2JBAB

Phob response regulator receiver domain constitutively-active double mutant d53a and y102c.
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
121
structure length
121
Chain Sequence
ARRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNEPWPDLILLAWMLPGGSGIQFIKHLKRESMTRDIPVVMLTARGEEEDRVRGLETGADDCITKPFSPKELVARIKAVMRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords PHOSPHATE REGULON TRANSCRIPTIONAL REGULATORY PROTEIN PHOB
publication title The X-Ray Crystal Structures of Two Constitutively Active Mutants of the Escherichia Coli Phob Receiver Domain Give Insights Into Activation.
pubmed doi rcsb
source organism Escherichia coli
total genus 37
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2006-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2jbaB00
3N6VA 3LTEA 1BDJA 2FN9A 4N41A 4ETNA 5CNMA 1QNLA 3CS3A 3HDGA 3EQZA 5JS2A 4Z0NA 3JVIA 2HJ9A 4YP9A 5IEJA 1USIA 5TQ0B 2YHBA 1PNRA 2LIVA 2FVYA 2JB9A 4G97A 3VNBA 3O75A 3OQNA 1VKRA 4QPJC 4MS1B 5KWSA 4Z4EA 1D4ZA 3FFWA 4E7OA 3OM1A 5ED4A 1JH9A 3C6QA 2J48A 4LDZA 5BRJA 2HPHA 3A3KA 5I4CA 3QLTA 1SXHA 4IMJB 1GUDA 5TQJA 9ABPA 4Q6WA 4NCBA 4JA2A 4TN5A 2PUEA 5HSGA 4LE1A 4EVSA 3FFXA 4XXHA 4NICA 4YLEA 1QP0A 4YO7A 4DN6A 4XAQA 4O1IA 3MM4A 4OBBA 3TD9A 4MR9A 3RVPA 2MSWA 3HSYA 4XASA 1LBHA 5DLEA 2IPNA 3C3KA 3Q7SA 3D02A 3JY6A 3S99A 1Z17A 3ROTA 5PNTA 3RVNA 3MQ4A 4YRZA 4M88A 3O1JC 3QEMA 1M5TA 3HUUA 2L18A 5KC8A 3QEKA 1DRJA 3T95A 4KPYA 3CG4A 4KRFA 3F73A 5CNJA 1F51E 3KG2A 2ZWMA 1AB5A 4PE5B 3O21A 1VRVA 1TMYA 2AYZA 5IC5A 1H9CA 3F7NA 1DC8A 4YS6A 3ROFA 3CNBA 5HKOA 2WJAA 3CU5A 2GKGA 1SD5A 4Q6BA 1QQAA 3IPCA 1Z2EA 2GI4A 2GX6A 4HYEA 1FQWA 3SAJA 1Z2DA 1Z18A 2WY2D 4RS3A 1I3CA 1SXGA 5EWJA 1C0EA 3LOPA 4MS3B 1YS7A 2FN8A 2WRZA 3GL9A 4G0PA 3EULA 5BR1A 4MPTA 4IGAA 2JCGA 3IP7A 3TO5A 1EFAA 4RSMA 5FWXB 5KI6A 2FMHA 5GQSA 4KFCA 1OXBB 1AB6A 1M2EA 1F4VA 1M5UA 1NTRA 2KYRA 3A0RB 1JX6A 2MYNA 2R4QA 3Q41A 3URMA 1D2AA 1JDNA 2NZUG 1BVHA 3DLBA 4B09A 4NQRA 4ML3A 3KSMA 4QYWA 2PJUA 2QW1A 4OATA 5EWLA 3SQNA 3N0RA 1S8NA 4WT7A 2M98A 5KQPA 3OMWA 4UHKA 2FXIA 2OENG 4XLTA 4KVFA 3OO0A 4FE4A 5T7BA 1DZ3A 2FEPA 1RNLA 2PL1A 3EDCA 3SG0A 7ABPA 1YTUA 3EGCA 2FQXA 1PHRA 1Z26A 4KZKA 4MR7B 6CHYA 3N0WA 3B2NA 2VYCA 3CKMA 4W5RA 4QICA 4EGSA 1E2BA 5CNKA 4PICA 5KQLA 3F6PA 4KQ9A 5KQMA 5B3JC 1JL3A 3H5LA 3H5IA 4MQEA 4RU1A 3KS9A 1DG9A 2H0AA 2QSJA 3C97A 3GV0A 1FSPA 1GCAA 2FLWA 3IP6A 4MS4B 4RV5A 1D1QA 1NY5A 1UDRA 3HCWA 4D74A 3H5VA 3CZCA 1NXOA 3C3MA 2JBAB 3KYJB 2Q5CA 5JNRA 1LK0A 3QLVA 2IOYA 1ZN2A 5IUNC 2F8TA 4EVQA 3Q7RA 2R48A 1YVUA 1TVMA 1ZVVA 1RXIA 1SRRA 2GBPA 3OLZA 1YMVA 4Z4CA 4RK4A 1EAYA 3LUFA 4G0MA 5FWYB 1RPJA 3JS5A 3GT7A 4HNQA 3HZHA 3OO1A 1ZH2A 1T34A 2LPMA 3LKVA 4WUTA 2IPLA 3NHZA 3RVKA 4JAVC 2PKXA 4MS1A 5JNWA 3H6HA 2E4YA 2L2QA 4W5OA 3HXMA 1L5YA 5ABPA 3RH0A 1ZHHA 4WXMA 4LRQA 2N9UA 1JFTA 4MR8A 4RK6A 2PUFA 1EWTA 4RXMA 1USKA 1P2FA 2XDYA 4MQFB 5TE9A 2LUOA 1DJMA 1QPZA 2A9OA 3DZDA 4ZPJA 3MF4A 5EWMB 1DBPA 5TQ2B 4KK4A 1ZGGA 4RDCA 4OLAA 2FQWA 5FBHA 4MRMB 5DKFA 3ILHA 4RWEA 5IUKC 4N47A 4YGXB 1ZGZA 3O1IC 3KHTA 3N8IA 4FB4A 4Z99A 3NBMA 3O2JA 1BDIA 2MYPA 1XHEA 1YK1A 1ZAYA 4Z4GA 2V0NA 2E4WA 2A9QA 2FQYA 4EYQA 2PUDA 4PYRA 2MSLA 4RXUA 3O1HB 2NUBA 1NXXA 1DCFA 3P9YA 4G0OA 3OQOA 1JDPA 1YK0A 2ID9A 2LP4Y 4MAAA 4RKRA 1ABEA 1A0OA 2JVJA 3O2SB 3OLWA 3QX9A 4MGEA 1ABFA 1CHNA 3H5WA 2PE5A 3I09A 4CBVA 3OLVA 2RJOA 1MB3A 2TMYA 2JK1A 3K9CA 3T6KA 3GYBA 2CWDA 2QU7A 4XARA 4IRXA 1KRWA 2PMCA 4JASB 3JPWA 3HVRA 2OQRA 1VLZA 3FDFA 5TPZD 4OTZA 4P1ZA 2W42A 1FFWA 3IP5A 5KC9A 1DC7A 2FMKA 3TX6A 8ABPA 3GWGA 1RXEA 4KV7A 3SY8A 1FFSA 1Z15A 4G0XA 4MR9B 1KRXA 5DTEA 3K4HA 5JNTA 2I6FA 5CHYA 1DBQA 2E4UA 4MLDA 3QELA 5HQJA 4LDAA 4MYRA 2LBPA 1JWLA 3JPYA 3HO1A 4OG2A 1J56A 1PEYA 1PEAA 3QLUA 5E3JA 4GNRA 4KQCA 1K68A 4RKQA 5BQ3A 1D5WA 2RGYA 5B3JA 2FW0A 4Q7EA 4Z9AA 2WB4A 1NXSA 3CTPA 1YMUA 1BA2A 3KJXA 1ZY2A 2QVCA 1HEYA 4YWHA 3LMKA 1U0SY 1IIBA 1ZDMA 3FMVA 3H5OA 2L17A 4NCAA 1A2OA 3OLXA 3HS3A 1QMPA 1E6KA 4JB0A 1RZRD 1ISRA 2JVKA 2GWRA 5IBQA 2FMIA 1DCMA 5GOTA 5F64A 3W9SA 3CRNA 4MR7A 3KLOA 3C3WA 3CHYA 4YCSA 1JLKA 1QO0D 2QV0A 2QR3A 4ETMA 4JP1A 4ZMRA 3HK2A 2IDMA 1P6UA 3E61A 1E6MA 2QVGA 3ILYA 4MLCA 2MYTA 3G1WA 3KCNA 4DADA 1TLFA 4KNYA 4WZZA 2CHEA 4ETIA 4GPAA 2E4ZA 1JF8A 4S04A 2MSKA 1TM2A 1U2PA 3N75A 3OM0A 2JBAA 3OQMA 1QP4A 5TPZA 4PZ0A 2VK2A 5DCLA 5JNSA 1P8AA 2WJWA 3MA0A 3JTEA 2R47A 1JYEA 4HNRA 4S05A 3I5AA 1Z13A 5EWLB 3H1FA 4EYKA 1NXPA 2YHAA 5TQ0A 4RK0A 1LJUA 4KMRA 1LJLA 4N0PA 4HNSA 3IDOA 2IKSA 1K66A 1Z12A 3MMNA 2FSPA 4EVRA 4MQFA 1LBIA 1DP4A 4LE2A 4RK1A 4UHJA 5C5CA 5IUJC 1XWWA 1YIOA 4N0QA 3LUGA 1GUBA 4KK3A 2RJNA 3H1EA 3UUGA 1M2FA 2H3HA 1ZITA 4G0ZA 3D8UA 4Y9TA 5TPWB 1SXIA 3RVOA 4MQEB 4IMIB 5TQ2A 1APBA 1RZRA 2M1ZA 3A0UA 2JRLA 4EUKA 2DRIA 3BREA 1JYFA 4N03A 2P9HA 1JFSA 1NXVA 2PUAA 4TLLB 4MRMA 4LE0A 3O74A 3QX8A 1URPA 1PUXA 4DQDA 3LUAA 3GBVA 3H6GA 2PAFA 3CG0A 4ZMSA 1QO0A 2CD7A 3DBIA 2QZJA 3G85A 5D2CA 4D6XA 3LUCA 4E7PA 3TB6A 2FLKA 3N0XA 3NNNA 3Q7TA 3RVSA 2PL9A 4F12A 4ZYLA 4P98A 4Z4HA 3JVDA 5HM6A 3N53A 3GRCA 2A9PA 4EYOA 3OLYA 5JNVA 1U8TA 1JFVA 3QK7A 3F6CA 3M9WA 3Q9SA 