2JCCF

Ah3 recognition of mutant hla-a2 w167a
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
237
structure length
237
Chain Sequence
b'EAAVTQSPRSKVAVTGGKVTLSCHQTNNHDYMYWYRQDTGHGLRLIHYSYVADSTEKGDIPDGYKASRPSQENFSLILELASLSQTAVYFCASSDWVSYEQYFGPGTRLTVLEDLRNVTPPKVSLFEPSKAEIANKQKATLVCLARGFFPDHVELSWWVNGKEVHSGVSTDPQAYKESNYSYALSSRLRVSATFWHNPRNHFRCQVQFHGLSEEDKWPEGSPKPVTQNISAEAWGRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA CLASS I HISTOCOMPATIBILITY ANTIGEN, A-2 ALPHA CHAIN
publication title Single Mhc Mutation Eliminates Enthalpy Associated with T Cell Receptor Binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 54
structure length 237
sequence length 237
chains with identical sequence M
ec nomenclature
pdb deposition date 2006-12-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2jccF01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2jccF02
1UEMA 4XZUB 3BIKA 1HHGB 3ZKMC 5T3XD 1U3YA 1UA6L 5IHUL 1OTTD 4M7ZC 2ADGB 4GXUN 4M93B 2FX7L 3P73A 2EYTA 4QRRA 3EDDA 1I9JH 5KTEL 5I1JH 4WRLA 1NMBL 4J1UB 4G8GA 4XVSH 3K2UL 1NC4B 3V5DB 1T03H 4L3EB 2CXGA 1JMXA 4MQSB 1JYWA 1JGVL 4M7LH 4L8CA 3A0OA 2V5RA 4JAMA 1CFSA 3O6FB 3EBAA 1OCWL 4APQB 3QIBA 4FOMA 5IQ9A 4M5YH 2X4RB 4RFEB 1R3KB 5TFSH 3IS0X 1R0AL 1LK3H 2VISA 4GMSH 1AGDA 1FO0A 2UWEB 3O9WC 1HI6A 5L6YH 1MAJA 3FQWA 5E0QA 1AQKL 3LPGA 4Z0BL 1ZHLA 3NN8B 3Q6FB 1B6UA 1T5XB 1A6ZA 5FKPB 3QUML 3G5VA 4DUWA 1SVCP 1DFBL 1EFXB 2P5WD 1GC1H 4G3YL 1U8QA 3CH8A 3U4AA 5D7LA 4NKIH 5T3ZH 1S7TB 1A14H 2AJ3A 5HI4C 3T09A 5E95B 2WW8A 4L4VA 3BGAA 5KG9B 4DCQA 2E7BA 5DJZA 5I76A 1WJ3A 1BFOA 4JKLA 3RAJH 4EKXA 3OGOE 5DD5H 5F7EH 2FIKB 5K9OA 1HHJA 1NFDB 1UWXK 4CJ1A 1JRHH 3LN4A 1RJZA 3Q48A 5JOFB 4OZHA 3HCVA 3N50A 5IVXB 4Y4KB 1ZHKB 1SMOA 1FYTB 1VGKA 3VFSB 3TIEA 3MRPA 2Y25A 2CKBB 3GUTB 3ULVF 2HP4A 3MBEA 1V5JA 3LKPB 1TJHH 5DZLA 4L3CB 2IGFH 3BKJH 2E7MA 3V6FA 1EEQA 4NO0A 3KPOB 1Q72H 3FN3A 1B4RA 5ACMA 3EZJB 2QQNH 3O8XB 3CX5J 4LVOB 2NYYC 3BWUC 4A6YH 5KSAA 3ARZA 3VWKC 3HA0A 1MHPL 2QQKL 2NY6D 1JHTB 2VDRH 4PTUA 5BMFL 4YFLF 2FEEL 3QXDA 3NGBB 3IF1A 3GMQB 3TESA 1ZSDB 3O11B 4KPHL 2FH6A 2DQJH 3GMMB 5D1ZB 5D71L 3RWGB 3MMEA 2OTUB 2ITDB 1WT5C 5F3BA 5CZXD 2Y07L 4U1IA 2P8LA 4JY4A 4UILH 1P9MC 2R2BB 1AGBB 4NN7C 5F3HA 5GSRA 1SYSA 1TCRB 2XXCB 5DJYA 2FBJL 2ED9A 4BH7A 4TUKH 3KPLA 3KWWB 1I7ZA 5L2KB 1F4XL 1ZT1A 1ORQB 3L5HA 3OF6A 4MB3A 1D5ZB 2W9LA 2Y5EA 4XCYA 4LVEA 2D4DA 1D5IL 1G6RH 5EOTA 4N0FB 1SBSL 4Y5XA 1QOKA 1CS6A 4QHNB 5L88L 4KROD 2GI7A 2P49B 3DIFA 3Q3GB 5F7DA 4ZDHB 4NFDA 1KTRL 1QBBA 5ALBH 3S37L 4OD1L 5ESVB 4U0RB 4R0LA 5GGUB 3WSQL 1RZKC 1UWGH 1FPTL 5I71B 4K3JH 4NOFA 4I3RH 2H8PA 1FSKC 4MNQD 2HVJA 1AGEB 3FOLA 4PJGB 3S34H 1N3NB 3E2HB 4XNUL 1MWAA 5CEYB 1RURL 3QDME 5C70A 5E6ID 5ISZA 5F70A 4YJZL 3WFCH 3RHWK 4PYGA 4LQFH 5L0QC 1Y0LB 4XPHL 1MFCL 3BDYL 4XGZB 2BMKB 4F7PB 1IC5L 2K7QA 2R4RL 1R5IA 3FN0L 1XGPB 3P4OA 5FM5M 5ADPL 4WCYH 4I0PD 1Z3GL 2C7UB 5JXAL 1EA9C 3U46B 2X1PA 4UT6H 2GFBA 2R23A 3G6AB 1KPVA 5I30L 3O3UN 4MMXC 1MNUL 3R4DA 1QUNA 4EQ2A 3S88H 3BP5A 4I2XA 1LP9A 1U3ZA 5MEOB 5IIEA 1RZ7L 2W59A 3P3YA 1E27A 2DLGA 5F1KC 3BP7B 2DS4A 4KVCL 2FJGA 5IROC 3C2AL 4JPIB 5I2IA 4LSSL 4Y5VA 1MLBA 1WBYB 3CUPB 3QG6B 4ODSL 1FL5B 1U8KA 1UYWH 2A6DA 3WHE1 2Q20A 1NC4D 3EUUA 3FO1B 4L3ED 5EO9A 2YRZA 5C86A 1RZGB 1NBZB 2YA0A 4QGTA 1W2KT 4APQD 1U42A 3JV6B 5E8NA 3UTSE 5IHZA 2X4TB 5GS0C 5D6DC 4NGHH 3BP6B 1RZIA 5C3LD 3NCJL 1WICA 4JQIL 4I77H 1EEYB 2GSGA 4JZOB 3IDJB 4AZ8A 2H45A 3ALXA 2FECI 4N0UE 3THML 2VLME 1I1YA 2IH3B 4ZUSA 4Y1AE 4MB5A 4S10A 1AR2A 3RTQA 2HKFH 3VFVB 4DZ8B 4P9HC 1T3FA 1EFXD 1MQKH 3A6CL 4WO4B 4F7EB 4LLYA 1LO0H 4QXWA 3VWKA 3OX8A 3P11L 2D7QA 1MCPL 1FG2B 1CFBA 2DJ4A 1EVTC 2MKLC 2ZOLB 4U49A 4KI5F 4X7TA 2XKSA 2LVCA 3L95A 2OMNA 4WW2A 4YBLC 3MFFA 3M1BA 3PG2A 1WT5A 3CIQA 4HC1A 4MVBD 4JRYB 2AGJH 5B38B 1DBKH 3MJ9L 2PO6B 4TNVK 3ZKND 2CLVA 4U3CA 4R26H 1QYGH 3QUMB 3UJIH 1RK0B 4EDXA 4NP4H 3AU1A 4YX2L 2DYPA 4K9EC 1YEKL 4ZUUB 1KLUB 4XVTL 3EOYG 4GS7C 4WI8A 3KLHD 1XR9B 3IKCA 3V4VH 2GSIA 3O8XD 4HV8A 2DDQL 4DUVA 4NBZB 3GSQB 3G08A 5TF1L 1X4YA 4QRQA 5EBWA 2CIIA 2ZG2A 1DUYA 3UROR 5IW6B 3VGEA 3GKZA 4JDTL 1FNSL 4P3WA 4PG2C 3LKNA 5D1ZD 1MCKA 3KPRD 4JLRA 4K71B 3U2SA 3SJVA 