2JAZA

Crystal structure of the mutant n560d of the nuclease domain of cole7 in complex with im7
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
85
structure length
85
Chain Sequence
b'ELKNSISDYTEAEFVQLLKEIEKENVAATDDVLDVLLEHFVKITEHPDGTDLIYYPSDNRDDSPEGIVKEIKEWRAANGKPGFKQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COLICIN E7 IMMUNITY PROTEIN
publication title The Conserved Asparagine in the Hnh Motif Serves an Important Structural Role in Metal Finger Endonucleases.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/inhibitor
total genus 28
structure length 85
sequence length 85
chains with identical sequence C
ec nomenclature ec 3.1.-.-:
pdb deposition date 2006-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01320 Colicin_Pyocin Colicin immunity protein / pyocin immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.20 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Colicin E immunity protein 2jazA00
2VLPA 3U43A 2GZJA 1FR2A 2ERHA 2JB0A 5EW5E 4F37A 1E0HA 2JAZA 1CEIA 1MZ8A 1ZNVA 2GYKA 1EMVA 2WPTA 1UJZA 1IMQA 2GZFA 1GXHA 2NO8A 2VLOA 1AYIA 2GZGA 2VLQA 2K5XA 2JBGA 2VLNA 1UNKA 4QKOA 4UHPB 7CEIA 2GZEA 1GXGA 2K0DX 3GJNA 1IMPA 2GZIA 3GKLC 1BXIA
chains in the Genus database with same CATH superfamily
3I56P 3DS5A 2EHTA 2LIWA 2GZGA 2JBGA 2AFDA 1BAJA 1YJWP 3CC4P 3EJEA 5HV8A 1FR2A 5HVCA 1NJIQ 1K8AQ 2PY8A 1VQ4P 2KGCA 4COPA 2KWLA 1UJZA 1IMQA 2MR8A 3RG6C 2KR5A 3G29A 2JYGA 4PH1A 1VQ8P 2FVEA 2Z44A 5EW5E 2XXMA 3MGEA 2PEIA 1K30A 1MZ8A 2L0QA 5DCKA 2LF4A 2CGQA 1VQ7P 2FQ1A 4QNBA 3H47A 2OTLP 2VLQA 3DPHA 2CQ8A 3G21A 4M0IA 3CC2P 1RNIA 2JYLA 3CMAP 1K73Q 2KOSA 5F2NA 2XT1A 1VKUA 3RG2A 2KOPA 3DS2A 2JO0A 3G6EP 2EFJA 4PXHB 5F2OA 3CCLP 2N6ZA 3CCJP 2XZ0D 1DV5A 4U0BA 1L0IA 2Z46A 5HGNA 3LMOA 2EHSA 3DS4A 2DGYA 2PNGA 2EIAA 1RO0A 2NO8A 1KLPA 4U0CA 3EJDA 7CEIA 4PH0A 5BS2A 1Z6MA 2CNRA 3CCRP 2N50A 2MR7A 2PEQA 2KW2A 1ZMBA 4COCA 2GDXA 3CCVP 2AVAA 2GDYA 2PEMA 4BPGA 2M8NA 3G26A 3CPWO 3H4EA 4PWVB 3GJNA 2N5HA 4WYMA 3EJBA 4U0DA 