2JAZA

Crystal structure of the mutant n560d of the nuclease domain of cole7 in complex with im7
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
85
structure length
85
Chain Sequence
ELKNSISDYTEAEFVQLLKEIEKENVAATDDVLDVLLEHFVKITEHPDGTDLIYYPSDNRDDSPEGIVKEIKEWRAANGKPGFKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Conserved Asparagine in the Hnh Motif Serves an Important Structural Role in Metal Finger Endonucleases.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/inhibitor
molecule keywords COLICIN E7 IMMUNITY PROTEIN
total genus 28
structure length 85
sequence length 85
chains with identical sequence C
ec nomenclature ec 3.1.-.-:
pdb deposition date 2006-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01320 Colicin_Pyocin Colicin immunity protein / pyocin immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.20 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Colicin E immunity protein 2jazA00
3U43A 2K0DX 2VLNA 2GZEA 3GJNA 1GXHA 2ERHA 1IMQA 4UHPB 4QKOA 1UNKA 2WPTA 3GKLC 1EMVA 1IMPA 1GXGA 1AYIA 1FR2A 2VLOA 2GZIA 2JAZA 2GZGA 1CEIA 2GZJA 1ZNVA 2GZFA 2K5XA 2JBGA 1BXIA 4F37A 2GYKA 1UJZA 2NO8A 7CEIA 5EW5E 2VLPA 1MZ8A 1E0HA 2JB0A 2VLQA
chains in the Genus database with same CATH superfamily
1YJWP 3CMEP 1QRJA 2XZ1C 1GXGA 1AYIA 4XRQA 1FR2A 1DV5A 3DS1A 3LRYA 1D1DA 3B5IA 1N8RQ 3CCQP 3HYBA 5KP7B 2DGYA 1QVGO 3M1MA 3CCUP 4U0FA 3CCJP 3CXCO 2JO0A 2EG5A 1S72P 2EFJA 1M74A 3GKLC 3DS0A 3G29A 2GZIA 1ACPA 1ZNVA 2GZFA 3G6EP 2KORA 4GR2A 2QEXP 1VQPP 2GYKA 4PH1A 2KGAA 2EHSA 2LKIA 2GDXA 3Q20A 1YITP 3E2DA 2EIAA 2DNWA 1JJ2O 3CMAP 4U0EA 2KOQA 2XXMA 2Z46A 4QKOA 4BPHA 1VQMP 1CEIA 3MGEA 5BS1A 3HZQA 2FHSC 1EIAA 1BAJA 1M90Q 1YIJP 2AFDA 2LOLA 3H47A 1VQNP 2BHVA 2L6EA 2QNWA 2E1MA 5EJDA 2K94A 3CPWO 1VQ5P 2LMLA 2K5XA 2JQ4A 3G71P 2FVAA 4BPFA 3VRLC 2JU1A 3CCMP 1VQ9P 1DNYA 2KG9A 1F80D 3RG6C 3U43A 4NEOA 2KOOA 2K0DX 5KP8B 2ERHA 4UHPB 2PEMA 2VSQA 2PEOA 4DG9A 1M6NA 2MVUA 4U0CA 5F2KA 2KODA 2AVAA 1K73Q 5JPAA 2N6YA 1MZ8A 5I4TG 