4PBXA 1CD0A 2YUVA 3MRRA 1KT2B 3PHQB 1V7NH 4R4BA 3JTSB 4G8EB 1M7XA 4FZ8H 1FCGA 2W38A 3P0GB 1ZEAL 3O3EA 4ZSOB 3KJ4C 5CZVH 5L2KD 2GJ6B 5F7WC 3CFBA 5C9KA 3FZUC 5GRJH 3UZVB 5BZDA 4YWGH 2R15A 1MCFA 2X1XR 1MJJA 2VZUA 5FGCE 3D0LB 4TQEL 1GHFH 2FWOA 3IFLH 2EEBA 4IRSA 3H7BA 4R96A 2VDQL 2C4FU 2PTVA 4Y16B 1KULA 2NY1B 4CDGC 2HT4D 4PPTA 1IILE 2QQLH 1AFVL 2VYRE 2YD4A 2IF7A 2FSEA 4AEHL 4JRXB 3MLVH 2YPVL 4S1DC 3S6CA 1TVHB 2NY5C 2C5DC 3ES6B 2WLYA 4G8FB 4DKFL 3OB8A 5EIVA 2CO6B 3ZKQD 5GXBB 2YUWA 4GMTH 4LEOB 4AT6A 4MAYB 2FD6H 3NIDF 4RWYL 5LQBL 4LCIH 1YPZF 2V5SA 5J1AA 2N7AA 2KBGA 4QHKI 4ZO8A 3KR3L 3O6LL 1N8ZB 1OAQL 2IBBA 3QXWA 1ZKAA 5IROA 3MODH 3QHFL 4RFOL 2FO4A 2W0FA 1AGFA 1EVUA 4N8VB 3VFGL 3BN9D 3L5XL 2J7LA 4YE4H 4M6MH 4PG9A 3WEXA 2IC2A 4HS8L 1HXMB 5DD6B 4PJXB 1FAIH 1NEUA 3ARDA 1L0QA 4OF7A 3HI1B 4JDZA 5BQ7A 4UDTA 2R1YB 3UJTL 1CDCA 1IM3B 1BVKA 1X5AA 3U4BL 1KELL 4M7KH 4J8RB 2FEDC 4ELMF 5D6DA 4C59B 4ENED 4U6HA 1ZLSH 4WFEE 4X80L 5CBAB 1MH5A 1IEAB 1ACZA 3MLRH 1UH4A 1FFNA 4NWTL 3JUYA 4HFWB 3HNVL 5KVGH 2Y72A 8FABB 1PQZB 4PJEF 5L9DL 3LEYH 5IQ7H 4OZGB 2HJKB 4GW4A 1SEBA 3MV7E 4MNHB 4F9PC 3DO7A 3T4AB 4L4TB 4L9LB 1FO0L 2V7HA 1G9EA 1MVUB 5I1HH 5AAWA 3DVNA 2ZPKL 1M6OA 1LO3L 1ES0B 3F7QA 3A6BL 4QY8B 1A7PH 4X5XB 1N0XH 2WINB 4MCZA 2MHAA 5F9OH 4Y8AA 2HFGH 5KS9B 4R97B 3VXOA 1J18A 1MCEA 5D2NE 4NO2A 3QA3B 4DQOL 4FQPA 4JQVC 4YHMH 3FRUB 1UFUA 2BVOB 3RKDD 1ZLVK 4K3EL 3RJQB 4BQ8A 1KGCE 2CUIA 1I8LA 3QNXA 4ZFGH 5EN2A 3WFEL 4OFIA 3EO1B 4FFYL 3HUJE 4F15C 5FYJU 1NANH 1J05A 3CSBA 2RIKA 5DJCA 2Z4QA 1DANU 3T4YA 4AL8L 4XP9L 1JE6A 2BDNH 3N9GL 3IDGA 4JREC 2IPTH 4WO4D 1IL1A 4HUNB 1RIHH 3I9GL 2IANA 1NCDL 1LDPL 3HN3A 1F8TL 3WBDA 5CJ8A 1KUMA 3MOAH 4XCFH 5JQ6L 3B5TA 3JWNC 1B90A 3OKDA 4PG2A 4OSUL 1T2JA 2DQUL 4YQXL 4Z7QF 4GLRI 3NPSC 4EUPA 3S3PA 5F93C 4M48L 1FFQA 5DJDA 2PO6D 4QRPA 3KVQA 5DO2D 1MFEH 4LLUB 4NQXB 1KC5H 1YJDH 2E9IA 5FUOL 2HWZL 4BFIA 4X4ZA 4J3VA 4F7CA 4MWFA 5CKAA 2PW1B 4PP2A 1A47A 5I8CB 4HJ0C 4HJJL 4JPKH 4JFFA 3GSNA 4HUXB 3NH7H 5FUZL 4V1DA 5DS8A 5EB9A 5B8CC 2CLZA 5CHNB 3VXSA 1UJ3A 4XCNA 1J0JA 4D9QE 3DGGB 4PRPE 3VDAA 5EDXA 2VXSL 3TP4A 2QR0B 3BD5A 4JHAH 2A6KB 5D96C 1Z0NA 4HUUB 4RMWA 5DI8B 3SQOL 1KIRA 1YQVL 3CVIL 5T5FL 2IEPA 3MV8E 3LS5H 1F4YL 4RAVA 4RX4D 3QEQE 5EU4A 4AENA 1A9EA 4FP8H 3KYNB 5INCB 2YMXH 1F4WL 1MIEH 1WBZA 4LVHB 3SDYL 3O6ML 4X6EB 2SEBA 2GJ6D 2NW3B 3HG1A 2YRPA 3IYLW 1KCRL 1YEFH 4OIAA 2MNUA 1REIA 4JGMA 2B7DT 4RQQA 3RP1A 1AJ7L 4G6KH 1A5FL 1EXUB 1HYSD 2E5EA 4G6ML 4ELKA 2VXTL 5JIKA 3SE9H 3EFDL 3NPZB 5J6GA 2F19H 2NY1D 2VLKE 5F9WC 2BOBB 3SEPA 1ZT7A 4U1LA 5BO1H 2R29L 3IDXH 3PGCA 4DFHA 5EU7C 3H9HB 5K33A 3I6LD 4Q9RH 2AXFB 3ORJA 4Z7VF 4P2OC 1EERB 3GSOA 3T2OA 5DRWB 2H1PH 2XZAL 2LTQB 1X5KA 4MAYD 3J7HA 1LWRA 5C6PB 1LEGA 4HEME 3EYOB 4IJ3C 1H3WM 4PJHB 1E4WH 1QRNB 2IQAA 3FN9A 4PD4J 1A6AB 3QFDB 1NUNB 3PIQA 3FFCE 3SDXF 4AMKH 1UCBH 3IJHA 4KKBC 1PLGL 2PW2A 4HMEA 2CDGB 4YDVA 2QBWA 3EOTL 4HIHA 4DWHA 4MA7H 4UOJA 1ZGLB 3VD7A 3RPIB 1MCRA 35C8H 1IC7H 2HKHH 4O02H 4GUPA 4FQLH 2ZKHH 4PLJC 4YR6B 1JPFA 1NGQH 1IT9H 3WLWC 1KLGB 4TUJB 1F58H 5E8PA 1UZ6F 3VFOA 3LEVH 1GH7A 3PNWB 1VFMA 4NNXA 5ITFA 5BS0E 1VEMA 3LQAC 5A16B 1OP5K 3H3BC 1CLYH 4O2CB 1YC7A 3KS0H 2VITB 3P4MB 4Y4FB 2AJYH 3UYRH 1ZTXL 3B6SB 4XMPL 2O5ZH 5T3XE 3FONA 2J88H 4EIGB 2GJJA 3WNNA 2A6IA 4AEIH 1BEYH 3P73B 2EYTB 5KAQG 5LGHL 3V6OA 4QRRB 3UXFA 5DK2A 1HSBA 5FGBA 3OAZK 1S9WA 4U7SA 4G8GB 4R2GD 1R5VA 3NFSH 1J0YA 5DA4A 5FYKD 3EYQC 4KHXL 4D3CH 4J3UA 2GYSA 4L8CB 4JAMB 4ZFOA 1CFSB 2OJEA 3QIBB 3PGFL 1AR1D 5IQ9B 2MPAL 4QOKD 4LMQI 25C8L 3GJFA 1IAIM 3MJGX 2DQIH 3R1GL 3GIZL 1G7QA 4MA1B 2VISB 1UACH 2CO7B 1AGDB 2VC2L 5J7CC 1FO0B 4ZO7A 1I1RA 1HI6B 4HC1L 1EX0A 3U9UA 2CKNA 4HWEH 4XNZB 4XP5L 5LKNA 3QRGH 5FB8A 1FL3A 4E41D 1ZHLB 2CD0A 4JCMA 2OL3A 1TVBA 1A6ZB 1FVDA 5ABDE 1CCZA 1AY1H 2R0ZL 3G5VB 2D7TH 1BWMA 1MAML 1U8QB 1QBMH 4UDUA 4JFXA 5D7LB 1C5CL 3ARBA 4GAJL 5C09D 2AJ3B 3C8HA 1KCVL 3B3IA 4L4VB 5K9JL 4IMLB 4DCQB 5DJZB 4M6OH 3P9LA 3C87A 5DMIH 4YXLL 1BFOB 5I76B 4UBDD 5K9OB 4PJAE 3BUYA 3IRPX 1HHJB 1RJZB 1N6QH 1SBBA 3HCVB 2EDTA 3T65B 1VGKB 2EDQA 2VXUL 4U1MA 3LKSA 1A7BA 3TIEB 4M6NH 4RSVA 2D3VA 3MRPB 1EEUA 4GOSA 1MREH 3MBEB 1RZKL 4UAOB 2ZCLH 3HI6H 3V6FB 1BJMA 