2JCBA

The crystal structure of 5-formyl-tetrahydrofolate cycloligase from bacillus anthracis (ba4489)
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
194
structure length
194
Chain Sequence
HHHHHVREEKLRLRKQIIEHMNSLSKERYTTLSEQIVFSLYEQKEWAEAKTIGITLSMENEVNTYPIIEKAWKEGKRVVVPKCNKETRTMSFRQISNFDQLETVYMNLREPIPALTEEVNADEIDLQIVPGVAYTERGERIGYGGGYYDRYLVHYKGKTLSLAYSFQMVEHIPVEPFDKNVEKIITEKGTMVKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of 5-Formyltetrahydrofolate Cyclo-Ligase from Bacillus Anthracis (Ba4489).
pubmed doi rcsb
source organism Bacillus anthracis
molecule tags Ligase
molecule keywords 5-FORMYLTETRAHYDROFOLATE CYCLO-LIGASE FAMILY PROTEIN
total genus 63
structure length 194
sequence length 194
chains with identical sequence B
ec nomenclature ec 6.3.3.2: 5-formyltetrahydrofolate cyclo-ligase.
pdb deposition date 2006-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01812 5-FTHF_cyc-lig 5-formyltetrahydrofolate cyclo-ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10420 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NagB/RpiA/CoA transferase-like 2jcbA00
1U3GA 1U3FA 3HY4A 1WKCA 3HXTA 1SOUA 3HY3A 2JCBA 2G40A 1YDMA 3HY6A 1SBQA
chains in the Genus database with same CATH superfamily
2J3MA 3WDMA 4EK9A 4HB3A 1QJ4A 1SKYE 3LNTA 1THZA 5DLDA 4Q9JA 3ZW7A 3AU8A 2CD7A 2WDPA 3M9LA 3N8KA 4LJKA 4UQPA 4D79A 1K89A 4XLZA 1KNXA 1WV0A 4CT0A 2P30A 3RYHB 1W35A 5T3UA 1XKLA 3P9PA 2IGTA 2F00A 1PFQA 1WF3A 2HB6A 2HPAA 3EF3A 1W25A 4Q4JA 4ZV9A 2P27A 4DIDA 1ADYA 1P74A 4TTJA 4BYGA 5BPHA 2VAWA 3F6CA 1Y4UA 1XNGA 4TQUS 2FETA 4HRVA 5IAKA 2C29D 2J4DA 5I9MA 3UWKA 4QOJA 4KUHA 4BGVA 3A26A 3RS8A 3N7AA 3UJ6A 2QYOA 4KIWA 3ZH9B 4C03A 1O94C 4J9UE 5KDLA 1CXZA 1DKRA 3EDQA 2QKYA 3IMEA 1V1MA 4OHXA 4JH0A 4CF6A 3GLHB 4CL3A 5ALDA 4OU4A 5CA0B 3OUUA 1SELA 3LQQA 4DLYA 4I8DA 3TG2A 2MJLA 1QHIA 3ONEA 4URWR 5E9AA 3R6TA 1X86B 3EZYA 4QU0A 1H9CA 1Z6GA 1RYHA 4EMBA 3RSLA 5BSKA 3FBGA 1FLNA 2TECE 3K5WA 3QUBA 4MHOA 3FZNA 4YVFA 2GZ3A 3ENWA 5DYTA 3NP7A 1YZQA 3LO5A 3SIPA 5DV9A 4EVQA 4FFMA 1XMVA 3C6BA 3U7FB 3EIOA 3NBQA 1RI3A 4CUZA 1Z33A 1U7XA 2VHYA 2WYWA 5FFNA 1YK0A 3ADDA 2JA2A 3GLIB 2ZGVA 4PZEA 2AFRA 1WD7A 1S3IA 1MGOA 2O3TA 1XDUA 2OQ2A 4YP0A 5H70A 3AP3A 1CDEA 2DTXA 4XWWA 4RZUA 2FZKA 1Q7GA 1GDDA 5D7NA 2Q8NA 3L9WA 4BMNA 3O9VA 5DN6D 4BKPA 5K99A 1XK7A 3T95A 4G3XA 3DPSA 5CCDA 2IP2A 3O75A 1SUBA 4IQ8A 3L4BA 5F9HA 2VYFA 3CF2A 3V8EA 3ROTA 1YL7A 3FLAA 1C0IA 1CYDA 4JB8A 1I3CA 5ECDA 3SOZA 3WNZA 3BTVA 3IE0A 1COWD 1PD1A 3AILA 3CVWA 2VDKB 4HATA 4EQZA 3IKJA 1NTOA 2Y93A 2Z3WA 3ZNPA 4JXJA 5C80A 1S2OA 1M5UA 4G37A 4IFEA 2A9KA 3KOOA 3GGOA 4WL0A 3CVYA 4JYAB 1V11A 3GUUA 3ZIAA 4BAUA 1CB0A 1M1XB 2P79A 2VLIA 3LC2O 2ZRCA 2XWSA 3F98A 4MYHA 4YI5A 5E0OA 4WSOA 2OORA 3T4UA 1II8A 3T1TA 1C80A 3JD3A 3IE1A 3HWRA 1MPXA 4X94A 5KOYA 1L5HB 1L3CA 3K0BA 2IYEA 5FNVF 1NVAA 2HFKA 4ZOAA 2EGHA 4ESHA 1CLEA 1KRWA 3PQCA 3OTGA 4R8SA 1LWOA 1ONPA 3D6HA 3RH0A 3TIFA 1UJ4A 3GP8A 1K92A 4HLDA 5LA6F 5DLQC 1E6KA 1ZD9A 4GL4A 1J90A 2QW1A 1LJUA 2NSHA 2Q8QA 2ACVA 1S2IA 1PIWA 3BMOA 3LW7A 3IQXA 3OOHA 4XQCA 3WGUA 4QGAA 3J80A 2Y1KA 3FMOB 3JAKB 4WKBA 4Z7QB 2ODEA 3ZQKA 1DKMA 4EX6A 2GA8A 1PD0A 3MF4A 3R7NA 1TMOA 2IFTA 3LBHA 2B8NA 3TRFA 5AIBA 4H1TA 5J40A 3EGIA 1FPQA 4PG5A 4QTZA 4ALMA 5CIYA 4A2PA 4ZVKA 3TLJA 4OHFA 4LRUA 3GFSA 3WO0A 4FGZA 4FDAA 3H6HA 2JF0A 4FDMA 3TZEA 1B74A 4WVLA 1QGDA 5I9TA 4QT4A 3A6HA 1VL0A 1JYEA 4IILA 1BU8A 1LKZA 2WM3A 2XQVA 4NNJA 3S55A 3DE3X 4UBJA 4F97A 1W76A 4ZYTA 5GZ1A 1RMTA 3MJRA 3I6QA 1Q0TA 2X19A 3NUZA 4Q4AA 3VR6H 4EMUA 5B36A 1QDEA 1IMJA 4BNGA 4B6EA 3UK0A 3QBVA 1V26A 2WVAA 4YA6A 4DGSA 3DBHB 2G82A 1R0CA 2G4LA 4X1YA 5HM8A 4L57A 4PF1A 5LA6A 3SWWA 4DHWA 1O94A 1PU2A 5DYWA 3UC5A 5FBRB 4UPVA 3T3GA 2CZCA 4L0QA 3QUAA 3BF7A 3SZLA 4DMGA 1XNJA 2GUGA 3IHTA 1QANA 2NPFA 1W75A 2H7VA 1GCIA 2GLTA 4X9XA 1YHNA 4DEYA 1R6BX 2P6RA 1C7RA 5CIQA 1GTSA 4EH1A 1D2AA 2H65A 1Y5RA 2A3NA 3VPDA 1W47A 1NXVA 2ORWA 3FPHA 1MORA 2PPVA 4RKWA 4FYIA 3OM0A 2EKQA 4R1TA 1H9BA 1G8JA 1ZN9A 3AUYA 1RM0A 4TXHA 3M6UA 1XHEA 1W0KA 4M49A 2HF8A 2C9BA 2QRNA 1UXIA 1DAPA 1J99A 2CCKA 3G2NA 1XZCA 4JVMA 5ICEA 2HHAA 1K68A 3L84A 4IZOA 4AJKA 2IHTA 4FZVA 1KBOA 2PUHA 4D98A 2XMQA 2YOFA 2Q0SA 5DHFA 4AIRA 3T9FA 4CLXA 5BN5B 2JG3A 4TZ6A 1KXZA 2GK6A 2XVMA 2JPDA 3HUFA 4DLKA 1H4SA 1KR2A 1F9AA 4Z7OB 1YIAA 1SOMA 2B98A 1UFVA 4QELA 1FDUA 4LYHA 1HE4A 1L5FA 2DWPA 4YAOA 4LV5B 1U2DA 3T1QA 1HMPA 4O4IF 5T64A 2B7LA 2ZUFA 1XBTA 3BICA 1ADGA 3LLUA 4KXNA 4C7XA 1Q1ZA 2F8MA 2ISQA 3QWIA 1PFUA 4OHUA 4S1WA 1NQAO 2B83A 1XDWA 1VIAA 5IJAA 1W93A 2VN8A 4RK4A 1KSHA 1P7PA 5EJ9A 3V7NA 1CJCA 4FCVA 1GCGA 3U0VA 2BUCA 2WLTA 5HGJA 1E7YA 4H6WA 3C6XA 4X20A 1P39A 3GYBA 1EFTA 2FWIA 4MPRA 3LP6A 4D6YA 3HVKA 2BSQA 1CR4A 4D97A 2W2NA 2XB4A 1AKVA 5ALKA 1NV8A 5AD1A 1L5YA 3BRQA 4YRCA 4AG6A 3C6MA 1G64A 1WLSA 4FQ5A 1SC9A 3IAM6 3QKSB 5B7QA 2BHRA 1RRKA 2FN9A 2VOEA 5KC8A 3O8QB 4P33A 1U6IA 1KKMA 1K4YA 4Q7LA 2VR1A 1UBLS 1UMDA 3MQ4A 3M6IA 3TINA 2D1SA 3W7AA 1NM5A 4EGSA 1B3RA 1F0NA 2G4CA 3FI0A 1EH5A 4CDNA 2G1PA 4V39A 3DTYA 4OI4A 4Z4EA 1J2EA 2WA2A 3OIDA 5C7OO 1C3OA 1G5RA 2CHFA 1G7TA 4W5WA 5AUNB 1VE9A 3L6DA 3FN4A 