2JCCF

Ah3 recognition of mutant hla-a2 w167a
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
237
structure length
237
Chain Sequence
EAAVTQSPRSKVAVTGGKVTLSCHQTNNHDYMYWYRQDTGHGLRLIHYSYVADSTEKGDIPDGYKASRPSQENFSLILELASLSQTAVYFCASSDWVSYEQYFGPGTRLTVLEDLRNVTPPKVSLFEPSKAEIANKQKATLVCLARGFFPDHVELSWWVNGKEVHSGVSTDPQAYKESNYSYALSSRLRVSATFWHNPRNHFRCQVQFHGLSEEDKWPEGSPKPVTQNISAEAWGRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA CLASS I HISTOCOMPATIBILITY ANTIGEN, A-2 ALPHA CHAIN
publication title Single Mhc Mutation Eliminates Enthalpy Associated with T Cell Receptor Binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 54
structure length 237
sequence length 237
chains with identical sequence M
ec nomenclature
pdb deposition date 2006-12-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2jccF01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2jccF02
4LPCA 4MDJB 1FRGH 5JUEL 5TE6L 4MQ7B 4U1NB 1OSZB 4KFZC 1QUNA 4X4MA 3GK8L 3W0WD 1EDQA 1NDGB 2DM7A 4E5XA 3TFKC 1QSEB 1EJOH 1ED3B 4OGZA 4MX7B 4XPBL 4NPYB 4MAUH 1XGPB 5DK0B 4QHUA 3QULB 3P11L 3HFML 4LEXL 5K9KB 3TH2T 2G75B 3DX6B 4A2MA 4M6ML 3VD5A 5CINL 3DMMA 3PUCA 3HR6A 2BNQE 4G5ZH 12E8L 2Y5TB 4HIJA 5D7LD 1P5VA 3HMWL 3STZA 2X6MA 3BGAA 3G5YB 3B2VL 3UX9B 3KJ6L 4NSKA 3CMOH 4K55A 4UT6L 1MHHA 1AD0B 2CDGB 4X7CC 4XCFL 2GITA 3P9LA 1KYOJ 4NWTL 4XP1H 2Z4QB 4AH2A 3HLAA 3O2WH 1UQSB 5IMMA 3HAEH 2R1YA 5EFIA 1OCWH 1X6NA 2KL6A 3NCFB 4O4YL 1I8KA 1BX2A 4PGZA 4G6KL 3QNZA 4F7TB 1XT5A 3QDMB 4KRLB 4BJLA 1I8IB 1RIHH 5EWIL 3ZKSD 3VXRE 1MRCH 1D5MB 1J8HA 3W81A 3QDHA 2CLRB 2VLME 5IB4A 4GAGH 5LQBH 1BQHA 3L3JB 1V7MH 5H94A 3FAWA 4AL8L 1S9KC 1H5BB 1NFDE 3B8YA 4DVBA 3LZFL 4M6NH 3DNKA 4HBCH 3TESA 1L7TL 2APTA 3LEXB 1LO5A 1A1OB 2X4RA 4P4KD 4YR6A 2ADGB 5HJ3A 3V6OC 5GRWA 2Y7QA 1KNOB 4N9OB 4XXDA 1JRHH 1NC2D 3L95B 1YPZA 1OB1A 2OYPA 4OB5H 3NOIA 1CD1A 3RPIA 2CLVB 2J8OA 1J18A 3RDTB 1KLUB 2X4OA 3V9FA 4YHYC 2VDOH 3FQTB 2ICWA 1Z9LA 1FPTH 5E2UL 4NKIL 1DP0A 2DAVA 4LU5H 5IEHB 5B38G 3ULUE 5IK3B 1A6PA 1IAOB 1U8PB 1YY9D 1CT8B 4MAYA 3QISA 4PJ7B 1FQ9C 4HV8B 1RZ7H 5K9QG 2ADJA 3RGVC 4FQ2H 2VSCA 4HUKB 4KWUA 2EICA 3GHBH 2XWBA 3QG6B 5E7BA 1U2HA 3RY6C 3BDYH 3WE6A 2BOCA 4X7SH 3D2UA 3SCMB 3VFGH 4TUKH 1PG7H 5KZCB 1DEEB 3I9GL 1MREL 3M1BB 4I0PC 4N8CL 4D0CA 2HFEB 4M1CD 4K7PH 5FGRA 2XKNB 2FZ3A 2MTPA 3PL6B 5F7UA 1WC7A 3LMJL 1E4KC 4H1LH 1ZOXA 1T03H 3SGJC 4IS6A 4PJIB 2NXYD 5FCUL 1EEYB 3RKPA 2VITA 3VGFA 1UZ6E 4F7MB 3CZJA 2IQ9H 4N0YH 5FXCH 4YFEA 2WBJA 1ES0B 1IC5L 4ZFOB 4OV5B 4XPTH 3VFVB 3SDCB 3SDAD 2DYPD 2APFA 3PHQA 1I7UB 3NTCH 1NCCL 1L0YA 1QFHA 5J7CC 5HDLA 3VXRA 2V17L 3IDJA 2BSED 3QUYD 5BVJA 1HSBA 1XR9B 5T1KA 3H9ZA 4JN1H 3HE6A 4H5SB 5HHQB 2LABA 5KOVC 1NFDA 1CICD 1MCWW 4I2XE 4BSVB 2DQCL 1J11A 4TSBH 5BMFL 3IFOA 1IGFH 2CD0A 2HLFD 4IJ3C 4YC2C 4CMHC 5GS2D 3VXUB 5D6CB 4BFEA 1LO2L 5E4IA 5HD8D 3VWJA 1RAMA 1EAJA 1FFPB 4POZD 2VDNL 2R0WL 3EYVB 2AABH 1LD9A 1QLFA 2PNDA 4XVUD 1DUZB 3CUPA 1FGVH 4NQVA 1FJ1B 4GBXC 1SBSL 3HZKA 2IGFL 3CPLA 1NEZG 3PP4H 1T21B 1JVKA 3VD7A 1BAFH 2YRZA 4RGNC 5C0CD 2AK4D 3OJ2C 1A47A 3BPNB 2OTUB 3HC3H 1GZPB 5EZJB 3VH8G 1RFDL 5FYLH 1T22B 1XGQA 3WSQL 4B53A 2O5XL 3LKOB 4KKCD 3LKSB 5TFSH 4CVZB 4NDMB 4QRQB 5C6TH 3MGOB 2R56H 3QWRA 4K8RC 1FL6A 1HSAA 2E9BA 1UEYA 2VDPH 1KJ3L 1N5AA 5JDSB 1XAUA 2YKLH 3D1MC 1CR9L 2IG2H 1A0QH 4E42B 4UDTB 2XNAB 1DJSA 2AJUL 2IAMC 5MI0C 5DMKA 1CFQB 5CBEB 4ELMA 3P0VH 1C1EH 3GSUB 3EDFA 4JFPA 1UJTA 4MS8D 1FG2A 2ZP0T 5JNYB 1OLLA 2FEEL 2Z8SA 2JCCA 4QRSB 5ECJE 1UM4H 3GIVB 1ZGLM 3QUMB 5EOCJ 4OGYL 1W0YT 5IG7A 3OG6B 5DQJB 3OG4B 5FGBC 2PYFA 2GJ6A 2YPLE 3BGMB 1T2JA 43CAB 4UNTA 1N0LA 3T65B 5JHLL 4MQXD 1HI6B 3E3QC 4JVUA 1QRNB 4G6ML 3VFUB 3CFDA 4G9DA 4Y4KA 1G6RL 3JV4B 5F8QC 2J6EH 3GMOB 1U8LA 1CGUA 5EZOH 3FT4A 4DKFL 3U1SL 1MY5A 3QUKA 3ARTA 3VI4F 4Y4FB 5DJDB 3W9EA 2B2XL 5HYJB 3S9DB 4X8XA 5C07D 1NUFA 1T4KA 2Q8AL 4GAJH 3SQOH 4KU1A 3DHJA 2YPKB 3M8OL 1J88A 2MSPA 3ZMRA 1PAMA 3PWJA 4QRTB 3EO1B 4LSSH 5J3HC 4KZDL 4F8QA 5HYSA 4KGLA 4FQCL 5C1MB 2BVEA 1RUQL 4TTDC 3MODL 2FO4B 3K4AA 2F53E 3C5SB 1BVLA 1IZJA 1BP3B 2DWDA 2Z8VC 3W9DA 5IUSA 1YJDL 5FO8A 4PRPD 3IDXH 1DLHA 3BGFB 5T1DL 2H32H 4P23B 1A6ZB 1CFVH 3KXFA 1MELA 4K3JL 3VXMB 2MKLC 5LXGH 2H45A 4M7LH 5IMKB 1PEZA 3MRQA 5EUKB 1D9KB 4ZUVA 3UO1L 3ZLQC 3PABB 4OCYH 5I18H 4YUEL 3MACH 5I17B 3AM8C 2P1YA 4K9EC 4R4FL 4GW1B 1Y6KR 4LRIC 2MQ3A 5FOJA 1I75A 3O8XC 1IGYA 3KNBB 4R96B 3C2AH 4MHHI 4AJ0A 1D5XB 4ERSH 2X40A 4Y5XB 5C70A 4QWWC 3IT8D 1I4FB 1KIPB 5JW5A 3PGCA 1WBYA 4KDTC 3ILQC 2NY6C 3NMEA 4Y16B 2CMRH 1DQTA 4KI5E 1YNKH 3KYMB 1LE9B 1I7RA 1NMBH 4HZLA 4O5LL 4AZ8A 3I2CL 3NZ8A 2ARJQ 5IB1B 2PR4L 2NNAA 4GMSL 5I19L 5BVPL 3MREA 4FQLL 3D39E 3GB7A 1ZAGA 4CU8A 2XA8H 5GQBA 1T1ZB 4CJ0A 1JV5A 2X05A 3RTQA 1BBDL 3H9SB 5K33A 4YDKH 1OGTA 4WWKA 1J0JA 5CSZB 4I3RL 4JVWA 3BDXA 3PWLB 3ELAT 1EAPA 1ITBB 1JGEA 2Z35A 5DWUL 4JDTL 2JJVA 3PJSB 4U1KA 5E6ID 3RUGE 4LCIL 4K3DL 4PJCE 1CD9B 2IPTL 4MJIB 2ZUQC 4AMKL 2BSSB 1GC1H 2YUWA 1JHLL 4FQXC 4PJ8B 3AXLB 3TEUA 4HMDA 4M9PA 5IW3A 2DICA 3CFIC 5FCSH 4F2MB 3VRLF 1YN7B 4FQIH 1XR8B 5KOMC 1MRDL 5D5MA 4OD3H 2EXWC 4OF5A 1QNZH 3MCKB 3LKPA 1EEZA 4PYGA 