1Q1JL 4YH6A 4NO0B 3LQZA 4DTGH 1T6VN 1T0NA 4JM2C 1CT8A 2EE3A 4YHOL 4O5LH 2DQFA 3BSZL 5KSAB 1NAKL 1W72H 3L3IA 5CJOL 2YA2A 4PTUB 2FEEI 5ETUA 2NCMA 3HZMA 3QXDB 1K8DA 1EJ6A 1F6AA 4M5ZH 1WIPA 4WFGD 3V9FA 5EUOE 2FJHA 3GHEL 3VGFA 5F3BB 2OZ4H 4GAGH 1B9ZA 2HJLA 3KPTA 4U1IB 2P8LB 4JY4B 2GAZA 2CK0H 5I1KH 1DSFH 4FA8A 5F3HB 2R8SL 5GSRB 1SYSB 3FQXA 2IAMA 5DJYB 4PJDE 5CGMA 4BH7B 3WFBL 3KPLB 1I7ZB 3C6LC 1IGML 5TPWH 1ZT1B 5LBSH 4OI8A 4MD0A 4W6WB 1Y18A 3ZL4H 4N0CD 4XCYB 3EOBA 5DVKA 1RFDL 1YEIH 5EOTB 2VDMH 1WUNT 4MA8L 1HN1A 1NBYA 4XAWH 5LCVH 2EDEA 3DIFB 4OLYL 3MO1A 5F7DB 1OARH 5ELIA 4D0BA 4NQEA 1UEYA 4Q0XL 3NCFB 3BPCA 3CPLA 5SWZA 2HJFA 2LQRA 4JG1L 3HZYA 1QRND 1MCOL 1F6FB 4R0LB 1P5UA 4BM7A 4R4NC 5GGVY 1CDGA 2H8PB 2JCCE 4ETYA 4TSCH 5GS0L 2HVJB 2NNAA 3PV6A 5FM8A 3NAAH 3FOLB 3F7PC 5IOPA 2BNQE 4OTXH 2R0LL 4HGMA 3S96B 1MWAB 3O2WH 4ONOA 5E03A 4WTWA 5ISZB 2ENYA 4XC3L 1PDKA 3EYUH 4OV6F 3RL2A 2YD8A 1QO3A 4N0YH 4Y2DB 4P9HL 3GJFK 4U31A 4EXPX 5I8EA 3PDDA 4LCWE 1R5IB 4TSBH 3P4OB 2OLDA 4FMFA 3ZDYE 3W11C 1KXVC 2FHCA 1QFUH 5J06A 4W68A 1MSPA 4BZ1H 5IEHA 4Y4FD 2R23B 1KPVB 3D85A 3KNBB 4HXAH 2EDKA 1IGFL 4H0HB 3BP5B 3NA9H 3QQ9D 4I2XB 4P2YA 4XX1G 1LP9B 5SWSA 1IGIL 3VGAC 3OKOA 1X5FA 2AABL 3JBG7 5IIEB 4JPWL 1E27B 1IC1A 1CDHA 3WXWL 1DBML 3RVXD 5T5NG 2FJGB 5I2IB 1MRFH 2A9MH 4Y5VB 1JF6A 1FFRA 1UKQA 4QRRD 2AVGA 3RNQA 4K9EL 2ILLA 1MLBB 2X10A 4YFEA 5J4MA 1U8KB 3EFFA 4NQTA 1XH3A 4NHCH 2A6DB 4OGYH 1N5YH 4G8GD 2O5XL 2YUXA 5EO9B 1RMFH 4IRJC 1DQQB 4R3SA 4FABL 1CDYA 2F58L 4BQCA 5C2BH 3SY0B 3QIBD 3HE7C 2FB4H 3DSFL 1D6VL 3B83A 4PGCA 1ZANH 1BIIA 3IU4L 3L3DA 5E8NB 1KN4H 3V4PH 5IHZB 5GRZA 4OI7A 3U0WL 5AD0A 1RZIB 2UZXB 1KCSL 5IFHL 3BDXA 4BZ2H 2GSGB 4FQJL 5L8LB 2I24N 1KYOJ 4NKDA 5IKCA 3HFML 5I1DA 1F11B 5IBUB 3UO1L 2CMRH 3MUJA 3GRWL 4K94H 4HLZG 4ZTPH 5IUSA 1I1YB 2ZUYA 1V3JA 1JPTL 1QFWH 4ZUSB 4J3TA 5J11C 4X4XA 3RTQB 4UTAH 4WFHE 1T3FB 2E6QA 4WVRA 1EO7A 3RUGA 3VG0H 4LLYB 5D7LD 3VWKB 3OX8B 2EDHA 3GSNL 3UTPE 5DMYA 4L4VD 4X7TB 3HC4L 3L95B 1NFDE 2XIDA 4P59H 4WW2B 1AXTL 4X98A 3LV3A 3WO4C 3SO3B 3M1BB 3VFNA 5HD8C 5IVXE 1F45A 2NTFA 4NQSA 5EORL 1FYTE 3ZE2E 4KZEL 4GAYA 2AXJA 1JWUA 3O4LA 2NY5L 4NN5C 2CLVB 4X5WB 1V7ML 3MBED 4EDXB 3HAEA 5C0IA 3AU1B 1BIHA 2DYPB 3ELAT 3D25A 1QSVA 3ZT6A 4KJYA 1NMCC 3WIHH 2VDNL 3B9EA 4F37F 4PJBE 1BJ1J 4HGWB 5LWYL 3IKCB 1A7QH 2GSIB 3RVTC 4HV8B 1OAKH 3NOIA 4B50A 1O5DT 1JTTA 3G08B 5KSAD 4QRQB 1CLZH 5FCSH 5EBWB 2CIIB 1DUYB 1OGAA 1A6UH 2PYEE 5GISL 4ODUA 1S7WA 3LKNB 3PHOA 3V5HA 4P3CL 2EIEA 4JLRB 5IMKA 3H3PH 3U2SB 3T0DA 2X40A 3SJVB 3MRRB 1ZK9A 1NL0H 4R4BB 3M8OH 1X4ZA 3O2DH 4L29B 1ACYH 5D1XC 4P46C 5KZCB 2RQ8A 1T1XA 5L2KE 3O3EB 4OFYA 2DTMH 3JV4A 1WFNA 2XY1A 3V52H 2QQQA 4XMLH 3TNNA 1C5BL 2H26A 3OF6D 2VE6A 5TGBA 4H20L 5BZDB 4YAQA 1MJJB 5CJXA 3C08H 4OFDA 4KAQL 2FWOB 2NY0C 1B4JL 4X6CE 2DOCA 4FQCL 4IRSB 4X4YA 5L0QB 1H3XA 2XZCH 3EKCA 3H7BB 4R96B 2XWBA 1CZ8L 4XBPA 1MPAL 2IG2H 1HHIA 3QCVL 3QJFA 1GZPA 3DX6A 1AGCA 2FSEB 5HYFA 4DGIL 2E9WA 1EZVX 3SKNA 3WLBA 2I60H 3D3VA 3UTTD 1IZKA 1JHKH 4OD3H 4POYA 5C0NC 4AT6B 4URTB 1S7SA 2B4CH 2ZUXA 5SX5K 4F58H 3FHQA 5J1AB 4MXWH 2Q76A 5I8KH 1TQBC 4MQ7A 1QNZH 2FO4B 2W0FB 3ZSSA 3CVHA 4U1JA 5ISZD 4Z7WA 1AGFB 4R4FL 2H2PD 3K1DA 1FORH 4HULB 1UADC 4PG9B 3WEXB 1YECH 5F96L 4Y2DD 2VH5L 3LKQA 5BRZA 3ARDB 4IRJA 4JDZB 5MP6L 4MMZC 4B0MM 4UDTB 1BVKB 1VDGA 3S35H 4V2BA 4NRXA 4NJAH 1MLCA 1CF8H 1GGUA 3JXAA 1Q9KA 4NC1E 4ODVL 3UPCA 1ZE3C 5CIPA 2C9AA 3UBXA 1YNKH 1CVSC 3F7VA 1MH5B 1ZOXA 3RJDA 5C92A 2JB5L 2JJWA 1FFNB 4ZFOL 2HFFA 1V8HA 1IGYA 5A40E 2P47B 3E3QE 4P2QA 3RVVD 2X4OA 3GDBA 1MCCA 5EIQA 2AXGA 4GW4B 4XPTH 1SEBB 2ZNXA 3PXJA 4FNLH 1OP9A 3HUJF 4N1EA 1R3JA 3ROOA 3DVNB 3KYMA 1QA9A 2YK1H 5GJTH 1M6OB 2B1AL 5JXEC 2A1WL 3OR7A 5IBLC 5DD0H 1DR9A 2R69H 2BRRL 5EOCL 4N8CL 4YBLB 5C0EA 2MHAB 3PL6D 2R9HC 3VXOB 2BVPA 4YBHA 5HYSA 1DL7L 4OQ1A 4GKNA 1RJYA 4NO2B 2LU4A 2PETA 1F42A 4M4PA 3NTCH 4P2RE 3QPXL 4NM4H 5TE7L 4O4YH 5FM5O 3QULA 1A3LH 2YD6A 3QNXB 4WWKD 5FGSA 2V17L 5EN2B 4ZFZA 3VH8G 2G60H 1LEIA 2R2CA 4PS4H 1J05B 4FXGA 5DJCB 2Z4QB 3ULSA 5T1DL 3RTQD 3T4YB 3VXRA 5IFAL 1I1AD 1IL1B 4OQTA 4U0QB 2IANB 3GKWL 3L1OH 3MLSH 4LMQE 2LU3A 5ICXA 3OKDB 3HC3H 5I1CH 4JRYE 3CCHA 1J9CT 1KB5A 4EUPB 5IW3A 