2KGCA 1VQ9P 1AUMA 2DNWA 2X2BA 3CCRP 1HY8A 3DPHA 3GZLA 5KP7B 2AF8A 1L0HA 2JAZA 2M8PA 1VQPP 1ACPA 1GPJA 1N8RQ 2XZ1C 2P9XA 2LOLA 1AYIA 3DS5A 2N5IA 3OW2O 1KD1Q 2FHSC 2JBGA 1VQKP 1GXGA 2ROQA 1BAJA 2N6YA 3CCMP 2Z46A 3RG6C 2OTLP 3RG2A 1QVFO 3CCSP 2M8LA 3CCQP 3G0VA 4U0BA 2VLQA 3GZMA 4DG9A 1E6JP 5HV8A 4R0MA 2MR8A 4CA3A 2EHTA 2M5RA 3CCUP 2XT1A 1CEIA 1A8OA 3G21A 3DS4A 2EG5A 3CXCO 2EHSA 1Z6MA 2GZEA 1QRJA 2CNRA 2OTJP 2GDYA 5BS2A 3B4QA 3CMAP 4HKGA 2CG5B 4IZ6A 4PH1A 4QNBA 2KOPA 3U43A 2VLPA 1YJ9P 2N6ZA 1YIJP 2JYGA 2JU2A 3I55P 2GDXA 3G26A 1VQOP 4H2XC 2K92A 3G1IA 2JQ4A 2LIWA 2FVFA 1M90Q 2KGAA 2KOQA 3G4SP 2GZGA 1K9MQ 2E1MA 1W2BO 2GZIA 1RO0A 2MVUA 1D1DA 5HGOA 3CCEP 2KOOA 3G29A 2PNGA 3NTEA 1K8AQ 1YI2P 1HQBA 2KORA 2PEOA 1M74A 2L6EA 2PEQA 1KLPA 3NY7B 4U0CA 4NEOA 1X3OA 3E2DA 4QKOA 3GJNA 4UHPB 3VRLC 2VLOA 1VQLP 2JU1A 3CE7A 4XROA 2KG9A 2AFDA 1NQ4A 1YJWP 1Q7YQ 2JYLA 3DS1A 2L0QA 2KGEA 1ZNVA 3CPWO 5EJDA 5BS1A 2ERHA 1EOQA 2L4BA 3DS0A 2EIAA 2N50A 3I56P 3H0DA 4XFYA 2K93A 1A43A 3G28A 3CCVP 2L9FA 4XRQA 4H2WC 3HYBA 4GR2A 2WPTA 1VQNP 5EW5E 1YITP 2GYKA 4GR6A 2PEKA 4MRTC 1IMPA 3EJBA 2LKIA 2CQ8A 2K0YA 2N98A 3MGEA 3CC4P 3EJDA 3CD6P 1DV5A 1VHNA 2ONTA 1JJ2O 2MD9A 2GZFA 2JGPA 1YJNP 5F2NA 1KQSO 2KOSA 3CCLP 2KODA 3WBHA 5HGMA 5KP6B 1RO2A 2PENA 2K5XA 1VQ8P 3EJEA 2VSQA 2LL8A 2QA4P 4PXHB 3H4EA 2OARA 3P05A 3CCJP 2K2QA 3DS2A 4U0DA 1VKUA 2KG8A 5HGNA 2LMLA 2NO8A 2MVVA 1M1KQ 7CEIA 1VQ7P 2LF4A 4F37A 2JO0A
chains in the Genus database with same CATH topology
1CEIA 2GZJA 1MZ8A 3GKLC 2GZIA 1IMQA 1AYIA 1ZNVA 3U43A 2WPTA 2VLPA 2VLNA 5EW5E 4QKOA 3GJNA 1UNKA 2GYKA 4UHPB 2JBGA 2GZEA 2ERHA 2GZFA 1GXGA 2K0DX 2NO8A 1IMPA 2VLOA 1BXIA 1EMVA 1FR2A 7CEIA 2JAZA 1UJZA 2JB0A 1GXHA 4F37A 2K5XA 2VLQA 1E0HA 2GZGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CEI A;  2GZJ A;  1MZ8 A;  3GKL C;  2GZI A;  1IMQ A;  1AYI A;  1ZNV A;  3U43 A;  2WPT A;  2VLP A;  2VLN A;  5EW5 E;  4QKO A;  3GJN A;  1UNK A;  2GYK A;  4UHP B;  2JBG A;  2GZE A;  2ERH A;  2GZF A;  1GXG A;  2K0D X;  2NO8 A;  1IMP A;  2VLO A;  1BXI A;  1EMV A;  1FR2 A;  7CEI A;  2JAZ A;  1UJZ A;  2JB0 A;  1GXH A;  4F37 A;  2K5X A;  2VLQ A;  1E0H A;  2GZG A; 