1AV7A 3JQ9C 3CLSC 3QWHA 3IV6A 3JQ9A 2WR8A 4JQZA 4QYTA 3W3AD 4NY1A 1MT0A 5A7GA 2ZWOA 3ZHYA 4K28A 3F46A 2FZ4A 3HN2A 5L4LA 5G4LA 2DXIA 4D02A 1PTJA 4HZUB 1OLOA 4J7AA 4YJ3A 1OXVA 3WHLA 4F7DA 1YRYE 2O8DB 2FLWA 2LD4A 4CNBA 3E22B 4LXXA 1DAEA 4GL2A 1W94A 2IXBA 4XDYA 5CCXA 2GF9A 2HRZA 3DQPA 3KKMA 4DOMA 1I01A 5SY4A 3HP4A 2RBGA 5AK5A 2PM8A 5BUZA 1ZX1A 2M6KA 3UT5B 2B1QA 1NDHA 1YA4A 2DECA 2FI1A 1R5NA 3KVOA 4U2BA 4D9FA 3ZVNA 3UUGA 4B3GA 3PEWA 3P4XA 3AVVA 1DG9A 1Y63A 2J0VA 3DGEC 5DF1A 2PL5A 1DAGA 1GNVA 1KA9H 2C2KA 3WI7A 5LMZA 5BW6B 4IXDA 3WHPA 3FFTA 5FBQB 3KTAA 5LBIA 4P5DA 1CRQA 3T0FA 4DB2A 4TRRA 1YGPA 1Q2UA 3OLZA 2WSYB 3AVYA 1AS0A 1VZ2A 5KNCD 2CKMA 1BHQ1 5G4KB 4BTLA 4W5NA 4JGBA 2BP7A 3V33A 4NNOA 2VWPA 3NGMA 1C3JA 4C0WA 2OQRA 3EW9A 1PNRA 2AC2A 2XEDA 1XZEA 4K9RA 1E9FA 3PPIA 4QYMA 1F7UA 4KBYA 3DL0A 3SX2A 4UASA 4BBPA 5G40A 2Z6VA 2WWVD 1G8GA 4N8DA 4EBFA 5DGIA 2IHVA 5AJZA 4ALKA 5KVCA 3H0CA 3LPCA 2NM0A 4EHJA 4GGPA 2C7QA 2I4IA 2ZB7A 2ZSBA 3N2IA 4J2OA 4P4SB 4Q82A 5C51B 5CA0A 4F06A 4TQGA 1QIGA 2RGXA 1MXHA 3KV3O 3DL2A 2QUIA 4G0QA 1H05A 2QOEA 2VP0A 4BO9A 1SNYA 1GRNA 3MBIA 3VSDA 4AF6A 2OXTA 3DQZA 3T8YA 1BQEA 2OLJA 2CNWD 3R9WA 1D2GA 3K5HA 2XOKA 4TV8F 5A4MS 1XRJA 4QM6A 3G9ZA 1U2GC 2AE2A 2PMCA 3GZJA 4OM8A 4BX8A 3PJFA 3FR8A 3MFYA 1Q44A 3NHYA 2PL3A 1BO6A 4BV2A 1R9GA 3GXBA 4L4XA 4WCFA 3JV7A 4RACA 1O95A 2YCBA 3TW6A 4WLNA 2BEJA 3KBBA 3RYHA 3FOEC 3QE9Y 1DSSG 2QR3A 3D4PA 3M70A 5CT5A 5CVTA 5EIBD 1X6VA 2IY7A 5EEHA 1A71A 2B1IA 2I4MA 3JYNA 4MIEA 1OGIA 1GM5A 4FN5A 2J41A 3ECAA 4RGQA 5A0VA 4EG3A 3TPZA 1XIVA 2ZFUA 2ZXFA 4O4JF 4R8RA 1AN0A 4C7BA 3K1AB 5KNDH 3HCBA 2B20A 2YVUA 3HKEA 4NEQA 1F3OA 4HDQB 4ZRNA 1DCKA 1YVUA 4N18A 4U6NA 2F55A 2BFMA 3NBFA 7ADHA 4YWHA 1UDCA 1YNSA 4HBZA 1YCHA 5FT9A 2NYAA 3CUSA 3ICVA 3IUNA 3K9LA 4ZCPA 1QYIA 2D7CA 3IAS6 3M6LA 3TFWA 3JD4A 3UPDA 4D9HA 2CE7A 4Z9XA 4HLUC 3RVJA 4D1YA 1TEVA 1NBMA 4ZK2A 3QEMB 1SCNE 1Z4MA 2P6MA 3KKNA 4QUGA 5ITWA 1T5SA 1OBFO 4WOPA 4YCSA 2B8TA 2VHWA 2J67A 2O20A 3ECCA 4JJ7A 1IIRA 2O2IA 3OM1A 2D5AA 3DUFA 4XIFA 2VCEA 1JJVA 4EUHA 2VQEB 1GWNA 5C1PA 4U7FA 1FA9A 4YALA 4D80A 3DULA 4HN9A 1BC5A 1TB4A 4GNKA 2GCGA 1EB8A 3QPDA 4ZO7A 4UMEA 4DNFA 3IEUA 5M7EA 1EVJA 4UOQA 2PMEA 1ISFA 1D7OA 1XXHB 4W82A 4C5CA 3AL3A 1C4XA 4FFWA 1FUYB 3LQRA 1UMBB 3O84A 4GBGA 5HRCA 1NP7A 5AI8A 3QZUA 4CU5A 1XPUA 1KZ9A 4FYHA 1YOVA 1NW5A 2H4ZA 2KB0A 2C82A 2XNSA 1ZI9A 3A9TA 1HNNA 1U2SA 3AL2A 4MWSA 4V0QA 5L53A 2CSXA 1IWPB 3HJAA 2PH1A 4OBEA 2XB6A 5L7YA 3U7QB 4F72A 2XZDA 1F6WA 2P9JA 1I3OA 1NXWA 2N0SA 3EUEA 1GTMA 2C2GA 3ITEA 1QQAA 3SVTA 4YASA 1YBAA 2YL2A 4RY2A 13PKA 1HY3A 4MUAA 5IVDA 3GL9A 1Q0SA 1IEWA 1ZLYA 3FDZA 3KHKA 3OEED 4B71A 5MF6A 2EU8A 4H08A 4X7PA 3AHEA 2A0FA 3KQOA 4NZMA 2RMKA 3JYHA 1GRVA 5E9QA 3IFSA 4QPJC 3OHPA 1YI1A 2X8BA 3A31A 3EPPA 4KJZA 5ER9A 3TXXA 1EWYA 1R7RA 1R4AA 1OXMA 2ZR0A 3CB4A 3F5DA 3GC6A 1NLZA 5JCJA 4DIUA 2G9QA 2QN9A 3TK1A 2QLFA 4BMOB 3AJDA 1TQ6A 1Z5PA 3F3SA 3GROA 3QWFA 4PAQA 1FDWA 2Q9CA 4AJIA 2C2BA 4WNYA 1YR9A 4HRXA 5JDIA 2KM1A 3D8TA 2A6PA 4Q48A 5CLHA 4W6ZA 3LZ6A 1G9XA 5JSFA 4LBVA 3L0DA 5KKCA 4LXHA 5AI9A 4URXR 4XFDA 2HBQA 5AJWA 2QS9A 4BEBA 1YE3A 3S7TA 2YICA 1QYRA 2NXJA 4A8PA 1ESMA 3NHZA 3CT4A 2JK0A 1X8JA 1J7KA 4M7OA 2G9ZA 4IH9A 4U7GA 1RP7A 2F8SA 4QYWA 3RNLA 5CXUA 2Y99A 2OD7A 4YRJA 4DLTA 2WM9B 3L49A 4BMDA 4Y6SA 3CX3A 3GUHA 2AGVA 3AUJB 2Q4DA 3AM4A 3OQNA 1QM5A 4DZRA 2CZQA 2BM0A 3KSAC 1ISIA 2P4QA 3FIJA 5I8PA 3GJ0A 2JH8A 2XGSA 3KQMA 1RSZA 3QG1A 1ZUNB 3LECA 5J4KA 2EWWA 1OXBB 2J3EA 4GM1A 4W1RA 1PK7A 1LI4A 2AN1A 4RDHA 5KSWB 5DMXA 3PUIA 3RUEA 2HSDA 3AZQA 1BEZA 2B61A 5DW0A 5IC4A 5JU6A 1TCVA 3NHWA 2ZLBA 3MJDA 3PQEA 1HT1E 3TSOA 4GM4A 2ZUSA 2D5IA 4X7BA 4L5CA 3VTZA 4DEVA 2O3QA 2FE1A 3INRA 3L0ZA 2P4EA 5JVDB 2FQ1A 2NZXA 2ZSUA 4XDZA 4XSGA 5GMOA 2B2NA 4L6AA 5DHPA 2PNJA 4E6EA 3OCWA 1VIVA 4KQ6A 4EMSA 3FNIA 1A9TA 1IATA 1JHXA 3TEMA 2VA9A 3I30X 1H4QA 3HDVA 1XVIA 2VC2B 4BP3A 2WUEA 2BFEB 2YQ5A 3ETNA 2RH8A 5F77A 4Q00A 1JFTA 1QGUB 4Q3NA 5DTRA 1RXVA 2I2DA 3P8ZA 1YBHA 3PPXA 4YCJA 2ZI9A 1O94D 4YXWA 3PQ6A 2D0DA 5K03A 2PKEA 3WIUA 4Y9SA 4QWMA 3ENVA 1CDDA 3U37A 1Z37A 2HIGA 1FZQA 5FQNA 1D4OA 3NYRA 5BNFA 3N2KA 2E4ZA 1SPBS 1XCJA 2JI7A 1FMTA 3H2KA 1BDMA 1XTJA 2ZB4A 5C5CA 2Y4NA 3QHAA 1N2CB 3OZCA 3DZHA 4C6SA 2VTBB 4RFSA 4TS4A 1RLUA 4BTEA 2JKZA 2P7HA 1LTQA 3L8ZA 4RLSA 3R0ZA 4HS4A 5KOJB 3C3JA 5ISMA 2JFVA 1CF9A 3NDBB 2WJHA 2R85A 2CYAA 2VZLA 3DM5A 3NO4A 3ZHBA 4P3PA 4K2HA 4CKCB 2PZMA 1MO6A 4RHTA 1PVVA 3GCXA 3KWJA 3ANNA 3B5JA 2OCBA 2FWJA 1DUVG 1OQAA 2DFPA 1LDBA 2HXGA 1NX6A 1K75A 1TAHA 2IY9A 1V3VA 5AK3A 1WMAA 2UVDA 2XZPA 3IBTA 4FYJA 4BGEA 2QXYA 3WV4A 2IEAA 4TKMA 3SLKA 1BWPA 5E7JA 1T4CB 2LKCA 2WNIA 3OTHA 5E4FA 3W5AA 2JD0A 2WTAA 3IQEA 1R0WA 2XB2A 2Z2KA 1XR3A 2PZKA 2GD6A 1T24A 3CFYA 3L8YA 4PHGA 1G6HA 2IXGA 4HOYA 2IPOA 4XVHA 4KXFB 1GXSB 4X00A 3DNPA 3B2EA 4JBXA 4AS2A 2O2EA 1VPDA 2J85A 1ML3A 2CLIB 4PFJA 4NWIA 3L3BA 5FWYA 3CVXA 3SZUA 3OJEA 1JZTA 4QSHA 5J2UA 5B3JC 3G9QA 5CTJA 1O6BA 2PMWB 3CLTC 2V9CA 3PGJA 5A4AA 4YP5A 2NQTA 1DX4A 2IOHA 1WEHA 3SSAA 3H83A 2FJUA 3ZY3A 3T7TA 2H07A 1UMCA 1Z5ZA 1N5DA 4AVYA 1XXHE 2C92A 2ZRFA 4PHTA 4B6OA 4QHTA 4CMCA 4CIWA 3QVXA 3UFXB 1Z16A 2FZEA 3CRZA 