4G0QA 3DGEC 3GA5A 3DLHA 2F8SA 4ZJPA 3KYIB 1Z25A 4H3HB 3M9XA 4MR8B 4O1HA 4XFKA 4OLBA 4O5AA 4G0YA 3LKBA 3NHMA 2CHFA 3SNKA 1U04A 4TLMB 3CZ5A 3H5TA 4F06A 1D1PA 2VUHB 3LFTA 4WXEA 5FBKA 1KGSA 3CFYA 3EQ2A 3QLVC 4H3KB 2WWVD 5IULC 1Z16A 2PUCA 4D6YA 1ISSA 1KMIY 3LUKA 4F8JA 1NXWA 2FTKE 2PUBA 3KLNA 3LUHA 1EWVA 4MS3A 3L6UA 2L19A 2E4VA 1QP7A 3H1GA 4KREA 3RVLA 4IILA 1BDHA 2QXYA 1USGA 2A9RA 1L5ZA 1R8JA 1U2QA 2NZVG 2ID7A 3BILA 5FWXA 3H75A 3FGZA 1CEYA 3Q15C 4RK7A 3R0JA 4H60A 3QEMB 1JHZA 5CNIA 3HM9A 3HUTA 4JB2A 1DBWA 3MYYA 3KKEA 3MIZA 1B00A 5DGCA 3FFTA 1FFGA 4RY8A 2E4XA 4G86A 1GLGA 3HEBA 3RVJA 4W5QA 1A04A 2BGGA 2IPMA 4RY0A 3UKJA 1BAPA 2B4AA 3TMYA 5KQGA 3HJFA 1E6LA 4N76A 3IP9A 4WWHA 1MAVA 2VUIB 3RVMA 1NATA 3OMXA 4QYMA 2IYNA 2ZAYA 2PLNA 1W25A 3RVRA 4RY9A 2NT4A 2R25B 2HQOA 1VPWA 3L49A 4IF4A 4RXTA 3QELB 5EWJB 2WMYA 1MIHA 1TJYA 3DGFC 4TMYA 3O2QB 3UK0A 3EAFA 4EYGA 1CYEA 4EY3A 1ZH4A 2HSGA 1P6QA 2O20A 3I45A 4MS4A 3RQIA 2FEKA 3EODA 2RDMA 4LX8A 4Z4IA 2X7XA 1Y1LA 4Z9BA 4Z4FA 3LUJA 4NV3A 5T3YA 4JOQA 3T38A 4F11A 3EJWA 5JNUA 5IX8A 5JS1A 3GBPA 3M6MD 3HV2A 2PUGA 1C4WA 3KTOA 3SM9A 4W5TA 5FWYA 1MVOA 1GCGA 2HQRA 5IEBA 1MB0A 4PEVA 3HDVA 2NT3A 1OXKB 1XHFA 1PNTA 2B1JA 2HQBA 3NNSA 1ZESA 3NNDA 1DCKA 4L4UA 2P4UA 2JVIA 1JBEA 3A10A 3BRSA 3LUDA 3QLUC 2MYUA 2FKAA 4RZSA 4L85A 5TPWA 3CLKA 2FEWB 2FMFA 5C5EA 1DRKA 3I42A 6ABPA 2IPAB 4FE7A 3BBLA 3T8YA 5EWMA 1EHCA 1W9HA 3BRQA 4W5NA 2AYXA 3RVQA 3E3MA 1QKKA 3IPAA 1NXTA 5BRAA 4RK5A 4YV7A 1QQBA 1EWKA 1YS6A 1WETA 4F3TA 3VNAA 4YR7A 4LZLA
chains in the Genus database with same CATH superfamily
2ISQA 1WW8A 2FN9A 3RV3A 1Z4QA 2XYGA 4WY2A 2BN4A 4CMBA 3EQZA 4US0R 1RVDA 1IL0A 1CUUA 3FZQA 3MMZA 3R3XA 4OHUA 4P33A 2PSSA 4WY5A 1K86A 5CLGA 4QDJA 2WHQA 4TMTA 3KU4A 2NSDA 1BYIA 3ND5A 4CHTA 5CFQA 1EEHA 4GWKA 5B5SA 3U62A 8MHTA 1M6HA 4GPBA 4DA7A 1KEPA 2QMYA 4YCDA 5AICA 3A2KA 1CJKC 4AYTA 4X84A 1T9DA 1CRQA 1OYYA 2HK8A 2B1RA 3OESA 4M1YA 5B4VA 3NM5A 1TAUA 2OPHA 5ESDA 1CBUA 1SZPA 4BO2A 4MV6A 3O8RA 1L4KA 2J46A 5ITZA 4DR1B 2GSWA 4YDSA 4DCCA 3D6JA 4W9RA 4XWOA 1A95A 2HWKA 2ODPA 4KN8A 2H00A 4KZPA 4LGYA 3VYWA 4PYJA 1AS2A 2SCUB 3N5KA 2HPVA 2P5TB 1QYXA 1E89A 5AVVA 3IPYA 5INTA 3JW8A 1ODIA 4RF3A 4KRGA 3ZQJA 4YUWA 3QUCA 3SQLA 4FS8A 3OPXA 5FQNA 1QHGA 2HA4A 2QPLA 3BH7A 3OFSA 3NJ4A 2POCA 4WERA 4WZ6A 3I76A 5JS6A 5HX7A 4UTZA 3G2IA 1C81A 3E2IA 2Q62A 2OKGA 3EWNA 3FPFA 4L2IA 3ZPXA 3L4KA 1FFYA 1H42A 1N0IA 1SVIA 2Q2VA 5I7AA 2FW6A 3T5DA 3T3NA 3TVTA 4GR4A 4NAHA 1K0FA 4Y2QA 1HE8B 4B7AA 1I5RA 4RDHA 2X3YA 3KP1A 2O8BA 2HSEA 3UH0A 1R37A 3KXLA 4HWRA 5EKTA 2HPAA 2R5FA 2CDAA 1THMA 2WIDA 3WIOA 3F73A 3C6KA 4HN2A 1O03A 5EGSA 5J1TB 4CT0A 4O25A 4EYEA 1TOAA 2P9BA 4A6PA 4RD4A 5EMNA 2H08A 5L3QB 2V3WA 1OZ0A 3UKOA 1AY0A 4F5DA 4X0EA 1V6AA 3E9NA 5LJLA 1ZXBA 2RMKA 4D3XA 4QD3A 1H6AA 5C35A 4B1FA 5L6MB 2ZREA 3AERA 1QOPB 3DMHA 1Z2EA 1ITZA 3BHIA 1IMJA 3O91A 4PWZA 3T0GA 4HHEA 2DCUA 1VLLA 1J09A 1D04A 1U9YA 2BZ1A 3MPUA 4GP9A 1KP9A 4PC7A 1P9RA 3E53A 3FKQA 5EWJA 3TFQA 3HMKA 2H57A 1V71A 4OB6A 1PR9A 5KYYA 3A32A 3F6EX 2GR9A 3NONA 3EDQA 2P2YA 1B43A 2NXJA 1PJ8A 3M8KA 1TAGA 4FFWA 1B6TA 1Y7TA 3LRTA 4CTJA 3TO5A 3I58A 5CB8A 5HKKD 3MINA 3M49A 3L7BA 2JJ2A 4R9VA 5J2TA 3FMPB 2MMGA 2HJHA 2ATXA 2KYRA 3L8GA 5AP9A 5B30A 4U2GA 1JZQA 1QHNA 1OIWA 1BGWA 1FL9A 3L1VA 1PNOA 3N2EA 1C3OB 3QUQA 2P9QA 4GHWA 4NENA 3GXBA 1HRDA 1PK8A 3H2KA 3DB1A 3JZMA 4FYIA 5G0TA 1XUOA 3TNYA 1TZ2A 1ZW1A 1ECBA 3RT9A 4IRUB 3ZLJA 121PA 4QAQA 4E07A 1FCJA 5CRIA 1ELOA 1QGED 4ER6A 1YFLA 3BB1A 3WRXC 1T9GR 1PYOA 2ON6A 2RGAA 2ZROA 3NOQA 3VU3A 2C9OA 2Z1MA 5EOVA 3DCYA 2CNDA 1LK5A 1Y5IA 1EZ4A 4KZKA 3PG5A 5JAIA 1IY8A 4J76A 4LI3X 4EZIA 2H29A 4M2LA 1JG7A 1YONA 4ES6A 1QZXA 2O3RA 4KFRA 1NT4A 3GCWA 3P9IA 2ID4A 3DXXA 3T3DA 4ER0A 2BGNA 2C8KA 1KJZA 1DFHA 1PFKA 4F2PA 2C29D 2UVPB 3H2ZA 3K0BA 3AY0A 3DDCA 3EXIA 3KUKA 4JKOA 4MS4B 4YVFA 1P7YA 4JJ4A 4CNQA 3LT4A 2RK6A 2QLTA 2YN0A 3TRDA 2GD0A 2X5NA 3RTCA 2R65A 3Q7QA 4OUKX 5DASA 4OHYA 2IOFK 3OD5A 2HA2A 2YXNA 2V5VA 3BSFA 3VKGA 2IOYA 6ADHA 3I8OA 3NX4A 4EVQA 1K8ZB 2R48A 1GP2A 1AK9A 1IY2A 1CR2A 4JC8A 3EZ9A 4Z6KA 4G0MA 4KFTA 1YRYE 3IJPA 4LY0A 3L84A 2A5FA 2NW6A 3R76A 4BEVA 4Z51A 1KDOA 5HG0A 4JUIA 3NW9A 3V00A 4FHCA 4WBNB 3GJSA 2FE1A 4FD2A 1B6GA 2JAOA 5E9AA 1MX9A 3LG2A 5HF9A 2CLCX 2R6ZA 3UB4A 1E3LA 3RH0A 1JSZA 2G06A 4FFDA 2ZAGA 3T1NA 4PIVA 4F96A 2N9UA 3SMQA 4RUKA 4HH1A 5HIKA 3W8FA 3LC7O 4HXFB 1XNQB 1SAYA 3CZMA 1DQZA 4TTSA 1KJJA 3MBKA 5TE9A 4B4OA 3K0EA 1SOUA 2I1VB 4UKDA 1F4LA 1GEEA 4Y6GB 4KJXA 4TVSA 4N7JA 5JZMA 2Z5FA 5LZ8A 2G1PA 3ORQA 4G6ZA 4I3GA 4ZV4A 3MUFA 5LDDC 4LECA 3C8ZA 1DPFA 4L1KA 4UASA 3DO6A 3I0NA 1FFAA 1VPDA 2F3RA 2O2CA 2GXQA 1Q0UA 1YL6A 1ZGJA 3KHTA 5CK5A 4D9FA 4F84A 3CGGA 5BN5A 3K70B 4B6JA 2MYPA 3DVLA 3IAXA 3HCEA 3D6TB 4Q7KA 4AAYA 1M2OA 1W88B 3GZJA 3LE8A 3K16A 3ODPA 1MBZA 3ANNA 3QI2A 4ALIA 1R15A 3DJFA 1E60A 5JNLA 1I94B 1H3NA 2WVAA 4YWJA 4FJ2A 3LDGA 2TMDA 1R10A 3E9QA 3Q87B 3QE2A 1QPBA 4LF9B 1Z83A 3TR0A 4D9JA 1VBMA 4OFZA 4AY6A 4L15A 4H31A 4MKRA 3K5PA 5JRDS 1IXSB 4P4UA 1JQ3A 4BTLA 3ZHXA 1M1YA 3HVRA 2ATCA 1P80A 2NXEA 3AYXB 2JAXA 2DR2A 2HA5A 1MDBA 4C5CA 4KG7A 2O7NA 2EZUA 4H17A 