#chains in the Genus database with same CATH topology
 1DNY A;  5DCK A;  3GKL C;  1IMQ A;  1VQ6 P;  2Z44 A;  2FQ2 A;  3DS3 A;  4BPF A;  5KP8 B;  2VLN A;  2KG6 A;  1UNK A;  5I4T G;  1L0I A;  2K0D X;  1S72 P;  3G6E P;  2PEM A;  2FQ0 A;  4IPY A;  4PWV B;  3Q20 A;  4COC A;  1GXH A;  1AF8 A;  3CME P;  2LIU A;  1VQM P;  2XXM A;  1K30 A;  2K0X A;  2KWL A;  5F2K A;  1Q82 Q;  2FVE A;  2GZJ A;  2KGD A;  4M0I A;  4COP A;  4U0F A;  2AFE A;  4U0A A;  1Q86 Q;  2MF4 A;  3HZQ A;  1BXI A;  1EMV A;  4H2Y C;  1T8K A;  2FAD A;  1UJZ A;  3G1G A;  2KR5 A;  2QEX P;  5F2O A;  4WYM A;  1YHQ P;  2MY5 A;  2XZ0 D;  3M1M A;  2KW2 A;  2AVA A;  1K73 Q;  3H47 A;  4XFX A;  1IUQ A;  1ZMB A;  3LMO A;  3CC7 P;  2L22 A;  2DGY A;  2N5H A;  3DTJ A;  2CWO A;  5CZD B;  2JB0 A;  2K94 A;  1VQ5 P;  1RNI A;  1E0H A;  2CGQ A;  4PH0 A;  1KC8 Q;  4U0E A;  3LRY A;  2FVA A;  1QVG O;  4BPH A;  2LTE A;  2QNW A;  2BUO A;  2Z45 A;  1NJI Q;  1VQ4 P;  1M6N A;  1OR5 A;  1Q81 Q;  2BHV A;  2FAE A;  1MZ8 A;  2PY8 A;  2MR7 A;  2LPK A;  2M8N A;  3CC2 P;  2EFJ A;  5HVC A;  1FR2 A;  1F80 D;  2GDW A;  3B5I A;  1EIA A;  2PEI A;  4XFZ A;  1M6E X;  4BPG A;  3G71 P;  5HGL A;  2FQ1 A;  2PEJ A;  2XV6 A;  2FAC A;  5JPA A;  2KGC A;  1VQ9 P;  1AUM A;  2DNW A;  2X2B A;  3CCR P;  1HY8 A;  3DPH A;  3GZL A;  5KP7 B;  2AF8 A;  1L0H A;  2JAZ A;  2M8P A;  1VQP P;  1ACP A;  1GPJ A;  1N8R Q;  2XZ1 C;  2P9X A;  2LOL A;  1AYI A;  3DS5 A;  2N5I A;  3OW2 O;  1KD1 Q;  2FHS C;  2JBG A;  1VQK P;  1GXG A;  2ROQ A;  1BAJ A;  2N6Y A;  3CCM P;  2Z46 A;  3RG6 C;  2OTL P;  3RG2 A;  1QVF O;  3CCS P;  2M8L A;  3CCQ P;  3G0V A;  4U0B A;  2VLQ A;  3GZM A;  4DG9 A;  1E6J P;  5HV8 A;  4R0M A;  2MR8 A;  4CA3 A;  2EHT A;  2M5R A;  3CCU P;  2XT1 A;  1CEI A;  1A8O A;  3G21 A;  3DS4 A;  2EG5 A;  3CXC O;  2EHS A;  1Z6M A;  2GZE A;  1QRJ A;  2CNR A;  