1AF8A 2ROQA 3I55P 4H2XC 2K0XA 2LOLA 1KQSO 3CCUP 2KOQA 2BUOA 2E1MA 1OR5A 1GXHA 3E2DA 2CG5B 2K0DX 3GKLC 5HGMA 3CCEP 3G28A 2VSQA 3GZMA 3U43A 2FADA 2CWOA 2LIUA 3H0DA 3G0VA 1M6EX 3CD6P 2P9XA 1IUQA 2L22A 2GYKA 3DS1A 2WPTA 3VRLC 1YITP 2FQ0A 2GZFA 3CCMP 1A8OA 2FVAA 1QVFO 2PENA 1VQPP 1W2BO 1IMPA 2QA4P 3DS3A 2N98A 2QEXP 2FQ2A 1GPJA 1YI2P 1E6JP 1Q7YQ 2JQ4A 1T8KA 1QRJA 3CC7P 3DS0A 1A43A 3CMEP 2PEKA 2K5XA 2LPKA 1Q81Q 2KOOA 1VQ5P 1DNYA 1VQLP 2MVVA 4F37A 2KG9A 1M74A 2K94A 3NY7B 5HGOA 2AFEA 3G4SP 2L9FA 4UHPB 1GXGA 2LTEA 1VQ6P 2VLPA 2K0YA 3DTJA 1Q82Q 3OW2O 2LL8A 5HGLA 2N5IA 4BPFA 2OARA 4U0EA 2L6EA 3CXCO 4CA3A 1HY8A 2XV6A 1F80D 1KC8Q 2GZJA 4XFYA 2ERHA 2JB0A 2LMLA 2GDWA 1JJ2O 1KD1Q 2BHVA 2KODA 1CEIA 3M1MA 2KG8A 2K2QA 2KG6A 2M5RA 4U0FA 2PEOA 3B5IA 1S72P 2MD9A 1Q86Q 1YIJP 1VQOP 2QNWA 4R0MA 2FACA 4IPYA 4NEOA 4MRTC 2X2BA 2KGDA 3G1GA 3NTEA 1ZNVA 5BS1A 1EMVA 1N8RQ 1AYIA 1YJNP 1EIAA 3CCSP 5EJDA 4XFXA 2GZEA 2L4BA 2LKIA 5F2KA 5KP7B 3Q20A 2JU2A 1E0HA 2JU1A 4IZ6A 1K9MQ 2MY5A 5KP6B 2FHSC 1EOQA 1M90Q 2KGEA 5KP8B 4XFZA 2Z45A 1YHQP 2M8PA 1RO2A 2MF4A 2GZIA 3LRYA 3HZQA 5JPAA 2OTJP 2JAZA 5CZDB 1AUMA 2AF8A 4BPHA 2MVUA 1VQKP 1NQ4A 2M8LA 3G1IA 5I4TG 1VQMP 1ACPA 3P05A 1HQBA 1M6NA 4GR2A 2VLOA 3CCQP 1UNKA 2K92A 4H2WC 1YJ9P 4HKGA 2EG5A 2FVFA 1QVGO 2DNWA 2KORA 4U0AA 2JGPA 2ONTA 3GZLA 2K93A 4DG9A 1VQNP 1VHNA 2N6YA 2XZ1C 3CE7A 2KGAA 1M1KQ 1D1DA 4GR6A 2PEJA 4H2YC 3HYBA 1L0HA 4QKOA 1X3OA 3WBHA 4XRQA 1VQ9P 4XROA 2FAEA 3B4QA 3G71P 2VLNA 1BXIA
chains in the Genus database with same CATH topology
2VLPA 3U43A 2GZJA 1FR2A 2ERHA 2JB0A 5EW5E 4F37A 1E0HA 2JAZA 1CEIA 1MZ8A 1ZNVA 2GYKA 1EMVA 2WPTA 1UJZA 1IMQA 2GZFA 1GXHA 2NO8A 2VLOA 1AYIA 2GZGA 2VLQA 2K5XA 2JBGA 2VLNA 1UNKA 4QKOA 4UHPB 7CEIA 2GZEA 1GXGA 2K0DX 3GJNA 1IMPA 2GZIA 3GKLC 1BXIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VLP A;  3U43 A;  2GZJ A;  1FR2 A;  2ERH A;  2JB0 A;  5EW5 E;  4F37 A;  1E0H A;  2JAZ A;  1CEI A;  1MZ8 A;  1ZNV A;  2GYK A;  1EMV A;  2WPT A;  1UJZ A;  1IMQ A;  2GZF A;  1GXH A;  2NO8 A;  2VLO A;  1AYI A;  2GZG A;  2VLQ A;  2K5X A;  2JBG A;  2VLN A;  1UNK A;  4QKO A;  4UHP B;  7CEI A;  2GZE A;  1GXG A;  2K0D X;  3GJN A;  1IMP A;  2GZI A;  3GKL C;  1BXI A; 