2OAGA 3K70C 1E1RA 1G16A 2DX7A 2XRFA 2BMDA 3GAAA 4L0QA 4MKXA 4MQBA 3VH3A 4EM6A 4OQEA 2AD5A 1QORA 1XCMA 3IE0A 5JNTA 2WVHA 3DLPX 5JO0A 3SKYA 3GC6A 4KE6A 5IHPA 2FUCA 2I8AA 2H65A 5LA6B 2A6PA 2FWMX 4Y8VA 3SZUA 1K68A 1IC6A 5KSYA 2QW8A 1NONA 3AU9A 3MUOA 1EFKA 1A5BB 4UD6A 1KK3A 5BUQA 2PBLA 2C83A 4P35A 2DYKA 4IXTA 3DDNA 4YWHA 3UT6A 1EUQA 1A9ZA 1I6KA 1Q15A 1J7KA 2XHEA 3CIOA 3PS9A 1A2OA 3AJRA 1LC0A 3KJHA 4NRDA 5CLJA 2VJBA 1VRCA 2CL0X 4QXMA 3J7AC 4QYSA 1MABB 4WZAA 5DSZA 3ZNNA 2BEVB 5I9NA 4HN9A 4NBWA 5FOVA 1KZGB 1W44A 2GM3A 3DSRA 4IS2A 2PSHA 2VJNA 1G3IA 4PHTA 5AW1A 3QHPA 5K3EA 1ULAA 1Y5RA 2QM8A 2X1MA 1H2RS 1JJFA 2XCQA 4WSOA 3IAHA 4LOLA 4CV2A 4GLJA 1PIWA 1G6HA 1WVGA 3CRNA 5F64A 3RF7A 2AR7A 5CXUA 2QJWA 4HZUA 1LPOA 3OZTA 4WKCA 3CRZA 1MRNA 5ITWA 5FX2A 5HOQA 3CNQS 3I37X 4ZTBA 1P6UA 3E61A 3O90A 4M1WA 4PRZA 9ATCA 4RA9A 3AVWA 1HG1A 1ZMRA 3SKVA 3BMQB 3RHZA 3ZGNA 5KTRA 5F7ZA 1T5TA 4WZZA 5LIRA 4DKJA 2QQ0A 1J49A 2XLCA 2JHFA 1FLDA 1ZWLA 4YPVA 2MSKA 4WLFA 4PZZA 4GM4A 4TX1A 2PX3A 2Y66A 1D1SA 2K4MA 4WXHA 1HPLA 3LY7A 4RZQA 5DCLA 1T36A 2JFQA 4D8TA 1QR2A 1LGYA 4J1TC 4R1PA 1NMZA 1U8FO 5B3AA 2GMWA 1G7RA 3E3AA 3GJ8A 3V4RA 1X14A 2ANCA 2G71A 3ITNA 1G6KA 1HE2A 1UDWA 3U48A 3E27A 4U7TB 1PR0A 1JT2A 3IIKA 1JDBB 5E1OA 4ZVNA 4B3XA 2J45A 5DVZA 1W2GA 4X7BA 4QQRA 4YJHB 4JS0A 3RS4A 4EYSA 5ARCA 4HX9A 1UMCB 3AVVA 3UMBA 4OP3A 4TWZA 3F78A 2NP6A 3PGVA 4ZK2A 1W1IA 1YVPA 3G9QA 4CVNA 4RK1A 2FG7C 5EHIA 4B73A 5JBNA 2ZSFA 1UF9A 2B36A 3AUYA 4FGSA 2Z6UA 1JIKA 2BTOA 1UBGA 4GPTA 3ZJYA 3ELDA 1ZITA 1QOQB 3OJOA 4GSLA 1C80A 4K9PA 4GKVA 1IHPA 1XTBA 5J2TF 3BREA 2VJKA 2X8BA 3W90A 3HBAA 4HSEA 1PUXA 2KX7A 3VI3B 1EA7A 1EUYA 3LUAA 3FPKA 3RR2A 2D06A 2D1FA 3HPRA 5EJ7A 4CUZA 1D3AA 1JDBC 3KTDA 2OEPA 4INOA 3S40A 5C7YA 1QO0A 3NCHA 1NC3A 1XDGA 2V7EA 2ENWA 2HUPA 3B6MA 4M54A 4TMXA 5LZ7A 2Z3VA 4NNJA 3D0QA 4IFTA 3WRWA 1G4AE 5AVSA 4IIJB 1Q50A 3IQEA 1FNNA 1ACJA 2VYQA 1GSOA 3DKPA 1RI1A 1JQEA 2D7JA 2HMYB 5DK4A 1TCAA 1T0UA 3EPRA 3F4LA 3FCCA 4FLMA 2WKWA 5LFAA 4QM6A 3BE5A 2R0QC 4GSYA 4YYZA 1O7JA 3DUFA 4V0LA 3COPA 2VH1A 1R0RE 2O2XA 2IYVA 3LL4A 1L5NA 2F8SA 2PFSA 4MR8B 4RLQA 4KDRA 5LQUA 4OLBA 3SXJA 3VPCA 3CT4A 1X1DA 3KSRA 3B8EA 3N2ZB 3NHMA 4MWBA 1ZCZA 2EX4A 4M1KA 5HQ3B 3S44A 1DKQA 3W8RA 5HKBA 3GLUA 3CBGA 3ZW7A 4CG2A 1J20A 3NOOA 3GFGA 3OAAA 4H3KB 4JC4A 1Z16A 4HDNB 1KZ7B 3HH8A 2SECE 5DNWA 1NNUA 5DPMA 1KMIY 1S7GA 5JQGA 1U7OA 1ODKA 2PD6A 3CUUA 1GVHA 2ORYA 5SZKB 2PUBA 2J3LA 2O1WA 3UWSA 3C39A 1I3NA 1KVSA 1ULZA 2WDZA 1F8GA 1KK2A 4MS3A 3UT5A 3QU2A 1Z8FA 2MOKA 4A7PA 4ZZ3A 1NZDA 4WECA 2QXYA 2O8EB 2GBCA 1C8VB 1GADO 1L5ZA 1YRAA 3JCZA 1MD9A 3AEQA 3H75A 3RRYA 1DRVA 3RAPR 2FQ1A 2VXYA 3G2LA 4KXUA 1D4OA 4Q19A 4HTAA 4A0HA 4HB4A 4RACA 3WSVA 4JBIA 1XWIA 1SBHA 1ST2A 2EWMA 4OHWA 2EL9A 5C3UA 3PDIB 2JAUA 5AW5A 4WASA 5I01A 4XSHA 1GM5A 2ACVA 3D2CA 5J4YA 4NOMA 1O6BA 2NO0A 2QRHA 3N7UA 1MAAA 3GLQA 4RY0A 1ABBA 1ZL2A 4NBLA 1BMFD 1TECE 4MW4A 4LVUA 1JPUA 1OH7A 4CEHB 4HDKB 3ZIAA 4DUYB 2UU9B 4KGVA 1ZVQA 4ASUA 1QGUA 4TVOA 2ZT7A 4LWOA 4GW3A 4C2BA 3PQ2A 2JFHA 3LCJA 2I6QA 1HMPA 3Q1LA 2PU5A 4J91A 1KAEA 2GN0A 3DVSX 2CHVA 3SM3A 3ST7A 1FTQA 3C3YA 4ZRMA 1P31A 1IN7A 1GSAA 1MQ8B 1UADA 3GDWA 3NEJA 1N7JA 2UYGA 1EHIA 3I45A 4ONEA 1P6QA 2SBTA 1PD1A 4GEKA 4OCZA 3RQIA 4ZJYA 3UAYA 2EC5A 2RAVA 3CR8A 3B51X 3CH7A 4AZ0A 4GQIA 5IYZB 4JOQA 2OZKA 1ZH0A 1C1DA 3VZBA 4MRSA 2YASA 3M6MD 3R0VA 2XY4A 3VO1A 1NY6A 3PXCX 5C18A 1Z7YA 4CF3A 1N3LA 1XCPA 3B48A 4O6VA 3BH6A 3VR4H 2ZQ5A 1R4NB 1JJBA 3JARB 4TXHA 1KPHA 1E4OA 1XHFA 4D0GA 4PCAA 1KZ6A 3DXYA 3G2JA 1ZESA 2CD9A 2VSNA 4GDMA 3BWYA 3BRSA 2A1UB 4MNTA 4ER7A 3BF7A 3Q6MA 2ISSD 4RZSA 5TPWA 3RSSA 1T24A 2B8TA 4JYMA 2CW5A 4OYRA 2I4NA 1FPMA 4G4SO 4IMPA 4AQDA 5BYJA 2Q2QA 1LWOA 5FV7A 5FTJA 2XMCA 6ABPA 1S2GA 2QAGA 1JHOA 4IRMA 4R68A 4RQUA 1ZONA 3JQAB 5EA2A 3F96A 3P2IA 3P0RA 4PBTA 5IFLA 2MR5A 1LDBA 4WOKA 1T43A 4U7HA 3KJEA 5HIAA 5SY9A 1K8XB 4YAJA 4Q82A 3ZGYA 3WOHA 5FUMA 4DNPA 5DEOA 2PUTA 4W7IA 4WIAA 1EIZA 4G25A 4OXKA 1SCBA 3M5CA 4LTMA 1JIVA 1EVJA 1NOKA 4FDLA 3VPSA 2ZBFA 3HYLA 3QFFA 2I54A 3NBZC 4PY2A 4ZI7F 4QVIA 3EMDA 1DV1A 1ULSA 1CZLA 3GUVA 3HLYA 3R20A 4I4TA 1OILA 4J0QA 2LIVA 2PPLA 2JLCA 3IIIA 2I8LA 1NUTA 1P60A 3IDSA 5EL0A 2Z8YM 3WNZA 1T1JA 2VWPA 1HDOA 1WU8A 3OQNA 4QPJC 3EC2A 4W82A 1TK2A 2XDAA 3L0PA 1JH9A 3PPWA 3IEPA 4GI7A 3LYHA 3SSOA 3H3XA 3LF2A 2A7QA 2CF6A 3FVVA 3ZG6A 1XTSA 1E8MA 3D1VA 4RVFA 4F92B 3SK0A 5FUWA 3HN7A 4X7MA 2WG1A 4RCYA 1W35A 4HFMA 4X00A 1NI3A 2ZSUA 2V7XA 2Q3JA 2AG1A 4TRMA 4MQMA 4L22A 4BVLA 4QJ3A 3W1EA 2H6EA 2V7TA 1CY7A 4NNOA 4R16A 3UMGA 2DXIA 4MR9A 5EKSA 4RVNA 5G2OA 3HSYA 2WMDA 4UATA 4XASA 1ZRHA 4WADA 3S2YA 3IX7A 3GMDA 3S99A 4CI9A 4P08A 3K0SA 4D0NA 5FWDA 2J41A 2D5LA 3PNSA 2DVMA 1GZ3A 4OBWA 2ZVPX 4TYMA 2PD3A 2VJPA 2IHNA 1GQRA 4GLLA 3MTEA 3RYCB 1SHJA 1PWHA 4IG4A 4RPJA 3WLPA 1QIHA 4G1VA 2ZR9A 1Y6GA 3VX4A 3UMCA 1FFEA 4JLOA 3TQTA 5CT8A 3CG4A 5WRFA 1HKHA 4KPYA 3KG2A 2ROQA 1HOXA 1FRNA 1I32A 4QULA 4Y1RA 5E6RB 3WS7A 1SUBA 4Y7CA 2HUNA 3AJAA 3U61B 1L7BA 3ZV5A 4LNAA 4PE5B 2XUIA 3VMFA 4XX0A 2F4VB 3FPJA 3IA2A 2ZRMA 3F7TA 4OV6B 4DREA 4X1IB 4A8TA 3IR6A 4P7JA 1Z2AA 1RLJA 2YOGA 1E5LA 3DO8A 1COZA 