2M8PA 1K9MQ 1E0HA 1KLPA 1W2BO 4QNBA 2VLNA 5DCKA 2K92A 1IMQA 5HGLA 4CA3A 4MRTC 2PEJA 3G28A 2VLOA 2K2QA 2XZ0D 1NQ4A 4IZ6A 3CCLP 2VLPA 2M5RA 3LMOA 1HQBA 2LL8A 1KC8Q 4XROA 3CCSP 4PWVB 3DS3A 4XFZA 2XV6A 3DTJA 4IPYA 5EW5E 2LF4A 1OR5A 4XFXA 1QVFO 1X3OA 1YJNP 1Q7YQ 3GJNA 5KP6B 2PEQA 2CWOA 3CE7A 1K8AQ 3CC7P 1ZMBA 2FADA 2FQ1A 3OW2O 2MY5A 2N5HA 1VQ7P 4H2XC 2GDYA 2KG8A 1A43A 1VQLP 5HV8A 2FQ0A 3DS4A 3WBHA 3G21A 2CNRA 2FVEA 1Q82Q 5CZDB 2MR8A 3G1IA 1RO0A 2GZGA 2L22A 2N98A 2PY8A 4PXHB 1VQ8P 2P9XA 7CEIA 1Q81Q 2M8NA 2VLQA 1Q86Q 2MR7A 2K0XA 2LTEA 2PEKA 4M0IA 3I55P 2FAEA 1EMVA 4COPA 2KOSA 1GPJA 1NJIQ 4U0DA 4BPGA 1AF8A 1K30A 2JB0A 4H2WC 3CC4P 5HGNA 2CGQA 2KGCA 1VHNA 5F2NA 2GZJA 2L4BA 2OTLP 2JBGA 2EHTA 1L0IA 4F37A 2L9FA 2K0YA 3GZMA 5F2OA 2JGPA 3H4EA 3NTEA 1EOQA 2PNGA 5HGMA 2JYGA 3CC2P 2KR5A 4U0AA 2ROQA 2KG6A 2X2BA 1A8OA 2JYLA 3CCRP 1BXIA 2FACA 2OARA 2LPKA 2N50A 5HVCA 5HGOA 1M6EX 1VQ6P 3DS2A 2GDWA 2PEIA 1VQOP 3DPHA 2LIUA 1L0HA 3DS5A 4WYMA 1HY8A 3RG2A 1AUMA 2FVFA 4HKGA 4H2YC 1YHQP 1E6JP 2JU2A 3G26A 4GR6A 2L0QA 1KQSO 2K93A 4XFYA 1YI2P 2ONTA 3EJDA 2KGDA 4U0BA 3G1GA 3EJBA 3G4SP 2CQ8A 2LIWA 3P05A 3G0VA 2MD9A 2AF8A 3H0DA 2CG5B 2BUOA 2MVVA 5BS2A 1IUQA 2Z45A 2GZEA 3CCEP 2PENA 2QA4P 1M1KQ 1Z6MA 1RO2A 2KWLA 2FQ2A 1VQ4P 2JAZA 2OTJP 2KOPA 1UJZA 2KGEA 1VKUA 3B4QA 3CD6P 1VQKP 2Z44A 3NY7B 2M8LA 1RNIA 2KW2A 2AFEA 1GXHA 3CCVP 1UNKA 2MF4A 3EJEA 2WPTA 1IMPA 2N6ZA 4COCA 4PH0A 4R0MA 1YJ9P 1KD1Q 2N5IA 2NO8A 2XT1A 3GZLA 1T8KA 3I56P
chains in the Genus database with same CATH topology
3U43A 2K0DX 2VLNA 2GZEA 3GJNA 1GXHA 2ERHA 1IMQA 4UHPB 4QKOA 1UNKA 2WPTA 3GKLC 1EMVA 1IMPA 1GXGA 1AYIA 1FR2A 2VLOA 2GZIA 2JAZA 2GZGA 1CEIA 2GZJA 1ZNVA 2GZFA 2K5XA 2JBGA 1BXIA 4F37A 2GYKA 1UJZA 2NO8A 7CEIA 5EW5E 2VLPA 1MZ8A 1E0HA 2JB0A 2VLQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U43 A;  2K0D X;  2VLN A;  2GZE A;  3GJN A;  1GXH A;  2ERH A;  1IMQ A;  4UHP B;  4QKO A;  1UNK A;  2WPT A;  3GKL C;  1EMV A;  1IMP A;  1GXG A;  1AYI A;  1FR2 A;  2VLO A;  2GZI A;  2JAZ A;  2GZG A;  1CEI A;  2GZJ A;  1ZNV A;  2GZF A;  2K5X A;  2JBG A;  1BXI A;  4F37 A;  2GYK A;  1UJZ A;  2NO8 A;  7CEI A;  5EW5 E;  2VLP A;  1MZ8 A;  1E0H A;  2JB0 A;  2VLQ A; 