4RBPH 1V3MA 4LSVH 5A2KH 3EDKA 4X6EB 5E00A 3JXAA 4ORGB 1KCUL 1Z3GH 4GT7A 2MNUA 1OGAD 2H32B 4GRWB 4Z0BL 3TNMA 4WO4A 2DJSA 5AD0B 1OY3B 4Y5VB 1A9EA 2HTKC 1EUTA 1QSFA 2G5BB 1YC7A 3ZO0A 1U3YA 1OF2B 1NFKA 2A6KA 4JO3L 5ABDE 4UTAH 3WV0A 2AQ1A 4WFGE 4CN1A 1AO7A 3ESVF 5D9SB 1NGXA 5HYQA 2XIDA 4K7FB 5DQ9A 1EO8H 1P7KA 2GY7B 1QRKA 3ZDZF 2AXGB 4PJ5B 2P5WB 3IAGC 4NOFA 4ZOCA 3HPLB 1IC7L 2B4CH 4YX2L 1U93A 4K94H 4ZODA 3ZE2F 4K71C 1F6FB 3UJJL 2Q7YB 2EYRB 5H35B 5D2NC 5AAMA 3LKQB 3O2DH 4K3GA 4X6FB 2WK2A 3O6FA 5EOCH 5GGQL 1CZ8H 3QNXB 5FM5O 2OCFD 2C26A 1MHEB 5F1NA 2EDFA 3QUZB 2CUIA 25C8L 4RISH 3RKDD 1KPUA 1PFCA 4DTGH 2GI7A 1NCDL 2HWZL 4GRLC 1MWAL 3BE1H 2YK1L 1DSFL 1RHHA 4P3CH 1QOKA 4Y4HA 5ESQA 2UYLB 3HR5B 4EEEA 4JY4A 5BRZA 1N59B 3EFDL 3U9UB 3IKKA 4OZGB 1YY8A 1EFQA 4YEFA 3RUGA 4NNYA 1W0WA 4UOJA 2YD6A 3GRWL 2HA1A 3TO2B 3H0TB 3RP1A 3EYQC 3DRTB 4Q7DA 3JWDL 4LLDB 5IWLC 4I0CC 4LPVA 3QO1A 5CJXA 5IT2H 5FV1L 1VDGA 3P40A 5FUOL 3VXQA 5TQ2L 1HZHL 4BH7B 3BRGC 3IXAB 3UYRH 2LU7A 1OAYH 1VFBA 4J23A 4JZJC 5TE7H 4DVRL 1XIWA 4LRNH 2G2RA 3QAZC 5T5FH 1JGVH 3TT1H 3VFPA 1X5LA 2CH8A 4G8EA 4P3DA 2W65B 3QDMD 3SPVB 4ZTOH 4OLVH 3ISWA 1K8IB 2E7MA 1ORQA 1T5XB 1WZLA 3OZ9H 5CS7A 3Q1SL 1GL4B 2YOCA 4WHCA 1QQDA 2FYYB 5C0EA 2AERT 3MRJA 3SJVE 1IAMA 4CADB 4A6YH 4FFZL 2EXYD 4UV4H 3X3GL 3HG1D 3SGDH 1FNEA 1CGSH 1H3GA 3OAZK 3CLEH 3SDYH 2YHGA 1CDBA 4TSAL 4IRSD 4WCYH 2ID5A 3CXHJ 4TTGA 1YMHB 2IQAA 5DMGD 2AJVL 1XMWA 4U3HA 4DOHE 3R8QA 5A3IC 5DF0A 1QBBA 4UINH 5I66B 4M7JH 1PQZB 3U0PB 5F9DC 3NFPA 4Z95H 1CFNB 1ZS8A 4BFBD 4G7YH 4XX1E 3ETBF 4HKXB 1KLGA 4PJAF 4J6RH 5GS0L 2DN7A 4MB3A 1S5IH 1B88A 3JSSA 1KCRL 1U3HC 5C09E 4DAGH 3CVIL 4OM0L 4Z7OF 4FNLL 1MFEH 2Y9RT 2Q7NA 2R1XB 2OJZH 5IMOB 1J7VR 2Z93B 4ZAKC 3RA7H 3SCMD 2NXZB 1QVOB 4HKZB 5KZCD 1VGKB 3KAAA 2IFGA 1NBZB 1XF4B 4HXBL 3BT2H 5E8EA 5I2IB 1ZT4A 4HPOH 4AQOA 1MCCA 3FL7A 5B39A 4DCQB 3VXSA 2WQRA 3HHRB 4R97C 1FYTE 2N4IA 2VZSA 3WFEH 3PL6D 3ARBA 2KZWA 5FK9A 4MXWL 4DGYL 3WCYA 1JBJA 4Z7VE 1ZA3B 4JM4L 4L4VD 1S8DB 4F9PC 3P4OA 4X6BB 4C83B 2DKSA 3UDWC 4OLEA 3T77B 3DGGA 3EO9L 4PRHB 1R3IL 4Z0XB 2CGRL 1MCFA 5D70L 3SDCD 2XXCB 1K8DA 3MRHA 4LHUA 2BSTA 3DX9B 3PG2A 2O61A 3L7FA 2EDYA 2H41A 2YSSA 3SHSA 4OLYL 5HHMB 1S9YA 5C2UB 4KKAC 4GW4B 2Q20A 1EGJA 3SKJH 2PTUA 4PRAB 3T4AA 1CD8A 2YN5A 4X80L 3VXUD 4TRPL 3IVKB 1QPPA 1AP2A 2DQDL 3VCLA 2QQKL 3EOTL 4MQSB 5C7XH 3MLRH 1YEIH 4F57H 3QXUA 3V7MA 4V2BA 3GO1H 4FZEH 4UQ3A 1UWEL 3A6CL 1U8OB 1U9KA 2XA3A 1WK0A 1TVBA 2CLZA 2JLLA 4NFDA 4BKLA 1JFQL 3VFSA 5DJ2A 1A7BA 4TNVK 1BZ9B 3VXNB 5T5NG 2A9NL 1OD9A 3DUHA 2LTQB 5DEFA 5B8CB 1ZT7A 4PIRF 2E7BA 2GFBA 3EJYC 3UTPD 3FRUB 1FE8H 1IKFL 1RSFA 4GG6E 1EVUA 3P77B 4OZHE 4PBVC 3Q6GH 1IT9H 3KDMB 4LDEB 3BH9B 1AXSB 3QEQD 2FBJH 4KROB 3QYCA 1C8PA 4P2OA 2XT1B 3LEVL 1I9JL 4ZOAA 4NQDB 1FYTA 5AZ2L 4KRPC 2E9JA 2FGWH 1YJDC 4G8GE 5I15H 2PW2A 4Z7VA 3IDYB 1S9VB 4AM0B 2XTJC 5J13B 3SDXB 3V4VL 2CO7B 5JXEA 4OKVA 1F4HA 1JPSL 2FR4A 1TPXB 2N7BA 5TGBB 3DVGA 1VACB 1QRND 1FL3A 3GGWB 4M61A 2QQNL 3ARDD 1ADQA 3BN9D 3C8DA 5KW9H 4PJXE 2HRPL 1BGXH 3BQUC 5T3XE 4NKMB 3K3QA 3QFDA 5IBUG 4Y4FD 4LSQL 1K4CA 1OAZH 3OX8A 4P3WA 3TO4D 5HYJD 2DQJH 4NZUH 3I3EA 3TIDA 3V6OE 1NC4B 1U8NA 5ICXA 1JI2A 4YPJA 2Q86A 5F44A 1ZTXL 3GM0A 3DSFL 3MXWL 1AKJA 1QBLH 3BKYH 1NMAH 4YDJB 3R06B 2V7HB 4M7ZC 3RWFA 1IFHH 3WKML 3T0XA 5L9DH 2ZSWA 5DZNA 4QTIH 2I5YL 1FSKB 3TF7C 3ROOA 2VDML 3F58H 2W60A 2XG5A 1SYVB 1G7QB 2AK1L 3QI9C 3MUZ1 1BLNB 3HCVB 3ULVF 1ERNA 1U8KB 2AQ3A 1UM6L 4P23D 5JO5A 1T6VN 1WIOA 2GSIA 5D72L 1HH9B 2ZCKH 1FFQA 3VXMD 1W72A 2AJYH 3W11D 5FYLD 1IQDA 1KCSL 4LK4A 2VDKL 4JRYB 2X41A 1D9KD 2AJ3B 2X42A 4R8WH 3KLAA 1IILE 2D7TL 4LLUA 2MJWA 4KKBD 2GT9B 2DB8A 5DVMA 1H3UA 3LQMA 1DL7L 5F70A 3NCYS 1MCPL 4Z7UB 3OKKB 4S1DC 5JIHA 4P46C 3EIFA 1U0QA 1OP3H 3WN5C 4H8WL 3CSGA 3LSOA 4ZFGH 4G8GA 4MXVE 3NVQA 3DX8A 1NAMH 4M6OL 4ETQB 4TULL 1IEBA 3U0TA 3HUJE 4PJEF 2YBRB 4ONFH 4Y16D 3D25B 1U95B 4F8TA 4YXLH 5KS9E 3ARFD 3QIWA 5CSGA 2Q3AA 1IKNC 3IFPB 3QNYA 5DUBA 4EDXB 4J8RB 4M6AA 4U3CA 1RK0A 3BDBA 2EEBA 2CQVA 4PJXA 3V7AG 2AEPH 2JJTC 4UUJB 3WIFB 2NY4B 5TQ0H 5FKPA 1A2YB 5BV7H 1BVKA 2X4SA 1VEPA 2UWEE 3H9SD 4AIZA 4NZJA 2NY7H 4PV9A 1CL7I 4KVCL 3WLWC 1L4IA 3V6OA 4GXVH 4G9FD 2Q6WB 4ZUTA 1K6QH 4MJID 2EEDA 1P7QB 1KC5H 2ARWA 2PCPA 1YEKH 4PJ8D 2V2XB 3K4ZA 4N68A 3QXTA 2DDQL 4WI8A 2F5BH 2GTZB 5CJ5A 5ICZA 1MI5E 1CE6A 3RWJB 5KJRH 1RUAL 2GY5A 3LQZA 4P5MB 2H1PL 3EYFB 3RWHB 5DRXB 5EORH 4PJDB 1MCLA 4WUKH 3DWTA 3V0VB 2E5EA 3FN9A 3DV6A 2HG5B 2VR4A 2HFFB 5ISZA 4PRBB 2VE6B 1LVEA 1KT2A 3RY6A 4MWFA 2C4FU 3IDNA 4JFDB 2EDRA 3JWDC 3TJEL 5HPMB 1W8OA 1WLHA 3QXAB 2XZCL 1HIML 1T20A 1FZJB 5ID1A 4JDZB 1F4YL 4HUVA 5DS8B 4MGXA 2X4QB 2AI0L 1F2XK 1PG7X 4ZG1A 1E4KA 3QIBD 2PXYC 2P5WD 3GMMA 5EO9A 3SGJA 4K7PX 4GRMA 4ZUUA 3HMXH 3MLZL 3HUJA 5AZEH 1SEQH 1X5JA 4E5XB 1EH9A 5J6GA 3K8MA 3RI5K 4MD0A 2VXQL 1PLGL 5H2BA 4LQFH 4QHUB 5ETUA 2IBZY 2W9LA 3E3QE 3QUZD 4O02L 2GIYA 4TOYL 5D1XD 4KK9D 3LS4L 2K7PA 5F7MC 4NO5A 3S3JA 3DMMB 1D6EA 2VYRE 3G04A 4WFHD 4TQEL 3U6RA 3BJ91 4HIJB 3RZCC 1DZBA 1T7XA 4Z5RA 3FKUS 3I6LE 3MA7A 2RFXA 3STZB 4JQIL 4NSKB 1SVCP 2V5SA 5BV7B 1MHHB 3AS1A 5CUSH 2BFVL 1YN6A 