2CXOA 1VLHA 3HDGA 4LJ7A 3ZZ1A 5FBWB 3EGCA 4BYMA 4W9NC 3W8DA 3I6BA 2PANA 2QUZA 1ID1A 5A9SB 1X14A 1A9XB 4Z51A 1TF2A 1DWOA 2EKPA 4J75A 3H9GA 1JHOA 3R40A 2WHXA 5TS3A 5HBRA 2GM4A 1UOEA 1Z7YA 3K20A 1GXSA 4LX8A 2CMKA 2YIJA 1N34B 1U3GA 1U3DA 2FJ0A 2Y1CA 1FVXA 2EVWX 3CPEA 1DELA 1UK8A 2XB9A 1VMKA 4N3AA 4LCEA 3ROGA 1YFLA 2NX2A 4MLPA 2B6HA 2XHEA 3A9UA 3B6IA 3FW1A 4RL4A 3DB1A 5T3YA 4K0KB 3W05A 2C95A 4U2CA 2GBIA 5IS2A 5FJJA 4Z6KA 3DE0X 4PZPA 4R3UC 1B8VA 3NETA 2L42A 2EBHX 2JFGA 2XRMA 5DSXA 5M29A 1VSUA 4X8HA 2QMHA 1HGXA 1KXJA 3P0RA 4U4AA 2UU9B 1UBHS 1BN6A 3Q0EA 1TW3A 2OHGA 5B1YA 2JGDB 2AJDA 2ZYDA 3HP1A 3MC1A 1M75A 3L6OO 4HL6A 1L4UA 3AF1A 3K9BA 3ZK9A 1N5LA 2GEBA 3I6IA 3L8FA 1O8BA 2B4KA 3ZZUA 1B6SA 3I01A 3GMSA 4YPOA 3AFHA 1J8YF 3DAGA 4BFZA 1N6HA 1WXEA 2YXLA 3OQHA 4JP5A 2YJZA 4JUDX 4LKOA 4P35A 1GNQA 3OKAA 4RJJA 2D4AA 3AZOA 4L50A 1G8FA 2DMRA 5JRJA 4M0PA 4FFBB 3AOGA 1U2ZA 1X1TA 4L1KA 5LVAA 3OUTA 1MMFB 4B4KA 2CXXA 2PK3A 4YP1A 1E9DA 2D1TA 3G7NA 4U3JA 3CSSA 4R1QA 5CTAA 3ZE6A 3B85A 3KG2A 3PBKA 1J0EA 2PBRA 5LMNB 1II9A 1ZLXA 5JSQA 2AXPA 1EA7A 2QTVB 4GECA 1WMBA 3CEMA 4BL5A 4GP7A 3ZN2A 4DSAA 2DH5A 4XPIB 2QMZA 1L4GA 4C6TB 4BQIA 1SQSA 4ZZ2A 3MM4A 3L4EA 4HXFB 1ZGZA 4NARA 1RQ2A 5AJVB 2A5YB 4QXMA 4P7KA 1C1XB 3FZGA 1HFWA 3EXG2 3W7VA 1MJNA 4AG5A 2AEEA 1AQYA 3EIFA 1U5AA 4KE6A 1FSSA 4L6CA 3BL5A 1FX0A 2NGRA 1CZKA 2QLBA 4XQ0A 1P2FA 2B21A 1GT6A 1Y3HA 4W8GA 5ADHA 3TZQA 3FE2A 2I6XA 3IRVA 2AFHE 3AG5A 3GIWA 5T57A 4CMEA 1T2EA 1U8ZA 3ESBA 2R9VA 2VTVA 3EY4A 4GYKA 4B1FA 2GN1A 3WWYA 4W99A 2YXPX 2JFYA 4V2IA 3U7QA 2BRUC 2NV0A 1P61B 3EEFA 3I52A 4E5SA 5LP6A 1KGSA 3N0VA 2O50A 4DA4A 3TNDA 2VBFA 4NDAA 4P32A 1G21B 1F3LA 1QKIA 5H81A 1DHTA 4XWGA 1U9ZA 1RXCA 2ZS8A 3QWAA 1SHUX 5LDDC 4Y2SA 4CXMA 5LQNA 3ZXYA 1FFHA 4GG1A 3RR2A 2GOYA 1J2UA 2JBWA 5HF8A 1DLIA 1NFRA 4L8GA 3V80A 1RRMA 4LZPA 2FFRA 2IYZA 1UADA 2ANBA 3DBOB 2DHCA 2W6IA 4YROA 1I9CA 2JK1A 2AR9A 5DYGA 1FP4B 3M1LA 3UWPA 4CYMA 4E22A 3SDBA 2O7SA 5I7FA 1AY0A 2NW6A 1RR6A 4EHFA 4KRYA 3GEBA 2C3OA 3ITDA 3ZWKA 4JLMA 3SG0A 3HO1A 1FDVA 2QJFA 3V7UA 1S96A 4AYTA 4YMHA 4C1BA 2QL7A 4LSMA 1M76A 3CUTA 1KQNA 2C20A 3CKMA 4F38A 2V7VA 1VTKA 1CR1A 4BFWA 3I2KA 1UPUA 2EWVA 3RROA 1L8OA 1FW8A 2OXFA 1SCDA 4RGYA 1GGKA 1HYQA 4BZQA 5AW6A 4Q3CA 3HG7A 3LL7A 1R18A 2WABA 5JC1A 3QYJA 4FX2A 3JQGB 3H5OA 5ALMA 1CUJA 3G7SA 5DP2A 4ER3A 4LZLA 3LVQE 1EVZA 5TR9A 3AUSA 5GWXA 3MCVA 3NH6A 1ZPDA 4JK3A 3EFBA 2B94A 2DVMA 5HQ3A 1O0CA 4EUKA 1MOSA 3ZCQA 2P4SA 2O8DA 4N03A 3SC4A 4MB0A 3AIMA 4URHA 1WJGA 1FLDA 4Y2QA 2I1QA 1Q77A 4H17A 4DIFA 1K3TA 4PLYA 3D7KA 3O9ZA 1Z88A 3EVBA 3EUWA 3TBKA 1OMOA 1UC9A 1W5EA 4MMYB 3ST7A 3UB2A 3D02A 1L7QA 1H2WA 5A4IS 2Q1TA 1F6DA 1NHGA 1NOIA 1Q0ZA 3SHOA 5DM60 5KHOC 4WH0A 4RPHA 3MSCA 2J4FA 1OGYA 3ITNA 5DVZA 3CA8A 5TMDA 4HAWA 4NESA 1GZ5A 3FCUB 2A78A 2E21A 3JWJA 3L0IB 2WJZB 3DWGA 1JS1X 3BE6A 3C4QA 2CK3D 5DE3A 3UG6A 1BMFD 2XSZD 3PFFA 2HU2A 2CB9A 4Y67A 5TEVA 4WAUA 1WUTA 1XP8A 2X4LA 3BK1A 3H2SA 1L5KA 4C08A 2GAJA 4OQMA 4UEOA 4R71A 2MYNA 2SBTA 4YXWD 2QRJA 4G56A 3RYCB 4XB1A 2O8BB 4ZQFA 2PUJA 1QGZA 3EEYA 5L7WA 2WT9A 2NYRA 1SU6A 1G20B 2XECA 1SHLA 4UCFA 4ZANA 4R05A 3S28A 3V46A 3WGJA 4D5EA 3WMXA 3MK31 3R4CA 3ZDDA 2VDUE 3ENKA 4FUTA 4TTSA 3IVAA 3A27A 2FNAA 3OOSA 5B58T 8AT1A 4M2LA 1HEIA 8LDHA 1PWXA 5AVTA 1KQOA 5L3ZA 5HA5A 4JGIA 1DIBA 3HNOA 3HY3A 4Q3KA 1A5BB 2AFHA 1RKXA 3LYAA 1OZGA 3BMQB 5F1PA 2C3YA 5AXBA 4R3NA 1RACA 3RUAA 3ME5A 5IK2A 2NP7A 1N2OA 3AUTA 3UMRA 1OWMA 1KYXA 1X3SA 1Q0PA 1ZA1A 3BJZA 3MINA 3OA0A 2WSMA 4M21A 2VJBA 4XPZA 4Y1FA 5FR1A 3LH5A 4YMSA 5FL3A 4HNGA 3JD2A 4QPPA 1I7LA 1ABFA 4GSKA 4RVOA 4UD2A 5GONA 2IUUA 3DFUA 4AWAA 4BGDA 1ZKDA 1NI4A 3K71B 1XZDA 2I1LA 3HXLA 3BWBA 3I4FA 2J9GA 1G5TA 2Y9PB 3SLRA 4XCQA 4F9FA 4ZYWA 4NMMA 2QP4A 5UKDA 1TDJA 2H48A 1C4OA 2QT1A 2V8OA 1ISHA 1ODSA 2OO3A 3WFIA 3V8RA 2NAPA 1AF7A 4RCVA 3U4HA 4OLBA 3VDXA 4BNVA 3ZU6A 4ZAZA 3KB6A 5J5AA 3SJBA 4GOKA 1U0SY 5DB4A 3VPFA 4XQEA 3EMBA 4DR2B 1JXAA 2WMYA 3UJDA 3SHTA 5LNK6 3BDVA 1RFGE 1RZUA 4ND5A 5CB4A 3FWNA 1G1AA 1ACMA 1QC5A 1UJBA 2OZEA 3R3JA 4JLUA 3BRCA 1O3YA 1R12A 1XTVA 4M9QA 3GJSA 3WXMA 4YYZA 5CBPA 4Z3OA 3DDUA 2P6UA 2P3SA 3L5KA 3QU2A 4J2HA 3TNFA 1VQ1A 1RHRA 1AT1A 2P2ZA 5AQ1A 5CA1F 4QLAA 2GXQA 4GP6A 1RIFA 1JG2A 1LLDA 2EFEB 4O4LA 3PPVA 3IVRA 2H2WA 4FBMA 4ZJYA 1L0BA 4HC4A 2W37A 5H3LA 1WY5A 4PQRA 4CTJA 1ZJ4A 2ORYA 2YWJA 4RIEA 1C8LA 1VMIA 3RTGA 2CV1A 3RIYA 3TQCA 1A4RA 1RXYA 1E3SA 2WE8A 1IHPA 1ACJA 1AIPA 1Q21A 1IUNA 1U9IC 4KV9A 4Q3AA 4IMPA 4ECEA 1E2EA 4NBUA 4OMFG 4KITB 2K87A 1L4HA 3R9XB 3OZIA 2WWXA 2AHRA 4W5TA 2PXCA 3HJBA 2RGRA 1E5DA 1S01A 1MQSA 3AERB 2OHJA 1W4BA 1DOZA 1E4EB 2FMXA 4G65A 4JA2A 4ML3A 4XFJA 4CG2A 1N75A 3NBMA 2NO6A 3ZWOA 4B4UA 2DPMA 2LBPA 4CG3A 1D1PA 3FSRA 5CIWA 1KJJA 1A1VA 3L8MA 4A1FA 1BVHA 1GYRA 4QNNA 3AR8A 5ESWA 2IHZA 1JKFA 4XVUA 5AVVA 2XDQA 1H69A 2AJLI 4HVLA 5J4LA 5KJCA 4JV5B 3BZUA 1KI2A 1AOXA 1KZHA 3Q0TA 3TLYA 2XIJA 3NVAA 2GDJA 3C41J 3HR4A 3OTWA 1YS4A 1N7JA 2BCEA 4U7JA 3JQ7B 4W1SA 3P71T 3TL6A 5F76A 1DZIA 2QSZA 4BJ5A 5L7TA 2RHGB 4JA0A 3O7MA 1JHZA 1QAOA 4HYTA 3PGVA 4JLBA 2A4KA 2FKNA 2PKYX 2FFJA 5I7RA 3W79A 3TW8B 1V9SA 4JCCA 3PT5A 4DIBA 4DMMA 5IWCA 2JFWA 3IKMB 5FUVA 