3ARGC 5DJDB 1TQCB 4DW2H 1L0XA 4QRPB 3JWOH 5D1XA 4P46A 2VN4A 1YYLL 2IBZX 1QLFB 4HWBL 1HZHH 4PD4K 2AEWA 3WS3A 1A2YA 5E9DA 3O3AA 4BFIB 1F3RB 2DYPD 4F7CB 4MWFB 1H3UA 1NBVL 3AREC 4PP2B 4TTDD 1A9BA 4JFFB 3GSNB 1QG3A 5JMRA 4KK5C 4V1DB 5DS8B 4MJ5B 4KDVA 2CLZB 3VXSB 1UJ3B 3PP3K 4XCNB 5KVEH 4OCYL 3QPQD 2ARJQ 1FDLL 2VZOA 1SY6A 3GK8H 3U82B 2X4SA 4NZUH 1INEH 1MCLA 4RRPG 5EBGA 5D7JA 4FQ1L 1KIRB 1W0WA 4OZFH 2UZIH 4LGSB 3V79C 1D9KB 3QIUD 4RAVB 1CLOH 5CD3A 3LN9A 5EU4B 2I5YH 4AENB 1A9EB 4PBWD 3QDJD 4ZSOE 1U41A 5KZCD 1WBZB 3O3BA 1JYNA 4F9LC 3HNSL 2SEBB 3LQAL 1QLRA 3HG1B 1FH5H 3C5SA 1BF2A 4PUBH 1CGSH 3VI3E 4KGLA 3B9KA 1U36A 3C5ZD 1DBAL 4RQQB 1MCHA 4IRSD 4ELKB 4JQXA 4JVWA 2MQ3A 3W5MA 2I26N 2OBGA 5J6GB 5KSBA 3I50H 3CDYA 3DNKA 3OAYK 5H8DA 3FTGA 4LSUH 4JRXE 1U8PA 4WFFD 5C8JA 1ZT7B 3B5HA 4U1LB 1I9EA 2ZWLT 3PGCB 2QADC 4EBQL 4HIEA 3UTSA 2F9BT 1XFPA 1HIMH 4LKCB 2NPLX 4QEGA 3GSOB 3PWLA 3O2VH 4LDEB 2AK1L 4LHQB 1DP0A 3ILPB 1LEGB 5FA3A 2IQAB 1N2RA 3PIQB 1RUPL 4JPVL 1X9QA 1I7RA 2ADFH 1FC1A 2VDLH 3P30L 4PRHE 3IJHB 3ZTNL 2F53A 3BD3A 4JO4L 4KHTH 4ERSH 1XF5A 2PW2B 1OAZL 1KTDB 1T80A 2H9GA 4U1KA 4YDVB 4JFQA 4HIHB 5IBUG 1FIEA 5JXEA 4GUPB 3U48A 3ARDD 1JPFB 1UM6H 5E8PB 3ILQD 3VFOB 5T3XH 3TV3H 2V9QA 4KQ4L 4JFEA 2W0PA 4NNXB 5EC2A 5ITFB 5C0GB 4NFBA 5JW5A 4Y0GA 4CMMA 1S9KC 4BQ9A 4IOSD 3BKYL 5DLMH 1FNEB 3GMPA 1LD9A 1NLBL 1TETL 5AZ2H 1XGYL 4F15B 4OZGE 3VXQA 5C7XH 4LCCC 3GM8A 4L4TE 3FONB 7FABH 5IJVA 4KTDH 2A6IB 2BHUA 4KKAC 2EH7L 1I9RL 2W9DL 5DK2B 2NY4C 1HSBB 1NEZA 3PDOA 5KS9E 3S97C 5E1AA 2DLEA 3VMNA 2DMCA 3AMKA 1R5VB 5KJRL 3ULVD 3CFCH 3NPSB 2EXYD 1IARB 4GBXA 2OJEB 3PQYD 4NO5B 4M3KB 4DKEH 2HLFD 3DMMC 5MENE 4M1GH 3GJFB 5EO1A 3J8F7 1EO5A 1G7QB 1FNFA 2IBGA 4PJAF 1GPOL 4G80A 4G8IA 2XICA 1YEJH 5EU6E 3U9UB 2Z8WC 2OQJA 5FB8B 2LE9A 2ERJC 1FL3B 5GGRA 3I02A 4FQIL 2OL3B 1TVBB 3BXNA 1FVDB 2IAND 1PZUB 1VKXA 3IETA 5BVJA 5I66A 1E4KC 1PY9A 2GUOA 4UDUB 4JFXB 5ADOH 4HQQH 5I8OH 4OF0A 3ARBB 1XZ0A 4AIZA 2PUQT 4JANB 2VXVH 3B3IB 5ANMA 1NFIA 5HI5C 5E2VH 4XX1E 3P9LB 3KG5A 4XNQA 1K2DA 1SMAA 2X70A 1G84A 3TGXA 4Z9KB 3BUYB 3LHPH 4QRPD 1MHEA 3GZKA 1HSAA 3WJLA 4UQ3B 4PJ5A 3OB0K 1G7HA 1DBJL 4U1GC 5DGRA 2YUZA 5F7NC 4EN3D 4U1MB 2VXQL 4J3XA 5EUOF 5CMAA 3S4SA 3QI9C 1A7OH 1QP1A 3UAJC 4JFFD 5JMOC 5FCUL 4V1DD 5HDQL 2Q3AA 1S5IL 3VXSD 1ZVHA 4PJ8C 2HG5A 3CDFA 3LQZB 4OUOA 1Q0XL 1T0NB 4PJDF 2VN7A 5F9WB 4E5XA 1JNLH 1XGQA 1CT8B 4U1SA 2BHYA 4HAFA 2DQFB 2NY3B 3L3IB 3BGFC 1JGLL 3SPVA 1S5HA 2HFTA 4XWGL 5ETUB 3HZMB 3PF2A 5DD1L 1K8DB 4WFGE 1D9KD 4GQ9H 4HX1A 4G5ZH 1AC0A 1F6AB 3MYJA 5JA8B 4NRYA 2X1QA 1YUHB 1LO2H 1MCWM 2FJHB 4R6UA 4OIBA 2HJLB 3SBWC 1UCTA 2GAZB 4POZC 3MV7A 4G6AC 3FQXB 4QWWD 1KN2L 2IAMB 4P99A 4OF3A 3ZT5A 4BQ6A 1U3HC 1UT9A 4HFUH 3LZFH 1QFOA 3DYMA 1PFCA 4MD0B 5FM4A 3GEWB 1Y18B 2JCCF 5KSUA 3FAWA 4CNIA 4GH7B 2DQTH 3EOBB 3NIFE 1JFQH 1JK8A 3Q5YA 1RZFH 4OLVL 5CINL 3VXNA 5EZIH 1NCTA 3CFKA 1NBYB 1E4XL 3CVHL 1D5BA 1TZHA 5E8DL 5HGBB 2ZCKH 4NQCD 3MO1B 2BJML 5CCKH 4D0BB 4NQEB 2QHRH 4QYOA 4PJHE 4JKMA 1QRNE 3BPCB 5SWZB 2PXYC 2ZJSL 2HJFB 3QWRA 5GGVH 3HZYB 3ZDZE 3WUWG 2OX5A 1HINH 3CJJA 3ZDYF 2CJUL 2BNUA 1FZOA 1T0MA 5DHVH 4LCCA 3OWEA 3MUZ1 3UTQA 5BXFA 3U4EA 5F7UA 2NNAB 3BGMA 3RZCC 1T7YA 1CXLA 1MCBA 5IOPB 5HDLA 2RR3A 3LAFA 3BJLA 5A43C 3QEHA 1QSEB 3QUXD 3MJ7A 6FABL 3PJSA 3BPLB 4YUEL 4ZS6C 1IGTB 4MA3A 1FGNH 5T1MA 3QIWC 2F8OA 3GNMH 1QO3B 3GSXB 4K2UL 1G6RA 1EDQA 4EI6B 5EOQL 4DOHB 2N1KA 5GS1C 1VFOA 2HH0H 5J1SC 3GBLA 2XQBH 1IJ9A 4ODBD 1UM5H 4OFVA 1QVOA 4CJ0A 3DMMA 3TH3T 1IGCL 3DECA 3TJHC 1DBBH 5IEHB 2LU7A 4P3DB 4RA0C 3X11A 3D85B 1SJVA 2J8OA 1LEKA 5SWSB 4PRAA 3OKOB 4KI5D 2DQCH 1N7MH 4LAQH 1TZIA 15C8H 5DA0B 5K93A 4YHZL 2R0KL 1FNHA 1RUAL 3P9MA 3RNQB 1KBGH 3GSVA 1BQHG 2EXWD 1N59A 4KZDL 1KJ2A 3T3ME 3EFFB 1MFAL 2NXYD 1XH3B 3EAKA 4MSWA 3CNKA 4YFLI 1Q38A 1PKOA 4AEFA 5I75C 1HWGB 5D70H 1GIGL 4R3SB 4OJFL 2MCPL 5I0ZA 2W07A 1JGUH 1VGEH 3QEQA 3MBXH 4ZNEE 4PGCB 2P5EA 1BIIB 5HBBA 4LSQH 3L3DB 5DF0A 3BAEH 2WWMD 1CICA 3NZHL 4ETQA 1NFDF 2NY7L 5AD0B 4FHBD 4YHYC 5IVXF 4F2MA 5BW7A 2FATH 3MRQA 3NACH 3QI9A 3FO0L 4NIKB 1KB5L 4NKDB 5IKCB 5I1DB 5T33H 2AJVH 4OCSH 4NNPH 4PJ8A 1JNNH 5AG9A 2BY0A 1SHMA 4K23L 5KVFH 2VLKA 4X4XB 4Z7NE 3LD8C 4KRPC 2Z93A 5A2IH 