#chains in the Genus database with same CATH topology
 1YJW P;  3CME P;  1QRJ A;  2XZ1 C;  1GXG A;  1AYI A;  4XRQ A;  1FR2 A;  1DV5 A;  3DS1 A;  3LRY A;  1D1D A;  3B5I A;  1N8R Q;  3CCQ P;  3HYB A;  5KP7 B;  2DGY A;  1QVG O;  3M1M A;  3CCU P;  4U0F A;  3CCJ P;  3CXC O;  2JO0 A;  2EG5 A;  1S72 P;  2EFJ A;  1M74 A;  3GKL C;  3DS0 A;  3G29 A;  2GZI A;  1ACP A;  1ZNV A;  2GZF A;  3G6E P;  2KOR A;  4GR2 A;  2QEX P;  1VQP P;  2GYK A;  4PH1 A;  2KGA A;  2EHS A;  2LKI A;  2GDX A;  3Q20 A;  1YIT P;  3E2D A;  2EIA A;  2DNW A;  1JJ2 O;  3CMA P;  4U0E A;  2KOQ A;  2XXM A;  2Z46 A;  4QKO A;  4BPH A;  1VQM P;  1CEI A;  3MGE A;  5BS1 A;  3HZQ A;  2FHS C;  1EIA A;  1BAJ A;  1M90 Q;  1YIJ P;  2AFD A;  2LOL A;  3H47 A;  1VQN P;  2BHV A;  2L6E A;  2QNW A;  2E1M A;  5EJD A;  2K94 A;  3CPW O;  1VQ5 P;  2LML A;  2K5X A;  2JQ4 A;  3G71 P;  2FVA A;  4BPF A;  3VRL C;  2JU1 A;  3CCM P;  1VQ9 P;  1DNY A;  2KG9 A;  1F80 D;  3RG6 C;  3U43 A;  4NEO A;  2KOO A;  2K0D X;  5KP8 B;  2ERH A;  4UHP B;  2PEM A;  2VSQ A;  2PEO A;  4DG9 A;  1M6N A;  2MVU A;  4U0C A;  5F2K A;  2KOD A;  2AVA A;  1K73 Q;  5JPA A;  2N6Y A;  1MZ8 A;  5I4T G;  2M8P A;  1K9M Q;  1E0H A;  1KLP A;  1W2B O;  4QNB A;  2VLN A;  5DCK A;  2K92 A;  1IMQ A;  5HGL A;  4CA3 A;  4MRT C;  2PEJ A;  3G28 A;  2VLO A;  2K2Q A;  2XZ0 D;  1NQ4 A;  4IZ6 A;  3CCL P;  2VLP A;  2M5R A;  3LMO A;  1HQB A;  2LL8 A;  1KC8 Q;  4XRO A;  3CCS P;  4PWV B;  3DS3 A;  4XFZ A;  2XV6 A;  3DTJ A;  4IPY A;  5EW5 E;  2LF4 A;  1OR5 A;  4XFX A;  1QVF O;  1X3O A;  1YJN P;  1Q7Y Q;  3GJN A;  5KP6 B;  2PEQ A;  2CWO A;  3CE7 A;  1K8A Q;  3CC7 P;  1ZMB A;  2FAD A;  2FQ1 A;  3OW2 O;  2MY5 A;  2N5H A;  1VQ7 P;  4H2X C;  2GDY A;  2KG8 A;  1A43 A;  1VQL P;  5HV8 A;  2FQ0 A;  3DS4 A;  3WBH A;  3G21 A;  2CNR A;  2FVE A;  1Q82 Q;  5CZD B;  2MR8 