4DLAA 3EDRA 4HSGA 5KX5B 1GQRA 2P5SA 4PEVA 3CTMA 1H2BA 3Q3EA 2EJTA 2YJ6A 4OB6A 4WN9B 4UOEA 5BQFA 4KR7A 4ZKEA 3ZK7A 2YR0A 2PX8A 5EI5A 5J43A 4OQQA 3O94A 2F4VB 1BDBA 3LKVA 3N87A 4M87A 5EUQB 2HY7A 4JLKA 2DBYA 3ND9A 9LDBA 3ABSB 4KN8A 1GEGA 1UJ5A 4KNYA 2L69A 2PSHA 3I5AA 2YS6A 4WQMA 2JIMA 2WIKA 2O2XA 3CJTA 3GP3A 3GVHA 3OZWA 1K63A 2EYUA 2XVXA 1P1RA 3OKPA 1NA5A 4ZZ1A 3OI7A 4XE5A 4DRYA 1XCGB 4E2WA 3THYA 1B6RA 4R1MA 1OZAA 5LOVB 2OG1A 4R2KA 5K2MA 2D7JA 4MVJP 1U4OA 2Z5GA 2OCYC 3CC8A 2HSWA 3G5LA 2BIFA 4PV7A 3O95A 3KJHA 2XWPA 3GP5A 4A0QA 2QA5A 2CMGA 3AINA 3R7FA 4BC1A 1DPFA 3V1NA 4JBGA 1RBMA 1T3ZA 4XVRA 2FN3A 1JWBB 3KVYA 5AK6A 4BLPA 1Z25A 5IVHA 3TLBA 1IB0A 1CQJB 4D7AA 3EVEA 4Y1GA 2QRGA 2C04A 2B78A 2FW9A 2DPHA 3CRMA 1LZKA 3MBOA 1N1GA 2GRUA 3UAVA 2NQ2C 3WK4A 4DW8A 2FYTA 1B93A 3U7HB 3ZH2A 2QEQA 2A1TS 2GAIA 2XOKD 3UGTA 4BLOA 2B7CA 1W36D 1L9KA 2FK8A 1CUSA 4ZAWA 5A4JA 5MN6A 4C4RA 3UB3A 1DU4A 1X1BA 1LX7A 2ASEA 4HAXA 4PYLA 3VAZA 4DIKA 2BBTA 1K6XA 3W8EA 5KNDA 1VI6A 4BXOA 1B14A 4X7MA 1E7SA 2Q99A 4PE5B 5SZIA 4CM1A 2UAGA 1KMIY 1ICIA 2KE5A 3LG2A 3ZI0A 2WJYA 1E2FA 2NO4A 4XEHA 5DO9A 3JTMA 1TO6A 3VC2A 2ONCA 4KODA 1A8HA 4DWVA 4FNGA 1HLFA 1P19A 2FN7A 3A05A 3K5IA 1OVGA 2Q3MA 4IIEA 4BBAA 2G80A 4O33A 4P5PA 2HMAA 2O3UA 2FY8A 3KPJA 3EG9B 4O2RA 2VZ0A 4MKRA 4J0KA 3AR7A 1AKNA 4BLSA 1IZ8A 2ZJ3A 2J0EA 2FV8A 3ASZA 3RSZA 4WZBA 3I4CA 2QZJA 4AZ3B 4LEIA 4I4TB 3LD9A 4BNUA 2C8KA 2EKZA 4QE3A 4WXRA 1E6EA 4JR2A 2C2HA 2R00C 2Y0CA 1AB6A 1DP4A 1VG1A 3BIXA 4GOJA 4Y9RA 3ZDQA 3E3NA 3WQSB 4NJOA 5FUXA 3JQ6A 1QRSA 1T5IA 3Q7SA 1E6MA 1GP2A 1NAIA 2RK3A 1EM8A 3TZKA 1RYFA 2X1LA 2D74A 4RQBA 3FUXA 1E3LA 1XU4A 3V8BA 5C46F 2HLDD 3HYSA 3VDRA 5AVUA 2PJDA 3RSFA 2A59A 3E5NA 1I36A 2NUAA 3VOBA 1W9HA 3A1FA 3G1TA 2OR3A 4CKCA 1NRIA 3A2MA 1QX4A 1XZJA 1JMVA 4DCCA 2GBFA 5KYUB 1E58A 1OLSA 5JZ9A 2FG5A 4Q15A 3FTPA 4G24A 1ZNXA 2HSJA 5DBGA 5LP6C 3RIGA 3I83A 4F84A 5JY1A 1XXHA 3H9EO 2WJAA 1WUKS 3LVRE 5TDHA 1GPAA 2CVQA 1RKVA 3PJEA 1USKA 2P6NA 3BS4A 3ESYA 2NO5A 3VR3A 1XF9A 1J5EB 3WGNA 1GGEA 2W98A 1CUCA 5F7ZA 3IAXA 5BWMA 5F98A 2C9CA 2C84A 2ZI4A 1VGRA 3OFKA 3B1XA 4JLJA 2DPYA 1O6GA 4RIIA 3VYWA 4YRSA 2NSLA 3T5AA 4ZI7A 1AGYA 5FJIA 5KQGA 2GBLA 5FUBA 3AKEA 4XDGA 2B6NA 5EXDA 1SC3A 2JLZA 3PX2A 2WU4A 3WL8A 1GJRA 2ZT7A 3F6BX 5CFMA 1HZZC 1Z8HA 4EB3A 1B1AA 3I09A 4ZZ0A 2A9PA 3EF1A 4RVGA 3V8PA 3G2PA 1GA1A 4HH3C 3PT9A 1IG0A 4EARA 1ZFNA 5EN4A 3ONVA 4S1PA 3HVJA 721PA 2HNAA 2GPBA 1T4MA 4U0JA 4U7DA 5CUQA 1UEXC 4C4SA 1M1ZA 4U2GA 3G02A 1F2VA 1IB6A 2RIRA 1ICEA 4PXAA 4L5IA 4E70A 2GN9A 1T4DA 1V3UA 3ZR4B 2HBRA 2HJ9A 4TSKA 5DNAA 4ZT6A 3DLHA 2OILA 2YHBA 3VZPA 3R8XA 4CWAA 2R7KA 1QZZA 3PVCA 4B5KA 5B4TA 3SFTA 4MLZA 3ZOKA 4DBLC 1ND5A 3Q88A 3LRPA 1F60A 2QN7A 5EXPA 2P2NA 3T5BA 2WB2A 1MG0A 4Y98A 3RTEA 2ZRMA 2YZ2A 2BGKA 3TOZA 1CG6A 2RB4A 5EJ5A 2J08A 1JEQB 1JVNA 3K1JA 5I5EA 3GLIE 1J0AA 2ZQ5A 1ZHFA 1ADBA 2JLCA 3COSA 3QOWA 2HJRA 5EY5B 4DR4B 1JHPA 2IA5A 3RAEC 1FSZA 1YL6A 1SK9A 4UMVA 1UZNA 1GD1O 1SCUB 2FPKA 5FOWA 5BR4A 2P7IA 4QHYA 2BGNA 2CV2A 1WPRA 3NTLA 2WT4A 3CR7A 5BSFA 1XO1A 5K3SA 4F1KA 2GVZC 1M8JA 1WKBA 3H2YA 4IRUB 4PNZA 4FFPA 4DWWA 4E6PA 2IIQA 3MWFA 1VB5A 2YBDA 4RIHA 4GICA 1FP4A 2H16A 4NEGA 1CX9B 1O4WA 2B3DA 2R79A 5LU9A 4LJ4A 2ZRAA 4CDMA 2XWQA 2CUTA 1KZ6A 4NV3A 2QAIA 5EMLA 4BATA 3AVUA 2CNNA 3AYZB 2R8XA 1EDBA 3F71A 4PRYA 1PZHA 4A2CA 4B6FA 1P29A 1RKBA 1CR6A 1CQXA 1UT5A 3FMGA 2OFOA 4WLUA 3WP1B 3SEQA 5JZVA 1G20A 4XWYA 3TRKA 3VZCA 5LQKA 4YJFA 5JG7A 5LQUA 1VL6A 4NE7A 3LX5A 2A5GA 4CE6A 2X6QA 2A88A 3H2IA 3IIEA 4KVAA 1F51E 3LV8A 2KWIA 5I4CA 4UEQA 2DBVO 1SOWA 4ZAXA 4TUYB 3ITKA 1Z36A 1RWQA 3FY4A 3KXPA 4DDHA 4PU0A 4LV8B 4TZKA 5IM4A 3NJ8A 4EHHA 4IIHA 1P2BA 2JA1A 1RWOA 3BMOB 4J7UA 4EFMA 2W42A 1W87A 4ND2A 2C4VA 3ZXUB 1CY0A 3AEYA 4J49A 1IN1A 1F14A 5IDVA 1EHIA 2R25B 2ODBA 5EQFA 5A3SA 2GX6A 2HRRA 4YMGA 1H3FA 3ICOA 3IP8A 3MTGA 3SHWA 2GS9A 1DDOA 4BO6A 4KSYA 3UT0A 2Q28A 4NCNA 1ZIYA 5L6LB 1CTQA 1QVRA 3RREA 3RFVA 1U0LA 3WC4A 3JWEA 1PJ4A 1L5VA 5JO9A 4KI7A 3RJTA 1O2DA 1TM1E 1Z39A 4I6EA 3FUTA 5ALIA 4CBVA 2DTEA 1GFZA 3D6TB 2PVSA 1WKVA 4NENA 1KU6A 2XF8A 2FTKE 4JJAA 4BBZA 3GAZA 5DNDA 2GPSA 3EQZA 1OU4A 5CA1A 3SF0A 5JD3A 2YZ7A 1U1CA 4PAGA 5AOVA 5FTKA 3FCXA 3KKLA 2AEMA 2ECKA 1A4UA 3DLIA 2ZTHA 4UHJA 1W85B 4GKBA 1OTXA 4JN6B 2ZVDA 1NF2A 2B0CA 4EPWA 2ACEA 5HKAA 5LL6P 3LZDA 1I51A 2AG6A 4HFRA 1UEJA 2JGDA 5K8VA 1CNMA 1G17A 1ZN8A 2CUKA 2GD0A 3HWWA 3Q85A 3EAFA 4UAVA 1KRXA 1UBUS 4NMHA 2NXNA 4RTKA 2WIDA 3BMQA 3A9VA 2AV6A 3CZ5A 3QUCA 1AUOA 1Q12A 3IXMA 1T9GR 4QBKA 2DUJA 2PSFA 3K2QA 4X1IB 3GYGA 5AIAA 5AKEA 1L2TA 1SKQA 1U9JA 2BHNA 3EA4A 4ZHQB 3NP9A 3VC1A 3LLSA 5JJKA 1IOLA 1D9XA 1HTWA 3QKUA 1XMQB 1X1RA 4TMTA 2R44A 5C8XA 1ESDA 3KJFA 2YHSA 4L3WA 2B4RO 1KJ8A 3EWAA 2P2DA 2A2ZA 4JNCA 3FCOA 2R87A 4A6PA 5KYXA 4CEHA 2VBIA 2JAQA 4MVXA 3RRFA 1DIAA 2POCA 3GBSA 5K45A 1I4OA 3M6VA 1U7WA 1MFPA 3D0RA 4P38A 1XFAA 1NRWA 5EKXA 4KR9A 2EKDA 4MV0A 3RIMA 3FPAA 5TRTA 3K8YA 3O93A 1SUSA 2YOGA 3QUSA 2B36A 1TTPB 1GQOA 1GG9A 2IOYA 4HEQA 3WB0A 4MV9A 1CUUA 3L1IA 4ZMRA 3AYXB 1JDBB 1FTQA 2IITA 2ZSEA 4JBIA 4XB2A 1MB4A 1N1EA 4MI3A 3RRMA 4NDZA 3PL5A 1TUIA 3TQIA 4CEJA 3GDOA 4RENA 5FIUA 3U6BA 1KAGA 2SNIE 3CRRA 