5DMGC 5D1QC 1VADA 3KPNA 1CFVL 3FQUA 4HEPG 2CKBH 5I19H 5JHDA 3ARBD 4L4VE 2FCBA 2OR8A 3K0WA 5TE4H 4PJBF 5CLWA 4OLWH 5IT2L 1INDL 3KS0J 5T1KA 1OP3H 4KU1A 5DWUL 4X98B 3LV3B 4KK8D 4OZHE 3VFNB 5IVZA 1SY6L 4J4PC 2NTFB 4NQSB 4HDIA 4GLRH 4S11A 5DR5H 4M7JH 3T0VA 3GBNL 1WCBA 2FYYA 1FIGH 4GAYB 1BX2A 1JWUB 3O4LB 2ZSVA 2OSLB 3WDHA 3TVMC 3NA4A 1MQ8A 1VEOA 1E6JL 1KG0A 3HAEB 5C0IB 3D25B 5AUMA 3T0EC 3QISA 3PWNA 3IKKA 1ZHNA 2BSED 4UUJA 4KJYB 2W9EH 2Z31A 3TT1H 4XHJC 3MROA 4GXUM 3AVEA 1BBDH 4OF5A 4F7TA 4AG4L 1TXKA 2NY3D 4K8RD 3VFPA 3N85H 3WE6A 1OGAB 3GHBL 1AE6H 1QBLH 2P7TA 4X8JA 3GMRA 5LXGH 5ALCL 5SX4I 4JHZA 4HH9A 4NQDA 3TPUB 4NKQB 4X6CF 3SDXB 1TITA 4ODUB 1S7WB 3EJJX 3PHOB 2J5LB 3V5HB 5A2FA 4WI2A 1J87A 2PXYA 2J8UA 1YNLH 1B6DA 2J12B 5DEFA 1FC2D 1KEML 1WAAA 3GI9L 1ROWA 3BE1H 4PJFA 3HPJA 1BGXL 5HHOA 1PW3A 1A7NL 1T1XB 3BPOC 2IAMD 4QTHB 3RZCA 4CAGA 3JV4B 3HNTH 3QCUL 3TNNB 2H26B 4LLQB 2D7MA 4LARL 2VE6B 2VDOH 4OB5L 2XQYG 1BM3H 4JZJC 1UM4L 3KYKL 4X4YB 5GS1A 2XWBB 4AY0A 4XBPB 1NGZA 1HHIB 2DICA 3QJFB 1H3GA 1GZPB 3DX6B 4XC1L 2LVEA 1AGCB 4GRWE 2Z35A 2P4AB 2CGRL 4P23C 3BEVA 4OM1H 5F71A 1TPXC 4NQED 5CSGA 2D0GA 3WLBB 2YD7A 3QYCA 3SKNB 3D3VB 5CP3A 3DJ9A 5SWZD 3L9RA 1N4XL 4FFVC 2FX8H 3E8UL 4U7KA 5GZOD 3MA9L 1S7SB 3S7GA 1Z9SA 1ZLWH 2ATKB 3GBML 3VGAB 3VFUA 5TQ0L 2EDJA 1VPOL 2AJUL 3CXHJ 1OAXL 3RY6C 1N64H 1YJDC 2Q76B 4MQ7B 1QSED 2E7LC 3CVHB 4U1JB 4J2XA 4Z7WB 2D2OA 3QDHA 1L7IL 4M9PA 3VFRA 1ZA6A 1Z2KA 5F9JA 3TA3D 3LKQB 1U8LA 1HNGA 4BQBA 5BRZB 4MXQC 4NQUA 4IRJB 3EOAA 8CGTA 3OJMB 5E24E 4ODTH 4PJAA 2QTEA 1FL6A 4KJPC 1J8HA 3QNZA 4LVNB 4PP1C 3R06A 1MLCB 5GGTH 1VENA 1PAMA 1Q9KB 1S7UA 4XNYL 3DTXA 5CIPB 2WUCH 3D85D 4I2XE 3F7VB 1LP9E 3QUYC 2JK5A 5KW9H 5E6ZA 1RIVL 1I9IH 3JSSA 1IGYB 4Q58C 5C3TA 1NJ9A 4LOUC 4UIKL 4P2QB 1QSFA 3IXAA 1XCTA 4P5KA 5ILTL 2AXGB 3VGGA 5IHUH 1U58A 4UQ2A 5CGTA 3S36H 3ULUD 3EO9L 4HS3B 4IHOA 1ZLUK 1R3JB 4FQHA 3KYMB 3ROOB 1KXQE 1HH6A 1QA9B 3FO2A 3VFMA 4PGEA 1JNHA 2APWA 5F1OB 3MNZA 3VWJC 3OR7B 5ERWB 5C0EB 2ITCA 2UY7A 4J4PA 2BVPB 1OCWH 4WU5A 4GKNB 3UMTA 1RJYB 1I9JL 1TFHA 1T2QH 4FTVA 4XVSL 3TVMA 2DB8A 1T03L 1NCUA 1R0AH 1CR9H 3QULB 3IVKA 3MCLL 5E7FA 3FKUS 4R7NA 3T0EA 4U6VH 1LEIB 1INQA 1HCVA 4FXGB 1AQKH 3ULSB 4X7DC 1OT2A 4M43H 3UZEA 5KAQF 2IPKA 4Z0BH 2X9WA 1WIUA 4HD9A 3VXRB 3BN3B 2CRIA 4GMSL 3GSWA 3QUMH 1A4KA 3GFUA 5E8EA 3QNYB 3H9SA 5L6YL 1BVZA 4ZOAA 2GCYB 4G3YH 5ICXB 2B0SL 1A21A 4S1QH 3QDGE 5IHLB 3SCMC 3MGTA 1YY9C 5E4EB 5HYEA 3GB7A 3CCHB 1KB5B 4XVUC 2DIAA 2R2HA 4NKIL 1F3JA 5T3ZL 5D1XB 5JDJA 3O4LD 2D9CA 1A14L 4P46B 4MCYA 3AUVA 1U8IA 1BBJB 3WS3B 1A2YB 5E9DB 3O3AB 2BNQA 1XAUA 5DD5L 5F7EL 4IIQC 1XGRA 3RAJL 4MHHI 5ICZA 1D5MA 2D31A 1A9BB 1JRHL 2OM5A 1OY3B 3QJHA 2NY0B 4JZJA 5FA4A 4LDLB 2VDKH 4LRNH 3VI3F 4K7PY 1BFVL 3VA6A 4LCWA 3IDMA 4IBLT 1OGAD 1TJHL 2X4SB 3SQBA 1AKJD 2IGFL 3BKJL 1HHKA 2QQKH 3SJVE 4NN6C 4MS8D 5BMFH 3ARFC 5D7JB 5GGSA 1V05A 3BH9A 4FXLA 2QQNL 1J0ZA 4KPHH 4D0DA 5BVPH 4RGOH 1X4XA 4P57A 1ZT4A 5IJKC 3PE9A 1NUFA 1IAMA 5A2LH 1P5VA 2PTTA 3RY6A 4OFYD 5CWSA 1TVDA 4XXCC 1M4KA 1QLRB 3WKMH 2DQJL 3C5SB 2FBJH 4NUJA 3B9KB 4ODWA 3TO4C 5FUCC 4M1DL 5C07E 4RFNC 4UILL 1EV2E 1DVFC 3QFJE 4EI5C 3WS6C 3FB8A 5KSBB 3BWAA 3FTGB 1U8PB 1TENA 4TUKL 5C8JB 1VA9A 4FQXC 5DJ8A 4UMGA 4HIEB 3UTSB 4QXUL 3D3VD 3PWLB 3I6GA 4XBEH 3MX0A 3VG9C 4OM0H 4HKZA 5E5RB 1G6RL 3QUYA 3REVB 2HTKD 2APTA 1FVCA 1J12A 4OD1H 5FA3B 3RWDA 1CQKA 1N2RB 3TJEL 5DZNA 3CU7A 43CAA 1I7RB 4AJ0A 3I3BA 5D9SA 1NUGA 1XR8A 4LK4A 2F53B 1XF5B 1T7VA 5ALBL 2Z0BA 4U1KB 2H9GB 4JFQB 5CD5D 4KC3B 4XNUH 4RMSA 4OZGF 5HVHC 5JOPE 1BZ7A 2K3TA 5BRZD 1F6LL 4IRJD 2XN9A 2HT3D 5C9JA 1MFCH 3BDYH 1NCAH 2XRAH 5IBTH 3V7AG 4JFEB 2R4RH 1KJ2L 3WFCL 5HHVH 5JW5B 4CMMB 3F8UB 5KS9F 2EECA 4O51A 3O81A 5IWLA 4Q9BA 3GMPB 1B0RA 1LD9B 2KUTA 2YWZA 4CBPA 4YO0A 5FYKH 4WCYL 4PJBA 3VXQB 5CGYC 1LK2A 1T66D 4WGWB 4KJWC 5IK3A 4UT6L 4KVCH 5IJVB 5KOMC 3HMWL 1FJ1A 4H1LH 3CSYA 4KTYA 4LHUD 5E99L 1NEZB 3PDOB 3U30C 3EYFA 4Y89A 2FLBT 1DCLA 3LRSA 3T2NH 3QQ3A 3SCMA 5E1AB 5HGHA 4LGRB 2XTJC 4GBXB 1OPGL 3MV11 4MZ2A 1UYWL 5EO1B 4IOIA 4PTTA 4I48A 5B4MC 1IGJA 2GY5A 4IIQA 1P2CA 4JQIH 3HZVA 4G80B 4G8IB 4YHLH 4ONFL 5T5NF 2OQJB 3QAZC 3SGDI 3RVTD 4YDKH 5GGRB 3I02B 3VXRD 2ZZUT 2IANE 4NGHL 