2JAZA

Crystal structure of the mutant n560d of the nuclease domain of cole7 in complex with im7
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
85
structure length
85
Chain Sequence
ELKNSISDYTEAEFVQLLKEIEKENVAATDDVLDVLLEHFVKITEHPDGTDLIYYPSDNRDDSPEGIVKEIKEWRAANGKPGFKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Conserved Asparagine in the Hnh Motif Serves an Important Structural Role in Metal Finger Endonucleases.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/inhibitor
molecule keywords COLICIN E7 IMMUNITY PROTEIN
total genus 28
structure length 85
sequence length 85
chains with identical sequence C
ec nomenclature ec 3.1.-.-:
pdb deposition date 2006-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01320 Colicin_Pyocin Colicin immunity protein / pyocin immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.20 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Colicin E immunity protein 2jazA00
2VLNA 2WPTA 7CEIA 3GKLC 1IMPA 1FR2A 1MZ8A 4F37A 1BXIA 2JBGA 2VLPA 1E0HA 2VLQA 2JB0A 2K0DX 4UHPB 2JAZA 3GJNA 2GZIA 1AYIA 2K5XA 2GZGA 2NO8A 2GZJA 1GXHA 1IMQA 1UNKA 2VLOA 5EW5E 2GZEA 1ZNVA 1UJZA 1EMVA 2ERHA 2GZFA 1GXGA 1CEIA 3U43A 4QKOA 2GYKA
chains in the Genus database with same CATH superfamily
2KG6A 3CCLP 2JYGA 4F37A 1RO2A 1BXIA 2KODA 4NEOA 3DS3A 4U0BA 3VRLC 2M5RA 2K93A 2KOQA 2MR7A 2MR8A 3I56P 2N50A 3EJDA 1ZMBA 4HKGA 3G4SP 2Z46A 3G26A 1RO0A 2VLNA 5EJDA 3GZLA 4GR6A 2QEXP 5KP7B 5HGNA 3OW2O 3G1GA 2GDWA 3CC4P 1T8KA 2P9XA 3B5IA 3DS4A 4H2XC 3U43A 2JU1A 3DTJA 5HGOA 2OARA 2JYLA 2PEKA 1VHNA 4XFYA 3I55P 3EJEA 2MVUA 2LTEA 4R0MA 2K2QA 1W2BO 2N5HA 2N98A 5CZDB 1VQ8P 1VQOP 2CWOA 2LOLA 2EHTA 5BS1A 5F2NA 1OR5A 4QKOA 2PY8A 2EHSA 4BPHA 3G21A 2EFJA 1F80D 3CCEP 3CCVP 5HVCA 1K30A 4H2WC 2M8LA 5DCKA 1KLPA 1M6NA 1Q7YQ 2LKIA 3MGEA 1N8RQ 1YJNP 3P05A 2FHSC 2KR5A 1KC8Q 5F2KA 2MY5A 2CNRA 2KWLA 5HGMA 1VQ7P 2JBGA 4QNBA 2L9FA 2EIAA 1E6JP 1M6EX 2GZIA 2JO0A 3CCUP 1YJ9P 2QA4P 5EW5E 3CXCO 4PH0A 1IUQA 3E2DA 3CC7P 2KGDA 1M90Q 