3E53A 2W6QA 4PTZA 4LFAB 1YE8A 1RM3A 1UBJS 3LWDA 2C0CA 3P96A 1HETA 3O8LA 4M7PA 2JGNA 4DA6A 5TARA 5CM2Z 4D82A 3CVJA 5BWLA 5BRJA 2V6IA 2P62A 3T38A 3RV3A 3LF1A 2DFNA 3OJFA 4IKOA 5HIKA 4GRIA 3EISA 4RWZA 3KX2A 2ZB8A 4O4IB 1X39A 1BGWA 4MO2A 5DWVA 1A5TA 3BSFA 4XTCS 4C7KA 2WF5A 3PG5A 1H2RS 2QROA 4JBHA 2NZYA 3AU9A 3TGPA 4HP8A 1ZRHA 5A3JA 2PX5A 5JH7B 1KSFX 1IQRA 3UXYA 4NYIQ 2AOWA 4OI2A 3KEFA 4E4RA 1P7CA 3B20A 3TKYA 2R11A 4P86A 5KMGB 3BWCA 4DDMA 2CHEA 2PQ6A 4IIJA 4DRZA 4E4YA 2R0QC 1EX9A 1A9SA 4OTZA 5EMKA 1I3MA 3IUJA 4GBED 1VKHA 4H7FA 2X8AA 2XYGA 4UXIA 5F2EA 1EX7A 2IDKA 2MR5A 1H8EA 3JX9A 3DZBA 4DQXA 2DKFA 3D54D 4NS4A 3HKBB 5A5FA 4GEKA 3ESQA 1FYWA 2Q2NA 4GOMD 1DWUA 3KE9A 4A0GA 2C7RA 1I32A 1Z5UA 2WNSA 5C8ZA 1ISRA 2WJIA 5C8YB 5FI1B 3T99A 1KEEB 3LSYA 2QTGA 3SEAA 3LL4A 2J5BA 3C43A 1V16A 4ZQGA 2PL1A 3NV9A 5K4GA 4K86A 3HJTA 4QDOA 4FFSA 4U7HA 2GHQA 3GIDA 2D2EA 3FVRA 1LVHA 2PLWA 2X3YA 4P08A 2CD9A 1WZCA 1NYQA 1YVEI 5AKHA 3VU9B 5M2QA 4BEWA 2PUAA 5B1IA 4NX2A 4TSRA 4ZYVA 1TU4A 3L7AA 2OT3B 4B40A 1XZLA 3I9NA 4FGLA 1XHFA 4O4JA 4RKQA 3T7JA 4Y9UA 3B89A 3NRBA 2ZRBA 4U7PB 4U5QA 1IBKB 3H16A 2QN8A 4Y3UA 4FFDA 4C3UA 2W6PA 4L78A 4Z7JA 2Z3VA 1XTBA 2GBLC 2P9QA 3DSRA 3EH1A 2YMLA 3HCWA 2E49A 4JBWA 1GKKA 4ESOA 4Z2AA 1T2VA 3BEDA 1EJ2A 5ITSA 4DPMA 3LKBA 1V8OA 4PSKA 2B69A 1N2JA 2IYAA 1J4AA 1MTOA 2C5EA 4PSUA 2WWYA 5FCDA 4DC1A 2BR4A 2XXJA 3CCFA 5JH7F 1N5MA 4XJXA 3CUUA 3F7TA 5D6NA 2BELA 5DU2A 3U9TA 3LFUA 5KO2A 4MPJA 5AVQA 1HL3A 1A98A 1Y6GA 4UUOA 1U0OC 1BE1A 2XUOA 2P0EA 1R0YA 1TT7A 1RHKA 3OZGA 4EYSA 1DG3A 3HBFA 4TVSA 4Y6QA 4PGMA 5IYZA 3NHKA 2B82A 2Z0MA 1UPXA 1K3UB 2R8PA 1KDRA 1C9MA 1W581 2ZR7A 4FGSA 1MC8A 4X61A 4EDFA 2G63A 1FFAA 3LXXA 4ZGGA 2QE7A 2YOHA 5L95A 5ALPA 5DSTA 2XAUA 3IKTA 3NHJA 4HD8A 2W2PA 1FRZA 1SG0A 2IF2A 3SNHA 3B1ZA 2ZI5A 3TXAA 4N5IX 3Q7IA 2WM2A 3QE4A 3F2IA 1P1KA 1AKWA 3HABA 4EEXA 4AJLA 3H8VA 4HAVA 4EYGA 4OXKA 4QOEA 3BZWA 3WG9A 5FNVB 4CLDA 2ZYIA 5DNYB 1IVSA 2Q3JA 4OUDA 5IG2A 4MDEA 3EZXA 3A36A 5B1EA 3MMNA 4REMA 1MIHA 1N0IA 1KEVA 3K0AA 4S2UA 1GO2A 4R40A 5GTDA 4JXXA 3A4MA 1FCJA 1WDTA 1XTSA 5EUCA 4GGOA 3THOA 3HDHA 3EW7A 4GR9A 5REQA 2CXHA 1PFYA 4XD7A 3O74A 3BG5A 1EX6A 2E2WA 2M6SA 1F2TA 1TLTA 2OGSA 3H05A 3RG8A 4OFZA 5BR8B 2NMVA 4S1TA 2R8BA 3WSVA 3K6SA 2V1UA 1JI3A 1MRZA 3AGPA 3EOZA 3KU4A 4YRLA 2SICE 1BMTA 5IYZF 4LMPA 5DZSA 1UP4A 2WF6A 1PRYA 2FF7A 2EGGA 4O1IA 4IL5A 4RIGA 4AJOA 4B31A 1QK5A 1T6ZA 1FTSA 1XGKA 2O6LA 4KO4S 3RBVA 4CNQA 3U44B 3NCHA 4CCYA 1CP2A 1AKYA 3TAUA 4GZ5A 3O1HB 3UWSA 1FF9A 3PI7A 5F9FA 4I55B 3H17A 3KV1A 1NN5A 3I9KA 4M1QA 5FOXA 4YP9A 3CISA 1L1RA 4H7PA 4LQ4A 1UJCA 2C2WA 2HTFA 2O1WA 3CV3A 1V4VA 5DTIA 8GPBA 5CNMA 1L4KA 2JJ2D 1SCBA 4XRGA 3SXPA 3B5IA 2JZCA 5EAIA 4NFYA 3PNVA 1ZN2A 4RZ2A 1D3AA 2ARKA 3LTEA 3KOWA 1TIBA 3LFTA 2XF2A 4RD4A 4HDSA 3NANA 2GCOB 4DMCA 1HF3A 1SD5A 1LQUA 2HCRA 1JQ5A 2EOAA 1GAXA 1QQ6A 5H59A 4H0CA 1M2OA 3I37X 1U0TA 1MVNA 3A28A 4FOTA 4Y6GB 5CPBA 1Z82A 4QQKA 4L3VA 3TZHA 1RT9A 1XAHA 5FPSA 3R9XA 3DMYA 1X7ZB 4N0QA 5JDCC 4ZCIA 1SEVA 5EERA 5D3MA 2EDAA 1BA2A 2W0MA 1E77A 5A9TA 3GNQA 5HNKA 1VRCA 2BFBB 3C4JA 5CX1B 2WJ4A 3PFWO 2RGUA 2JARA 3MUFA 3AV0B 3FWYA 4G5SA 1M3SA 2W6JD 5G4KA 3ZHCA 1G7CA 4Z3KA 2DR2A 1T9KA 5G1NA 3IBFA 5DT2A 5LIRA 3LT5A 2IJGX 3CKLA 3E9DA 2BFCA 1U4SA 1IXZA 1E32A 4J0DA 4GLLA 2BVNA 3KD3A 3ZE0B 3DOFA 1NUTA 3H6GA 3VZSA 4FC7A 4BVBA 5A02A 4TS1A 1Z22A 2IE8A 2COEA 2X3UA 2I9KA 1G2QA 2HUPA 2GLXA 2WHPA 3U7JA 3H0KA 3KB8A 3AR3A 1NAHA 4RJIA 1X2BA 2W2KB 1B3BA 1VJ5A 2D5CA 2HLPA 4CLEA 2ZXEA 1GQFA 1A9YA 3HDYA 3T5DA 3PTZA 3ED1A 1NW6A 1UBOS 2ZYSA 2GN4A 4J1TA 3ESZA 5AW9A 4IDNA 5EQJB 1A9OA 1E92A 2A84A 5IH3A 1E2IA 1VL2A 5BNZA 4HXGA 3D7SA 5F73A 5E1MA 1QK3A 2DTDA 3QTTA 4G89A 5HIMA 3TSZA 4AN0A 1KJYA 1UKEA 3UKOA 1JHRA 2YVKA 1SN7A 3PQ4A 1ZOLA 4EYKA 1XYGA 1ZI6A 3ORRA 4Q9KA 2Q3FA 2BCGY 1PQPA 1A7UA 3FSGD 4U1RA 2QG6A 5LYJB 4HDNB 3AB7A 1XWWA 1I4WA 5FUYA 5IUKC 5CURA 4BU1A 4EAQA 4UOZA 4L27A 3X43A 3EIQA 4DV6B 3RC1A 4FJ0A 1N4AA 2C03A 2AJCA 4I2VA 5FA6A 3VR4D 1NP6A 4JMLA 4KTVE 3ZEIA 4IHKA 4XSVA 1XK6A 4C30A 4P0QB 3UV7A 3H0EA 3SJZA 1T3GA 4AWXA 2FE4A 5ALYA 3M3DA 3HCOA 1W5BA 2VXBA 5CVCA 2EJWA 1FBTA 2HXYA 2CFOA 3FRIA 3OZSA 3OLXA 2RC5A 4DDVA 3ECSA 3HRHA 4MW6A 4BV9A 4R84A 1T4GA 4AICA 1YQWA 5TEWA 3KAQA 2AW3A 1AQIA 2DT8A 2PAFA 2XTZA 1D4FA 3KPVA 4R69A 2GZMA 4QVKA 3WRXC 5EUBA 5E1DA 4UM8B 3MGKA 4TKUB 4ZVTA 2EFYA 2W6OA 3DXFA 1GPWB 4HXEB 1V45E 3OC0A 4F1JA 1Y81A 3DPUA 1XF1A 3EPKA 3ZU2A 2VSQA 4E33A 3JY6A 1UOPA 4Q21A 1M34E 2GZDA 1AGNA 5DDIP 1L7VC 2QNIA 3HJNA 1AXGA 4JR1A 4X62B 1TMKA 4NFLA 2W11A 4OQNA 4ZXFA 3A32A 1X1SA 2YV2A 4JT2A 4ARBA 2V5VA 3K05A 3ZHVA 4DLWA 3PB3A 4QFMA 2ZE7A 4HTFA 1IH8A 2AC4A 3B6ZA 3LU1A 3H7AA 1J8FA 1KMHA 2VRCA 4UREA 4TN1A 1J23A 3BWEA 1LF5A 3LA6A 3DEIA 3VR4A 3UK6A 2FPWA 2ZULA 3QF4B 2O48X 2PDAA 4EI7A 2C83A 4FE4A 4JVNA 1N5KA 4EFKA 3DW1X 2YXNA 1XA0A 4IUCS 4CMIB 1W0JD 3A7DA 4I36A 3DAPA 4RD1A 4L2IA 2Q9BA 1G5HA 3EXG1 5AKJA 1T0HB 2ODQA 3VPHA 1A88A 1QPGA 1KKLA 2X0JA 1P2DA 2AD1A 3ISVA 4U2KA 4GX1A 3RWBA 4D3XA 3E05A 2E85A 5JQGA 2RHHA 4JLAA 5T5QA 4MGHA 4WK4B 1A7AA 2BFAA 1Y5LA 2H0QA 3WY9A 2H31A 2H1IA 4RTJA 3ID6C 1EMDA 3N6XA 2CF6A 2Q4EA 2A1UA 3EA5A 3WNVA 