3BXNB 4B41A 2HN7A 3R8BB 2DIBA 3IETB 5BVJB 1FLTX 5I66B 3A6CH 2GUOB 2QEJA 2P8MA 1XZ0B 3TBTA 2OJZH 4AIZB 4ZFFA 1AHWC 4OCLC 5ANMB 4JR9L 1NFIB 3ARFA 5CP7A 2WBJD 2HKFL 1BP3B 2G75A 5DUBB 5J6HA 1Q9LA 4L8BA 5GZND 3C60A 1MQKL 4QRPE 1K2DB 2X70B 1C16A 4AIOA 3NCYS 1VHPA 5D1XD 3BT2H 5IJKA 1MHEB 1HSAB 1MRCL 2YPLE 4PJ5B 1G7HB 4S2SA 1ND0B 3MJ9H 2JJUA 4YXHL 5JHLL 1UXWA 4XXCA 4ZXBC 3IDUA 4JFFE 4PGBA 5CMAB 3S4SB 1R3LA 4LP4A 4YX2H 3TO4A 3VXSE 3HR6A 3O0RH 1DBKL 1YEKH 1CDBA 1FFOA 4HLZH 2HG5B 1DVFA 4FFWD 4EI5A 3WS6A 1QYGL 2VQTA 3MR9B 4E5XB 2QKIA 4NP4L 1UWXH 1XGQB 4IDLA 4OGXH 4U1SB 3ROLA 1T83A 1RJLA 5TF1H 2QADB 2QSQA 3HRZA 2MFNA 2FRGP 1NMAH 2ED7A 4NCC2 3SPVB 1S5HB 4XXDA 3NIFF 5D7JD 1TNNA 3V4VL 1GGYA 2ARJA 1HDMA 2DI9A 3MXWH 1F3DH 2VZVA 4HX1B 3NBNA 3MYJB 4NRYB 1AC6A 4GRLC 3TN0A 2AV7A 1JPSL 1H5BC 3L3KA 3HG1E 5C0JA 4PJHF 3UBXG 1QSZA 3MV7B 3B9KD 3ZDZF 1YYMH 3VI4E 1U6AH 4MQTB 2YKLH 5KANG 1BMGA 1WZLA 4OLEA 2OK0H 1V7NL 4HIXL 3H6JA 3MA7A 3OKKB 4K94C 5KSUB 3H42L 1PVHA 3K4AA 4CNIB 1PY4A 2WLZA 1SYVA 2NZ9C 1JK8B 3MUHL 5CZVL 2VDQH 2DQGL 3HTLX 4Y5YC 1ZA3A 2WSKA 3CFKB 5GRJL 2ZUQC 4LLDA 5LGJB 4YWGL 3UTSD 1D5BB 1TZHB 1T20A 2JE8A 4WUUA 2X9YA 4P2RA 3IFLL 4S1SL 1XIWC 4QYOB 2HTLD 3Q2CA 1CN4A 2W65B 1OVZA 4OCWH 2W91A 1VB9A 1AP2A 5K9QG 2QQLL 2OZ4A 5HYSG 1D3CA 3MLVL 2BNUB 1FZOB 4RMTA 1T0MB 3UTQB 5BXFB 3U4EB 1HCFX 3NCYP 5HPMA 4I18A 2BERA 2X05A 1OAQH 1A3RH 3BGMB 3H8NA 3VDBA 3QEHB 3MJ7B 4YPJA 4LCIL 3FT4A 3WCYA 3PJSB 2IFFL 1A6TB 1CXKA 2NY4B 4MA3B 5T1MB 3FQNB 1OGTA 3X17A 1QEWB 1G6RB 3KLSA 2I07A 2QSCH 2WP3O 5EA0H 4JFED 4JM4L 4OIIL 3UJTH 1QVOB 3T3MF 3DETD 4YE4L 3DMMB 4M6ML 5F7MC 1IAII 3UZQA 1KELH 2NMSA 2VAJA 4WUKH 1VEPA 4KKLC 3RHWF 1FAIL 2DQEH 4XAKD 1MCQA 1Z6JT 4J7RA 1DLHA 3PP4H 4JKPL 1LEKB 4M7KL 4C55A 3CLEL 4PRAB 2ERJB 1DJSA 1TZIB 2VDPH 3DHMA 5L9DH 1FZKB 1ZLSL 1HOCA 5EG6C 3V6OE 2XKUA 5SV4A 1F90H 4PRPB 3TYFB 2YXMA 3UPAA 3GSVB 2B8OT 4C83A 5KVGL 1KJ2B 3BKMH 2XWTB 5FO7A 1AHWA 3QUZC 3FMGH 4Z7NF 2H2SC 3LEYL 4U2YA 5GSVA 1S7RA 4M8QA 4Q2ZA 4GBXD 3QEQB 2Q86A 5I1HL 1MJUH 2P5EB 1FCCA 4OT1L 1CICB 4DN3H 1OF2A 4DQOH 4ETQB 1A7PL 3QZWG 3DGCR 4ZXBA 1N0XL 4OZHF 4F2MB 5F9OL 3MRQB 2HFGL 3QI9B 2EDDA 2B4CC 4M9OA 3WFEH 3BRDA 2VLRA 3DX9A 4Q6IC 4TVPL 4WI9A 1DQLH 2NY2C 2PYFA 4PJ8B 3PWVA 1TTUA 2Y06H 3H3KA 2VLKB 4AL8H 3MRKA 3TWCH 2Z93B 2FX9H 4G9FA 4BKLA 1VADB 3KPNB 3FQUB 3I9GH 5DRXA 1OLLA 4OLUH 3MJ8A 5JHDB 3SDDC 1GOHA 4D2NA 2EICA 4M1CD 5MHSE 1BECA 2R4SH 1H8NA 4O58H 5T1KB 3LRGA 4YQXH 1RIHL 4DN4H 2RFXA 4PREA 2E27H 1JMZA 3CFEA 5IV2A 1MJ7H 4HDIB 5C08E 1H5BA 2Q6WA 4KY1L 1KENH 4PJ5D 1WCBB 2FYYB 1X5IA 4XCFL 5DJ0A 1BX2B 1EPFA 1BF8A 2AQ3A 2ZSVB 4HWZA 4RBPK 1RY7B 5HHPA 1H15A 2B20A 2PR4H 3C6SB 5FUOH 2HWZH 1KG0B 1QR4A 2OR7A 5FO9A 3CXHK 4YXKL 5AUMB 3PWNB 1ZHNB 4UUJB 1T21A 5E7BA 3LS4H 3QHZL 4MQXD 1X5LA 5E70A 2Z31B 4HT1L 1B2WH 3MROB 1MFEL 5F1IA 4TNVF 1KC5L 1YJDL 2F54A 5FO8A 4W6XB 5EU7E 4Y5YA 4F7TB 1ZHBA 4D8PB 2QADD 2F74A 1Q0YH 3OL2A 3VFPB 1MFNA 3WE6B 2P7TB 3ZYJA 3NH7L 3GMRB 4X8JB 4HH9B 4NQDB 4XTRD 4WFED 5A2JH 1GGTA 1P7KA 5T1LA 1CWVA 2PXYB 2J8UB 3LVEA 1HWHB 1MHHA 3QO0B 3D0VA 4LF3B 5DEFB 5T5FH 4F33A 4GRWF 4JHAL 4PJFB 4M6AA 3HPJB 3HLAA 1C7TA 2YD1A 5HHOB 4XP4H 3MV7D 3SDYH 1FP5A 1OT1A 3RZCB 1VFUA 3U6RA 3D48R 3HR5A 5CSZA 4YHNA 1KCRH 2XY2A 2KZ1B 4FXKA 2KZWA 4LU5H 4YEEA 2AQ2A 1WK0A 1UKSA 1I3UA 3FRPA 2WIMA 1PJ9A 2FHFA 4P4KC 1WTGT 1YN7A 1NGYA 3A67L 1YEFL 1NGZB 1EHNA 3BZ4A 4NQEE 3HE6C 5GGQH 5MENA 4G6KL 2Z35B 1MWAH 3BEVB 1WEJH 1NEZG 4Y2OA 3SE9L 1KGCD 2F19L 3L9RB 1BZ9A 4WU7A 4L1HA 5EU6A 5BO1L 1EO8H 3IDXL 2WV3A 3FHAA 4JO1H 3OKMA 3VFUB 3EZ8A 1K5NA 3TO2B 2W1NA 1KNOA 4NQVA 1U8MA 2EDBA 1LP9F 1EBAA 2AQ1A 3LPFA 1KSRA 1PLGH 1E4WL 3O45A 4UTBL 2EIBA 4CVXB 3MNWA 3VFRB 5CBEB 2ZG1A 5B21A 1ZA6B 3ESVF 4KMTH 2O5YL 5F9JB 4AMKL 1U8LB 1UCBL 2R0WL 4M4RA 3EOAB 4XPGL 1GOFA 4X6DA 1NGWA 4Q6YA 4PJAB 1FL6B 1G7MA 1ODAA 3F12B 2J6EH 1J8HB 3QNZB 3WIIH 4BZYA 2J4WL 35C8L 1I3GH 3R06B 4PRBA 4WNQA 1MCDA 2HKHL 4O02L 5EWIH 3STLB 3G6DL 1S7UB 1EK3A 5HYIA 1CFTA 2LABA 1S9XA 2EDRA 3PHSA 5JTWA 4YHYB 3BEWA 5E08H 2EYSA 2FJFA 5SWSE 3LEVL 1OL0A 4D94A 4HKJB 5DQJA 3DURA 2JK5B 5H2BA 4IRZL 4XMPH 1NJ9B 3MXVL 3SDAC 4WHYH 1EMTH 1FLRH 1QSFB 3OPZH 3IXAB 1XCTB 4P5KB 4QO1A 3WFHA 