2OTJ P;  2GDY A;  5BS2 A;  3B4Q A;  3CMA P;  4HKG A;  2CG5 B;  4IZ6 A;  4PH1 A;  4QNB A;  2KOP A;  3U43 A;  2VLP A;  1YJ9 P;  2N6Z A;  1YIJ P;  2JYG A;  2JU2 A;  3I55 P;  2GDX A;  3G26 A;  1VQO P;  4H2X C;  2K92 A;  3G1I A;  2JQ4 A;  2LIW A;  2FVF A;  1M90 Q;  2KGA A;  2KOQ A;  3G4S P;  2GZG A;  1K9M Q;  2E1M A;  1W2B O;  2GZI A;  1RO0 A;  2MVU A;  1D1D A;  5HGO A;  3CCE P;  2KOO A;  3G29 A;  2PNG A;  3NTE A;  1K8A Q;  1YI2 P;  1HQB A;  2KOR A;  2PEO A;  1M74 A;  2L6E A;  2PEQ A;  1KLP A;  3NY7 B;  4U0C A;  4NEO A;  1X3O A;  3E2D A;  4QKO A;  3GJN A;  4UHP B;  3VRL C;  2VLO A;  1VQL P;  2JU1 A;  3CE7 A;  4XRO A;  2KG9 A;  2AFD A;  1NQ4 A;  1YJW P;  1Q7Y Q;  2JYL A;  3DS1 A;  2L0Q A;  2KGE A;  1ZNV A;  3CPW O;  5EJD A;  5BS1 A;  2ERH A;  1EOQ A;  2L4B A;  3DS0 A;  2EIA A;  2N50 A;  3I56 P;  3H0D A;  4XFY A;  2K93 A;  1A43 A;  3G28 A;  3CCV P;  2L9F A;  4XRQ A;  4H2W C;  3HYB A;  4GR2 A;  2WPT A;  1VQN P;  5EW5 E;  1YIT P;  2GYK A;  4GR6 A;  2PEK A;  4MRT C;  1IMP A;  3EJB A;  2LKI A;  2CQ8 A;  2K0Y A;  2N98 A;  3MGE A;  3CC4 P;  3EJD A;  3CD6 P;  1DV5 A;  1VHN A;  2ONT A;  1JJ2 O;  2MD9 A;  2GZF A;  2JGP A;  1YJN P;  5F2N A;  1KQS O;  2KOS A;  3CCL P;  2KOD A;  3WBH A;  5HGM A;  5KP6 B;  1RO2 A;  2PEN A;  2K5X A;  1VQ8 P;  3EJE A;  2VSQ A;  2LL8 A;  2QA4 P;  4PXH B;  3H4E A;  2OAR A;  3P05 A;  3CCJ P;  2K2Q A;  3DS2 A;  4U0D A;  1VKU A;  2KG8 A;  5HGN A;  2LML A;  2NO8 A;  2MVV A;  1M1K Q;  7CEI A;  1VQ7 P;  2LF4 A;  4F37 A;  2JO0 A; 
#chains in the Genus database with same CATH homology
 1CEI A;  2GZJ A;  1MZ8 A;  3GKL C;  2GZI A;  1IMQ A;  1AYI A;  1ZNV A;  3U43 A;  2WPT A;  2VLP A;  2VLN A;  5EW5 E;  4QKO A;  3GJN A;  1UNK A;  2GYK A;  4UHP B;  2JBG A;  2GZE A;  2ERH A;  2GZF A;  1GXG A;  2K0D X;  2NO8 A;  1IMP A;  2VLO A;  1BXI A;  1EMV A;  1FR2 A;  7CEI A;  2JAZ A;  1UJZ A;  2JB0 A;  1GXH A;  4F37 A;  2K5X A;  2VLQ A;  1E0H A;  2GZG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...