4UOW1 3U4BH 4XZUA 3ZTJH 2GITB 2WWKO 3P9LB 2VZ1A 4H25A 1U8HA 5CP7A 1QFWH 4AH2B 3HLAB 4FG6D 4DEPB 5IMMB 4GBXA 4OCWH 3ZKQD 5CLWA 2R1YB 5IHBA 5EFIB 4MA8L 3QEHA 1FAIH 3C8HA 1I8KB 1BX2B 4JHWL 1MI5A 2ITCA 5DEGA 3QNZB 1OWWA 3HAEG 5GS0C 1DQQA 1V3LA 1J8HB 2HRLA 3PE9A 5F7EL 1YEGH 4PFEA 5IB4B 3EZ8A 5H37H 4IDLA 1BQHB 3CD4A 1JZ7A 5KG9A 2NY0B 5H94B 4U6VL 2VC2L 1MCDA 4DVBB 3VG9C 2E9WA 1LO5B 1XGTA 1X5KA 2X4RB 1V7NL 4YR6B 3RDTC 4FQ1L 5HJ3B 2Y7QB 1HK6A 5E9DE 4JFQA 1L6XA 3UBXA 2MHAA 1WAAA 5GSVA 4XXDB 4XAKE 1YPZB 1OB1B 4GQ9H 1KPRA 1JWMA 1ONQA 2IAMA 1CD1B 3RPIB 2WNGA 5T3ZL 1MUJA 2X4OB 1G1YA 1Q9OA 2NX5E 5MENE 1UWGL 1Q0XL 1IGCH 4D0BA 4OF3A 2ICWB 2Y6SD 1IEAA 1QFUH 5B4MC 2R8SH 3FQNA 2MFNA 1F45A 3MJ9L 3EUUA 4UV7H 4MAYB 5FGBA 4JJ5A 5SV4A 3VFRA 2ADJB 2ZKHL 4GMTL 4ORZC 5L0QC 4KV5F 1MIML 4L3AA 5IFAH 2ZUVA 3WFZA 2DD8L 2XWBB 1F02I 1ZVHA 3ARYA 5HI3D 3OKYA 1F90L 3WE6B 4DKEH 2BOCB 3D2UB 2ICWI 3B9EA 4ZUWA 3QCUL 1Q9WA 4D0CB 5A40E 2CRIA 2N1KA 3NIFF 2FZ3B 5F7FA 2R69H 4I9WD 1EMTH 1WC7B 4NCC2 4X7TA 1JTPA 2NXZD 3QDJE 1AGFA 2PN5A 2DQTL 3GKWL 3O6MH 4IS6B 3ME0A 1I1AC 3CFCL 1NCWL 2VITB 2FD6L 5GRVL 1VPOH 1FIGL 4L29A 3NA9H 2WBJB 4S11A 4HXAL 1QYGH 3LCYA 1A5FL 3PHQB 2IPUG 4PLOB 3RWIA 3DVIA 5IESH 4PD4K 2F54A 3VXRB 1OSPH 3IDJB 4DN4H 3QZWG 3ULVC 4JFXA 1XEDA 1RULL 2ERJC 3GSQA 1HSBB 1NLBL 1K9TA 5BVJB 5T1KB 4PRHD 1NMCB 1P4IL 3HE6B 4PUBH 4P9HL 4XBGA 4MCYA 1NFDB 5DJ0A 4I48A 4PB9L 5C6PB 3QHTC 3W2DL 5HVHB 1TCRA 5C0BD 5JA9A 3IFOB 3AROA 3WFDH 1I3GL 5E9DA 2AQ2A 1MFAH 4QRPD 2DIJA 3VWJB 2X4NA 2ZWLT 5HHMD 4JFFE 1JGUL 4OIIH 5I74B 1LD9B 1QLFB 4JPVL 3AM8A 3CUPB 3GFUA 4NQVB 4CBPA 3HZKB 2Z92A 4U6HA 3CPLB 4POUB 4LRIA 1IBGH 4XPFL 1BEYH 2NX5A 3O8XA 5DEZA 4NN7C 2O26U 4M48H 5FA4A 4DQOH 5IB5A 4NJ9H 5KVGL 1GJIA 4NQSA 3T2OA 4JJHA 1XGQB 3MOAH 4KDTA 4MHHG 2BHUA 4KUCD 1KELH 1FL6B 2QLVB 1HSAB 2VZ3A 3TBWA 5HI5D 2YD1A 1N5AB 4XRCA 1OTTD 3SKOA 3ARUA 3CXDH 1IGIH 1P84J 5DMKB 5D4QA 4ELMB 5KVFH 4JFPB 2VKWA 3EGSA 4EVNA 1BJ1J 5L6YH 1OARL 1FG2B 5L7XH 3G6AA 2GAZA 1BOYA 2JCCB 2OTWA 5C0NC 4JO4H 5ADOH 4KROD 3QDJA 1VHPA 2W1NA 5BOZG 1WBXA 4N90E 5IG7B 4WY7L 2PYFB 2GJ6B 4U49A 1OAUL 4NQDD 4FQXA 2CPCA 5FO7A 4ODTL 2JIXA 3MMEA 4R0LC 2OSLA 4OBSA 3U9PH 2FJGA 2A83A 3HI5H 3GJFA 4K3EH 5EC1A 1OAKH 3CFDB 4G9DB 5HGAA 4Y4KB 3BZDA 5AWNH 4NO0D 2YXFA 5KN5A 1U8LB 3AMLA 1CLOH 3FT4B 1XGYH 3QUKB 4X4XA 2OI9C 2YD2A 3RY5A 3W9EB 1G84A 1RK1A 1SBBA 1XZ0B 1ZT1A 5CHNA 3PNWA 1T4KB 2EIZA 1DBKH 4P59L 5DA4A 3PWJB 4LNRA 3C5JA 1G9MH 1YEHH 3IDUA 3TPUA 5HYSB 5JOPE 4NC1C 4H8WC 4YE4H 5F7NC 3X17A 1EUUA 4RWYH 3MUY1 4X7DC 4TPRL 1BVLB 4H88H 1JYNA 4KY1L 2DM2A 2DWDB 1NC4D 1RI8A 2HKHH 3W9DB 5FO8B 1M71A 1RJLA 1DLFH 4QO1A 4XMKH 1DLHB 3PP3K 4NBZB 5J9PA 3GHEL 3KXFB 2B1HL 4CVWA 5CD5D 1KIQA 3ZKMD 3CAFA 2XQBH 2JB5H 3MRQB 4L4TE 1L0QA 4ZUVB 3EJZD 5KBNC 2D7NA 3K1DA 1HDMA 3KPOA 4OGAC 2D4DA 5D8JH 3BMWA 4GRLA 4LARL 3BP4A 3C6LA 3NH7L 5CIPH 2AGJL 3VI4E 4XNXH 4OBRA 4JRYD 5C0RH 4FMFA 2NY3B 1IGYB 4XPGH 4NO2A 4L1HA 4HIIA 4WTZG 5EU6E 5JW5B 1T0PB 4JKKA 3PGCB 3TYFA 1WBYB 5IWLA 1AHWC 1I9RL 3KLSA 2G60H 1IAII 2Q76A 2Y5EA 5DK3A 1TTGA 3BHBA 4PGEA 1TJGH 4KRMB 4WFED 1I7RB 4HZLB 5D7KE 3NZ8B 2NR6D 2ZCLL 1M7IA 2NNAB 6FABL 3WO4B 4AEIH 3MREB 4LCWD 3GB7B 4PS4L 3O4LA 1JV5B 2A74A 1DDHA 3RTQB 4XGZA 1DANU 1OGTB 4WWKB 5J11B 1MEXH 1INQA 1MNUL 1EAPB 1JGEB 2Z35B 1KGCD 3KS0J 4U1KB 1G9NL 1UT9A 1NQBA 4YHML 1UA6L 5L8JB 2NY4D 3AB0C 3V4PL 3BMVA 5C8JA 5JQ6L 5I16A 3IFNH 3VFOA 2VXUH 2R2HA 1RZKH 4F7PA 2QHLA 5D5MB 4LOUD 4G80A 2EDHA 3DRQA 3U0WL 4JG1H 1FC2D 4NQXA 4M3JA 2I9LA 2FEDC 1P7QD 3S5LA 3LKPB 1EEZB 3AGVA 1DFBL 3UPRA 1FZKA 4IDJL 1QBMH 1Y0LA 3QCVL 1TZGH 2H2PC 1MRFL 4HQQH 4OLUH 5E00B 3DXAA 4KZEH 2DJ4A 5FUCC 3TNMB 4XVJL 2JELL 1SY6L 1FC1A 4WO4B 3QB7C 4N5UA 4APQC 5KSBE 3S34L 3L6FA 4YBHA 3OPZH 1A9EB 5TDOA 4EJ1C 1FO0L 1QSFB 4AIXA 3KPRE 4M4PA 2DTSA 2XY1A 2A6KB 1U3HA 4BZYA 5FV2A 4LMQE 1AO7B 2C4XA 1NGXB 2ICES 5HYQB 5DQ9B 4ZAKA 1JTTA 1P7KB 1FGNH 1MFBL 4KMTL 4G6FD 5EU6A 2CKNA 4OLZH 3U4EA 5GGVH 4ZO8A 1G1CA 1U93B 4XCYA 2EECA 5TE4H 1RJZA 5HXMA 4Q6IA 3O6FB 3ILPA 4G6AD 3VE0A 4YHKH 5F1NB 4U4BA 4JHAL 4F9PA 1F8TH 1KPUB 2XY2A 1CTNA 3UDWA 5TF1H 5EU7C 2GTWA 1RMFL 3T3PF 2XPGA 5LWYH 3RIAF 1RHHB 3S4SG 4B0MM 4Y4HB 3RL1A 5ESQB 4JY4B 5BRZB 1T66D 1AI1L 5CBAA 1YY8B 3RUGB 5J06A 4NNYB 1W0WB 5FO9A 3DMMD 2VKXA 1RZFL 2P49B 5LGHL 1EZVX 1NCUA 4LKXA 4R9HA 5E08H 2YZ1A 5F7WC 5D7JA 3QO1B 3BP5A 2UUDH 3VXQB 4FHBD 3W82A 1CXIA 2I07A 5EBGA 4HDIA 1N64L 4UILH 3T3MF 1G7HA 1VFBB 1UVQA 1CLZH 3AMKA 15C8L 1XIWB 5FYKD 2G2RB 3MLSH 4HK3J 3JVGC 3OB0K 3FJTA 3VFPB 4G8EB 4P3DB 1J5OH 2VRAA 5CEZD 1G6RA 4MB4A 2C9AA 4PY7A 1ORQB 2AXJA 3ZDXF 1J8HD 4AIOA 2VWEE 3K81A 2AP2A 3KPRA 3EO0A 3PP3H 1WV7T 1QQDB 5C0EB 2AW2A 2NY0D 1X5FA 3P4MA 5HYFA 2P42B 3MRJB 3DECA 1FDLL 1I9IH 4C4KT 5I8OL 2PO6C 1FNEB 1RURH 3E2HC 4KHXL 3VGHA 1X4XA 4J3XA 4DW2L 1AR1D 1KXVC 3VU2A 2E8ZA 1LNUA 4FQHA 2IQAB 1H15A 2ZCHL 3Q5OA 5ANME 1CE1L 2W0KA 2GEEA 2NYYD 5C92A 4XNYL 4ODWA 5M94B 5BW7C 3NFPB 5D71L 2EDOA 1ZS8B 4OTXL 5DT1L 5MP6L 3WXWL 1WTGT 1KSRA 3MRGA 1KLGB 2EDXA 4NJAL 3TH4T 1T2XA 4P9HC 1OAXL 4MAYD 3GJEA 4P5TC 3TT3H 4HGWA 4IOFC 5JDJA 4Q9QH 2Q1EA 4I5BA 1GIGL 4HD9A 