#chains in the Genus database with same CATH topology
 3I56 P;  3DS5 A;  2EHT A;  2LIW A;  2GZG A;  2JBG A;  2AFD A;  1BAJ A;  1YJW P;  3CC4 P;  3EJE A;  5HV8 A;  1FR2 A;  5HVC A;  1NJI Q;  1K8A Q;  2PY8 A;  1VQ4 P;  2KGC A;  4COP A;  2KWL A;  1UJZ A;  1IMQ A;  2MR8 A;  3RG6 C;  2KR5 A;  3G29 A;  2JYG A;  4PH1 A;  1VQ8 P;  2FVE A;  2Z44 A;  5EW5 E;  2XXM A;  3MGE A;  2PEI A;  1K30 A;  1MZ8 A;  2L0Q A;  5DCK A;  2LF4 A;  2CGQ A;  1VQ7 P;  2FQ1 A;  4QNB A;  3H47 A;  2OTL P;  2VLQ A;  3DPH A;  2CQ8 A;  3G21 A;  4M0I A;  3CC2 P;  1RNI A;  2JYL A;  3CMA P;  1K73 Q;  2KOS A;  5F2N A;  2XT1 A;  1VKU A;  3RG2 A;  2KOP A;  3DS2 A;  2JO0 A;  3G6E P;  2EFJ A;  4PXH B;  5F2O A;  3CCL P;  2N6Z A;  3CCJ P;  2XZ0 D;  1DV5 A;  4U0B A;  1L0I A;  2Z46 A;  5HGN A;  3LMO A;  2EHS A;  3DS4 A;  2DGY A;  2PNG A;  2EIA A;  1RO0 A;  2NO8 A;  1KLP A;  4U0C A;  3EJD A;  7CEI A;  4PH0 A;  5BS2 A;  1Z6M A;  2CNR A;  3CCR P;  2N50 A;  2MR7 A;  2PEQ A;  2KW2 A;  1ZMB A;  4COC A;  2GDX A;  3CCV P;  2AVA A;  2GDY A;  2PEM A;  4BPG A;  2M8N A;  3G26 A;  3CPW O;  3H4E A;  4PWV B;  3GJN A;  2N5H A;  4WYM A;  3EJB A;  4U0D A;  1AF8 A;  2ROQ A;  3I55 P;  4H2X C;  2K0X A;  2LOL A;  1KQS O;  3CCU P;  2KOQ A;  2BUO A;  2E1M A;  1OR5 A;  1GXH A;  3E2D A;  2CG5 B;  2K0D X;  3GKL C;  5HGM A;  3CCE P;  3G28 A;  2VSQ A;  3GZM A;  3U43 A;  2FAD A;  2CWO A;  2LIU A;  3H0D A;  3G0V A;  1M6E X;  3CD6 P;  2P9X A;  1IUQ A;  2L22 A;  2GYK A;  3DS1 A;  2WPT A;  3VRL C;  1YIT P;  2FQ0 A;  2GZF A;  3CCM P;  1A8O A;  2FVA A;  1QVF O;  2PEN A;  1VQP P;  1W2B O;  1IMP A;  2QA4 P;  3DS3 A;  2N98 A;  2QEX P;  2FQ2 A;  1GPJ A;  1YI2 P;  1E6J P;  1Q7Y Q;  2JQ4 A;  1T8K A;  1QRJ A;  3CC7 P;  3DS0 A;  1A43 A;  3CME P;  2PEK A;  2K5X A;  2LPK A;  1Q81 Q;  2KOO A;  1VQ5 P;  1DNY A;  1VQL P;  