3RHZA 2I3BA 4JT9A 1ZA2A 3TLGA 3WA7A 5DCYA 4L15A 3REQB 3LDHA 3RVPA 2ZIFA 4II3A 1K5DA 2ONJA 3SMVA 3A9RA 1BHSA 5KNBH 1NBEA 5B1DA 3G0CA 5GJCA 3A8TA 3E3OA 1R9JA 1RRCA 4F9GA 3ZHSA 2QVCA 3B1YA 4N9QA 1USWA 5DBIA 4AKTA 4Y2YA 4HDMB 2WD9A 3KHTA 4OYRA 2ZCJA 3ZWPA 3IBSA 1R2QA 4DT1A 1Y98A 5AVXA 4IDOA 3O6VA 2X6TA 4G9BA 1KY3A 2G9UA 3L8HA 3N2NA 2X9LA 4IDCA 4R7TA 5EYPA 2QT0A 2V7WA 4I1RA 1L4FA 3PGA1 4QJ5A 2XUFA 1IEQA 1D07A 1IAQA 1Z7BA 1UH5A 3A9SA 3C3AA 3W5BA 2IGBA 4ND4A 4BVFA 4P6VF 4Y30A 2PUFA 1RYYA 3NM4A 2CL0X 2PZJA 3IT0A 3HADA 4K9LA 4LY0A 4AO7A 5DISB 4TTIA 3W9SA 3HB9A 2G8LA 2MU1A 3LYUA 3OEEA 1JHYA 1MP0A 4TQAA 1OLUA 4REOA 4GF5A 4B3CA 2R68A 3NWEA 4E5VA 5EE9A 2X8JB 2XUAA 2WUWE 3W1VA 4D0RA 2O8VA 3BEOA 4GZ3A 5HE9A 1Y6JA 3LPNA 3IAM1 4N7BA 3GOQA 2I7VA 3S40A 2AQKA 3AJEA 4JUBA 3ROFA 1AMOA 1K2VN 3S2GA 2HJVA 3DW3X 3STYA 1L8AA 2D8AA 2KBEA 5A5VA 3DTVA 1YTLA 1E4OA 4G1CA 1U8XX 4YRBA 4IWYA 1QOQB 4MHSA 1A96A 1Q3KA 5JAUA 3ORYA 3P0EA 3PC8A 2X14A 3SQLA 4L4RA 5D84A 5DXFA 3H2BA 3B3GA 5F52A 1T4CA 5GIPE 3U5ZB 2WHYA 3OETA 3ZTYA 5ESDA 4QGBA 4B6PA 3AEQA 5A5DA 4FXPA 2FPXA 5K09A 1SG9A 4EECA 5WRFA 3DOJA 3EFHA 4RH0A 3G2QA 3PGXA 3OE7A 2PO5A 3OQ1A 4NAVA 2DHDA 2RGNC 2XEXA 3GO4A 2R6HA 4MRMB 4F9EA 2HJSA 1MAUA 1QFSA 3Q3JB 4ZU1X 2YXEA 3MOSA 3A3KA 5DNWA 3ZS9A 4E31A 1EUDA 3HZOA 3C97A 4JX8A 1T1EA 1NJ1A 3DFIA 4RW0A 1NC1A 1Z38A 5EP1A 1Z5WA 5G0SA 5K3FA 4N9WA 3B9RA 1EFLA 4LOKA 2QI9C 1O5OA 1SBQA 5KSYA 1XE3A 2PRKA 3FFBA 2XE8A 1TCCA 1K6JA 4MVJD 4TYWA 1TAUA 5JASA 3AEQB 3I5XA 1SOUA 4QXOA 2N42A 5H0IA 1W2HA 2EQBA 3JU3A 4IIUA 3VR5H 3HYTA 3PDUA 5LXTF 2H4HA 3E9MA 2XCTB 2HWKA 2PYDA 2H2IA 5E1OA 3W2EA 4YAKA 4NOLA 2Y6VA 4JVLA 1PR5A 3R0XA 1Y6RA 2C5FA 1J42A 1JE0A 4FVTA 5HQJA 5BW8A 1FPMA 4QYIB 4DNQA 2ZT8A 2R5NA 4LGYA 3U7IA 3VTFA 3F90A 1MNAA 1BX1A 4LUCA 2V6JA 4S2EA 3ZDBA 4GOXA 3HLYA 3TTUA 3N0XA 2YV3A 1KMCA 3CZ4A 4OJQA 1VB3A 3VKGA 3ZEAA 1L5SA 2YFKA 2MT9A 1I0IA 2XKBA 2ZJBA 3HB0A 3LT4A 1EUCA 4D42A 1VLQA 2ZJOA 2GZ2A 3CH7A 3QFTA 5AW8A 1DGQA 1VIDA 1QR6A 3DLCA 2Q5JA 4G5XA 3CQ9A 4AB1A 5BUQA 5JOQA 5KNDD 3HXTA 4JB3A 4F4FA 1ZD4A 1RAFA 2YNMC 3MYRA 4Q4JB 4WLEA 1CBUA 4WNAA 1IY2A 1ORDA 3DJFA 4YWJA 2QF7A 1PL8A 3RS0A 1EUYA 2XCRB 1GUYA 4I50F 4RVUA 4EPTA 1NW7A 4IS3A 4KWHA 3BXGA 4X63A 1WXXA 4PQYA 1E5TA 2O1XA 1GUDA 1E2PA 1D6NA 2HSEA 4JXKA 4MB6A 1WOYA 2D0OB 2W2TA 1C9NA 1Y1TA 4A23A 3CSUA 3EIUA 3FX2A 3OQIB 1JZSA 2PRJA 3PF9A 3A6GA 1AD2A 2QVBA 2BDUA 3A6JA 3PVSA 5IXYA 4PLGA 1ONOA 3BAFA 4DTCA 1BNCA 4IJ5A 3URMA 1J5PA 4G8DA 4I6GA 1AO3A 5LQDA 2QZZA 3DVRX 1JDZA 1XWFA 1S4QA 5J59A 4RCYA 4BKRA 2X1MA 2O23A 3BGOS 4DLLA 2IU4A 4DABA 4K6FA 3AL0C 3VPCA 4DCJA 3S5JA 4LXQA 4QQFA 2ADMA 4DCGA 3MJ4A 3LIIA 1RLJA 3C8ZA 1QRAA 4FSXA 4HB0A 4L72A 2IYOA 3IBCA 3UEOA 1XRLA 5U4QA 4HLUA 1YRQA 1Z12A 1ODLA 1PTKA 2X76A 4WINA 1HQKA 3N9IA 2BM8A 2NZ2A 3QF7A 4MW0A 4UCXA 4CN9A 1CJVC 1D2HA 3LS2A 3SYKA 1EFRA 3GH1A 4RH3A 3RU7A 4NCAA 4EY5A 2OV8A 4HFMA 1O9GA 3E3MA 2XADA 2V3VA 3N6RA 4LDZA 1OVMA 4OGGA 3KLNA 5H1YA 3N2KB 5FOSA 1KIAA 4M86A 2E5WA 2FPSA 1G5QA 3NPMA 1D5CA 4I4TA 3UBTA 5K3BA 1M0EA 3A2KA 2PGOA 1FDTA 1MA0A 4MUYA 1YZUA 1HOTA 1OPXA 2FWRA 3KSMA 4LA4A 4TVKA 4J6EA 1K27A 4DA9A 1EWTA 2JIRA 2ZAOA 5ALXA 5ILQA 1N9KA 2ZIEA 2O2GA 4S12A 4DXAA 3MHTA 4IJ6A 5DCLA 4P53A 4Z4QA 2OV1A 5DTJA 4G2TA 1EWVA 2H5LA 4BMYA 1KMHB 5LMCA 1VCOA 1FSGA 1TTQB 2BC9A 4NH0A 4CGZA 4FSHA 5P8WA 3IH5A 3K4QA 1JEAA 1Z2PX 4OXYA 1CSEE 1E8NA 2F3RA 5LZ4A 1XPRA 3BH7A 4WXPA 1SXJB 3TVDA 4P82A 3X1WA 1PSWA 2VP2A 1SCKA 1NXOA 3H4TA 3ZY2A 3K70B 3IBYA 3JZMA 2WU8A 4HQ6A 3GOHA 3BSWA 3NS7A 1E94E 1VP3A 3SX0A 4CF3A 3I2HA 5IC6A 4M89A 1JQAA 2GYVA 3E27A 3K30A 3UTCA 3WB1A 4U2EA 2ZJFA 2GARA 4OQXA 3RRNA 3ZC3A 3C3KA 2ID4A 4NSNA 1JR3A 1LNQA 2E3JA 4UE3S 4V0KA 1UEIA 4X85A 1IM8A 4NIMA 3S4YA 3T4PA 3CSDA 4D0SA 3F96A 5K5EA 3OF5A 3FKQA 1R0KA 3N74A 5BSVA 4PBRA 1M74A 2OYRA 3P52A 1NUUA 1UBSB 3MNFA 1MENA 3U4QA 4ME6A 1ZXLA 3D6VA 3JPWA 4X65B 1QMPA 5KPDA 1ZCBA 2H18A 1AA6A 1U99A 3R3VA 1JFFB 2WFAA 2XKJE 4MLDA 3VU0A 2DT5A 2MMGA 3Q6IA 4GSLA 3GLQA 4CG1A 4HWRA 3FHCB 4QOFA 821PA 1GTJ1 1UM9B 4HGZA 3GLIA 4RKYA 3DHVA 5KVAA 4MJ3A 3I61A 2BP7B 1WETA 4ZO9A 5HTOA 3QEMA 4BQOA 3CJQA 4Q39A 4XYBA 4FM9A 2O06A 1WSDA 1C29B 5CJPA 3R9IA 4DMKA 1DC7A 1PEKE 1QIIA 4YFVA 4PX2A 1GG2A 2R6DA 3LBNA 3ICEA 3KYBA 2J3QA 3HUUA 2F90A 3AOEC 3T1VA 1EFPB 2OLKA 1C7IA 1D09A 2B5OA 3R5FA 3LUBA 4J1QA 1SG6A 3NIGB 2W9XA 1DHRA 2CMHA 2ZIVB 4DMLA 2H8KA 1TVKA 4JDPA 4RM2A 1VSTA 1QF7A 3U62A 5EPOA 3ZQ4A 2IZ1A 4RY9A 1SUWA 2C5SA 3E22A 4V0LA 2YN0A 4YEDA 3IV9A 4PSAA 1G98A 2ZRIA 3ZNNA 4WK6A 2RK6A 2B92A 1PQWA 2HT6A 4G0MA 3DDZX 3LX8A 1LS1A 2IEIA 1QS0B 5JPIA 6REQB 1T1GA 4ZGWA 1C30B 1RIIA 2VSNA 1KZ4A 2GWRA 2YJNA 3FFWA 1ABBA 2WM8A 4O4HB 2HO5A 4WLOA 3HUEA 4ZU3A 3OUZA 5KTYA 1BROA 1JB1A 4X95A 5C1DA 2P3LA 1NJSA 1J9GA 2CW5A 1RQPA 4GKAA 2JANA 4EUEA 3DMNA 2IIPA 1OXXK 2K6GA 3MOGA 3KZOA 3Q0IA 1C1XA 1CZHA 4H16A 4I1IA 3EJ6A 2EG5A 3QU7A 4JC0A 5C3UA 3SYMA 3MUNA 4BKMA 1SQGA 1IN8A 5AVZA 5HW0A 2X9QA 3CH4B 1WXWA 1KF0A 4ZQBA 1NWHA 5G3YA 3OLWA 1V7CA 1IK6A 2C94A 1Z18A 1UZUA 3PD7A 4NOMA 4O08A 1HT0A 3L4JA 2JGFA 3WLTA 5IF3A 2JD1A 5KREA 5ALVA 3DH0A 3IJ5A 3PIIA 4YRQA 2VIIA 3MIIA 2E7ZA 2GCOA 1XEWX 1Z34A 3G2JA 