3N0PB 4L9LC 4YHNA 2OR7A 5EOQH 1BF2A 3MRKA 4HC1H 1U8IA 4X0KA 4Q74A 5DSCA 4MJ5A 5E8EB 3BQUA 1ZT4B 5TPWL 4WUUE 5B39B 1ZV5A 1DVFC 3VXSB 3P0YL 1AH1A 1A6TA 3ZSSA 3ARBB 5FK9B 1RUPH 2IMMA 3SKUD 5CJOH 1QSVA 3P4OB 4IRJC 1KENL 4XT1C 5SX5K 1A7QL 1OQXA 3DGGB 4NGHL 1FLRH 2W9EH 1RZGA 3UZQA 3MCLH 2WBJD 4JREB 1N0XH 4PLJC 1K8DB 4HJ0C 1TVDA 3MRHB 4LHUB 2BSTB 4HG4J 2DQFA 3VXRD 3QI9A 2O61B 1G0XA 1MLBA 4ENEC 3EOBA 4LSPH 3VFNA 4RRPA 3L7FB 4RFOL 3BEVA 1IM9A 1VENA 4YLQT 2YSSB 1J1PL 1S9YB 3MV9A 3U46A 5E8NA 4NUGH 5FYJD 3BP6A 3EYUH 2GK0A 3T4AB 4OIBA 4Z7OE 4LSTH 1A7PL 1AP2B 1KJ2L 4YHOL 3VCLB 3A0OA 4X5WA 5DUPH 4UT9L 4XAWH 2QKIA 3MJGX 4TUJA 4DOHB 1OP9A 2VN4A 3DETD 3QG7L 4F9LC 4P46A 4UQ3B 3SE3C 2XN9A 3WN5A 1FFNA 1TVBB 4I4WA 2CLZB 4JO1H 3LD8B 3NCJH 4BKLB 4UQ2A 3VFSB 1CWVA 4D9RD 2W9DH 5DJ2B 5AUMA 2EO1A 5DEFB 1ZT7B 4PJ9C 1LO3H 1LILA 5GSRA 2HT3D 1MCRA 2GFBB 2NZ9C 2ED9A 4J12A 3JUYA 5DHVH 3F7YA 5EOTA 1E4XI 3QWRD 4LHJB 3VW3H 1IKNA 5I8KL 3E1F1 2R2EA 1KIUA 4HS8H 4LVNC 4P2OB 2JJTA 4WENB 2UY7A 4I0KA 2VDQH 2XZQH 4I3GA 4UU9A 1ZHBA 4WUUA 4GSDL 2BY1A 3ULUL 4U1MA 1FYTB 2HVJA 3H7LA 2R4RH 3QPQC 3FT3A 5F9WC 4FQQA 2AV7A 3K2UL 1TQCB 1P4LA 3V6BR 2OL3A 2FSEA 2PW2B 4Z7VB 4XHJD 4N0UA 5T1LA 1FRGL 2BNRA 2FB4H 2KZ1B 1G7PA 2GJ6D 4OKVB 4EZMA 4L4JA 3GSWA 4POZC 4MVBD 1EJOL 2CRZA 2GUOA 3IFLH 3EW3B 2Z91A 1J0HA 5IBTL 4BH8A 2FR4B 1RZJH 5JLZA 4LLQA 4CMMA 1HKLH 2Y06H 3DVGB 4M61B 1FL3B 1RUMH 3D3VE 1J12A 2WUCH 3S7GA 4PJAA 4PR5A 4Y4KD 3KHQA 1UWXK 1MWAA 5I73C 5GGRA 3NACH 1MY7A 3MV7D 4OZIF 2HTLC 3QFDB 3MYZA 4G5ZL 1KIRA 1H3WM 4NWUL 4JM2A 1K4CB 4M62H 3OX8B 1TETL 1S7WA 1WQVT 4Z7QF 4X5XA 4EOWH 1KULA 4XNUL 4LSRL 3ZL4H 5EPMA 2BRRL 3GRWA 5I8EA 3TIDB 2VXVL 2EEAA 2R0ZH 3D9AH 1U8NB 1BD2E 5ICXB 3WUWA 1MLCA 2Q86B 2E27H 1P6FA 3GMNA 1WITA 1KB9K 3P3YA 1AKJB 1G7LA 3BSZH 4YXHH 2CIIA 5I1AA 3RWFB 5C0DA 1JYXA 1FVDA 2ZSWB 5DJZA 2VL4A 1FYHB 3ROOB 1JHKH 2W60B 4OFDA 1YYLH 2ENSA 1MRCL 2PXYA 1V3JA 1F58L 4TUOA 3U48A 5JO5B 5GIRA 1HNGA 2GSIB 3KXFD 4GAGL 3WNKA 5GXBB 4M5ZH 4M6NL 4HBCL 4N1HB 1IQDB 4OFYD 4R6UA 3BEWA 5DVKA 2WINA 1G9NC 3GMRA 2P5EE 3KLAB 4UI2A 3CLFH 2E3VA 3MV8E 3O3UN 4I3SL 4LLUB 2A0LD 1U8QA 5JR1L 4OV6F 1JRHL 3N1QC 4OIAA 1JGLH 4HIXH 3ULUF 1EV2E 1T0NA 3RWDA 3B9AA 4WTWA 1Q72H 2F8VA 3RZCA 2XXMB 2NY3D 3LSOB 2ORBH 2ZNWA 4G8GB 4YQXH 3G5VA 2W07A 4WTXA 3DX8B 2F58H 4DGVH 1FPTL 4PRNA 4LU5L 4FTVA 1HILA 1IEBB 5M95B 5C2BL 3U0TB 2IWGA 2CK0H 4PJHF 1AIFA 1J87A 5I1GH 4L8SC 4M3KB 4FQ2L 3FTGA 2ZG2A 3C2SA 4JLRA 1KB5H 2AJZA 2EE3A 3QIWB 5INCA 1IAIL 3QNYB 5DYOA 5DUBB 3D3VA 2WIIA 4V1DE 2YA1A 1RK0B 2B5IC 3OKMA 4EI5C 1DQDH 2C7UA 1G6VK 3HB3C 3ULVE 3BDYL 4PJXB 5BOPA 4X7SL 3VFGL 4TUKL 2NMSA 4O2CA 1PG7L 3VWKC 5FKPB 4CAGA 2X70A 4OD1H 3L3OA 1BVKB 2X4SB 4K7PL 3RTQD 1UZ6F 4AIZB 4WWKD 3U30C 3MBEC 4PV9B 1K85A 2BNUA 3MFFA 4GUPA 4GOSA 1BD2A 4N0CC 2WZPD 3PWPE 1E6JH 4ZUTB 1QA9A 4Y5YC 2RAMA 3K2MC 1EBAA 2PCPB 3O4OC 2O93L 4ZO9A 1N7MH 2R15A 2LU3A 2IQ9L 4N0YL 1BQUA 2OXGA 5CLTA 2VLKA 4XPTL 1NLDH 5ICZB 4YHYB 1NL0H 1CE6B 3NTCL 1FVCA 1PEWA 4LLMA 3IYLW 2WW8A 5E56A 4YK4C 1L7IH 3LQZB 3VA2C 4P2CG 4N9GA 4PJEE 3QP3A 1BQHG 3IU4H 1Q94A 3DV6B 5EIQA 5I0DA 1BREA 5ISZB 4TSBL 4WO4D 2OTPA 2P5EA 1IGFL 3VFMA 1WZ1L 3RVUC 3MV8A 1KT2B 1JYWA 3N1FC 5JMOC 4MWFB 1MFCH 3IDNB 1QSFD 2HLAA 5INDA 1LK2A 4HMEA 3OGCA 2AABL 3O2VH 3U7WH 3VDCA 1J86A 1I1FA 1OAQH 1T20B 2DMBA 2CDFA 4F58H 1AO7D 1R24A 5ID1B 4QCIA 3VMOA 3UC0H 3PP4L 5CD3A 4HUVB 1BAFL 4ODVH 4AG4L 3HC3L 2Z31C 2BVPA 1NCAH 3GMMB 5EO9B 3FOLA 4GRMB 4NCC1 4ZUUB 2ED8A 3HUJB 1I1AA 1MH5A 4LP5A 3SQBA 2A77H 4KKLC 5J6GB 5TFSL 5F6IC 4KI5D 1DCLA 4X9GA 5TJWK 4MD0B 3O6FD 5C6TL 5H2BB 4QTHA 2R56L 1C12A 1UM5H 5ETUB 2VDPL 1JNHA 2D3VA 2I27N 4YBLC 4NO5B 4QOKA 1D6EB 2YKLL 1OWRM 1I1YA 1A0QL 3G04B 2C3XA 3U6RB 3OBAA 2VAAA 5BS0E 3P0VL 4Y4HD 1VERA 1HYSC 4Z5RB 3MA7B 2RFXB 5BRZD 4IJ3B 4YC2B 5E8OA 4CMHB 5I1JH 5KANI 3PWPA 1YN6B 4XZUB 5F9AC 1FLTX 1U3JA 1OD7A 2ATKA 4H25B 1U8HB 1V05A 2YD4A 4P48A 5F7HA 4JHZA 4NC1E 4LVOC 4GBXB 3QCTH 4NN6C 1IRAY 3NAAH 3QEHB 4RGNB 3MLWH 1MI5B 2ITCB 5DEGB 1GHFH 3KLHC 3CVHH 3ARZA 1DQQB 5C0IA 3KPQA 1XIWD 2J6EL 4PJEA 3VXOA 1D7FA 5KG9B 4PG2C 3CIQA 1TENA 4HFUH 1KEGL 1XGTB 5H37G 3BZFA 3CC5A 4JFQB 1RPQA 4NC0B 1GZQA 2MQCA 3UBXB 2MHAB 3SQOL 4JPIA 5HYEA 5E1AA 5GSVB 4LSSL 4WFFE 4JFHD 1KPRB 1JWMB 1ONQB 4WFGD 5LBSL 2IAMB 5MI0B 5CEXA 3UJIH 3C60D 1MUJB 1TZIA 1Q9OB 4D0BB 1IEAB 3FQNB 1A7OH 3IDXL 3PWVA 4UTBH 1PX4A 1CFVL 3UBXI 3WHE1 3RAJH 4JJ5B 3VFRB 1M4KA 2BERA 4UBDD 4C56D 4HIEA 1IGJA 3TCLA 1F4XL 4Y19E 4JY5H 4R0LA 2MQ0A 4M7LL 5LXGL 2EC9U 1AC6A 4FFWD 3WKNA 2APWA 2DWEA 3NZHH 4GW5A 1A4KA 2Y23A 5F9OH 4ZUWB 4OCYL 5I18L 3MACL 4ZTPH 4YH6A 1Q9WB 5BS0A 4BM7A 1AXTH 1YA5A 3UTSD 1FNSH 2V5RA 2M2DA 3B6SA 2HMID 3IAPA 3C2AL 4X7TB 2N56A 4JQXA 4ERSL 2AV1A 4NM4H 1AGFB 3GIZH 2F74A 1I85C 5CZXC 5B38A 3STBA 1DBBH 2HYMA 3VXSD 4L29B 3QQ9C 3ZT6A 4HWEH 3LB6D 1JJUA 3W39A 1MJUH 5MHSD 3ARBD 4U1JA 4HS6A 2CMRL 1CLCA 1YNKL 5D7IE 3RWIB 3H3PL 4MDIA 5HVHC 1S9WA 2F54B 3RVXD 5DZLA 4BQ6A 4FA8A 1NMBL 4JFXB 1EO5A 3GSQB 2FECI 3NGBC 3N1MC 1UB5A 3G6JF 4LEXH 3VWJC 3NBNA 3GBLA 2VERN 1MIEH 4PJCF 4HF5L 4XBGB 5DD0H 5CINH 4MCYB 5DJ0B 2XA8L 4I48B 4YDKL 