3DTVB 3MWFA 1SWWA 5LDGA 3X1JA 4TLBA 5JUWA 1MX1A 5EP1A 3SN6A 3IPCA 1P2GA 4G0NA 4HYEA 3NG1A 3P0EA 2D4HA 1VL5A 4PAWA 1L0BA 3ROEA 4IYJA 1U1IA 2V1XA 2OA0A 2OXRA 1K63A 2CHQA 2XUDA 1GPJA 1V7QA 3O03A 2I3GA 2JKYA 1QGYA 2G40A 2X1LA 3AF3A 3IP7A 3JZDA 3N2GB 4NL4H 1T2UA 1C0IA 2ZCUA 3WLKX 4G84A 2C4VA 2XNSA 3BWMA 3KPJA 3RC2A 4BDTA 4LMBA 2R68A 2AFHA 4KBGA 1M2EA 4TUYA 5I8PA 3A0RB 1BU8A 3DZ8A 1JJVA 1BROA 3I9OA 3Q0IA 1ZRNA 4TLAA 2H7YA 1FZTA 2B82A 2O2GA 3QA3E 4BNJA 3HR4A 4RDXA 1E79A 2PKWA 3T3PB 1HK7A 3EVZA 4F3RA 4OATA 3U1TA 1QXSA 1UAYA 2G5TA 4LYHA 2PANA 4U4AA 2VCYA 2JANA 3X1YA 4CG1A 1RNLA 1TW2A 4V0OA 5JQGF 4EUSA 1IB6A 4R0NA 2CXOA 4HX5A 3OPYA 3IVMA 1HEUA 1R27A 4TROA 4V1CI 2BJVA 1AQUA 4W5RA 3A4NA 2GTPA 3A9RA 3H2JA 1I01A 1BFUA 2VLBA 4L3OA 1L5LA 1WPRA 1LLFA 1NBEA 2TRSB 4QXRA 5EINA 3KQWA 3OLQA 1CRZA 5GONA 4QSHA 4BP9A 4X63A 5LSAA 4LCBA 3ANMA 3DBHB 3EVBA 4MQEA 4QUBA 3GJTA 1FSPA 1ZN7A 1H5QA 1VHJA 1N9GA 1UQRA 3PEEA 2B78A 3QOFA 2XMBA 3C1UA 3SXUA 3VJKA 1R6VA 3OSZA 4Y7DA 1WMAA 1XDZA 3VHXB 5LLSA 2WHXA 2X9GA 3AJ9A 3EXG2 1HO3A 1RRPA 2DUNA 3CSDA 3GW8A 3I39X 2J4DA 4LXIA 3TTYA 2BLLA 1KU0A 3WZ2A 2HA0A 4LJRA 3P7MA 3GFQA 1B6SA 3E2MA 3UEOA 2D1RA 3B3GA 4QDTA 3RUIA 1DRUA 1RJFA 4D81A 5JAOA 4EAQA 2CZCA 3OO1A 4US1R 3VSBA 3ZEAA 4R6XA 3B89A 3RVKA 1SPXA 4GO1A 2AI2A 1DEXA 2C5SA 3KE8A 4IR7A 3QBEA 4P9NA 4BV2A 5JARA 1L5YA 2EZTA 3OCXA 3EBPA 2P0YA 3WYNA 3HJTA 3G13A 2Y1OA 3EASA 1X2BA 3IP1A 1KOLA 3VPHA 4HGQA 3R8FA 4NMLA 2GD6A 2PUHA 2Q07A 1SD1A 1GTL1 2Y3IA 4LOJA 2HK6A 4BB5A 5B2FA 4NV0A 3U4QA 1TVKB 3ASVA 1UK8A 3U3DA 3OCYA 5E3HA 1NSFA 2FN3A 3BE4A 1L3CA 1T9HA 1BW9A 1F8FA 2QYOA 2Q5IA 5LC1A 3MS4A 1E2KA 5ENDA 3ETDA 2QD5A 3RCBA 3E4CA 1XQ6A 4QEZA 4JX9A 4EG0A 1C9MA 2CLIB 2Z9CA 5KQSA 2JW5A 3GT3A 4MLPA 4X1KB 3DJYA 2VSQA 3LVBA 5FFMA 3OP1A 2JFWA 4RKRA 1U7TA 2RHRA 1EE2A 3C5CA 4NBKA 4ZO8A 4ZP1A 1XTVA 3QU5A 2IXDA 5A9SA 4MUMA 1L7XA 5TIIA 3C24A 1X9GA 1OI7A 4J07A 1F48A 1NG9A 4YBZA 2GPJA 4M0PA 4PS1A 4Q4JA 3DBRA 1VLZA 4UUNA 3CO5A 4XWYA 3FAKA 5ITZB 5MN6A 2A14A 3KR1A 2IYWA 2CVFA 3ABSB 3DVQX 1SU4A 4CQMD 9MHTA 2HYDA 1FFXB 2XADA 3E9YA 4C4RA 1J6UA 4RHCA 3CGWA 3UJBA 4AS3A 1QDUA 2UXDB 1Z15A 2FPUA 2ZOSA 3AIKA 1UBJS 1UP6A 2ZVQX 2IUEA 3I4LA 1UK6A 4X7PA 4JVLA 2OFWA 4P3OA 4TKUA 4ZC8A 2J3KA 2JD0A 5K0LA 1F7UA 1RT9A 4MVJG 2E4UA 1DWPA 1ECLA 2DTEA 3WQBA 3PTLA 2P7HA 4MYRA 1KMNA 2BL4A 1J70A 5D85A 4L2IB 2ILVA 1EWRA 5FBWB 5HJ7A 1K9SA 1G5HA 5BQ3A 1D5WA 2RGYA 4HGRA 3GJ7A 1TJ3A 2B99A 3FJYA 3PI7A 2G5CA 2G25A 3KHSA 4NEGA 5FF9A 1A4IA 3PIDA 1YQXA 4O2RA 2I2CA 2W37A 4EHAA 3R9XB 2O8BB 3DBLA 3D6MA 1JBQA 5ED0A 2HPZA 3FMVA 4DHEA 5GADl 4NCAA 4P3XA 3LK6A 4A2QA 4GI3A 4ALJA 2NX2A 2O3QA 3OLXA 1I33A 1WXWA 2FX5A 2XUFA 3DWIA 5GZ6A 3ZTWA 2VAMA 2HMTA 4R5MA 2R1TB 4OF4A 5CH5A 3D59A 3OQ1A 4Y2YA 2NMVA 2AB0A 4UPEA 4RA6A 4FOLA 4DIUA 3C3WA 1ACLA 1BJKA 3T1VA 4OGKA 5EHQA 5ILQA 1DHTA 3GEEA 7MDHA 2ZG6A 1AIPA 4JP1A 1FTNA 3NVDA 1YA6A 1YA8A 3I4FA 1NLYA 3HWWA 1PFVA 1JHMA 2FY8A 2JCBA 5E7MA 2HK7A 2MYTA 4Z0PA 3VTFA 3IEVA 3K2EA 3ZDQA 4KNYA 1F6WA 2CHEA 1OE0A 1YQEA 1VE3A 4PSUA 4HEA1 4XIGS 4ZTUB 4BQEA 4EENA 3GFVA 4FFMA 2PYZA 5LUBA 2CLEB 4S04A 3NVKI 5J1SB 3OQMA 3TN7A 3KWMA 4E5MA 2JI8A 1CJCA 5TPZA 1YNOA 2VSXA 1HFKA 1MTZA 1QF7A 4GOJA 3AM3A 1ZD3A 2GTIA 1DXQA 4BRUA 4P83A 4NENB 2FCAA 3F6SA 2J7PD 4CQJA 1LJ8A 3DHEA 3U2QA 3NJ8A 2X5KO 4TTPA 1ATIA 5B6PA 2FSIA 1IDN1 4RETA 2RG7A 2X4IA 4HDRB 3MHPA 1KSGA 3U60B 3JTMA 4JQCA 5ALXA 1EQ2A 2YHAA 1UAGA 2OCDA 3PHHA 1V1JA 4UM5A 3SNHA 3JAWA 4BFCA 4BV9A 1FBTA 3ZWBA 3F3MA 2WI8A 2VS1A 4G1FA 1RLMA 4AJLA 1XYYA 3KOOA 1Z12A 2Y93A 3BK2A 2F67A 3QY9A 2MSCB 4FDVA 1SURA 4G63A 3INGA 2XIJA 2DBRA 3AHIA 3NH6A 1CUVA 3IQDB 4KIJA 1O89A 5DYTA 3FRJA 2GA9A 3LHDA 4YRFA 2OFXA 3A6FA 1UKEA 5EHGA 3U16A 3IE1A 3W5UA 1EX7A 3IRVA 3EXIB 4Y6PA 1T5LA 4TUYF 1YZHA 3R77A 3IUEA 2REQA 4UCQA 4B80A 3WLAA 2QT9A 4GWGA 2D1QA 1VI2A 2VR1A 4G5FA 3LP6A 1JDJA 3ETHA 2VYVD 2VZEA 2VPWA 3AHEA 2CCKA 5KJCA 4HC4A 2JZOA 1O97C 4M38A 4O02B 3H4MA 4I0WB 2PCJA 1XL0A 2XYRA 5HE9A 4M7RA 1OTXA 1EFRA 5L7TA 1RYEA 4EUNA 1WQ4A 1XD2A 5DGDA 2CYBA 5KYUB 4F46A 1J07A 1O95C 1Q6ZA 7MHTA 2GZ1A 3PWZA 2R86A 4R0VA 5IF9A 5JNVA 1BWRA 5BURA 2GCNA 2Z2ZA 2DQYA 2D62A 5CH3A 3ZD8A 3AI1A 1SG6A 3LD9A 1AKWA 1HY3A 2P68A 2HA3A 3H7AA 4X24A 5JYBA 5HTOA 1Z25A 3AEYA 1E0JA 1RAIA 3DKRA 1W47A 3R6GA 5GONF 5KUTA 1LQUA 1OBOA 2W93A 3ORRA 4E08A 4U2CA 2UZ1A 4C4TA 2YV2A 1TPZA 5FBKA 3EQ2A 4CWAA 4FYJA 3V1KA 4NDAA 3DEZA 1KKLA 1Y3BE 1QC5A 2N42A 5AVQA 4U2KA 5AYVA 1UKYA 2V0GA 4HVLA 1OWNA 4M98A 4Z3OA 3IPLA 2JLUA 2FZEA 2OY0A 2XYHA 4OLJA 3MAAC 1EWVA 5A4FS 4DYHA 4UVEA 3H1GA 3WC4A 4CN8A 3I73A 4UFNA 2IOQA 1H4VB 1W6UA 2K87A 4J3FA 5BN5B 4C04A 3REOA 2C5EA 3L6CA 1V16B 4LJ7A 1GGKA 2F62A 4DLRA 1OFIA 2BKEA 5J2UA 1PV4A 1KVRA 4GPZA 1KK1A 1M2OB 1PJ3A 3QFCA 2PV7A 3LI2A 4M7WA 3S3TA 1KBZA 1BRMA 3Q6IA 2QRZA 3WGQA 3R8CA 2B35A 5CD9A 3HUTA 4MYSA 3MGGA 1NC1A 1ST3A 2JI7A 4MYDA 5LR6A 3D3NA 2YWHA 2JEOA 2WKRA 4GVLA 1P2DA 1CZRA 4LEIA 3N39C 3T3OA 4TYYA 4BFTA 2BF4A 1M1YB 3IO5A 1H8HD 3OTHA 3U3MA 4HT3B 1YCFA 2B4AA 1BX0A 4NKRA 4KSCA 1VSTA 1UDCA 2WTXA 4N0MA 3WA6A 4F93B 2WUGA 3ZBQA 3GFOA 2V0CA 2V9ZA 1YR7A 2GRAA 2V6FA 2C3YA 