4PRPD 3ULUE 4J3SA 4RIRA 1U58B 4UQ2B 5JZ7C 1Y6NR 2AJYL 4IHOB 3SDDA 4O2EA 1A0QH 3TZVC 2EIZA 1J0KA 4FQHB 2O5ZL 1HH6B 3FO2B 4HUVA 1Y6KR 3VFMB 1IC4H 3V5KA 2Q3ZA 4PFEA 5HI5D 1JNHB 3MNZB 3MV8D 1P1ZA 2J88L 1IBGH 3QEQD 2ITCB 4AEIL 1BEYL 2ESVA 4KHXH 2XNAA 2P5ED 4NNYA 3QG7H 5DEZA 4WU5B 4WW2F 1CICD 2X09A 4F57H 5DTFA 5EU3A 3WN5B 5D7SL 2MPAH 2X4QA 4C58B 1WWWX 4FTVB 4TSAH 2G2RA 25C8H 2BCKA 5F9AC 3TVMB 2RCSH 3NFSL 5IB1A 3GIZH 3QI9D 4D3CL 3IVKB 4R7NB 4LLWA 4Z6AT 1EJOH 5DMKA 1INQB 3IU3A 2VLKD 1VFBA 3QEUA 2IPKB 4JVPA 1HILA 4X8XA 3RUGE 3P9WB 3V7AE 3VXTA 3K74B 3O6KL 3QQ4A 1DQDL 3UPRA 3GSWB 4J23A 1A4KB 5E8EB 3DRTA 3H9SB 4P9MH 4HWEL 5FDWA 3QRGL 5D5MA 3BJ91 4GAJH 5I1GH 5IFJA 1CFQA 1ZLVH 1K4CB 5HXMA 1T6WA 1OAUH 1XF1A 3MGTB 1NGXA 3GB7B 5IM7A 5IB2A 1AY1L 3C09C 3SGKC 5DXWA 1OTTC 5HTSA 3O4LE 2MMXA 2R2HB 3D9AH 1QBML 5F8QC 3DXAA 1F3JB 2ZG3A 3OXRA 1XF4A 4MCYB 4X9GA 3BPOB 3WXVH 1IM9A 1U8IB 4M6OL 2VXUH 5GS3A 2BNQB 5DFVD 4LNRA 1XGRB 3INUL 1TJGL 1D5MB 5ICZB 5D7IE 2D31B 3BD4A 5HDBE 2Z31D 4K7PH 4LIQH 1E28A 4HH8A 3LEXA 3QJHB 4JZJB 4JKKA 1Q1JH 1IQDA 5FA4B 3TM6A 2HRPH 3U9PL 4MD5A 1CDIA 1P6AB 4M6NL 2UYLA 4LCWB 3IDMB 5IMMA 1JP5A 2H3NA 5BS0D 4YHOH 3HE6A 4C56A 3BSZH 4NQDD 1NAKH 3HI6L 5CJOH 3ARUA 4RAUA 1HHKB 4KXZI 3WFDH 4GAFB 4GJTB 4DTGL 3M17A 1SM3L 5GGSB 1PYWB 3BH9B 4ZO6A 5FV1L 2UUDK 4JFPA 4O5LL 4P57B 4XPAH 3H2WA 1ZT4B 1W72L 4X6BA 4KK9D 1IZJA 3UP1A 2B5IC 5HHOD 5DJ6A 1UZ6E 2J3SA 2PTTB 3RZCD 3L5WB 5GS2D 5CWSB 3ZTJG 1XF2B 5TDNA 3WYRA 3HZKA 2R8SH 2CR6A 2X4NA 4U6XB 4M5ZL 5INDA 1J5OH 3K4ZA 1PG7H 4NUJB 2NQCA 2Y5TA 4ODWB 3OG4B 4HUKB 2OZ4L 4GAGL 1TCMA 4LLAA 5HVFB 2CK0L 5I1KL 4LEXH 1IEHA 3FB8B 1JGDA 3BWAB 3OHXA 4FQ2L 4ZNEA 5TPWL 5DJ8B 3D3VE 3JTTA 2CDFA 3O41A 4OLYH 4PR5A 3I6GB 5I15H 4Z76A 4HKZB 1KLFA 4IMKA 3WNKA 2N56A 2X4UA 4Q0XH 5EZJA 3OAUH 1YEIL 2GQHA 3QUYB 4ZAKA 3JWDH 1FVCB 4LSPH 2CK2A 3SKUD 4XAWL 3TNMA 5LCVL 3RWDB 3GSUA 4GKSA 5EUKA 4LFHG 4UT9H 1OARL 3STBA 43CAB 4NT6A 1NDGA 4Q9QH 2NY6C 3IFOA 5D9SB 1XR8B 3BOVA 3W2DH 4Z7WE 3RVUD 5J8OA 1QTYT 1I3RA 3NCCB 2R0LH 3TZVA 5BRZE 1TZGH 5IB5A 5EBLA 1BZ7B 2XPGA 1PZ5A 2HLAA 5CZXC 4TSCL 2XN9B 32C2A 1ORSA 2AW2A 3NAAL 3WHXA 5C9JB 2BP3A 4PB9H 3GMOB 4OTXL 5GJSH 3I2CL 4I9WD 4X0KA 3O2WL 3BISA 1KCUH 1BVLA 1FRGL 2X4PA 1BFTA 4N0YL 3I6KA 4O51B 5JO5A 3QP3A 2X89A 4L8SC 1B0RB 3FFDA 1IEBA 5BZWA 2I9TA 4YO0B 3Q6GH 4P2QE 4TSBL 1U8OB 5C0AA 3RNKA 3ULVH 1IGFH 4LKXA 3KPPA 4PJ7A 3CU1A 4KROC 3DUUA 1QSFD 4PJBB 3RGVD 1LK2B 1QFUL 4CVUA 5IK3B 4UV4H 1DBMH 2Z92A 5F7KC 1IE5A 4S1RL 3NA9L 4J6RH 2V5MA 2V2XA 1FZJA 1J1OH 2PYEB 1K4DA 3MRBA 1T89C 4HF5H 1OP5H 3EYFB 1Q9WA 2BHZA 4XP1L 3KDMA 3LRSB 3SCMB 2Y6SC 3VH8A 5IG7A 1I1CA 1MRFL 5HGHB 1TDQA 2A9ML 1BQLL 4O2FA 1QZ1A 4KDTA 5ICYA 3AS0A 5DD3H 2FH8A 1D6VH 4JFHE 3CXDL 1I75A 4JJHA 4G6FB 4FTVD 4NHCL 4OGYL 2AJZA 2WUBH 5E6IC 1CQYA 4IOIB 4PTTB 4I48B 1RMFL 1IGJB 4KFZC 4PGDA 3VU2A 4BK4A 3MRJA 3U0WH 2CH8A 2RBLA 3DVGA 4IIQB 1P2CB 5C0RH 3HZVB 2WANA 5IFHH 4DGYH 2FB4L 2KPNA 3RWJA 4EUPH 1ZANL 3OAZH 3LDBB 3VXRE 3UO1H 3V4PL 1FFPA 5J56B 2AKRA 4X6CB 2Q7NA 1H9VA 1BAFL 2HN7B 5DUPL 1XF3A 3NCBB 4BFBD 4BZ2L 3BYTA 5ESAA 2P8MB 5KBNC 4K94L 4ZTPL 1CTOA 3TBTB 3GSNH 1QFWL 4ZFFB 3EGSA 3ARFB 5CP7B 4HWUA 2G75B 3ZE1E 4UTAL 5J6HB 1Q9LB 4L8BB 4EDWH 3C60B 1LE5A 2DBLH 1C16B 4M93C 4OD2A 4L3AA 1U8HA 4KTEH 3DUHA 3EJYD 3V8OA 2Z91A 1JPGA 3MGOA 3L5IA 1JUFA 2P5WA 1EUTA 4S2SB 5E9DE 4KZEH 4YNYA 1UXWB 2GJZA 2OYPA 2BNQD 3L3JA 4P59L 4PYHA 3P0YL 3L7FA 2EO1A 4OCNC 2A9NH 4RRPA 1AO7A 1V7MH 2XYCA 3TO4B 1J10A 4APQC 5LGKA 1FG9C 4RFNB 1RAMA 1FFOB 5IB4A 5JPMA 1DVFB 1NCBL 4EI5B 4DVRH 3VMPA 4LCWD 3VI4F 5HHNA 3AGVA 1CGUA 2QKIB 4LBEA 3S3JA 3KLAA 1JBJA 3ROLB 1RJLB 3HRZB 4CU8A 1LO5A 4NBYB 4OUUB 4XXDB 3VG9B 1YMME 3O9WA 1A7QL 2ARJB 1HDMB 2LAGB 5GISH 5SX4H 3LB6D 1OAKL 4P3CH 1SEQH 1CLZL 2Y9RT 5KSVA 3TN0B 1FNLA 2AV7B 4W6YB 5J1TC 2AEQH 1L7TH 3L3KB 1A6UL 5C0JB 1V3LA 3MUGA 2BSRA 2EZ0D 1Q9OA 1CIDA 1BLNA 1Z0MA 1G7JB 1NL0L 4CU7A 2OTWB 3BZFA 4FMKA 3M8OL 1C1EH 1JJUA 3MA7B 3O2DL 5HVHB 4HGKC 1ACYL 1F2XK 5KSBE 5EZOL 1L6XA 3O6FD 4MVBC 4XPBH 3SGEI 1SYVB 3ZKNC 3P4NA 1ETZA 3V52L 1ZA3B 1CZ8H 4XMLL 3GMNA 3QCVH 3R8QA 4LLDB 4XWOD 1T20B 4P4RA 4WUUB 3C08L 5EZLB 4P2RB 3GO1L 1NGPL 3TBVA 2NZIA 3FQTB 2XZCL 3QUYD 