4LIQH 1TCRB 1QO3A 5FUCE 1M7DA 1MCBA 3HMWH 5E9DB 1GVIA 1CIDA 2OMNA 4OCSL 2X4NB 1TZHA 5IR1A 2OQJA 3PQYA 3ULUC 2J8UF 2B7DT 2F19L 3UTTE 1V3KA 4YO0A 2X44D 4K23H 2YRLA 2J4WL 2Z92B 1YNLL 4U6HB 5F72S 3A67H 2VLLA 3NIFE 2QADC 4OFKA 2NX5B 4HLJA 3O8XB 4FQIL 2HJKA 2EYTA 5CGTA 4IMKC 4WU5A 4OD3L 2ESVE 3FOMA 3LY6A 5FA4B 4ZFFA 2OMBA 3G08A 1JL8A 4G6KH 1Q0YH 5IB5B 3U2SA 2E9IA 4H26A 5EWIH 4NQSB 3SGEI 1TFHA 4LSVL 1N4XH 3IGAA 1FHGA 5CZVL 1AHWA 1Z3GL 2NY6B 3VA6A 4NHUA 4YDLC 4M9OA 4EQ3A 1L7TH 4L3CA 3TBWB 5GGRY 4XRCB 5D1QC 3SKOB 3ABZA 1HHKA 4TVPD 4XP5H 2IAND 2FLBT 2EDWA 1MCEA 1OLZA 4QRRE 1A1NA 3HZVA 3D18A 1R3KA 1F42A 3GM8A 2D2OA 3EGSB 3FZUC 4L8DA 4EVNB 2EDNA 3G6AB 5IW6A 2GAZB 4JZNA 1T0MA 1NEZA 2OTWB 2I9TA 5E5UB 3QDJB 1EO8L 5DD1H 2X89A 1K2DA 4P2OD 1WBXB 3H42H 1NEUA 2ZUQB 5T3ZE 2B4CL 4R90H 3VH8A 4FQXB 2HT2D 4K94L 2A6JA 4AEEA 5FO7B 2BHYA 1MPAH 4PRIA 4D2NA 2JIXB 3MMEB 4BZ1L 3MLTA 2OSLB 1KFAL 5EOCL 2BX5A 1J0YA 2FJGB 1CZ8L 2A83B 3GJFB 4KHTH 5EC1B 3F7PC 5HGAB 5J1AA 4RMVA 2GK2A 7FABL 1IZKA 3MV01 5JXED 5KN5B 5JQHC 1N3NA 4DTGL 2ZOKA 3BE1L 4ZOBA 1DBMH 4X4XB 4P3CL 4Y1AE 4QHLA 1MREH 1RK1B 4OZ4A 1ZT1B 5CHNB 3KR3H 1YMMD 3PNWB 2EIZB 2M1KA 3FMGH 4APQA 1LP9E 1T83C 1NANH 3DYPA 4LNRB 3C5JB 3LMJH 4LIQE 3TPUB 5FECA 1ZHLA 2R4SH 3MJ6A 1JMXA 4OLWH 5IT2L 2WWKT 1DE4A 4EN3D 4HUUA 3W0WE 2ESVA 4PP2A 2IH1A 4E9LA 1M71B 3FB7A 1RJLB 4EUPH 3EFFA 1FP5A 1NCCH 5L8KB 5J9PB 3UYRL 1OAYL 1RJCA 5TE7L 5GZND 4X83A 4LRNL 5T5FL 2LU4A 4G8FA 3KPSE 1JGVL 4K71B 3TT1L 2GHWB 1Z9OA 3RBGA 1G0DA 1KIQB 1H3PH 1NDMA 5GRXG 2FATH 4O58H 3RY4A 4NFCA 4ZTOL 2EZ0D 4KTYA 1QP1A 3BD4A 5D7LE 3OZ9L 2F8XC 3C08L 1HDMB 2VJXA 3OJDA 4HFWA 3KPOB 4B41A 1LO2H 3RGHA 2J88H 4GRLB 3TFKD 3BP4B 2VDNH 3QUXC 4QRRA 2YR3A 4A6YL 3LIZH 4J3SA 2P8LA 2C3GA 4RAVA 1T7VA 5HHOA 4P9MH 5FDYA 1CGSL 1O5DT 3CLEL 1B4RA 4NO2B 4HIIB 3CU7A 4WCYL 3TYGL 4KVNH 4WEMB 5KSUA 2VXTH 3J7HA 5J0BA 4OFIA 5JIPA 5HPOA 3TYFB 4UINL 4ZYKA 4NRXB 3WFCH 4M7JL 3JV0A 1ZHNA 2Q76B 4QHKJ 4Z95L 5GS2H 3BHBB 4PGEB 5L2KA 2CO6B 3MJ9A 4G7YL 1W72L 3TO4C 2H26A 1S7UA 2YD8A 1M7IB 1YEEH 4J6RL 5DC9B 1S5IL 1R5WA 1KACB 5HBBA 3N06B 1AJ7L 3QAZB 1IGML 3JVGA 3O4LB 2X9WA 1MAML 2A74B 1GGIH 1DDHB 1HHGA 4XGZB 2X4PA 3FO1A 1T2QH 2RBLA 1MFEL 1INQB 2CXGA 2OZ4L 4KDVA 3EOAA 5ILTH 4GKZA 2OJZL 3QWQB 4OM1H 5F7KC 1AY1L 1A6UH 4JAMA 3ZSTA 5T3XD 3BT2L 1GH7A 3GSNH 2P8PA 5C8JB 4OGYH 2NW2A 5I16B 3QFJA 5ITFA 3VFOB 2R2HB 4L3EE 1OTUC 4LL9A 5HDQL 4U1GB 2PO6A 5GPRA 3WFEL 1XF3A 3IU3A 3X13A 4F7PB 3WS3A 2FH6A 4G80B 5JHLH 1DBJH 2DQIH 3L9RA 3DRQB 4WU7A 1W2KT 4XPAH 4NQXB 4R7NA 2I9LB 3S5LB 1ZMYA 3UPRB 1FZKB 1WSST 3ARRA 5EUOF 1GGBH 2C3WA 4XPHL 3KPSA 3DXAB 5BW7A 4BUHA 4U7MA 5E8DL 2EKJA 4NQEA 1UADC 3RWGA 4JPWH 4UIKH 5E2VL 3L6FB 1REIA 2HFGH 5TDOB 5CAYB 3D69A 1CI5A 1I8LC 4P5TA 3DJ9A 3RGVD 2COQA 2X4TA 1U3HB 3VRJA 3SKJL 1JPGA 1PDKA 2BDNH 5ISZD 5I1HH 4OFPA 5GJTL 1UENA 4BQ8A 1ZLVK 5FFLA 2WWMD 3MODH 4HH8A 4L9LA 4MD5A 5ENWA 3SY0A 4ZAKB 1HXMA 3UZEA 2XV6B 4EXPX 3IXTA 3ARFC 3U4EB 5EU6B 3SE8H 4FQJH 3ULSA 5C7XL 1D5ZA 2MMXA 4I0PD 1ZLUH 1CBVL 3U79A 5LVEA 3BVNA 3LPWA 1BBJA 3L5XH 1DVFA 4HAGA 5T1DH 4RMUA 4R97B 4XCYB 3UCRA 4GG6F 1JPST 1RJZB 3ZKXC 2B1AL 2JJWA 3NN8A 4OZHF 5E4EC 4Q6IB 3ILPB 3VE0B 1MCHA 3VMNA 2B39A 4KJWC 3CX2A 3QJFA 3ALWA 1FL5A 1WZKA 2VZTA 4HKJA 1S7QA 4IRJA 4JZOA 3CSYA 1QKZH 4JGJA 4IM8A 4X7FC 2GTWB 2XPGB 5E5RB 1FE8L 1X4ZA 2AJXL 4YUEH 1NC2A 1QZ1A 4ZS7L 3RL1B 3Q6GL 5HHXH 2QR0A 3HNTL 5CBAB 1EEQA 2FBJL 3HPJA 4Y89A 5FO9B 2F8OA 2AK4E 1CXHA 4WHTA 2V2TA 3OKDA 4LKXB 5B39G 3QO0A 4L3EA 4Y2OA 5D7JB 1IAKA 1PJ9A 3BP5B 5GRUH 4Z7WF 1Z0NA 2PF6A 1JE6A 5I15L 5DVLA 2I07B 4HDIB 1BF8A 1NUDA 4KC3B 5SX4I 4CVUA 1G7HB 1UVQB 4M4RA 3WJJC 4F9LA 4Z78A 2KQNA 4GBXD 1EEUA 4GAFB 3SE3A 3NFNA 4RGND 5D7SH 1VSCA 2DKUA 4FQLH 1MI5D 2FEEI 3MR9A 1G6RB 2R29L 4NN5C 2HJLA 4PY7B 5I1EL 2D7OA 1XGUA 5KW9L 1ZANH 3PWUA 4PJ9A 3KPRB 3EO0B 3T3PE 3P4MB 1BGXL 4K3DH 2AEQH 4KK6D 4K8RD 1YDPA 4NZUL 3F5WA 3KPPA 1Z2KA 2JK5A 1LNUB 1MRDH 4FQHB 4JKPH 3SDAA 2GSGA 2DYPA 1H15B 1QBLL 2R2CA 3BKYL 1NMAL 4PLKC 4LEOA 2OLDA 4JO2H 5D1XC 4MA3A 1IFHL 4F3FA 5L9DL 1I3UA 4QTIL 4ODWB 4KJQC 2FJHA 1N2RA 5C0GA 5CZKA 2RQ8A 4Z0BH 2J8HA 3MRGB 2XTJB 3TNNA 2DLHA 4RFEA 1A3LH 5C07E 3GJEB 3T3ME 5JOFA 4HGWB 2ZCKL 1JWUA 3SDDC 2AJYL 1ITCA 2FX8H 4I5BB 5I8CA 3LN5A 4YHNB 4YGVA 2DLEA 4MXVF 4R8WL 4ISVA 3ZDXE 3MRKB 3I6GA 4Q58C 1U8IB 4X0KB 4NKOA 5DSCB 4MJ5B 3BQUB 3EDEA 2VUYA 3N1GC 5LKNA 3MLXH 3I6LD 4CDGC 1A6TB 4JRXA 1CVSC 3VXPA 1YEDA 3VI3F 4BQCA 4ZFGL 2CKBH 5CKAA 1J1XH 1F2QA 4ALAL 5KS9F 1UFUA 1NAML 1E0OB 1TTUA 3BAEH 5J3HD 2FIRT 3IETA 1ACYH 4M7ZB 5FDWA 4TTDD 1T5WA 1RZGB 4XCCL 1NCTA 2DQGH 3MUHL 4FN0A 1UB6A 4KH2A 2UWEF 1DSFH 1F4WH 1HOCA 2DQFB 3SOBH 2F54D 3QI9B 1MLBB 4LPXA 3BKJH 3EOBB 3VFNB 3ESUF 1KV3A 4M7KH 3DO7A 3BEVB 2AEPL 1IM9B 4NQCA 4WWID 3ARGC 4M8VA 2PW1A 2GCYA 2R0KH 5JHDA 3MV9B 3U46B 1KEMH 5TQ0L 3GRWH 5E8NB 3BP6B 5FGCE 3CX5J 4KK5C 2GK0B 5DGRA 2NY7L 1F3RB 4GXVL 5FUOH 1GGCH 2A38A 2BVYA 4XAKD 4X5WB 2B4CC 2QKIB 1IJ9A 4TUJB 4K94C 1KC5L 1YEKL 3MFGB 5LCVH 4P46B 1VEMA 2ZUSA 2XN9B 2NX5D 4YDVA 1YC8A 2F5BL 3O8XD 4PGBA 5LGKA 3WN5B 4AT6A 1CYGA 1FFNB 4I4WB 4J3TA 4XCNA 1ZLVH 3MRBA 4UQ2B 