2RAUA 4GXNA 4PXYA 2I55A 4Q19A 1YZNA 4HEJA 1JT9A 2DFKB 2OGUA 3E15A 3KZNA 5JZSA 4C4YA 3ER9A 3BT7A 1FU4A 4GQAA 4FT4A 1OU0A 4FEGA 4GMHA 1QH1A 4IUBS 3DO5A 1IEVA 1NRXA 1FP6A 1HYEA 3IVXA 2NTEA 3KZMA 5LJIA 4O2BB 4CQJA 1KJZA 1KS2A 2WYIA 5BNTA 1QU2A 2ZIUB 3GY0A 4XUGB 3EEOA 1MEEA 5G0VA 5SYMA 3T7RA 5F3WB 1EM8B 1PO7A 3OIWA 4RFLA 3X1ZA 2GCIA 1HYHA 4NC9A 2EIHA 2EV9A 3H2GA 1M7BA 2R8RA 4AAYA 4Q03A 3T5TA 3WB2A 1VKZA 3LF2A 5JSHA 4FHGA 3PGKA 4JY7A 4NEHB 3JXEA 3LC1O 3OAAA 4YACA 3FAZA 1G21A 4OD0A 5DLEA 5AVRA 1IZYA 1P3DA 1JYFA 2HK6A 2VTKA 3I9FA 5HGXA 1N78A 1ZW6A 1NVMB 4JVSB 1GA4A 3W8RA 4EB6A 3KXLA 4EM6A 4BLVA 1C3EA 4FX5A 4JYCA 2A0KA 4JUAA 4XAQA 5DNCA 4D4LA 2XMGA 5FP0A 4WPGA 2G77B 1GAQA 3L1KA 5KYYA 3UYLA 2FCRA 2PYIA 3MRSA 2BKXA 3DWFA 5H82A 2OO7A 3QVKA 5KQSA 3BUSA 4KI0A 3QXGA 1FQJA 1Z4KA 4E51A 3KYDA 2ATIA 4BE4A 2SKCA 4O5OA 5EIAA 2KMLA 3TSAA 3UMJA 1NONA 4EQ6B 2H9YA 3AIKA 3R0IA 2F67A 2FF5A 3I76A 3JQAD 4FYXA 3P27A 3E7WA 4RF4A 4ZCLA 4DMUB 4N4AA 2IIBA 3M49A 4OBBA 3PHBE 1SUPA 2B1RA 2GTIA 2YHIA 2ZSFA 3G3EA 1ZCJA 4KGZA 4X8LA 1EFAA 4XR9A 3CZCA 3H1TA 4I19A 3RSGA 1FNMA 3M6AA 4FCWA 3RFTA 4C4AA 3GJ8A 5CLQA 2GM3A 1E1QA 3ZBUA 6Q21A 1LH0A 2GAAA 2JKYA 3EEIA 3DPIA 3WYCA 2Y1WA 4QM7A 3I0ZA 3DOIA 4KVGA 1N0VC 4TV8B 3QFCA 4L5JA 2FGKA 3FYUB 2FW1A 3FCCA 1VMDA 2GJ4A 4EHDA 4IHJF 4KRXA 5GJBA 4OIFA 5JXJA 1VL8A 2Q5OA 4MUFA 4LCBA 1Z13A 4DIOA 2GN6A 2BTQA 2VJMB 5JYCA 4DT1B 5HIJA 3S0JA 4ARSA 1CEXA 3FAKA 3RWOA 3Q15C 1ZI8A 2XUHA 2NU8B 5J2TA 3Q6MA 1QZUA 4LF6B 1GQQA 3BE4A 1IMOA 5JJLA 3GGJA 1KP2A 3QHPA 4BWGA 1PKXA 5EL0A 4BMZA 1U94A 4NF2A 4BCCA 1O6CA 2GXUA 3E58A 5LOVA 1JILA 1H0RA 1NGSA 2ZS7A 3FDXA 1TUBA 1XI2A 3TTWA 1N2HA 5BN3B 4MGKR 3WL4A 3WLMA 1CUZA 2BRUA 3MAAC 4GHWA 3GBVA 2R8EA 2PX4A 4LRTB 1X1AA 5IN4A 4MHTA 1CC1S 2G28A 3PYLA 4MWOA 3KKZA 1XLUA 3TBFA 2GCNA 3D64A 4I4NA 3LP5A 3QP9A 3ZHZA 4EHIA 1MAHA 1U31A 3DDHA 4YQFA 5K0TA 1IBCA 4LWPA 5LFAA 3C8MA 3MGGA 3BL8A 4JT8A 1JKIA 2HL6A 2I66A 3MJHA 1CZOA 3OSZA 1HE1C 1OTHA 1UPFA 3OA2A 3VDNB 5M5BA 1KJIA 4Q0MA 3WNCA 1OZFA 5D7BA 3UJAA 1AHNA 3IAAA 3KFLA 5JS1A 4OMDA 1UFOA 2OECA 4DR6B 2FWAA 3K2BA 1YR6A 3KL4A 5F78A 2QM3A 1TCAA 1FP2A 2IS2A 5T6BA 3JCZA 1E20A 1GT91 3ONDA 4UHBA 3DZJA 5EQTA 4B82A 3V7FA 1M2HA 3GGGA 1OI2A 3DXXA 1S89A 4QX6A 3U17A 1YIOA 3ZGYA 5JIBA 4FWTA 3KEGA 4JODA 5J2TF 2VA8A 4F4HA 1J09A 1NVDA 2G9RA 3LUDA 3R4VA 2WIFA 4FZJA 4Y6PA 5CFPA 5CM9C 2VBGA 4IQ0A 5BN3A 3IJPA 1TKBA 3N05A 1OGJA 3N8NA 3SJ7A 2X5OA 4R5HA 1J07A 2AZTA 1JRLA 2DHQA 3Q11A 3WJ1A 5HJ7A 3DCIA 4UBNA 2EKLA 3GEPA 3QW2A 1EXMA 4A91A 4Q7QA 2VUSA 1A0OA 1YZVA 2I0FA 5HDQA 1NZFA 2QQ5A 4FYVA 5LP6B 3NR2A 4UTZA 1AQ6A 2RGAA 5HM6A 5BYAA 3SVLA 4NLLA 3D1LA 3OLVA 1C9KA 4FDUA 4DCPA 2PKRA 3CH6A 3ZDRA 3HDJA 3UG7A 1I13A 1KU0A 3M7IA 1QCZA 3HZZA 1PJRA 3ILSA 4FD2A 4Y2HA 3K96A 3JAMA 1CHDA 3NDJA 4Q3DA 2JIOA 5EMHA 5FRDA 2H29A 3WKBA 1XN4A 4TLAA 2CDNA 4FBGA 1UBKS 1RLMA 3W5CA 4ALIA 1QHNA 4PN7A 5FBLB 2HI0A 3QMMA 2AG8A 4KBFA 5C0OE 4TS9A 2ST1A 4Y1RB 2FMHA 1Y3FE 121PA 5JYBA 3C0KA 5JSKA 2EYQA 3L6BA 3T5PA 4HB4A 5IAAA 3BD9A 4CEJB 3D6JA 7AT1A 5KHLB 1COZA 4YMWA 5H9WA 1EXVA 4F5YA 2XYQA 3ZGLA 2QVYX 2H00A 3EN0A 5H83A 3VKHA 1WB9A 3K9CA 1ENOA 3D2AA 2PV0A 1FLVA 5A2GA 3F6YA 4JI2B 3NIWA 4UUMA 5B57C 3KPYA 3H13A 3I34X 1MGPA 1T1RA 3IA7A 3O9MA 4RIFA 4Y2PA 2RDMA 5IBCA 1YRBA 5EHZA 1B0AA 2HU7A 3CMCO 3ED5A 1JG7A 2V7PA 5JEEA 4R1OA 5HRAA 1PWHA 3N70A 1M10A 2RHWA 5SZKB 2A5LA 5GVSA 2XGMA 5HQ3B 1XVTA 3U4AA 3CT6A 5TT1A 4C3OB 1Y4AE 2PPLA 4IWNA 5DTMA 3UCXA 2PCLA 2XIQA 1RRFA 4QUJA 3ZNOA 4R8MA 3S7ZA 3NGLA 5IHXA 1I6KA 2L0XA 3JPYA 2PRIA 2AYZA 4NFHA 4K9NA 4ANFA 1IUPA 4BP1A 4ZYYA 1LCIA 1H1LB 3R2JA 2X23A 1IVYA 4HGNA 1RHJA 5F7JA 4BCBA 3U1TA 4IWXA 5ESXA 1GRQA 1M1YE 3VNQA 4QBFA 1EXNA 4D8WA 4GZLA 1FSFA 1IM5A 4Q7JB 2WYHA 2HQRA 3C1UA 4O4LF 4B9EA 2OPBA 1UQUA 4M37A 1SY7A 4IXWA 4D4IA 3TZ6A 4TLBA 5K8UA 3H2ZA 4CL8A 4CMJA 3OFNA 1KEPA 1UPBA 2ERCA 1JHAA 2RSLA 4RV4A 4TT3D 1KYVA 2G17A 4F2PA 1BFKA 1IM2A 1NKTA 3KEQA 2DHRA 1I4TD 2DPLA 2PSDA 3M81A 2FEPA 3HRIA 4FZ3A 2RGDA 4MI6A 3T6KA 1SD2A 2GKGA 4K05A 4B3XA 3WMFA 1KETA 1FBNA 3OEYA 1X1CA 1KAHA 1AHIA 3AG6A 1LBSA 3O1IC 3I8XA 1YZ3A 3SBEA 5A4KA 1TQ2A 5EJ4A 4C76A 3QLVC 4ZC8A 3FYDA 4JCOA 1W2GA 4LOAA 4H3HB 1XRRA 4V0RA 4ZA2A 3RUIA 2AK3A 4QDKA 3KQNA 3VOAA 1FZTA 4F4UA 3L6RA 1PV1A 5J63A 2AG5A 2RONA 3QUQA 1HDOA 3DD1A 3T0IA 4LOJA 2WOJA 4BEJA 4CI0B 3UNXA 5G0UA 1DKOA 1P31A 2G7MC 3NHAA 2VP6A 3O38A 3Q8WA 3TD2A 2VHVA 3UH0A 1H22A 4OPMA 2I87A 3UAOA 4ETWA 2ZB3A 1DKUA 1N25A 3HJGA 1QQBA 4YCBA 1ZHOA 1J25A 1I4EB 1OZ0A 3IGFA 1G7RA 1UXOA 3MQFA 5AM5A 4ZEXA 1IONA 1R0LA 1S2LA 2J87A 4YECA 2XBLA 3N8GA 3BKXA 3IMGA 4H60A 4RM3A 3O1JC 2XUIA 3LQ1A 1CJKC 1UAAA 1YMVA 2V6BA 2A57A 1GDHA 4HWPA 1KVTA 1IQ0A 1FDRA 3K15A 1SA0B 2E87A 3DAFA 4OY3A 3EXEB 3A6FA 1DDGA 2QHXA 3JYLA 1L7OA 1V8DA 2XODA 3QK7A 5HE8A 2EX0A 3RB8A 4Y9DA 5ALGA 4IG4A 4DMRA 4NH4A 1ORVA 2IELA 2YFHA 4NCBA 1EFVB 1TZJA 1E6LA 3UYKA 1PK8A 1Z28A 3KQVA 4HZGA 4DDUA 1QKJA 1DJOA 1PI3A 1B0UA 1Z75A 2E1PA 1EK6A 3JYQA 3F6SA 3DHWC 3SJAA 2ZWMA 2ZVJA 3K9QO 4IH4A 1GGHA 4E5MA 1I3KA 3MB5A 1VHJA 3C39A 3OU6A 1EG7A 4JGGA 5CDUA 4FHCA 4JWKA 3VPGA 1H8HA 2EZTA 3C5VA 4E3WA 3KVNA 4F4CA 4GX5A 3X0DA 3OSUA 3JQQA 3AIOA 