4NBUA 4X1YA 5F1KA 4XIYA 1FYVA 2P6RA 4E94A 2Z43A 5FFFA 2C4MA 2PLNA 4JBXA 4ZKEA 2RKWA 3CZQA 3PXGA 1HDCA 5M2QA 1U3DA 4JXKA 2R25B 3VR6H 1BFKA 1SUCA 2W4MA 3VOBA 2GPSA 3L7OA 1CP3A 5K2OA 1PT8A 1XMVA 3GLRA 4D79A 3EEQA 3EG9A 2BGLA 1THZA 4JT8A 1KAHA 1P6XA 1K27A 2DSTA 3LCMA 1TCBA 1Y1LA 3NTXA 4RL4A 4XPIA 4TM8A 1V5EA 3CJQA 3DHNA 5T3YA 3C7KA 3P2OA 4QHSA 3T38A 3KQUA 3VYSB 1XP8A 2HHCA 3JYLA 3DFKA 3W04A 4WZAB 4ZPXA 4Q9JA 4PCVA 3ICWA 1KYWA 2IXAA 1FUYB 3ONVA 3DULA 4UTXA 4ZI7B 1EGVB 4HY3A 5HMLA 1K7CA 2QGZA 5JE8A 2H9AA 4YRCA 1QFXA 5ECWA 3SYKA 1XC7A 3NI2A 5B7NA 1DWUA 4KVGA 3I4CA 5ER6A 1MC1A 2YHIA 1GTJ1 2FWPA 3PPVA 4PNZA 4DYVA 3FTCA 3O3NB 4HZUB 3PJDA 2RGNC 2AG6A 1AUPA 1CQZA 2W6PA 3A10A 1RP1A 3GRFA 1CUEA 3KSAC 1OMOA 3A3NA 2B8EA 1ORHA 3VJMA 4LYDA 3ZE2B 3IOCA 1A9YA 1CF2O 3GA0A 4FKBA 1V95A 1DRKA 1R9JA 4G36A 2D0OB 5SV2A 1IOZA 4MUKA 4CMEC 2OV8A 2JATA 5AWFC 4EY6A 1HR0B 1OBHA 3U7JA 1RACA 3BRQA 2N1MA 1EXWA 1TQHA 1KMCA 4MGYR 3IQWA 4FQ8A 4PSCA 4Q21A 1KJ8A 1U6IA 2PZLA 4M8LA 5TF0A 3PUKA 4YMSA 3VQTA 3FUCA 3O4JA 4DANA 3DFIA 4JP8A 1TKCA 1FRFS 4GF5A 4H27A 2OXCA 4UNNA 4BOYA 4C43A 1DG3A 1QLWA 1BKSB 1OFUX 2CVPA 4C01A 1BDJA 2QQFA 4CM6A 4OMDA 3ZWWA 3W3AA 5I7VA 3ENZA 5BVHB 3JVIA 5ALMA 2NUTB 2Q21A 3L8YA 2E1RA 1HLDA 5GJVC 3T9CA 2FX3A 1ID8A 3LUPA 5LQKA 2QMUA 3B1KA 3I04M 4A15A 3JQFA 1ODCA 3IIEA 4P7FA 3IPXA 3D1LA 4H77A 4EEKA 3D4BA 4UVHA 3R3YA 2LKDA 4ZI2A 1A5ZA 3QLTA 5CB4F 1N2OA 1SXHA 4WXRA 1I80A 3NYRA 2Y1DA 3K0KA 1FX0A 3T5MA 1W87A 3RSGA 4JVOA 1LD3A 3ZWPA 4DIFA 1N9KA 5CIQA 1LSJA 3IHKA 2ACKA 2OESA 3GEPA 3HWX1 1P81A 4XAQA 4O1IA 4E5KA 1SXQA 1E3MA 1GAEO 4OYHA 4EBFA 5I3ZA 1E2UA 1AO0A 2IHJA 1HYBA 5JWRA 2GZ3A 1TB4A 1UDBA 2H5IA 4XEUA 3NUGA 3C6MA 3O4FA 3Q7SA 4B3BA 3E58A 4KPFC 3EUWA 3QHAA 4F1KA 3DDUA 1IN6A 2VPTA 1SVKA 2FWBA 3RVNA 4C03A 2P90A 2M6KA 4ZYVA 3GRKA 1VMEA 2PBZA 1RXSA 3HEMA 3JWIA 3KAPA 3EY9A 3QEMA 4FEEA 1XYGA 5KCZA 1D9XA 3O4GA 1ENOA 1VYTA 3B3AA 4UPDA 4RJLA 5C53B 3IQFA 1BMTA 3LBFA 4CLEA 1T8SA 2VQ6A 2Y77A 2QGFA 3DUFB 3OFND 3PFCA 4MI1A 5CX4A 5BSRA 4MQ5A 3T95A 4D7AA 1H65A 1DOAA 4DBVO 3F2VA 3OCCA 1KFCB 2J6IA 4B85A 4C0XA 1I10A 4RL6A 3SI7A 2GNOA 3QVUA 4F4IA 4P54A 1VL6A 1O58A 4CQLB 2HU8A 4FLEA 3O5AA 4Y9UA 3FR8A 1VL1A 5ELMA 3E7DA 5TX7A 4WRRA 3GG9A 1VSQA 4BNGA 1E62A 1D0IA 4PPQA 3ZU5A 2VUTA 2MCFA 2OO3A 2V03A 2G4VA 4FQ7A 2B7LA 5A4DA 3BL5A 1BWQA 3BMOA 3JXEA 4CU2A 1CR4A 4G5YA 5JQGB 3P9SA 5DN6A 3TKAA 5DTIA 3M0EA 5F76A 4DG8A 1GQFA 2Q50A 1U99A 4MS3B 3EHEA 3UT5B 5E4TA 1YKGA 3V6MA 1Y3FE 3GL9A 3IUPA 3UGKA 2CMDA 5AH0A 4LG1A 3DOHA 4MA4A 2KS6A 4AWBA 4Q7LA 3AEQB 3RYFA 3TK1A 5KVCA 4C0BA 5KJFA 2ZSEA 3K6RA 4Y9DA 3JR7A 5LMNB 2C82A 1AB6A 3W5VA 1F4VA 2IE0A 4WLVA 5DYWA 4PGMA 5A5EA 3ZY3A 2R4QA 3KZKA 4OQQA 3TW6A 2V7PA 3FI0A 3WB2A 1CYDA 2XOKA 4JBHA 1PKXA 2JG3A 4EWLA 5CB6A 1XDBA 4FGLA 3H1TA 2IT1A 4QFCA 1Q3KA 2GK6A 3GBSA 3PDHA 4J7UA 4QYWA 2MU1A 3LQYA 4HI0E 4O4HA 5IAKA 3HNPA 3TZLA 4AT1A 4E6PA 3D3EA 4Q03A 1JU4A 1KI4A 3RTDA 1UBSB 1T4BA 2GOYA 3S2IA 2WYOA 2ACEA 3UQYS 3KKNA 1U63A 7ABPA 3N2NA 3W2GA 2V5AA 3EGCA 3PHBE 2AUTA 3AINA 1G55A 1PJ4A 1QGUB 2IZ0A 3Q8LA 4K03A 4QM7A 3FR7A 4PHCA 4DLPA 2FP4B 3DCNA 4MVJE 3HKBA 2XKJE 5ALRA 2YY5A 5CXQA 1M8KA 3NHBA 1D4AA 2WPDA 3KLPX 4PQRA 5KQLA 1U2SA 3WKBA 1DG1G 2B1GA 4L5IA 4AKSA 1T4CA 1JL3A 2ZDGA 3R5XA 4X65B 5J2UF 2VP9A 1NQOA 2XPCA 4ZICA 3GV0A 2G28A 2NU9A 1LPNA 5FPSA 3EK2A 3ZDCA 1GCIA 4U7PB 4BVBA 3AB3A 1F0NA 1XTTA 4FEAA 4F5YA 1TF5A 4ZT6A 4MIEA 2OECA 1UWVA 2V54A 1ZN2A 1GT91 3ZX4A 2IW3A 4DE5A 3NEPX 1RXIA 1DDGA 1CETA 3NIGB 2WIJA 3U1BA 4RK4A 1JAXA 4LK2A 4F85A 3X1DA 4B4KA 4K6KA 4EABA 1JTVA 2OORA 3BGOS 5K0NA 1OZHA 4MS1A 3RGWS 3KR9A 4EF5A 3G0HA 2QTGA 1A7JA 1QFYA 2H5EA 2ZULA 4BNNA 2XH8A 4H7HA 1HQKA 4C4XA 4QQNA 2BCJQ 2IIQA 4MKHA 4NU0A 3B13B 3Q7IA 1NNSA 5F12A 5H1YA 5IMBA 3TR6A 2IYPA 1VBFA 3VMMA 4CW7A 1NFRA 4HEA6 1FYFA 3OUTA 4KLNA 2C88A 1P2FA 2H4XA 4QEKA 2RBGA 3BXPA 4BX3A 3MHTA 1WV1A 2QR5A 4S2UA 1TCCA 4PX3A 1XD9A 4FUTA 4JJGA 1O0SA 3BJRA 2YZ7A 3GOHA 3KB6A 3TGPA 3TTVA 3GLGA 1KMQA 5KTSA 1K6IA 2CNKA 1WD5A 1NN5A 4C1NA 3HWRA 3OZCA 3K0AA 4ZEXA 4PLWA 3T5PA 1E7WA 2I6TA 4IMRA 4A0GA 3FCXA 2G77B 3FCUB 2XMGA 4TKVA 5AHXA 1NW5A 2ADMA 2RC5A 3O1IC 3OU7A 2ZRJA 3BKWA 5I51A 2ZVJA 1J2EA 4KW7A 2R7NA 2QI9C 3A11A 4QA9A 2H5JA 2WIFA 5K3AA 3N05A 5GINE 1QYCA 2MSLA 3A6EA 3KRTA 4YB8A 2NUBA 2P6MA 2QRUA 3WGKA 3ZU2A 3SF8A 2AFVA 4X90A 4DCMA 1MAWA 1ABEA 3I2YX 1FDWA 1IYZA 2AW3A 4XI9A 2B25A 4OPMA 1DUSA 2GEKA 3JZFA 3JQ7A 2FWJA 1G8PA 3L8CA 5AUPB 5GZ1A 1IJFA 1U0NA 4JP3A 1NWCA 2OHIA 3HNRA 4JLAA 3GY0A 3LP5A 2BLNA 1Y6JA 4EO4A 5CYGA 2ZYSA 3L0SA 1JEQA 2QRVB 4Q9AA 4B5KA 4C5BA 1EX1A 3EXEA 5JD6A 1IN8A 1Q1EA 4I2VA 4ZODA 2HQSA 5LNK1 1DWQA 2A35A 3EIEA 3OQJA 3CRVA 1VCOA 2N47A 1PLLA 4MCAA 4MR9B 4HL6A 2XRYA 1RXUA 1ZRMA 4OHVA 4DIEA 2G9NA 3EUAA 3HSKA 3AC0A 3EXFB 2D5CA 3I6ZA 1MHPA 1XJWA 2PN1A 4DPKA 4OXNA 4YUVA 1T91A 2OGTA 5JEEA 2HMSA 5AXCA 5ARDA 3ROMA 3C41J 4CV3A 1LX7A 2BHRA 3RRFA 4ZC1A 3MGBA 4YRDA 4D2IA 4S12A 3VTKA 3H04A 4KKVA 2JF0A 5U4XA 5C8VA 4Q3CA 3L7JA 1U0SY 1OLUA 1FQKA 4LSGA 1LQTA 1UJNA 1QIDA 2GHTA 2WYUA 2HF9A 4Y1RB 4PAGA 1JPVA 2DULA 1NQ5A 4FINA 2I33A 3UY4A 3Q88A 4LQLA 4ZRDA 3OE5A 1HSZA 