5C08A 2D7QA 1TCMA 2PKDA 5AUMB 5KJRL 2EE6A 3OR6A 4QWWD 4L8BA 5ALBL 4LKCA 5GSRB 5C07A 1LDPH 1CFTA 4DGIL 4WUKL 3S3PA 3BW9A 3MNWA 3Q1SH 4LLAA 3ILQD 4L8SA 2IPUK 1C08A 3K0WA 4ZXBD 1SY6A 3QPXL 3F7YB 5EOTB 2XI9A 4ODHH 4S1SH 3DIFA 3O3BA 4WGVB 3ZYOA 4FFZH 2R2EB 1FO0A 1FZOA 4EI5A 3E6HA 3TVMC 1A3QA 3GSVA 3EYOA 2DF3A 1M1SA 4NBYB 1BOGA 3T1FA 4G7VH 4UU9B 3T04D 1ZHBB 4FP8L 4NNXA 3VWKA 4WUUB 4EIZC 4U6XA 2AJVH 3C9NA 4U1MB 5EULV 2HVJB 3FT3B 3MBEA 4FQQB 2AV7B 2EH8H 1P4LB 2OL3B 4XB8A 4HPYH 3V0WH 2FSEB 1UXSA 3GBMH 4N0UB 5T1LB 5D93C 3B83A 3O3DA 2BNRB 4Y5YA 1G7PB 1KXQE 3HMXL 3B43A 5AZEL 4FQXD 3C09C 1NBYA 1SEQL 3GSWB 2EDBA 2GUOB 5JTWA 2Z91B 4BH8B 3IRZA 5FKAA 5JLZB 4LLQB 4CMMB 3MSPA 4LQFL 2EXWD 1JPTH 2FX7H 4PJAB 4PR5B 2BY3A 3IDGA 1MWAB 5DHXB 3RPKA 5GGRB 5SWZD 1WGOA 2YD9A 3WNMA 3TBSA 1KBGH 4IEFB 1MHPH 4X98A 2YUZA 1KIRB 3JWNC 5DD3L 4JM2B 4RAUA 3TN0C 1S7WB 2QQLH 4X5XB 4UNVA 1EJ6A 1KF9B 5EPMB 5F3HA 4Z6AT 5I8EB 1NKRA 3MRFA 1O7SA 5CUSL 2Y07H 4J1UA 3WUWB 1MLCB 3U4BL 2HTKD 3GMNB 4NYLA 4DGYH 1IAIM 1FFRA 3C5ZC 1YECH 3FO2A 4RDQG 1G7LB 1QFWL 2CIIB 4JM4H 5I1AB 5C0DB 2P47B 4R4NC 4TSCH 1FVDB 3K4DA 4OCWL 4XI5C 5DJZB 3MRRA 1WICA 4W6YB 4HK0A 1JNNH 2CGRH 5GISL 3RIFF 3V6FA 2Z31A 4UAOC 4HULB 4N8VG 2PXYB 4TUOB 5GIRB 1RU9H 2MOVA 5ALCL 4HJJH 4XWGH 3V7AE 4CVXA 1EX0A 3EYSH 4YZFE 3GSOA 1OL0A 1R5IA 4O2FA 2FIKA 3BEWB 4LFHD 2WINB 1T7ZA 3GMRB 3QHZL 4TNVF 1A3RH 1KYOK 3IS0X 4TN9A 1WTLA 4YHPA 1U8QB 5IROC 1X7QA 3U36A 1MAKA 2NW3A 4TRPH 5K9JH 5HTSA 4GRLD 1GYAA 4GQ9L 4OZIE 1SEBA 1T0NB 3RWDB 4KPHH 5EZLA 3EOTH 5GGSA 3RZCB 5IKCA 3RVTC 4G3YH 4Z7QE 3G5VB 1IGCL 5B21A 3C8KA 3QIWC 4OQTL 2R8SL 4PRNB 1U2CA 4N90D 1F4AA 4FTVB 1HILB 1MJ8L 3QDME 3EYQD 3IJHA 3WL9A 1AIFB 1NGZA 2IC2A 1VFAA 3U83A 3FTGB 4JVPA 3Q48A 1KLFA 4HMCA 1IKFH 5F96H 2R23A 3FFCE 2AJZB 4JLRB 5C0AD 5IFAL 1YNTA 5INCB 5DYOB 5F71A 3D3VB 2WIIB 3CDGA 3RU8H 3KWWA 3OKMB 2C7UB 3HG1E 3WNOA 4KK8C 5D2LF 4DKEL 3QIUC 4O2CB 4ZNEA 5CP3A 4PG2A 2X70B 3O11A 3O4LD 5F7DA 2ADFH 3L3OB 3JWOH 1B0RA 3L3DA 3VG9B 1JP5A 1JIBA 2IADA 3MFFB 4GUPB 3E8UH 4X9FA 1BD2B 3G9AB 1QA9B 4MNQD 3O6ML 1SJHA 2PYEE 2C1PA 3DHMA 4P2QE 1VPOL 2VLRE 5DD5H 3NA9L 4PGJA 2XICA 1QYGL 2VLKB 3MLYH 2X7LA 5HDBF 2APVA 3CFJA 3WS6C 3UYPA 2CDEA 1JPSH 1FVCB 4PTUA 3L7EA 5IESL 4LLMB 2YRPA 1OSPL 3T2QA 4DN4L 3FQRA 4OGXH 5LGJA 5E1HB 5A3ID 4PJHE 3MOBH 5I9QC 3DXAD 35C8H 4N9GB 4PUBL 1RZ8A 2BNQA 1Q94B 5L0QB 6CGTA 1U91A 2H9GA 4X6CF 3QUMH 5JOEA 2P5EB 3VFMB 1NAKL 3WFDL 3OMZA 1OPGL 3MV8B 1MFAL 3MRMA 1NJ9A 1S7XA 3UBXG 1R0AH 5I75B 2HLAB 5INDB 1LK2B 3OGCB 5IHUH 4OZIA 2HH0H 3UTZA 4OIIL 1U3HD 4JEGB 1I1FB 4L4VE 2CDFB 2APBA 2NR6C 1R24B 4OCMC 4QCIB 5E8PA 1IBGL 3WKMH 5CD3B 1BEYL 2JJSC 3ZYIA 1CGVA 1KJ2A 2I5YH 2BXYA 4M48L 1AR2A 4ZAKD 2BVPB 1F6LL 3OKEA 4JN2A 4DQOL 3OV6A 5HI4D 3FOLB 3OAUH 3WNPA 3HRPA 1I85A 1I1AB 1CS6A 1MH5B 3WEXA 2E7CA 3MOAL 2YWYA 4Q2ZA 4ZPVA 4E41E 3FFCA 1ND0B 4IOSD 1KELL 4QTHB 4PGDA 4JKWA 2ZUWA 3HG1A 1JNHB 1KCSH 3Q6FA 3CU1A 2ERJB 1A22B 3CXDL 4S1QH 1IGIL 4QOKB 5DVOA 3VD9A 1I1YB 3VXUE 4RBPK 3DVFA 3PXHA 4IRSA 3RVVC 2VAAB 4QGYA 5TDNA 3KYAA 5GGTH 5DDHA 5L6YL 3MJ8A 3AUVA 4LLVA 4KDWA 5E8OB 4JO4L 3PWPB 1UCTA 2ATKB 2H6PA 2PYEA 4OZFA 4KKAD 4M6OH 1IC1A 4P2QA 1U3ZA 2VLRA 1FG9C 4MXQC 1DTUA 3MLVH 1BJMA 3QR2A 3F62A 2BY2A 4BSWA 3UTQA 4NN7B 3U9PL 3UTPE 3DO3A 4IMKA 5F6HJ 1DQMH 2W59A 3HI5L 2D03H 3D85A 4K3EL 4X6DF 1OAKL 3K1KC 4LCUA 5C0IB 3L3KA 5AWNL 3DX7A 4PJHA 3JTSA 1PSKH 3KPQB 4YEEA 3QEQE 4PJEB 3VXOB 7CGTA 1CLOL 5IM7A 1XGYL 3BH8A 4N0RA 1XCQA 1A14L 5ACMA 1AFVH 1WIPA 3MJ7A 3BZFB 3CC5B 1TJHH 3ZYZA 1DBKL 1GZQB 2IBBA 4KVCH 4JPIB 5D1QA 5E1AB 2M26A 4URTB 2P46B 4JANA 3MV11 1G9ML 1YEHL 3EJYD 4G6AC 4XXCC 4Y2DC 4L4VA 5CEXB 5SWSE 1JMZA 1XF2A 4P2RE 4RWYL 1TZIB 4XP6H 2EE9A 4H88L 2CIKA 4D3CL 2HKHL 4M03A 3T8XA 1M05A 1DLFL 5FF6A 1II4E 2MCPL 2VAJA 3PWVB 3HAEA 3T0BA 2ITDA 4D8PA 1QRNE 2E6PA 3CFKA 2H1PH 5JW4N 4HIEB 1IGJB 3TCLB 4KRPD 5CJQH 5E2JA 3RL2A 4E41A 4R0LB 1B0GA 2XQBL 4I2XA 2CXKA 4X7EC 2JB5L 1T7YA 4JPKL 2XTJD 4OT1H 3UJTH 2DWEB 5HYJE 4GW5B 1A4KB 5D8JL 3FQWA 4PREA 2Y36H 3SEPA 4C4KO 1PBYA 3MRDA 5BS0B 2OJEA 1SJVA 3RI5F 5J1SC 2OI9B 4XNXL 5KAQG 3ARXA 4GLRI 5C0RL 3B6SB 2UY6A 2I26N 4XPGL 3TBYA 1WVZA 5JIIA 3V0AC 5D96C 1T83A 2AV1B 1E4WH 5TF0A 5MERA 2AI0H 4KTDH 2F74B 3INUL 1Z6JT 5B38B 3BQUD 4JFZH 3AREC 4GRWH 3V5HA 3V6ZA 3MLZH 4B50A 4CL7A 3W39B 4U1JB 4FRWA 4HS6B 3TP4A 1TJGL 4J3WA 3EHBC 4MDIB 3VXME 1S9WB 4O2EA 2VXQH 2P4AB 5IV2A 1QLRA 5FYLE 4LAQH 1TLKA 1UB5B 3QEQA 3WIIH 4AEIL 1S7TA 4XVTH 4MNGE 5IBLC 3ZE0E 4CW1A 4HH9A 1MEXL 1QO3B 4EIGB 1M7DB 3BYTA 4PTTA 4AEHH 5K9QI 1IM9D 1TZHB 4YPGA 5IR1B 2OQJB 3PQYB 2BVUA 3MV9D 4YO0B 4JE4B 1AQKH 3QUXA 4BZ2H 5SWSA 3T0EC 3IFNL 4P2RA 2VXUL 2YPLA 2VLLB 1MJ7H 1BFVH 1RZKL 3FN0L 1MCSA 2BVOA 2L7JA 2HJKB 2EYTB 1NFIA 4H1LA 3MPCA 4WU5B 3WFHA 1JWSA 3FOMB 4PB0H 2NZIA 4QXUL 2EO9A 4ZFFB 4JG1L 5DJXA 4JHWH 3G08B 3U2SB 5KSBF 1F3JA 5DI8A 3CZFA 4H26B 1X5AA 3D0VA 4S1DD 3QZWA 4P46D 3ARDA 4Y8DC 1TZGL 1EHLL 2BP3A 4NHCH 1GPOH 3IGAB 4HQQL 5DO2C 2XN9D 3TZVC 4XP9L 1AHWB 3LH2H 4NHUB 4KZEL 1JPFA 4D9QD 1EBPA 4FZ8L 4J4PC 1A7RL 4L3CB 3BWUC 3TO4A 3OPZL 4EI6A 1HHKB 4NZTH 3G6JE 3PGFH 5T1MA 3WO3B 