3DS0A 1HQBA 4XFXA 3RG2A 2KGEA 1VQ6P 3CPWO 3NY7B 2JB0A 1JJ2O 3B4QA 2FVFA 1IMQA 2VLOA 3RG6C 1M74A 5HV8A 3CE7A 1DNYA 2KG8A 4GR2A 1YJWP 3HZQA 2LIWA 1YIJP 5I4TG 1M1KQ 2XZ1C 2VLQA 2PEJA 3CMEP 4PXHB 2GZJA 2VSQA 1Q81Q 1EMVA 2ERHA 5HGLA 2FACA 2PEQA 1VQNP 1Z6MA 2JQ4A 4XROA 2FVEA 2K0DX 4UHPB 1EOQA 2M8NA 1YI2P 2KW2A 2L0QA 2JU2A 3CCQP 1UJZA 2N6ZA 2K0XA 2DGYA 2PEIA 2KG9A 4XRQA 2PENA 1IMPA 2XV6A 3CCSP 4WYMA 3CCMP 2DNWA 1QRJA 1KD1Q 2EG5A 3CC2P 4U0DA 4U0FA 4U0AA 2OTLP 2LMLA 2FAEA 2Z45A 4PH1A 4H2YC 4DG9A 2GDXA 1A8OA 2MF4A 1VKUA 4MRTC 3G0VA 2GDYA 2GZEA 2MVVA 2JGPA 2XXMA 1ACPA 2AVAA 3M1MA 2WPTA 1L0HA 2FQ1A 2L4BA 1FR2A 1K8AQ 5JPAA 2K94A 2FVAA 3GJNA 3GZMA 1AYIA 3DS2A 2NO8A 2KOSA 1D1DA 1YHQP 2K0YA 2GZFA 2PEMA 3NTEA 2X2BA 2ROQA 1VQLP 1VQPP 5KP6B 2FADA 2L22A 1DV5A 2VLPA 2BHVA 1A43A 3G1IA 3H47A 5F2OA 3H4EA 1VQ5P 3CCRP 4PWVB 1GXGA 4COCA 2PNGA 2AF8A 4M0IA 4BPGA 2GYKA 2E1MA 3CD6P 2KGAA 2LL8A 1YITP 4U0EA 2QNWA 2LPKA 1NQ4A 2K92A 3DS5A 2KORA 2L6EA 5BS2A 1NJIQ 2AFEA 1VQKP 1CEIA 2KGCA 4CA3A 2LF4A 2OTJP 2AFDA 2ONTA 2N6YA 1K9MQ 1EIAA 2CQ8A 4XFZA 1VQMP 3G28A 1S72P 3CCJP 3LRYA 4IZ6A 2JAZA 3G29A 1K73Q 2FQ2A 4COPA 4U0CA 3G71P 4BPFA 3H0DA 1X3OA 7CEIA 2PEOA 1VQ4P 1Q82Q 3GKLC 2MD9A 3DPHA 1QVGO 2Z44A 3Q20A 1L0IA 2LIUA 1GPJA 2KOPA 1AUMA 2FQ0A 3EJBA 3DS1A 2CG5B 1GXHA 2XT1A 1UNKA 1ZNVA 1VQ9P 1KQSO 1HY8A 3CMAP 3HYBA 1QVFO 3LMOA 1RNIA 1MZ8A 1E0HA 3G6EP 2XZ0D 2K5XA 2GZGA 3WBHA 2N5IA 2CGQA 2KOOA 1Q86Q 1AF8A 5KP8B 2BUOA 1BAJA 4IPYA 2M8PA
chains in the Genus database with same CATH topology
2VLNA 2WPTA 7CEIA 3GKLC 1IMPA 1FR2A 1MZ8A 4F37A 1BXIA 2JBGA 2VLPA 1E0HA 2VLQA 2JB0A 2K0DX 4UHPB 2JAZA 3GJNA 2GZIA 1AYIA 2K5XA 2GZGA 2NO8A 2GZJA 1GXHA 1IMQA 1UNKA 2VLOA 5EW5E 2GZEA 1ZNVA 1UJZA 1EMVA 2ERHA 2GZFA 1GXGA 1CEIA 3U43A 4QKOA 2GYKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VLN A;  2WPT A;  7CEI A;  3GKL C;  1IMP A;  1FR2 A;  1MZ8 A;  4F37 A;  1BXI A;  2JBG A;  2VLP A;  1E0H A;  2VLQ A;  2JB0 A;  2K0D X;  4UHP B;  2JAZ A;  3GJN A;  2GZI A;  1AYI A;  2K5X A;  2GZG A;  2NO8 A;  2GZJ A;  1GXH A;  1IMQ A;  1UNK A;  2VLO A;  5EW5 E;  2GZE A;  1ZNV A;  1UJZ A;  1EMV A;  2ERH A;  2GZF A;  1GXG A;  1CEI A;  3U43 A;  4QKO A;  2GYK A; 