1QYRA 2C2XA 5AKZA 2AC4A 4CYMA 3TLMA 4MI9A 3PX7A 3EY4A 4RIEA 1JILA 2PVPA 3BX1A 3H7IA 2Q8PA 4LTDA 3D4LA 3RWMB 1X7GA 5G53C 1K3TA 2VYND 3VPAA 4EY8A 4ZGWA 2Z2JA 3C74A 1Y5NA 3HFSA 5JXJA 2B83A 4BCDA 4GE0A 1R6AA 3FGOA 3LXXA 3QUTA 4UZEA 4QJ5A 1QO0D 1OBFO 3EZ2A 3U39A 4LYFA 4TVKA 1J25A 2CHUA 2V5UA 1U2TA 2QVGA 3FYDA 2BFFB 1I2BA 1L7AA 4HP8A 4TMWA 2IC5A 4NPAA 4X64B 1KI1A 3KL4A 1Z4MA 1OAAA 2E4ZA 3HA5A 2IEYA 5KOYA 4MDEA 3H9BA 3KFXA 5CYPA 1U2PA 2XQJA 5E4FA 3SHWA 2AFHB 2UYQA 2WPNA 1LSUA 3ESYA 3OBBA 4TUYB 4BP8A 5BXYA 4JLSA 4OJQA 1P3Y1 1EJ6A 5BQXA 1XDWA 3E7WA 3BXEA 3MA0A 3W5CA 4G81A 2Q6KA 4DLNA 2ZSKA 4CGYA 4FOTA 4PGHA 3MWJA 3HB5X 3PK0A 2VZ0A 5REQA 3DPUA 4H4CA 4YUXA 1AGPA 4PLFA 1A4XA 3DMNA 1F60A 4JCOA 2CLHB 5IS2A 4CL3A 2VDLB 5JWOA 3KT0A 3AJDA 3SDZA 1PYDA 2BRUA 1WY7A 2P9GA 3NR2A 4IG9A 2UXCB 3QGMA 4HJRA 4EA8A 4KMRA 3PRKE 3AR8A 3J81k 3OPYB 2AK2A 1B1CA 1O9BA 4C30A 4F6RA 2R5NA 1PL0A 1K0UA 3MCZA 3QVGA 4NBTA 2CDNA 2GJKA 5CLFA 1QIKA 2XVAA 2H2AA 3LUGA 4DMHA 2RKBA 5GONB 2II6A 3B6JA 4B3GA 3D8UA 4JMPA 2PBFA 4IVNA 3GMIA 4MQEB 3GLIA 1R9MA 3FUWA 1Z5GA 3O8LA 4J1SA 1N9GB 1T1EA 2B4RO 3OUZA 1EFVB 3UBMA 1O6GA 4ZI5A 1EXVA 1K08A 1EGAA 2TMGA 1Y9DA 1H9AA 3LNCA 4BNFA 3GLVA 1REQB 5K6TA 1GKYA 4BQNA 4CLDA 4FSDA 4G4JA 4R8LA 1QS0B 3WISA 3TM5A 2FSHA 4DJ5X 4O4HF 1L7PA 3MTQA 1N4AA 3U9SA 3R9XA 2NPIA 4NCIA 3WRYA 3WYEA 3GUYA 3QPDA 2DLCX 2VKTA 3ZLTA 1VKOA 3O0TA 3WZMA 4AZTA 4URVR 4O3MA 3VR1A 1N2CE 4HQKA 1S96A 3OLYA 3HLKA 4GXNA 4L02A 3KOXA 2VJQA 4FI3F 4KQMA 4RHUA 4CV0A 5C46F 4N3GA 4X3CA 1JH8A 3BL6A 1Q3TA 3RS7A 3VDRA 2QD1A 3SZ3A 3AP2A 1IJKA 3DOOA 3P4XA 4JVSB 1OR8A 5K3FA 2QVYX 3DVAA 4UXJA 4HXGA 1YRLA 2VAVA 1B3RA 5FDFA 3PLRA 3PPYA 3KYIB 4Y30A 2G9ZA 3CNHA 4XFKA 2AOVA 4Y6SA 1ISPA 3QWIA 4LIPD 3WYAA 4EKNB 2WHYA 3E0XA 3N5CA 4MHOA 3L1JA 3T4EA 4EATA 1OLXA 2XTZA 3PX2A 1Q0SA 1YJCA 2VHUA 1T1GA 4L8VA 2DAPA 4TQGA 5LBIA 3RRXA 3VU0A 4IJQA 3IOBA 4I9GA 3WFIA 1NVFA 5GP1A 1JR3A 5D84A 3A1UA 5DHQA 4DJJA 1CQIB 5LB4A 4BLRA 3WGOA 1V96A 4ALMA 4RM2A 4Z5XA 4JLJA 2HZ7A 3ERCA 1Z06A 3Q10A 1AXEA 5JW6A 4B17A 2C9CA 1WQ1R 1WUHS 4NF2A 2WU3A 1UC5B 2FWIA 5EIHA 5DNVA 4RHFA 3QVSA 3TNLA 4YMLA 2YFKA 3R23A 3TZ6A 4JYBA 1XAGA 1JEDA 3GFRA 1RKBA 2SKDA 4BWFB 2FPXA 1LSSA 1E7MA 2IU6A 2EIXA 5CNIA 1OD6A 1BIFA 3VBEA 4JP5A 3WL5A 3SQWA 2KHZA 3M5WA 4ITRC 1WXDA 3A9VA 1L4GA 5BSTA 1SKMA 2FJ0A 3FCOA 3QITA 2EZ4A 4QODA 4LF4B 1JXMA 3LT2A 1J23A 1PJ2A 3BFXA 3NOXA 4OD0A 4W5QA 1Q0HA 1X1AA 2D0PB 3DBRB 3M1IA 4CKWB 5CBPA 3B82A 3THYA 1JJIA 4KQXA 1M3SA 3Q3VA 4IJ6A 1JV2B 1QVAA 4FDMA 2OMKA 3VX3A 4XCVA 3I0MA 1PEDA 2YFHA 421PA 3DCJA 4NPCA 4HNTA 2NTEA 2PIAA 2GGSA 1DQSA 2QUBA 3WDKA 4RTQA 2NO4A 3BIJA 4TKUB 1NT2A 4ZT2A 4ZO4A 2D2IA 3F90A 3OY2A 1HETA 2HLDA 5TSDA 1MIHA 1TJYA 1ZA1A 3FVWA 4L5CA 1MW8X 4N5NA 3UWOA 2R44A 3WGJA 2QMZA 1KC1A 1IN4A 4YP1A 4UEWA 1PR2A 2AMLA 2PGDA 3C0KA 1ECGA 3CKLA 3UK7A 1ESNA 3TGWA 1PV1A 1PG2A 1TD9A 2FEXA 2E1PA 2FFHA 4QE3A 3DBLB 3N58A 1XB2A 4Z9BA 3T94A 3S8YA 4HS9A 2C2WA 4U2BA 4F11A 1T3TA 3R8XA 5IX8A 3RC3A 3M1YA 1N57A 3UAXA 5FTKA 2K2QB 5IJZA 3P2KA 1HT2E 1ZG3A 1PZGA 2I3ZA 4W5TA 3MRSA 3GNTA 4QASA 3INRA 3JYHA 4CRWB 4BQRA 3X1XA 3KQKA 2XDQA 2PJZA 2W22A 1C4XA 2HQRA 2DQKA 1U8CB 4ZIRB 1L4HA 1GAQA 3K05A 4RA6B 4R2KA 4AWAA 1RYHA 5DTRA 2ZSAA 2HQBA 4O8ZA 4OQPA 1RC1A 4QGGA 1XTZA 2J5XA 2IWHA 2UVQA 4JJFA 1XR3A 1RQ2A 1EINA 4GI2A 3ZH9B 5D5PA 3HR8A 1T8TA 2VVTA 2IEGA 3K15A 2ONCA 4NULA 1GPDG 1I0ZA 2YNMA 3S55A 3VSAA 5CB4B 1ZC4A 4KR2A 4R54A 4R0MA 2GM4A 5BWLA 4MWCA 2AN3A 1V9CA 1EDBA 1AG9A 1QG0A 1XF1A 4NOLA 4XIFA 4BO8A 4NBRA 2YVAA 1GZUA 2ZQZA 2EOAA 3C7CB 1N5MA 4LVNA 2VDQB 2QNIA 1DU4A 2XMQA 4KQFA 1BA3A 1U0EA 4N49A 3O0DA 4EGQA 4Y2TA 1N2HA 3K0HA 3VNAA 4AMUA 1Q5PA 2EU8A 4ETNA 3EVEA 5AW3A 1NFFA 4FYMA 4QNMA 2E5FA 2CB9A 2H2WA 4ODIA 3RSZA 4CM3A 3CX6A 2Q3MA 1HRKA 4DLUA 3ZS9A 4FX2A 3HDJA 3CX3A 1BCSA 5C7LO 3QE3A 4KQWA 3S28A 2QD4A 4B8YA 4M1ZA 1XMPA 5KHLB 2FSUA 3H4IA 5C1BA 6GPBA 2YYAA 3GK3A 4MARA 2W11A 1AKNA 2VNSA 3ONEA 4ZVSA 1UIMA 2J48A 3V2UA 5BRJA 1KDTA 2HPHA 4OVKA 1HQDA 3W78A 4A0RA 1GUDA 3AUSA 1Y3AA 2ZK7A 3CLTD 4UUPA 1H8EA 1NW4A 1QF9A 2W6OA 3FKSD 4Y2UA 5F78A 5LQAA 1CS0A 3PHGA 3TRHA 4C6SA 2V6IA 2FPIA 2EFYA 4XXHA 3I2JA 2C4TA 5K0FA 3W9YA 1XJQA 1QCCA 2REQB 4EPXA 2DBVO 5F7OA 4LGMA 4PYOA 2HFJA 1KE2A 2YS7A 4KSYA 3E9MA 1E79D 2I1QA 2MSWA 3TSWA 1U65A 2O06A 4RD2A 1DC3A 3FVRA 5CLIA 3C3KA 3DMDA 4FHEA 1ZJJA 3A26A 3D02A 4FLFA 4IWYA 4MGKR 4YO8A 5FPYA 3D5QA 2I4TA 2QJOA 5GM2A 2EP8A 4EF4A 4OOEA 1YB5A 4DQXA 1XD2B 2GFHA 3HJNA 3IERA 2XVYA 4LRXA 4FQ5A 3O1JC 3H0EA 1R0LA 5JPIA 2FZGA 3JVEA 3L0DA 1AGNA 5BMOA 3VHRA 3J80A 4EF6A 4P0TA 5BNTA 5DW0A 1E2HA 4LX0A 1JSRA 4MHSA 3NWJA 3IP8A 4QHTA 2F90A 4PYIA 4MZXA 3TLCA 5M5BA 3E7PA 4RVCA 5F4ZA 3WBFA 3KAKA 3FF1A 3IGFA 2IYUA 1VMDA 4CLRA 3S27A 5HYVA 1MA0A 2IL1A 1G8KA 2JGIA 1WKBA 3L1UA 1UJ2A 3VUEA 3WGIA 3OJWA 5IC5A 1NVMB 2BUAA 4O4IA 1YZFA 4PQYA 4DYDA 3AX6A 4IDFA 4XTRA 2WJAA 1V48A 1U4NA 4WKBA 1QC5B 2J6CA 2JAQA 3LJKA 4UU8A 5D1NA 2C2YA 3ECAA 1PK9A 3FTEA 2O7SA 2WY2D 4RPGA 2CBGA 2FPLA 2XSZA 1LVHA 4DDMA 3EFOA 3WG9A 1SIUA 4E5YA 1CDEA 3FZGA 3CVVA 3QX7A 5LCXA 1UANA 3KJFA 4MKZA 1QHYA 2BEUA 1B0UA 4DLXA 3IDAA 2Z8XA 