5HVWA 4G9FE 1A1NB 3HZVB 3D18B 4X4YA 1R3KB 4MJIE 2XRAL 4L8DB 5IW6B 4JZNB 2F53A 4S1RH 2XKUA 1T0MB 4WDIA 1NEZB 5EBWA 3T1WA 2I9TB 2ZUUA 1PD6A 2NTSP 1K2DB 1FGNL 4J3UA 4OLZL 5GGVL 2J8UE 5EO1A 3AB0B 3THML 1XGRA 4WUUD 2ARJA 1VFOA 3VH8B 2RIKA 3JV5A 2A6JB 3QEGH 3JV6A 4PRIB 4XC1L 3MLTB 3WLWD 3H2WA 4GMTH 4R7DA 2YA0A 5T1LD 2D0FA 3RHWK 4NCDA 4QRUA 2BNRD 4GRWE 1F8TL 5J1AB 1JZ3A 4OCNC 1N3NB 2VH5L 4MNGA 2ZOKB 1M6OA 2AAVA 4HKBA 1AE6H 3GMPA 4QHLB 1VADA 2BVTA 4OZ4B 2MPAH 3MLPA 4D9LH 1P4BL 4WVRA 5IEKA 1P5UA 4APQB 3SBWC 4Q9RH 5DTFA 1I8LA 2OL3L 1OM3L 3REVA 2WAHA 5FECB 5GGSY 4NO3A 1ZHLB 3WIHH 3NCMA 2P5WE 4R26H 1RIVH 5E08L 4X9HA 4XTRD 1W0VA 1NCWH 1DE4B 1IC4L 4HUUB 3NCBB 2ESVB 4PP2B 2IH1B 3KYOA 4MA7H 5HVFB 3FB7B 1A5FH 1X6LA 3UZVB 3ARFA 3SO3C 4GS7B 1C5BH 3S5LG 1GOGA 3EDJA 3ORJA 4UILL 4FFVD 1CLZL 3GSRA 1RULH 3RNKA 3MLSL 1NLBH 4G8FB 4EUPG 3CSBA 1QSED 3D39A 3C6LC 5GGUA 1J5OL 1NDMB 4WFHE 5EIIA 2YEZA 4GFTB 2PXYD 1KJMA 1WF5A 1ORSA 2J6EA 1FN4A 3OJDB 1BFOA 4HFWB 4OQ1A 3G6JA 4OZGE 5GRJL 5HYIA 4PJCA 4LSUL 1OTSC 4OCLC 4G9FA 4QRRB 4XBPA 4A2LA 1YEJH 2YPVH 2P8LB 4RAVB 2W91A 2BC4A 4JPVH 3VG0H 5HHOB 1CFSA 1RURL 2CUHA 4YFDB 1IARB 3I02A 5E5MA 1DQJA 4UDUA 3IDIA 1BQSA 2A1WL 4JB9H 5KSUB 2GJJA 2A6IA 2J8UA 3PWNA 4LPWA 5HDOA 3UYOD 3H9YA 5KVGH 4ZYKB 4ZMAT 3P73A 4NQTA 1P9MC 1ZHNB 4KXZI 4YDIH 4PJBE 1A1MA 3QQ4A 3RZWA 5L2KB 2I25N 1QLEH 4FTVD 1KCVH 4M5YH 2H26B 1S7UB 1UZ8A 2H2SC 1D5IL 1R5WB 3WJJA 4HUWA 3TT3L 4Q9QL 3FQXA 3G6DL 1HHGB 1CD0A 2X4PB 3FO1B 3F12A 1QACA 4PYHA 3D3VD 3S8WA 3EOAB 5GS0D 3CXHK 4GKZB 4U1GC 4YAQA 1OARH 3V5KA 3MRIA 3LN4A 2VISA 4YHLH 4JAMB 4WTZA 2HFTA 1FCCA 2P8PB 3BKMH 3QIBA 2NW2B 1T1WA 3QFJB 5ITFB 5I1LA 4WY7H 3O3AA 2PO6B 4HWBL 1OAUH 1UH2A 1XF3B 3GBNL 3IU3B 3OXSA 3RDTD 3E2HB 3X13B 3WS3B 3HNVH 5KSVA 1RUPL 5DFWH 5H35A 1INEH 3P2TA 4RWHA 5A16A 5CJOL 4WU7B 4R7NB 4NP4L 2DQEH 1P53A 1SMAA 2R2BA 5DUMH 5DHYA 2BK8A 3AC0A 5D1XA 5F6HI 1FLRL 2W9EL 3KPSB 3MCLL 1N0XL 1T04A 2VLKD 3KVQA 1OP3K 4IMLA 4W4NA 3FO0H 5M7QA 4JM2F 4NQEB 4CNIA 5B4MD 1E6OH 3RWGB 4N0FA 4LSPL 4HCRL 3D69B 1WEJH 5IIEA 4N5EC 4I9WE 4S0SD 1Q9KA 4WJ5A 4GXUM 4P5TB 4FQPA 2X4TB 3VRJB 3K7UA 4NUGL 3PV7A 1JPGB 3SDDA 3EYUL 3N1PC 2VN7A 3EOYG 3WMSA 3L5IA 4MLSA 3P30H 3S96A 4DKAA 4L9LB 4MD5B 5ENWB 1CF8H 3SY0B 4Q6IC 1HXMB 3IXTB 1HQRA 4XAWL 3WXVL 3ULSB 2CRMA 4HGKC 5ID0A 1D5ZB 3BVNB 1S78C 1BBJB 1DVFB 3TIEA 3OWEA 4PRHE 4PJBA 3NN8B 4JO1L 3NCJL 3CCHA 5JW3H 3WD5H 5B3NA 5DC4B 2C3HA 3QJFB 1J0ZA 4IRJB 1FL5B 1KG0A 3L3IA 4HKJB 1S7QB 1LO3L 4FFYH 1I1AD 4JZOB 3CSYB 5C0BE 2F5AL 3RJDA 1AQDA 1G0YR 3CJJA 3O6KH 3T0AA 5EUOE 4QRPE 1NC2B 3SJVA 5I1DA 4JKLA 4J3OC 2AGJH 4QLRA 3VW3L 5D7JC 2QR0B 3DUSA 1DN2A 1G9MC 4HIHA 3HPJB 3O6LH 4QOKD 3RIFK 3MRNA 4EBQH 3ARGA 5EB9A 5FHBH 2VDQL 4WHTB 2V2TB 3OKDB 2IJ0C 1KUMA 3QO0B 1KN4H 4L3EB 1IAKB 3IRPX 4X4ZA 1K3ZA 2AXFA 4KQ4H 3I84A 3PWPD 2IALA 1NGWA 2FB4L 3GSXA 2DI8A 3H6JA 4Z78B 1XF5A 3O2DA 3ULVL 1K4DA 3NFNB 2WQ8A 3D48R 3R8BB 3L1OH 1F6AA 4ODSH 1RZJL 5C09A 2E6JA 1HKLL 4I18C 3S4SA 2Y06L 3MR9B 2IBGA 2ICWJ 2QL1A 2HJLB 1NGQH 2WUCL 4RRPG 1XGUB 5EU3B 3PWUB 4PJ9B 4ZOEA 1I3VA 3LEYH 1H8SA 3P0GB 5C71A 4O9HL 3BX7C 4YHMH 3WHXA 4HW6A 4M62L 2NXYB 2BY0A 3D87B 5JA8B 2A9MH 1YDPB 2XACC 3ZL4L 3F5WB 1CXLA 3KPPB 2R0ZL 3D9AL 4F7EA 5C6WH 2JK5B 3HZYA 3HN3A 3RRQA 2DBLH 2E27L 1CL7H 2OP4H 3TVMA 1B2WH 2GSGB 1H3VA 2DYPB 4LVNB 4LEOB 4YXHL 3BSZL 5DA0B 3B2UC 4MA3B 4F3FB 4KAQH 3SDXE 2XKSA 5F9WB 2FJHB 1N2RB 5C0GB 5JPNA 5MEOA 1BIIA 4Z7WE 5C0ND 2HT4C 1ZHKA 3HC4H 1YYLL 4R4BA 3AY4C 2JELH 1SY6H 5C0BA 2ZNXA 3TNNB 4RFEB 1QSZA 1BWWA 5HGGS 1RIUH 5EUOA 5JOFB 3CDFA 4QRPA 9CGTA 5IHZA 1JWUB 5AAWA 1FO0H 4M5ZL 3S35H 5I8CB 1Z9MA 1Q1JH 2ZUXA 5EN2A 4XB7A 5TDPA 2I60L 3LN5B 5IF0A 4XC3H 5IB3A 4YGVB 3R4DA 4ISVB 3CSPA 5D1ZC 3CLFL 3NPSC 4K7PY 3I6GB 5I73B 1JGLL 4HIXL 4A6YA 4NKOB 5CILH 3AU1A 1RZKC 3TN0A 2FO1A 5CMAA 4JRXB 5HHPA 3VXPB 1YEDB 2QHRH 3T0DA 4LDLB 2CJUL 5DR5H 4BFIA 5IW1A 4LASH 2ENYA 2XZAH 3IETB 3BKCH 1GRWA 3C5ZA 3OKNA 1HCFX 2CK0L 3OAYK 2VWEC 2NY5H 5FDWB 1CU4H 1T5WB 5I1GL 5B22A 4GG6A 1ZEAL 1UB6B 4OZHA 1KB5L 4J2XA 2RCSH 1HOCB 3E6FA 2OS7A 3DO7B 5BZWA 4JRYE 5IQ9A 1AI1H 4NQCB 5LG1A 2PW1B 2GCYB 4ELKA 5JHDB 4U2ZA 5CCKH 4L5FH 4OD1L 2HKFH 4RDQF 2OZ4A 5AYUH 2QEJA 4Z7UE 1UGNA 5E6ZA 1V5JA 1MFDL 3T0VA 4M8QA 3V79C 5IGXL 1OP5K 3PQYD 1E6JL 5IROA 2VNCA 4XMLL 1R5VA 3B9KC 5BXFA 4WFEE 2MCG1 5IVXE 1N7ML 4OI8A 4YDVB 4PGBB 4NO0A 4AT6B 1NLDL 3VI3E 4H0GA 4XCNB 4Z7WA 3MRBB 4D0DA 4LCWE 4EDWH 4GKOA 5C08B 3OR6B 2UZIH 4L8BB 4LKCB 5C07B 1NKOA 1CFTB 1KGCE 3BW9B 3MNWB 4L8SB 3IU4L 1C08B 2W0PA 3LS5L 4M1GH 4KUZH 4Y88A 1QFWM 3DIFB 3O3BB 3QXWA 1L0XA 4XNZC 1B6DA 2B5IB 1FO0B 1FZOB 4EI5B 2K7QA 3E6HB 4GAYA 3TM6A 1UH4A 3QIUA 1MFCL 5BQ7A 3GSVB 3EYOB 3CNKA 5FYKH 1BOGB 1SJXA 3O2VL 4LPYA 3T1FB 1X5XA 3PGDA 3U7WL 3MA9L 4NNXB 3VWKB 1UEMA 1WFOA 4U6XB 1I3RA 1OAQL 4F58L 3R0MA 3C9NB 3U30B 4YWGH 3MBEB 5CEZH 1CE1H 4HK3N 1TQBB 1Z5LA 4MNHA 2QSTA 2WBWB 1B90A 3G5ZA 2XQYG 5EC2A 1UXSB 4LBEA 4OJFH 1WWAX 3O3DB 3BRDA 1NCAL 3BPLC 4Y5YB 5I6XC 4OTXH 5DT1H 3O4OB 3V4UL 3A6BL 5DMJB 1NBYB 1ZKAA 4NJAH 1OAXH 5DLML 4PRID 2AXHA 4Q9CA 4OSUL 1Y18A 4PJDE 1GGTA 5FKAB 3N9GH 3WS6A 4DN3L 4JM2C 