1B15A 1FXWA 1VCHA 3HBJA 4XXHA 2Q9AA 2GAFA 4AL4A 5AI0A 3ZWQA 3PDJA 1X2EA 3GMTA 2WYOA 2ZAIA 3BWYA 4JJEA 5IM4F 4LF7B 3OMXA 1YJXA 4KLRA 4XKJA 4CLOA 1CV2A 3Q3VA 4IF6A 4DV0B 4A0SA 3IEPA 1G2OA 4GXTA 2OWEA 2C1ZA 2HAEA 3PPWA 4INPA 1RI4A 1TM2A 4FDVA 2PJRA 3FJ1A 2VS1A 1CRLA 4OHZA 1MC4A 1S2MA 4H31A 3OJOA 4QOHA 2IC5A 3GG9A 3V4OA 4EKEA 1DEOA 5J3JA 4OQFA 1Z6QA 2FPLA 4K1LA 1VBKA 4Q1EA 2WJPA 2P4UA 1V7PC 3LLMA 1OF1A 5T8KC 2G83A 4EO7A 1P1IA 3KETA 4UJ3A 5G0TA 4A6EA 4E08A 5L8VA 5LDHA 4HDNA 5FDFA 2HBYA 1R3UA 5IXJA 3U44A 3UK2A 5GY7A 1WIWA 4Q4HB 3OQJA 4EO4A 4H7IA 4BFXA 3ZD6A 5BW5A 3HVUA 4TVBA 2F4NA 1FXWF 4WCDA 1FYXA 1K8QA 4ZCRA 1R88A 2QMYA 1NVWQ 2Z2ZA 2BDTA 1PLLA 3B2NA 4LG1A 4ZOLA 4DC0A 1E1CA 1TYZA 2O0JA 3QOYA 5TLSA 3O4GA 4RJLA 5F2KA 4ETNA 4G4SO 3MWJA 3L7YA 2XE6A 1Y9ZA 4UDYX 1KY5A 3HB4X 4B8WA 1WXIA 4D8XA 2HRCA 1I2DA 1JXOA 4I9FA 4OMCA 1Q1QA 1Q5PA 1Z2DA 3BILA 3L02A 2AOXA 1TPYA 2OFXA 3AY7A 3AHFA 3ZIUA 4JZKA 5BRNA 2BN4A 1JTVA 1WU8A 5ARDA 3R7DA 3V9AA 3IXLA 2RI6A 2RI0A 3VOTA 4IX1A 5EXTA 4YJ2B 1L1FA 2P9CA 2VDLB 2XNHA 1P75A 3AEKA 4MW4A 5EGSA 2OESA 4J9VA 2DGDA 4JVOA 4O25A 2ZBUA 2QR2A 5B55A 5EINA 2O07A 4NZOA 4Z5XA 3AHHA 4Q9NA 2JLWA 1ULBA 3C1TA 3C5WP 1IYZA 3GUZA 2FSHA 1EE1A 4C5BA 3A3PA 3QI2A 1GG5A 4MQ6A 5DWDA 3TIVA 4EHAA 1OFTA 2C2XA 1GU7A 3PFIA 1LEHA 4LECA 3ILXA 2R1TA 2DZDA 5G0WA 3LXMA 5EIXA 3A1WA 1TTHA 3QMVA 1W44A 2QTRA 4IQFA 5TV2A 5HKKD 2VT7A 2FSVC 2ZBDA 5C8YF 3ZY5A 5HZKA 3U7GA 1TEZA 1XMPA 2VJCA 3FVVA 1BXRB 1X15A 5FOQA 1TRHA 2G1JA 2ZTSA 3ULKA 3E82A 1WHSA 2Y6UA 2QB5A 1T3TA 2HZBA 5EHNA 4R54A 4L73A 5I5GA 4AJ9A 1P6UA 4PR0A 4DFDA 3VYVA 4B76A 1EFCA 4TYPA 2G0TA 2ODPA 3IT2A 5J23A 1PEDA 4XUEA 2ZRNA 2PZGA 3CH5A 5FPYA 1UP7A 4AD8A 2WQ6A 2X1VA 4KFTA 2UYQA 3BQMB 2AH5A 2F3TA 3ICPA 1L5QA 1E9EA 3ZWVA 4RTNA 4A82A 4IFTA 1VJCA 4R0NA 4N8SA 4QXPA 1ZR2A 3BWXA 3BX1A 5ALFA 2HBZA 1WVIA 3OCYA 3KB1A 4MUEA 2HMUA 2HRBA 2YXDA 4LWOA 4BO3A 1NUQA 5JFOA 1PT8A 2VOJA 5JPCA 2VNJA 3MJTA 4ZVPA 4J07A 3IMCA 2F3QA 4RC9A 3KDSE 1NN1A 3KC2A 4RZSA 4UXJA 4AMUA 3OO0A 2B2CA 3C7CB 2N3ZA 4PGGA 1A77A 3ZE9A 2EP8A 3HNPA 1ZOIA 1U9YA 1QVWA 4FOSA 4X44A 3THRA 1RPZA 1QFJA 2XTNA 2X15A 1WX1A 2M9MA 3DLPX 4M1YA 1O9BA 2C8LA 3C3XA 2ZPAA 5C8YA 2KI5A 2OAEA 3T9DA 3E35A 4Q16A 4P7FA 1V3TA 1A2OA 3F6PA 1PFWA 3IO3A 5GZ3A 2IQIA 5AM0A 3B38A 2PR2A 3ZBPA 3C6ZA 4Q4DA 1XJ5A 5H68A 5HBGA 4TYQA 4RHUA 1ZRMA 4E1BA 1JU3A 2R2GA 4X92A 1U1FA 2NUPA 1NM5C 4JB2A 4LNHA 5GV7A 1QH9A 2HH9A 3COZA 1WVMA 2V58A 4DLSA 1DBSA 1B1CA 1JFFA 2G70A 4DADA 1QX3A 2R66A 3LBIA 4KQJA 3WFZA 3JQAB 1GQSA 2CT8A 3L1VA 3ZHXA 2G76A 2VEOA 1ODCA 2HSZA 3BH6A 1GG8A 2G1AA 3CZ9A 4RWEA 5F5NA 3U81A 1EFVA 3OTOB 2D1YA 1P0PA 3CE9A 1NY5A 4NG4A 1FYDA 1VG9B 3WL5A 4ZEVA 3CO5A 5C34B 1JKJA 2BFWA 1CPYA 3I6ZA 1IXYA 1VYTA 1L1EA 1L8LA 2ZBVA 5JNVA 1M2FA 4HX5A 4IZ6A 3AXSA 5EWLA 4GSYA 1Q0UA 3D8SA 4HPJB 4OHVA 3LGXA 1VFPA 3WLFA 3ZV3A 3D59A 3E84A 1HG1A 2ZU0C 3JVIA 3PNPA 4HFJA 4ZI5A 5FV7A 5EXEA 1RTKA 1C41A 2GB4A 4LTDA 2ZAGA 1RYZA 4EA9A 3S2UA 2JDID 1E2JA 1IN4A 4MS3B 3WLRA 1DRVA 3FGOA 3SS9X 3BYZA 4ARCA 3OLYA 2P1DA 2TMYA 1WCWA 2PH5A 2ABWA 3O1LA 4AP6A 1PGJA 4ACAA 3LX6A 2YWCA 4HNRA 2EP7A 4ZRMA 2YJTD 1NUAA 2VK4A 3M1IA 1EJBA 3NASA 4QDJA 1Q83A 4OM7A 3HO8A 3SDSA 2WMNB 3CGWA 1MQAA 3UOWA 2A5JA 3P2YA 4TUYA 3U4GA 4TWRA 4BVLA 3VNUA 3DEYX 4F92B 3EZ7A 3LI2A 2IYPA 1T8YA 4HH4A 2PZAA 4MCIA 4OA5A 1BXRA 1YOVB 1PL7A 2WAYA 4WOJA 1TZMA 2BCJQ 1QHXA 2VYNA 3ZE1B 3AR9A 1KTVA 1Y7HA 4EF6A 3LHIA 2FVYA 3KSDO 4EHKA 2V4ZA 3DV0B 4YJ3F 2XA2A 4MQFA 4EF4A 4MKGA 3KQPA 1WE2A 1PL0A 1CVRA 4XUDA 5FR2A 2ZDGA 4DREA 4F4IA 3FF1A 2PRYA 2FWNA 4LS3A 5ULLA 2IUFA 2PUBA 4M0EA 2RCYA 4EB0A 1ZQ1A 2WOOA 4K6HA 2DWCA 2QLLA 1X3LA 3H3XA 3U3OA 4LPKA 4GYWA 1WUJS 5CDFA 1IOVA 2ZOSA 3S2EA 2W22A 3L0CA 4LNAA 1U0FA 1UM9A 1RNLA 4EKNB 2WU3A 1EFUA 1A5SB 3S2YA 2I6SA 1ZH6A 2D5BA 3WQHA 5B6JA 3DR3A 1ZH0A 2IYTA 3QEKA 1UF9A 1U3UA 3LC0A 4RMIA 3QVOA 4Y6OA 4Q18A 1JAHA 1SRQA 4C7JA 2IYRA 2FOLA 4MRSA 2BDEA 3H5RA 2O8NA 1MJFA 2WTBA 4OK3A 4UU7A 4XQ9A 5I9NA 3KSUA 1GKIA 3MILA 2BSAA 3VOSA 1J06A 1DLJA 5IKMA 4J4TA 2QD5A 3EJWA 1B8UA 4BMCA 2D0IA 2GHTA 4R8LA 3QNUA 1T9BA 4WZAA 4JOBA 4Z4FA 2A9RA 4BE7B 4OQPA 3UA4A 1B8OA 3INGA 4KLCA 2EW2A 3WZLA 2P35A 4E15A 3OPNA 3PL1A 3TLXA 2OHFA 2HA6A 3GFQA 1W1WA 2P9BA 3ONFA 1FJXA 4MARA 3MCWA 4OSEA 5HRUA 2H4WA 3L8GA 2BBSA 3NBZC 4FSDA 2DJ5A 3THXB 1S1CA 3C3EA 2KW5A 2OOSA 3MRXA 2G07A 2XBUA 3I9OA 2R7NA 1BRTA 3RK0A 3N59A 5JAIA 3OU2A 4MYTA 3SE7A 5CLJA 1PS9A 4HADA 3WGIA 4GI3A 2AFVA 4OXNA 3THXA 1GTZA 4JC5A 4OK6A 2RHDA 2BFBA 2IUTA 2PRSA 4D74A 3IPXA 5BYJA 1KZ7B 1XTQA 2PU7A 4BTVA 3EASA 2P65A 4CZ2A 2Z1NA 3TECE 2JGLA 3DTTA 4HNHA 1LDNA 3W4IA 3LUKA 5D3KA 5DNEA 1ZC3A 3KELA 3WRYC 4J7XA 4KMOA 6YASA 1KS9A 3A06A 3MJVA 2IZ6A 1XTRA 1FOEB 2IY8A 3GRFA 4WDQA 5ER6A 3ER6A 5B4VA 4CEHB 4TX1A 1CD5A 3MYYA 1ODTC 5K8LA 3T34A 2A9FA 5KSOA 5CH5A 4A1OA 3EBLA 3P20A 1ECPA 1RRVA 1RYMA 1YAHA 1PZMA 5LZ8A 4PYMA 3W2FA 5KX5F 1SR8A 2B5WA 3MUOA 2WJVA 3OM8A 4URUR 5CVEA 4C4XA 4ZEOA 2VRNA 3P45A 5FBZA 3A1VA 3J7TA 3OOWA 4MDYA 1QZXA 1VMAA 3G0GA 4OHPA 4UM7A 3V1MA 4GPD1 3GLGA 4I6JA 5BQOA 2YYYA 1E7QA 3D4IA 4QHSA 1QOPB 2YWXA 1Q3TA 2AW5A 1GPUA 1SHZA 3KR1A 5F1YA 3V4ZA 2HWUA 3G5TA 3RAFC 1LU9A