5J2UB 3RUHA 5GQSA 1Y4ZA 4GP6A 1M5UA 1UFOA 3UO8B 4A92A 1WW3A 2HCFA 3RSOA 5DDIP 2OXEA 1ZK0A 2CXUA 3CJTA 3QF4B 5A3SA 3T34A 4TPKA 2C3OA 3ZBPA 3ZCXA 1BXRA 4HN4B 5KIAA 3N0VA 4D0SA 1PQ4A 2NPOA 3KSMA 4RGVA 4D9EA 2WWGA 5LQMA 2GPNA 1GGFA 4B8ZA 2ZUVA 4DEVA 1AD2A 2BM0A 4PVDA 4WEQA 2XQFA 3G7UA 1TNDA 4MGZR 1GL7A 5LNK6 3CNLA 2VHYA 2BW0A 1B76A 4CMIB 1HDEA 5FI3A 2Q2WA 4Y98A 1VE7A 3UFXB 4ZOQI 5T4EA 2G5PA 5CIYA 4Q3NA 1W93A 2HRQA 4IOLA 3UM9A 2MT9A 3SHVA 5CA1B 1P1FA 1TT5A 1WDLA 1JGTA 2G82A 1KFJB 3DTTA 3FIJA 1F6BA 3NBUA 4EGSA 1XQWA 2Q3EA 4TZ0A 3UMMA 4KQ9A 4Q1FA 3TBHA 4OHPA 5DM60 1XZDA 2H2IA 4NYIR 3L18A 4OHZA 1I14A 3U56A 2QLLA 1EK5A 3RGGA 1O5IA 3M4YA 4L07A 4Y6QA 5EJ9A 3OFJA 1YJQA 221PA 4RKYA 3LY5A 2JRCA 5BUZA 5AHKA 3AF0A 3UCEA 1BDBA 5A4MS 3V7WA 2GWHA 4XPIB 3O2NA 2V6BA 4M4SA 4R7TA 1CG6A 1QWOA 3QLVA 4TS4A 1CT9A 1JDVA 4GMDA 3RIGA 1XZJA 1MH9A 3Q7RA 4BVEA 3CZAA 3QA9A 1QFMA 4OL0A 2VJYA 2F8LA 3KAQA 4LXGA 5J58A 1J06A 1WBBA 2GLTA 5DX1A 4KR3A 2RH5A 4YONB 4YJDA 5GAJA 3JS5A 1TPYA 3VI4B 2W5UA 1XA3A 2VBGA 1FDTA 1E96A 3IBFA 1BCRA 1ICEA 2XGGA 4R2WA 1IXKA 3T5BA 4CV1A 2EJWA 1RKXA 1XALA 4PZAA 1GAXA 2PSFA 3KV1A 4RVSA 3SBXA 2XR1A 5E9QA 1W4LA 1YC2A 1NW6A 3P2YA 4WXMA 4ZVPA 3UOWA 1W59A 3LT1A 2WK1A 4JHLA 4BNHA 3DLCA 3FNIA 1V8PA 3CUWA 2REXB 2XCLA 1T8YA 3BTUA 4QREA 5EJ2A 5IJ0A 3ESCA 2AEFA 2PMDA 1HQYE 4D43A 2HNKA 3K9QO 1ZR2A 4JBNA 2PQMA 2AMYA 1QPZA 2A9OA 3VOAA 1WEKA 2OFFA 3WY9A 4YALA 1FP4A 3ZW8A 2Z2KA 3ID6C 4NFLA 1OTYA 4NFYA 4R3WA 1NP3A 5FPQA 2FQWA 1RAAA 3MBIA 4GMKA 4Z7QB 2RONA 2VWGA 4N47A 4Z0HO 3K4PA 1TQ2A 4DCGA 2B9EA 2W0MA 1KTVA 4ILKA 2DWQA 1G8AA 1II8B 3P2JA 2F3PA 3RJZA 2NTNA 1GGHA 2PGNA 3H2HA 4K28A 4KOAA 1V2HE 3EN0A 3R1IA 1XVAA 3UWKA 4PNHA 4B46A 2GCOA 4EQ6A 4MJLA 4X93A 1KU6A 2NVBA 3TNFA 3NBQA 4EG6A 1KYTA 6PFKA 4DNFA 1NJ2A 1XZPA 1OV6A 3VHQA 3SQOA 4N6GA 3H2YA 4BRWA 1AO3A 1F2VA 1KQ3A 1Z2NX 4FN4A 1OUMA 3NWPA 4GIBA 4MVYA 3NKFA 1K4MA 4IRXA 3ZK7A 1TDJA 1NBHA 5HEKA 2DMRA 3EZGA 3IV9A 3KJNA 5TPZD 3R9KA 4DGSA 2YICA 3NFRA 2HWYA 4KAFA 1Q22A 3C8MA 3FCYA 5JISA 1PGPA 5CVDA 5KSPA 1UK7A 3A1NA 3GWGA 1RXEA 2VRNA 1D6JA 4DEXA 3STUA 4YRGA 2XMPA 2X5XA 3NTVA 1TTTA 1P9NA 1IPFA 4KLZA 1BH6A 1SXPA 4LDQA 1DGQA 4EHFA 4HLUA 4L5BA 1D03A 5DM4A 4NHEA 4R1OA 1AK2A 5TJ9A 2WWXA 3DKKA 3QVJA 3RFFA 4OY3A 3ZHOA 3HO1A 1I1HA 2I03A 4MUBA 4CCWA 3PFGA 2Y1XA 1I6LA 4Z4QA 4JN6B 5CW1A 1L8QA 2DFTA 3FPEA 3FA2A 3U49A 3SZRA 2M6SA 3HN2A 4JR0A 2PHZA 5YASA 5DI3A 1HKUA 2W2LD 4DNXA 1YR3A 4V0RA 1J8MF 1GFZA 1ZDMA 3NTOA 2P6OA 3E9EA 3H16A 3LLMA 4P0PB 3TFWA 4NMMA 1TE2A 3V4FA 3UWDA 1L1FA 2I6XA 1QMPA 5HK8A 1E6KA 2OP0A 3AR6A 5FD8A 3UG6A 1KI6A 4WCFA 3WWYA 4BP1A 1JKFA 1OKKA 1XRPA 1ZX1A 1QRSA 2JIZD 3NAGA 2FMIA 4BBJA 3RFTA 3ZU4A 3M2TA 2ZJOA 1VLHA 1YR6A 3PNOA 4F6CA 3CF6R 1TMKA 2ZS8A 3TOSA 1U80A 4B6QA 1VGVA 1J0CA 1WCIA 3CW2A 3FUTA 3HHEA 3BMOB 3TKYA 4EW6A 2QR3A 3W6NA 4OXYA 2PRJA 4ID3A 5JSFA 1INLA 1L1EA 3IJ5A 2C98A 4E5SA 2HI0A 1O57A 4ZK6A 1U0JA 3RUAA 3V46A 3NV9A 5AW7A 1RLIA 3G1WA 1QYVA 5K51A 5C1OA 3ND9A 4H7IA 3LAWA 3MTBA 5IJXA 3ENWA 4OQDA 3RYFB 1XZAA 1S5PA 5JCJA 2RH8A 5BY2A 2Q9BA 1N2XA 1PFWA 4K9QA 5DMXA 2JBAA 3TLBA 4CNBA 2I7DA 4HR7A 3OF5A 4TXNA 3DZKA 1MFZA 4PXSA 2IBMA 4I4IA 4BO5A 2ZRPA 2FN4A 2JAPA 4N6NA 4XM1A 3CX8A 4RAOA 4QWMA 4A16A 2A58A 2BSQA 3NHSA 2DFPA 3SJ7A 5EPEA 4HNRA 3UGTA 2WNIA 2C20A 1MAUA 1PDVA 5JC8A 2YUTA 2O57A 4O4IF 4O4HB 1YTUA 1V5WA 1JFRA 2JI9A 2C2OA 2GN2A 2DM6A 3KUUA 4EKDA 1TZCA 2Y1GA 3PL1A 3DL2A 4W5JA 1AMNA 1LJLA 2J3QA 1XVUA 1YRBA 4HNSA 5IARA 5HUHA 3V55A 2WLSA 4ENUA 4WXPA 4J0CA 4JGIA 2C2MA 3HKBB 5EPUA 2IF2A 3NH9A 4UHHA 4FMDF 3SHTA 1SQGA 1UCFA 2RGDA 1GG2A 4G0ZA 1SXIA 3ESBA 1Y7PA 4W1PA 2NU9B 4HDOB 4XUEA 1PJQA 2P9HA 3UPDA 4R69A 5BWMA 1OW3B 2VHCA 3MLBA 6REQA 4R1TA 3WL6A 2HTFA 2VSFA 3SBEA 1IE3A 1P1BA 5BV1A 4KR7A 1ZQ1A 4TXJA 1M6YA 3TPZA 2Q49A 4K87A 1JHVA 1LVGA 3I2FA 2CMHA 4PPYA 2QZJA 1EBUA 3UFBA 2JFZA 1OREA 1RM3A 1RVV1 2ORWA 5GJCA 3DD1A 3ZYZA 1RYMA 3O38A 5IWCA 1S2MA 2ZRIA 1H2ZA 1Z0UA 3LA8A 5DYGA 4NABA 3TIGA 4F12A 3WA7A 4Z4HA 3JVDA 4PLCA 3N53A 2A9PA 3WFJA 3EZ7A 1PL7A 2AJBA 3C6ZA 1V8ZA 3OX1A 4H0NA 1HDIA 4YCLA 2OCGA 1GKUB 3H05A 4WJKB 5A6SA 4NZZA 3UPTA 5CT9A 4G0QA 5K3BA 2OXFA 1ZSVA 1CV2A 1XZIA 1Z34A 5A4AA 1YOBA 2VDOB 4TM7A 4YP0A 3WP0A 4CTKA 2HRRA 3MS7A 3O1LA 1FRZA 2Y6UA 4L9RA 4PCUA 4X62B 1DAMA 3CVYA 1A8HA 1Y8RB 2PR7A 1U28C 3EAQA 1AS3A 1PR6A 4C2UA 2CHFA 5ALKA 2J3HA 1WW2A 2CJYA 4ZT4A 1L2TA 3H5TA 3WNCA 4I5GA 3DM5A 2QSZA 5CAEB 4LF8B 1FZQA 4BGIA 4OX9Y 2WWVD 2FW7A 3KVOA 4TRRA 3GLGB 1HTTA 4D6YA 4GKKB 4MVJF 1DEOA 3IFSA 1MO5A 2D54A 4BQPA 3ISJA 2PXCA 1F2UA 2WP0A 3FNEA 3ZI4A 5E8JA 4AI6A 1XDSA 2L19A 2VPXA 1U8AA 3RM3A 3PQDA 2HXYA 5DWVA 1STOA 1MVNA 3OQVA 3SEQA 3A36A 5EJMA 4BGEA 3IBSA 4RTRA 3K9WA 1NBOA 2ID7A 1I1QB 1T3HA 4MDHA 5FOQA 5BVGB 3I9LA 4ZQFA 4OL9A 4B8WA 1Z8NA 2I7XA 1IUNA 4ZRNA 4BV8A 4IICA 1JHZA 5DHSA 2D7DA 1QNFA 1WSWA 2FV8A 3PZBA 4J49A 1P44A 2PSJA 3CLSC 4R41A 4UXIA 4AY5A 5K8JB 2BZGA 4IZ6A 3WTCA 3MJFA 1R0KA 2P1ZA 2JKVA 5DBGA 5CUQA 2RIPA 4M6WA 3FZNA 1N34B 3MJ4A 3E7XA 1JEQB 2P3LA 1Z0AA 1OX4A 5F1YA 3EXEB 1XZLA 2A0KA 1O0CA 5BN4B 2FR8A 1JB9A 3M6LA 3OA2A 2ZEJA 3IP9A 3NPMA 2FZ4A 4IV8A 3F9CA 