A;  3G1I A;  1RO0 A;  2GZG A;  2L22 A;  2N98 A;  2PY8 A;  4PXH B;  1VQ8 P;  2P9X A;  7CEI A;  1Q81 Q;  2M8N A;  2VLQ A;  1Q86 Q;  2MR7 A;  2K0X A;  2LTE A;  2PEK A;  4M0I A;  3I55 P;  2FAE A;  1EMV A;  4COP A;  2KOS A;  1GPJ A;  1NJI Q;  4U0D A;  4BPG A;  1AF8 A;  1K30 A;  2JB0 A;  4H2W C;  3CC4 P;  5HGN A;  2CGQ A;  2KGC A;  1VHN A;  5F2N A;  2GZJ A;  2L4B A;  2OTL P;  2JBG A;  2EHT A;  1L0I A;  4F37 A;  2L9F A;  2K0Y A;  3GZM A;  5F2O A;  2JGP A;  3H4E A;  3NTE A;  1EOQ A;  2PNG A;  5HGM A;  2JYG A;  3CC2 P;  2KR5 A;  4U0A A;  2ROQ A;  2KG6 A;  2X2B A;  1A8O A;  2JYL A;  3CCR P;  1BXI A;  2FAC A;  2OAR A;  2LPK A;  2N50 A;  5HVC A;  5HGO A;  1M6E X;  1VQ6 P;  3DS2 A;  2GDW A;  2PEI A;  1VQO P;  3DPH A;  2LIU A;  1L0H A;  3DS5 A;  4WYM A;  1HY8 A;  3RG2 A;  1AUM A;  2FVF A;  4HKG A;  4H2Y C;  1YHQ P;  1E6J P;  2JU2 A;  3G26 A;  4GR6 A;  2L0Q A;  1KQS O;  2K93 A;  4XFY A;  1YI2 P;  2ONT A;  3EJD A;  2KGD A;  4U0B A;  3G1G A;  3EJB A;  3G4S P;  2CQ8 A;  2LIW A;  3P05 A;  3G0V A;  2MD9 A;  2AF8 A;  3H0D A;  2CG5 B;  2BUO A;  2MVV A;  5BS2 A;  1IUQ A;  2Z45 A;  2GZE A;  3CCE P;  2PEN A;  2QA4 P;  1M1K Q;  1Z6M A;  1RO2 A;  2KWL A;  2FQ2 A;  1VQ4 P;  2JAZ A;  2OTJ P;  2KOP A;  1UJZ A;  2KGE A;  1VKU A;  3B4Q A;  3CD6 P;  1VQK P;  2Z44 A;  3NY7 B;  2M8L A;  1RNI A;  2KW2 A;  2AFE A;  1GXH A;  3CCV P;  1UNK A;  2MF4 A;  3EJE A;  2WPT A;  1IMP A;  2N6Z A;  4COC A;  4PH0 A;  4R0M A;  1YJ9 P;  1KD1 Q;  2N5I A;  2NO8 A;  2XT1 A;  3GZL A;  1T8K A;  3I56 P; 
#chains in the Genus database with same CATH homology
 3U43 A;  2K0D X;  2VLN A;  2GZE A;  3GJN A;  1GXH A;  2ERH A;  1IMQ A;  4UHP B;  4QKO A;  1UNK A;  2WPT A;  3GKL C;  1EMV A;  1IMP A;  1GXG A;  1AYI A;  1FR2 A;  2VLO A;  2GZI A;  2JAZ A;  2GZG A;  1CEI A;  2GZJ A;  1ZNV A;  2GZF A;  2K5X A;  2JBG A;  1BXI A;  4F37 A;  2GYK A;  1UJZ A;  2NO8 A;  7CEI A;  5EW5 E;  2VLP A;  1MZ8 A;  1E0H A;  2JB0 A;  2VLQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...