2MVV A;  4F37 A;  2KG9 A;  1M74 A;  2K94 A;  3NY7 B;  5HGO A;  2AFE A;  3G4S P;  2L9F A;  4UHP B;  1GXG A;  2LTE A;  1VQ6 P;  2VLP A;  2K0Y A;  3DTJ A;  1Q82 Q;  3OW2 O;  2LL8 A;  5HGL A;  2N5I A;  4BPF A;  2OAR A;  4U0E A;  2L6E A;  3CXC O;  4CA3 A;  1HY8 A;  2XV6 A;  1F80 D;  1KC8 Q;  2GZJ A;  4XFY A;  2ERH A;  2JB0 A;  2LML A;  2GDW A;  1JJ2 O;  1KD1 Q;  2BHV A;  2KOD A;  1CEI A;  3M1M A;  2KG8 A;  2K2Q A;  2KG6 A;  2M5R A;  4U0F A;  2PEO A;  3B5I A;  1S72 P;  2MD9 A;  1Q86 Q;  1YIJ P;  1VQO P;  2QNW A;  4R0M A;  2FAC A;  4IPY A;  4NEO A;  4MRT C;  2X2B A;  2KGD A;  3G1G A;  3NTE A;  1ZNV A;  5BS1 A;  1EMV A;  1N8R Q;  1AYI A;  1YJN P;  1EIA A;  3CCS P;  5EJD A;  4XFX A;  2GZE A;  2L4B A;  2LKI A;  5F2K A;  5KP7 B;  3Q20 A;  2JU2 A;  1E0H A;  2JU1 A;  4IZ6 A;  1K9M Q;  2MY5 A;  5KP6 B;  2FHS C;  1EOQ A;  1M90 Q;  2KGE A;  5KP8 B;  4XFZ A;  2Z45 A;  1YHQ P;  2M8P A;  1RO2 A;  2MF4 A;  2GZI A;  3LRY A;  3HZQ A;  5JPA A;  2OTJ P;  2JAZ A;  5CZD B;  1AUM A;  2AF8 A;  4BPH A;  2MVU A;  1VQK P;  1NQ4 A;  2M8L A;  3G1I A;  5I4T G;  1VQM P;  1ACP A;  3P05 A;  1HQB A;  1M6N A;  4GR2 A;  2VLO A;  3CCQ P;  1UNK A;  2K92 A;  4H2W C;  1YJ9 P;  4HKG A;  2EG5 A;  2FVF A;  1QVG O;  2DNW A;  2KOR A;  4U0A A;  2JGP A;  2ONT A;  3GZL A;  2K93 A;  4DG9 A;  1VQN P;  1VHN A;  2N6Y A;  2XZ1 C;  3CE7 A;  2KGA A;  1M1K Q;  1D1D A;  4GR6 A;  2PEJ A;  4H2Y C;  3HYB A;  1L0H A;  4QKO A;  1X3O A;  3WBH A;  4XRQ A;  1VQ9 P;  4XRO A;  2FAE A;  3B4Q A;  3G71 P;  2VLN A;  1BXI A; 
#chains in the Genus database with same CATH homology
 2VLP A;  3U43 A;  2GZJ A;  1FR2 A;  2ERH A;  2JB0 A;  5EW5 E;  4F37 A;  1E0H A;  2JAZ A;  1CEI A;  1MZ8 A;  1ZNV A;  2GYK A;  1EMV A;  2WPT A;  1UJZ A;  1IMQ A;  2GZF A;  1GXH A;  2NO8 A;  2VLO A;  1AYI A;  2GZG A;  2VLQ A;  2K5X A;  2JBG A;  2VLN A;  1UNK A;  4QKO A;  4UHP B;  7CEI A;  2GZE A;  1GXG A;  2K0D X;  3GJN A;  1IMP A;  2GZI A;  3GKL C;  1BXI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...