4LPUA 4MJ6A 4EKXA 3QDAA 2FEDD 5HGBA 4YK4B 3IDGB 4NM8H 1C5CH 3TBSB 2H2PD 5IQ7H 1CQYA 1HCVA 4X98B 5FGCB 3SGKC 4RAUB 5J12C 2N7AA 1QD0A 4RZCA 5F3HB 4APQD 3MRFB 5I1JL 4B7LA 3ZHKA 4J1UB 4YNYA 4NYLB 3FO2B 4GG8A 3BI9X 4PJ5D 5CEYA 5IVXA 1FORL 1Y6MR 5GRZA 4X4ME 3MRRB 4RGOH 4NGHH 3NAAL 2GQHA 4HK0B 2FBOJ 2ESVD 2JJSA 3OKLA 3UAJD 4LCWA 3MLWL 1GHFL 4RA0C 3V6FB 5KS9A 4DFIA 3CVHL 2Z31B 4M43L 2E7LC 5FOBA 1MQKH 5L88H 4ZO7A 5IFJA 1D6VH 1TJIH 2D7MA 5DRNA 4CVXB 2J3SA 3NIDE 2CSPA 4HFUL 1J1PH 3ARSA 5F6IB 3GSOB 1R5IB 4O2FB 2UWEA 2FIKB 2P44B 4ONGL 4OF7A 4YHPB 3BPCA 3OB8A 1X7QB 4LCCC 4YBLB 3U36B 2NW3B 2IPKA 1J1OL 1SEBB 4Z8FH 2BJMH 5MEQA 5EZLB 2CK2A 4POYA 1JF1A 3UJIL 5B3JE 5GGSB 5IKCB 3GNMH 5E2WH 5HHOD 3QG7H 1WFNA 5EH1A 4XWOC 3QDGE 3C8KB 3V52H 5FYKE 2XYCA 2XWTA 1T6WA 5ADPH 1A7OL 4UTBL 5T3ZD 4S10A 2EH7L 3V2AR 3IJHB 3WL9B 5FYJH 43C9A 1RJYA 4KJYA 3RAJL 1NGZB 4LVOB 4P49A 1J8HE 1VFAB 5ICYA 3LRHA 3KYNA 4NN6B 3LPFA 4JY5L 2R23B 1VKXA 5L2KD 4UIMA 1YNTB 4FOMA 3PF2A 5GJSH 5IOPA 3CDGB 4HUNB 2DLTA 3KWWB 3DPBA 3QRGL 2Y4SA 4EN3C 3NZHL 5KTEH 2EIBA 2C4FT 1R6VA 1PZUB 4ZTPL 1S3KH 3CK0L 3OAYH 3O11B 5F7DB 1AXTL 1B0RB 3L3DB 4YGAB 2ICEA 2IADB 1FAKT 4MCZA 3BWAA 5FGSA 3K2UH 1CLYL 1RD6A 5D7IF 4H0HB 1SJHB 2VR5A 2EZ0C 1GSMA 2C1PB 4XXCA 4Y2DA 3BOVA 1DBBL 3QFJD 3AS3A 3T0EE 4DKDC 1HHJA 2PO6D 4HWEL 2OXHA 1MJUL 1NAMA 2X7LB 2JB6A 3CFJB 5FB8A 2CDEB 4PTUB 3L7EB 3GMLA 5IBTH 3FQRB 1X5YA 3LOWA 5LGJB 1OP5H 1UXWA 3QH3A 1NSNH 1KCKA 1LWRA 4NRZA 2R0LH 5I75C 2QJDA 1MIEL 3KPSD 1RZ8B 5DD0L 2IFFH 2BNQB 5I1IH 1QHPA 1U91B 3ZT7A 2H9GB 4LIQL 4NQED 3F7QA 1INDL 4HSQA 4NWUH 3D5OF 1TETH 2UVFA 1A7NH 3MRMB 1NJ9B 1S7XB 5D2LE 2BSRA 4XNUH 4LSRH 2BRRH 4Q0XH 4JCMA 2VXVH 2O5YH 4P5TD 4OZIB 4TVSa 4IOFD 3UTZB 3HE7C 4K23L 4EXKA 4KRNA 1VGEL 1EA9C 3ARVA 3BFOA 3A67L 5ELIA 5GZOC 5E8PB 3Q2CA 3QDGA 3MRPA 1KJ2B 3BP7A 2QV2A 3B8SA 2X9XA 4RQQA 4C58B 3OKEB 4JN2B 2X1OA 4WI7A 1Q0YL 4PJFF 2PUQT 1AGEA 1LO4H 1F58H 3WEXB 5DD6A 1DVFD 1N4XL 1RZJC 3AREA 5JXAL 4Q2ZB 4V2CB 3MTRA 4ZPVB 2L4OA 4X5LA 3LQAL 4ZD3H 3FFCB 3FB6A 5HDBE 2DTMH 2V6HA 4PGDB 1CDJA 4IOIA 5FYJE 5KAQF 4Z76A 3HG1B 4FABH 4IRJD 3R1GH 3ZKNC 3Q6FB 5BJTA 4M1DH 3NGBB 1S7SA 4XP5L 4I3SH 4PRDA 5JR1H 1PYWA 2XZZA 4IRSB 1P1ZA 3LAFA 3TA3C 1LQSR 4PLJD 4DK6A 5TDNB 1E4JA 3DOSA 1I7TA 4HJ0D 5DDHB 5GHWL 3MJ8B 4LLVB 3KYKH 4X6CE 4WW2F 4MQTB 4ENED 1WT5C 3SE4C 5MENA 4QXTA 2B8OT 5DD1L 5ACZA 3H42L 2H6PB 4ONOA 2PYEB 4OZFB 2VDRH 1FVEA 3IJYA 4D9RE 4P2QB 4L3ED 2VLRB 4R90L 1U8MA 5C2BH 3T0EA 4RX4D 2QADB 3MUJA 1MPAL 1EK3A 1N5YH 5F93C 4OCXH 4XBEH 4BSWB 4F37F 3UTQB 1ZVSA 3HMXA 3D85B 2D0GA 4KHTL 2R39A 1IAIH 4KJPC 2P8MA 4LCUB 2WWMC 3L3KB 3DX7B 1LP9F 3IB4A 3JTSB 3QQ3A 1P84K 4OUUA 4PJHB 1NCNA 5DRWA 3TZVA 5IM7B 1DBML 3BH8B 2VDLL 1XCQB 3UXFA 4ZUSA 5I76A 4YDLB 4J4PA 4LGPB 3KR3L 3MJ7B 4ELME 4F80A 3FMGL 5KSAC 5D2LA 4PJ9D 5D1QB 3QEUA 3KG5A 2JCCE 2NZ9D 4JANB 5DMIH 5E7FA 2K3TA 4L4VB 1XF2B 1NCBH 2R4SL 4OLWL 2JJUA 3CH8A 2GJ6E 4D94A 5FA3A 4PP1C 4KKNA 4MSWA 1X4YA 1C5DA 2CIKB 3VDBA 3GUTA 3T8XB 1M05B 3FO9A 5FF6B 5EA0H 3HAEB 2ITDB 4D8PB 5SWQA 4U1SA 3X14A 3CFKB 5J4MA 3P9WB 3DSNA 1CK0H 2WUBH 3QPQD 1ZLWH 4E41B 3RL2B 1B0GB 3MV7E 1H3PL 4I2XB 2FATL 4O58L 2VB5A 3UP1A 4DWHA 2UUDK 5C3TA 4H20H 4X6DE 1Q9LA 5CGMA 5IFHH 2Z0BA 4JQXC 1WZ1H 3KJ4C 3FQWB 4PREB 2VABA 3T2NH 2J88L 4W4OC 4JFFA 3MRDB 4R2GC 2OJEB 3L3GA 2AKRA 2P7TA 3LIZL 5ITBH 2WV3A 4XVSH 4X6CA 4P9ML 2BHZA 4JDVA 3TBYB 3HI6H 3NA4A 5JZ7C 4U33A 3SBWA 4KVNL 4AG4H 5MERB 2VXTL 2HTLD 3O9WC 3S36H 5ESVA 1Z9SA 3HRZA 3KHOA 4WHYH 4WRLA 4B5EA 2LQRA 3V5HB 3V6ZB 4JRXD 1RV6X 3WFCL 1NGPH 5JW4Q 4NUJA 3ZE1F 4OQTA 2A73A 3KXFE 4AEFA 5CKGA 2C5DC 2QTEA 4KK6C 2ZG3A 4O2EB 4LGRB 5IV2B 1B9ZA 1QLRB 3F6IA 3O41A 3PHOA 1SMOA 1YEEL 1JRHI 2FL5A 1EZVY 3QEQB 4MB5A 1S7TB 4ETYA 3S6CA 1BPVA 3ECBA 4CW1B 1GGIL 1WFTA 2XOTA 4HH9B 1T2QL 5ILTL 3T2PA 4PTTB 2L7UA 1AGBA 1X5GA 3MO1A 4OM1L 4NQCD 4YPGB 1OHQA 1HINH 4M93C 5JHDD 1A6UL 2H3NA 2ZUTA 3FHAA 2LAGB 3GSNL 3QUXB 1EO7A 5SWSB 4P2RB 2YPLB 1CG9A 3SO5A 2OBGA 2LVEA 4I77H 1MCQA 1DEDA 2BVOB 3RX7A 4H1LB 1NFIB 3QHFH 3WFHB 1JWSB 1DBJL 1MF2H 2NY1C 5A2IH 2DQIL 4XPAL 3TV3L 1I1RA 5DJXB 3WLBA 1UC6A 1F3JB 5DI8B 3CZFB 5CSBA 3D0VB 2A2QT 3QZWB 4YBQD 3ARDB 1GGBL 4AENA 2AEWA 4HT1H 4UB0L 3RVWD 1P9MA 1VB9A 1NBVH 1JPFB 3MV7A 5C08D 4JPWL 4UIKL 1KEGH 1FNLA 4LP4A 4X6DA 3TO4B 1XZ0A 2HFGL 2GYSA 4ZQKA 4EI6B 3T08A 5T1MB 4WW1A 1M7XA 4NZRH 4X4YB 2BDNL 1R3LA 5I1HL 2DLGA 1IQWH 5LBSH 1JUFA 1MCIA 4MJ4A 3ZDYE 2F53B 4WDIB 1U58A 5EBWB 3SE9L 3ARQA 4EI5D 3ROLA 3HB3D 5DK2A 2MWCA 3TJHC 3SE8L 5D5ME 4FQJL 4NIKB 5EO1B 3VWKD 1T89C 1XGRB 2WIMA 3VDAA 2ARJB 3K80A 3L5WA 3L5XL 1O7VA 3MBED 3I75A 5F1OB 3JV6B 1W8NA 5A43C 4R7DB 4N0CD 4JR9H 1F4XH 3DYMA 1OW0C 5A2LH 2FX9H 4QRUB 4L4TA 4OFYA 3ALPA 1QKZL 2NY2C 3UEZA 1EFXA 4MNGB 4HKBB 1M6OB 3GMPB 4ZSOE 1QSFE 1VADB 1CTOA 5HHXL 1LEIA 4PJGF 3MXVH 5IEKB 1B4JH 4P4RA 1AO7E 2OK0H 4WV1C 1JHTA 5DTFB 4QYOA 1QR4A 3QJHA 3IJSA 4JFDD 3I50H 3REVB 3W5NA 5FYKU 4GS7C 1N6QH 4NO3B 2LAAA 1H8OA 1BJ1H 1W0VB 1MCOH 2AJSH 4C57C 1AGCA 5GRUL 3RVUD 5F1KC 4WI5A 4ZXBC 3KYOB 5AG9A 3FT2A 4I13B 3STLA 2EDDA 3C6SA 3ARFB 2VXSH 3H3PH 1SQ2N 1VFUA 3GSRB 3RNKB 3D39B 4OD2A