#chains in the Genus database with same CATH topology
 2KG6 A;  3CCL P;  2JYG A;  4F37 A;  1RO2 A;  1BXI A;  2KOD A;  4NEO A;  3DS3 A;  4U0B A;  3VRL C;  2M5R A;  2K93 A;  2KOQ A;  2MR7 A;  2MR8 A;  3I56 P;  2N50 A;  3EJD A;  1ZMB A;  4HKG A;  3G4S P;  2Z46 A;  3G26 A;  1RO0 A;  2VLN A;  5EJD A;  3GZL A;  4GR6 A;  2QEX P;  5KP7 B;  5HGN A;  3OW2 O;  3G1G A;  2GDW A;  3CC4 P;  1T8K A;  2P9X A;  3B5I A;  3DS4 A;  4H2X C;  3U43 A;  2JU1 A;  3DTJ A;  5HGO A;  2OAR A;  2JYL A;  2PEK A;  1VHN A;  4XFY A;  3I55 P;  3EJE A;  2MVU A;  2LTE A;  4R0M A;  2K2Q A;  1W2B O;  2N5H A;  2N98 A;  5CZD B;  1VQ8 P;  1VQO P;  2CWO A;  2LOL A;  2EHT A;  5BS1 A;  5F2N A;  1OR5 A;  4QKO A;  2PY8 A;  2EHS A;  4BPH A;  3G21 A;  2EFJ A;  1F80 D;  3CCE P;  3CCV P;  5HVC A;  1K30 A;  4H2W C;  2M8L A;  5DCK A;  1KLP A;  1M6N A;  1Q7Y Q;  2LKI A;  3MGE A;  1N8R Q;  1YJN P;  3P05 A;  2FHS C;  2KR5 A;  1KC8 Q;  5F2K A;  2MY5 A;  2CNR A;  2KWL A;  5HGM A;  1VQ7 P;  2JBG A;  4QNB A;  2L9F A;  2EIA A;  1E6J P;  1M6E X;  2GZI A;  2JO0 A;  3CCU P;  1YJ9 P;  2QA4 P;  5EW5 E;  3CXC O;  4PH0 A;  1IUQ A;  3E2D A;  3CC7 P;  2KGD A;  1M90 Q;  3DS0 A;  1HQB A;  4XFX A;  3RG2 A;  2KGE A;  1VQ6 P;  3CPW O;  3NY7 B;  2JB0 A;  1JJ2 O;  3B4Q A;  2FVF A;  1IMQ A;  2VLO A;  3RG6 C;  1M74 A;  5HV8 A;  3CE7 A;  1DNY A;  2KG8 A;  4GR2 A;  1YJW P;  3HZQ A;  2LIW A;  1YIJ P;  5I4T G;  1M1K Q;  2XZ1 C;  2VLQ A;  2PEJ A;  3CME P;  4PXH B;  2GZJ A;  2VSQ A;  1Q81 Q;  1EMV A;  2ERH A;  5HGL A;  2FAC A;  2PEQ A;  1VQN P;  1Z6M A;  2JQ4 A;  4XRO A;  2FVE A;  2K0D X;  4UHP B;  1EOQ A;  2M8N A;  1YI2 P;  2KW2 A;  2L0Q A;  2JU2 A;  3CCQ P;  1UJZ A;  2N6Z A;  2K0X A;  2DGY A;  2PEI A;  2KG9 A;  4XRQ A;  2PEN A;  1IMP A;  2XV6 A;  3CCS P;  4WYM A;  3CCM P;  2DNW A;  1QRJ A;  1KD1 Q;  2EG5 A;  3CC2 