4WWHA 4RABA 4LHYA 1ODLA 4BNXA 4EPWA 5EVJA 5CFZA 4HPWA 1CP2A 3TQSA 4FSHA 1X13A 3IBCA 4GKBA 4HYQA 1KH2A 4KXWA 1HUQA 4UAJA 3FMFA 4DWVA 5J59A 5E2IA 4J03A 2MDTA 2WSBA 4TMYA 3QMWA 4D9IA 4DMGA 4TV8A 1T1RA 1UP7A 2EYQA 1ORTA 1WTAA 2BFNA 1PJRA 4ZO9A 2QVLA 2XI4A 4Y0NA 2OYRA 3L5OA 2Q99A 4RIIA 5M29A 2PA3A 1EFPA 3VDQA 1TKAA 4OXQA 5AM4A 4ZJZA 1OLUB 4I8DA 3UH1A 1LLDA 2ZBPA 5TEVA 1G18A 2CZGA 1V11B 3I72A 3LIPA 5FL7A 4KNVA 4FEYA 5TMBA 3ZI0A 2XX3A 2NO1A 3TTXA 3EAGA 3EW7A 3QEOA 1L5VA 3WO0A 5KTMA 4U0JA 3TLGA 2XQIA 4URWR 2BGWA 4ZXFA 1WA5A 1X7WA 1CERA 4F7WA 3FUUA 3LCUA 2O59A 4FMPA 4ZAWA 1A5AB 1EM8A 1IZ0A 2O23A 3GVIA 5AW2A 3RTBA 3PDUA 3IEIA 4QU5A 5LYJB 4YMUA 1I7LA 1IBRA 1NQXA 4I55A 3I61A 3GUUA 1N5IA 4EI8A 1JBEA 5HW0A 1YJ8A 3ZD7A 2NO5A 1E1NA 2WUWE 1YBHA 3IUNA 4IV5A 3KYDB 3PV0A 1L3BA 3T1OA 2QSYA 1XZNA 2WHEA 2ZT6A 3L82B 2QLJA 1UKZA 4M9QA 2FQQA 3QPUA 3KAJA 2ZRLA 2R1ZA 4BMYA 4MUFA 3P4YA 5DNCA 3JYPA 4ND4A 2I9PA 4R7GA 5KU1A 1M5RA 1H3EA 1BVUA 1PT6A 2DJIA 4LDJA 1JVSA 1DKOA 5ALHA 2ZUFA 2V7QD 3IOMA 1GNRA 2WJIA 5JY1A 1U0BB 3AVUA 4FHDA 2FK8A 3HP1A 1SJ9A 3ZXIA 3DE6X 1L1RA 2QORA 3ZZ0A 2YVKA 3KT6A 2JJ8A 1AUOA 2IHYA 4EUEA 1NIPA 2DPGA 1CB7A 1S3FA 2I4MA 3DR3A 3F3SA 5ALNA 4ZZ0A 4GYJA 3SC3A 2JFFA 2QTFA 4O4LA 3DLIA 5AM5A 4BO4A 4C21A 2Q6VA 1D7OA 13PKA 3PKZA 4L6CA 1HNXB 3IMEA 4IH9A 4Q7MB 3TINA 1YI0A 1G2PA 5IDVA 4XRGA 2YFYA 4WKNA 2Z9DA 3H5NA 1EUDA 1QO9A 2IS1A 1ND5A 4FFRA 1G3MA 4BN5A 3IUYA 5FLXA 1E1MA 2W6IA 1VECA 4Q6WA 3F6YA 3AONB 5CVUA 1BO6A 2AI3A 1LBTA 4IQ4A 4MO9A 3NTQA 4UZFA 3WGVA 5IK2D 5JXWA 2J9FA 3ZGVA 4WDRA 1ZNWA 4D3ZA 4TZ6A 2QN9A 3BIXA 2PUWA 3KPWA 2XOKD 5FHRA 3ZDEA 4P0QB 5CDYA 2CMFA 1ZCJA 4D82A 3TD9A 4G37A 1L6IA 1CUFA 5TLSA 3A7DA 4EMBA 3PPXA 4YFVA 1NLMA 2FW1A 4JODA 3CWCA 3NC1C 2OR3A 4OIMA 1Q14A 2O9JA 1KL7A 3PYXA 4XLZA 3BDVA 3AVTA 3R3WA 3PNVA 4LC1A 3AFNA 4LJ6A 1N4DA 4DDWA 1US8A 4PPFA 5KNCA 4ZOCA 5IKXA 2CUKA 1SRQA 3PWKA 5A3JA 2ZYRA 5KC8A 1NPYA 3VGJA 3M6UA 1LLQA 1RLOA 2JD1A 3P96A 4FKZA 4CIVA 1VLJA 4ZVTA 4KRFA 3OHSX 3DAPA 4JI5B 2WPDD 2PH1A 3L7LA 3W2TA 4AZ3A 2P5SA 1K3UB 1BMDA 1ZIDA 3GB9A 4H1TA 2C5GA 1DO0A 2J4CA 2Y92A 5G0SA 3KJQA 3AFGA 1VHWA 1T2NA 2CMGA 4OI0A 4Q66C 5JYCA 1B15A 2JJYA 1Z33A 1XMJA 3MVEA 4R1MA 3U3OA 4F2WA 3IXLA 2GQ0A 1XD8A 4KIFA 5A5DA 4ZCPA 2GO7A 5FV4A 2GX6A 2G1AA 3BTOA 1CDZA 4YT4A 4JP2A 5P21A 3V7YA 2PS9A 1WXEA 3CSUA 2M2IA 3KTFA 1GYQA 2Q5EA 2PNFA 3W8NA 1SCIA 4BO3A 4GDFA 5EERA 5L3RA 3EULA 1Z82A 3BGDA 3M6WA 2LNDA 1R0CA 5FO0A 2HF8A 3WAGA 2X9NA 4WOJA 4RSMA 5C5DA 3NGLA 4QOEA 2Q7DA 3VU9B 4D57A 3E8MA 3AVOA 2X9QA 1G5FA 1M0TA 4MAMA 3T4UA 3HBLA 3HB7A 3I01M 3NIFB 3TQCA 1NYRA 3ZWXA 2XRMA 4LRUA 5EP3A 2YV3A 4I5IA 1JXQA 1VIVA 1K3FA 2H1OA 2I7TA 5ECDA 5DBHX 3IQXA 1M67A 2WZQA 5TVKA 3SIXA 1IY9A 4AROA 1MF7A 1TF7A 4YI3A 1S8NA 2ZAIA 3M5DA 4IKEA 2M98A 3BRWA 4NBSA 4CN9A 3I9NA 2AJ8A 2OHHA 5B1SA 2FEPA 3AU8A 1VJDA 3I05A 4BMOB 7YASA 4Z9YA 4C0WA 3U6BA 1TUIA 3R44A 3QSYA 1SU7A 2AOUA 2SHKA 1T9GS 2RE8A 1B74A 3AMVA 2IW1A 2C5BA 2WT8A 4LPSA 1SC3A 5DHUA 3TAUA 4O4JF 2JGKA 2ABWA 2HDNB 3U4CA 3WDLA 4AJHA 1DC5A 2OBFA 2QTVA 1YCHA 1GYRA 1Z37A 1S2NA 3L7MA 5EJIA 5GV8A 3UA4A 4FCCA 1X19A 4J9VA 2WAOA 2RHLA 4MVJP 2E82A 4MITA 1AZLA 1CWUA 2Q0HA 4WESB 1GZVA 1RYDA 3THXA 2CVOA 5K99A 4PRYA 1K2VN 2X8JA 4YCJA 1E7QA 3NWBA 2FH5B 3UMRA 1ZVVA 2C3PA 2Q3HA 2FSVA 3H18A 1QHIA 2A4KA 3V48A 4TYPA 1X1BA 3DHWC 5A5FA 4B45A 2XDQB 1AA9A 2HIGA 3A6DA 4X20A 1ZD1A 3A6PC 2R6R1 2CJXA 4UPVA 4AC9A 1N2IA 3E5NA 4OJTA 3PNBA 4QUGA 3CLRD 5A04A 1N1GA 1XFAA 1XI2A 3E1GA 3HXMA 4U3JA 1SZCA 2XJ4A 2FX2A 4R2IA 4X6XA 2G83A 1Y8CA 2Z95A 1KIMA 3UHAA 4FNMA 5FCDA 1W46A 3VKWA 3OCWA 4AN4A 1GZ6A 2NIPA 2IEZA 4RVOA 1PAUA 2PUFA 2GBLC 2QBYA 3C1OA 2XYQA 1ESCA 4TV8F 4LISA 3AT1A 2LUOA 2X6RA 1DJMA 3KPYA 2PY6A 1KH1A 1ONBA 2ZSJA 4F3CA 3IXQA 1FXWA 2EX0A 4JJAA 5LQRA 2QR2A 2OBLA 3MPOA 2Q27A 1ORIA 3CRQA 3K6JA 3O83A 4FNAA 4RDCA 4RQTA 3RFXA 3IB3A 3GN2A 4RWEA 1RI5A 1GGVA 4IIGA 1DFIA 5IUKC 2VDKB 3ENNA 3TG8A 2O6LA 3AR3A 1I30A 4Z53A 1QCYA 5IKMA 3MT9A 2ODTX 3MT8A 4QPDA 2ZYVX 2W43A 2AXEA 2XEXA 4QBTA 3D64A 3FZYA 3BULA 1OVGA 4PYRA 2ZYIA 4YRKA 4I55F 3GGGA 2YCLA 3ZLUA 1BCSB 2ID9A 4PN7A 2PE5A 1S1CA 1VCNA 2PT5A 4KX5A 1FFDA 4LJYA 2RJOA 5JS7A 4Y1FA 1X86B 5FPHA 4PBSA 5D87A 3OEEA 821PA 1SD2A 2PGAA 2CWDA 4KXMA 1OBVA 1DMSA 2J3IA 4CF4A 2O5EA 3R41A 4D9MA 2IY9A 2PA0A 1C3JA 3DQQA 4R1UA 1JNYA 3FDFA 5BQPA 4JD5A 5C34B 1CS0B 2FPIB 1C5KA 1FFWA 3KJIA 4HFNA 1UJCA 4YUAA 2O0JA 4QDUA 3V4ZA 2V1UA 5LL6P 2H18A 2C61A 1DKNA 3V9PA 2I78A 1RYNA 3WQRA 1HQCA 1XA4A 1R64A 4KIUA 4X95A 4GXTA 2G07A 1UMDA 2EW8A 4EHHA 4LDAA 1OWLA 3EQ6A 1W96A 1N8NA 3JPYA 1SCAA 3QFRA 1PEYA 4TMVA 4C6RA 3QLUA 1S89A 1IZ7A 2CLKB 3INYA 3V1YA 2XOEA 2Q4OA 2FW0A 1R9GA 4NOKA 4O4LF 2E87A 4Q7EA 5CVVA 2WB4A 4UE6A 1OT5A 3EZYA 1GA6A 2NO7A 2DECA 4I50A 4JYZA 2QVCA 3CZ4A 2UKDA 2HADA 4OKIA 5B37A 3VDXA 3VZDA 2R7KA 3B78A 4XOIA 1RHRA 2IZOA 1VA5A 2PZFA 5LWQA 1UBFA 1HFJA 2CK3D 2VRCD 3ZY5A 2QENA 4DMRA 4Z3KA 5DM70 4ARZA 1IULA 2F43B 1I7DA 1KAMA 4FE3A 3NGXA 2JDIA 3B1ZA 4DLWA 4O4IB 2PKEA 2R9VA 3F7MA 5EAIA 1R8XA 3CEHA 1RM4A 2HDWA 1U0GA 4UTOA 1Z7GA 3PXEA 2VJCA 4O08A 1MG5A 3FYSA 4MR7A 3UIEA 2XNJA 5BO5A 3WYCA 5CVJA