P;  4U0D A;  4U0F A;  4U0A A;  2OTL P;  2LML A;  2FAE A;  2Z45 A;  4PH1 A;  4H2Y C;  4DG9 A;  2GDX A;  1A8O A;  2MF4 A;  1VKU A;  4MRT C;  3G0V A;  2GDY A;  2GZE A;  2MVV A;  2JGP A;  2XXM A;  1ACP A;  2AVA A;  3M1M A;  2WPT A;  1L0H A;  2FQ1 A;  2L4B A;  1FR2 A;  1K8A Q;  5JPA A;  2K94 A;  2FVA A;  3GJN A;  3GZM A;  1AYI A;  3DS2 A;  2NO8 A;  2KOS A;  1D1D A;  1YHQ P;  2K0Y A;  2GZF A;  2PEM A;  3NTE A;  2X2B A;  2ROQ A;  1VQL P;  1VQP P;  5KP6 B;  2FAD A;  2L22 A;  1DV5 A;  2VLP A;  2BHV A;  1A43 A;  3G1I A;  3H47 A;  5F2O A;  3H4E A;  1VQ5 P;  3CCR P;  4PWV B;  1GXG A;  4COC A;  2PNG A;  2AF8 A;  4M0I A;  4BPG A;  2GYK A;  2E1M A;  3CD6 P;  2KGA A;  2LL8 A;  1YIT P;  4U0E A;  2QNW A;  2LPK A;  1NQ4 A;  2K92 A;  3DS5 A;  2KOR A;  2L6E A;  5BS2 A;  1NJI Q;  2AFE A;  1VQK P;  1CEI A;  2KGC A;  4CA3 A;  2LF4 A;  2OTJ P;  2AFD A;  2ONT A;  2N6Y A;  1K9M Q;  1EIA A;  2CQ8 A;  4XFZ A;  1VQM P;  3G28 A;  1S72 P;  3CCJ P;  3LRY A;  4IZ6 A;  2JAZ A;  3G29 A;  1K73 Q;  2FQ2 A;  4COP A;  4U0C A;  3G71 P;  4BPF A;  3H0D A;  1X3O A;  7CEI A;  2PEO A;  1VQ4 P;  1Q82 Q;  3GKL C;  2MD9 A;  3DPH A;  1QVG O;  2Z44 A;  3Q20 A;  1L0I A;  2LIU A;  1GPJ A;  2KOP A;  1AUM A;  2FQ0 A;  3EJB A;  3DS1 A;  2CG5 B;  1GXH A;  2XT1 A;  1UNK A;  1ZNV A;  1VQ9 P;  1KQS O;  1HY8 A;  3CMA P;  3HYB A;  1QVF O;  3LMO A;  1RNI A;  1MZ8 A;  1E0H A;  3G6E P;  2XZ0 D;  2K5X A;  2GZG A;  3WBH A;  2N5I A;  2CGQ A;  2KOO A;  1Q86 Q;  1AF8 A;  5KP8 B;  2BUO A;  1BAJ A;  4IPY A;  2M8P A; 
#chains in the Genus database with same CATH homology
 2VLN A;  2WPT A;  7CEI A;  3GKL C;  1IMP A;  1FR2 A;  1MZ8 A;  4F37 A;  1BXI A;  2JBG A;  2VLP A;  1E0H A;  2VLQ A;  2JB0 A;  2K0D X;  4UHP B;  2JAZ A;  3GJN A;  2GZI A;  1AYI A;  2K5X A;  2GZG A;  2NO8 A;  2GZJ A;  1GXH A;  1IMQ A;  1UNK A;  2VLO A;  5EW5 E;  2GZE A;  1ZNV A;  1UJZ A;  1EMV A;  2ERH A;  2GZF A;  1GXG A;  1CEI A;  3U43 A;  4QKO A;  2GYK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...