3KLHC 2IG2L 3TC9A 3VXME 3O8XC 1AP2B 3V0WH 1FV1B 3RX8A 4OAWB 5FDYA 2F53E 2V5YA 2F5BH 4K55A 5EIIB 4WFHD 1JCKA 4I18B 4PJ9B 4CDHA 1JHKL 1OB1A 3NGBC 4Q74A 2NX5A 5D1ZC 1U3JA 1LMKA 1QHOA 2WWKO 3T3PE 2B4CL 3UTPD 1I7UA 5AYQA 3U30B 3QDGA 1OGTB 1OSPH 2XN9D 2XT1B 2K7PA 4U1NA 5F96H 4JHWH 4JFEE 2XZQH 5I8KL 4Y4KD 1PSKH 2ICWI 2I07B 4MNQA 4ESKA 2VMFA 3Q5OA 1QNZL 1FYTD 2JIXA 5EOCJ 1P9MA 2HT2D 1UB5A 1FORL 5IESL 3TH4T 3VXUA 4XAKE 4JN1L 2E8ZA 4RMQA 4ODVH 1ZVSA 4MJ4A 3LQMA 3NCMA 1DLHB 2JB5H 2HT4C 3ZKXB 4NJAL 5JW3L 3VD4A 3ET9F 1LGVA 1KPUB 4TUOA 4UB0H 1HOCB 2I27N 2C3VA 5F7LB 5J13B 5I9QC 1BQUA 4U0RC 1RUMH 1QR1A 2PYED 4C83B 2VNCA 5C2UB 4NWUL 5FO7B 5I71C 1AHWB 4IDJH 3SCMD 3SE8H 2A6JA 3L6FA 3MTRA 5GRUH 5GSVB 1S7RB 4XPTL 2OL3H 4M8QB 1PBYA 2BRRH 1WIOA 1D7FA 4HCRA 3T8XA 4Q2ZB 3ALWA 2Q86B 4G6FD 3CAFA 3K8MA 3E2HC 2YK1L 2BY2A 3OR6A 4WEBL 1GAFL 2EC9T 4GG8A 1OF2B 4WGVB 5DD0L 3I75A 4HW6A 2R69L 4J1UA 4ZXBB 3V5DA 1NC4A 3ZDXE 2DM3A 2V17H 3BESR 5C07A 2VLRB 3DX9B 2PYFB 2V5TA 3BQUC 2FGWH 1K85A 3QFJA 3W9EA 3K46A 3PWVB 3G9AB 3MV01 3NTCL 4RFEA 5T1DH 3MRKB 3T1WA 1A3LL 4G9FB 1K6QL 4BKLB 1CFNA 4ENEC 5DRXB 4NC1C 1G7LA 2WAHA 3MJ8B 4UOW0 5ANME 4KKCD 2G60L 1UENA 1TJIH 4PS4L 1UG9A 2LV4A 2ZCHH 5C6TH 1T5XA 3C60D 5H37H 2RFXB 4DKAA 4PJ5E 3L1OL 5IV2B 3MLSL 5JNYA 2Q6WB 1H5BB 4JCLA 4KWUA 2VLJA 3B2UD 1T04A 4H8WC 4K8RH 4LPXA 5GRVL 4PJIF 4PRHB 2MCG1 2ORBH 4QT5A 3HC3L 4HWZB 4RMRA 4B7LA 5HHPB 1H15B 1ZMYA 4LQ1A 3UYPA 1HK6A 3TO4D 3OKLA 1MF2H 5FO9B 1LE9B 5GRXG 4PV9A 4ZPVA 1P4BH 4FG6D 4ZPTA 4UINL 5F1IB 1HZHL 2B1HL 2F54B 4N0RA 1P4IH 5FO8B 4Y5YB 1ZHBB 5T3ZE 1EIBA 4ORZC 2F74B 3RKDC 2ZUQB 2CKBA 2IALA 3OXSA 1H8OA 3DX8A 4WI4A 4OFKA 1A3QA 3SKMA 2E9BA 1P7KB 5T1LB 5KVEL 4YGAB 5MERA 4FQ1H 1K9TA 1MHHB 3TN0D 3D0VB 3GK8L 5DJ2B 4WO4C 5HHQA 3UTZA 1INEL 1E0OB 3KXFE 1QPXA 1IKNC 3HLAB 1EGJA 1JHTA 4MD4A 4CN4A 1LQSR 2Y36H 3RIAK 2YC1A 2F8XC 3U6RB 5DVLA 1ZSDA 3RWGA 3HR5B 3KPRA 4YHNB 1YQ2A 2HVKA 2OTUA 4FXKB 2I5YL 1U2HA 2Z8RA 3CFJB 4LLMB 2VL5A 2EDOA 2PO6C 3WUWA 1OTSD 5E2UL 2H32A 1H3VA 3FJTA 4K7FA 5DO2C 1H8SA 3CMOH 1FH5L 1YN7B 4PUBL 1CGSL 1NGYB 5DSCA 1BD2E 1CE1L 2JELH 4NKOA 3BZ4B 5MENB 4EBQH 4WUUD 5L7XH 4P2RD 5DJXB 3I50L 3TT3L 4MAUH 1BZ9B 4LSUL 5DGQA 5D4QA 4DGVH 4WU7B 5DVOA 1FNGA 3RWHA 1ZS8A 5EU6B 4ODHL 4KK6D 1EHXA 1R6VA 3OKMB 3EDJA 3G6JA 1CDJA 1JTOA 1HIML 1K5NB 5E1HB 1RUPH 3O2VL 3ARVA 4JPVH 4NQVB 4PJ9D 1U8MB 4WTZG 3ZE0E 2VZ3A 4K71C 1NSNH 1OAZH 3QWOA 4RMUA 5GGUA 4XI5D 3O45B 1UH2A 3MNWB 4WI6A 5K59E 3QCTH 4JRYD 4KRLB 2ADFL 2VDLL 1F3DJ 5FYJL 3ULUF 3TLRA 3GRWA 1NCCL 4WTXA 4X6DB 1NGWB 4PJGA 1G7MB 2YPLA 3ULUH 4WNQB 5I6XB 4PRBB 2ZUVA 3AXLA 1URLA 3TFKD 1CFTB 1BQHA 1M1SA 1S9XB 1UM6L 1HYSC 4LLVA 3VRJA 3BKYH 2FJFB 2QL1A 3TV3L 2C3HA 1NLBH 1F02I 5DHXB 1KJ3H 5DQJB 3DURB 1YEGH 2V7NA 1XGYH 1MI5A 3PV7A 4I0KA 3BQUA 4R7DA 1KCLA 3MSPA 4JFDA 3WFHB 1FNAA 4XNMB 1WZKA 4RIRB 4X9HA 5AZ2L 3GGWA 4MAYC 4O2EB 3SDDB 2EIZB 5CUSH 5F7FA 4HUVB 5IEKA 5I17A 3RUGF 4OZIA 2R39A 2BFVH 1P1ZB 4Z7UA 7FABL 3X3FH 3MGAA 4KTDL 2P5EE 1KJVB 5GHWH 5KJRH 2ESVB 1YN6A 1WQVT 5L2JA 2XNAB 5C0BA 4NNYB 5DTFB 5EU3B 2X4QB 2G2RB 3OJ2C 2BCKB 1VSCA 4R90H 1B0WA 1N5AA 4NZRH 5CLTA 5IB1B 2M26A 3CFCL 1A4JA 1J1PL 1CXHA 4LLWB 2VLRD 4Y16D 4DKEL 1R3IH 2YPKA 2VUOA 4NRZA 5M95B 5DMKB 4TVSa 4M1GL 3IU3B 5AYUL 3VD9A 1HH9B 1VFBB 3QEUB 4OV5A 4JRXD 1HILB 3VXTB 4PB0H 3SGDH 1JL8A 2BVUA 3HC0A 4G9FD 5JHDE 4JG0H 3QQ4B 3UPRB 2J8HA 2UVFA 3WNMA 5D7IF 1YEJL 3HAEH 3I85A 3DRTB 5HDBF 4YC2B 3WKNA 4X9BA 5FDWB 3SDCC 2WM0A 3CZFA 4OFPA 2FECL 5D5MB 5JW4N 1IFHH 5J12B 4W81A 5IFJB 3U0PA 3B9VA 1UH3A 5IB2B 4KRMB 4F7EA 1JZ2A 4L9LC 2EIDA 5IR1A 3DXAB 4HQQL 5I8OL 4F9PA 4PRHD 4YFDB 1RZJH 2VLLA 2WP3T 4UV7L 3OXRB 1XF4B 2VXVL 2UZYB 2P46B 5E2VL 1IM9B 2GY7B 4LRIC 4ONGL 2B2XH 3CGTA 2VXQH 4LNRB 4R2GC 2W60A 1O7VA 4R97C 5FCUH 5HDQH 4I3SL 1E28B 4UIMA 2NZ9D 4JB9H 1AR1C 4YBQD 1HXYA 1IQDB 3G5ZA 4MD5B 4QNPE 2UYLB 2D7OA 4JQVA 1ZVYA 4M61B 2H3NB 1A7OL 4NQDE 4A2LA 5LVEA 5FHAL 1K8IA 3HE6B 3RIFK 4C56B 5J3HD 1QLEH 4X7FC 1IAOB 1II4E 1JGLH 4YHKH 4RAUB 5ITBL 1JPST 2J8UE 5T1LD 3M17B 2D7PA 4OGAD 1WAAE 5DD1H 3L5JA 4KQ3H 2FIRT 4HXBH 3MACH 2L4OA 4PJFE 3GSQA 1CXIA 3BIKB 4JFPB 5HHOE 4JY5H 5IW6A 4L4TD 3PP3H 2XG5A 1GGBH 3CH1A 5DJ6B 4JFZL 3WD5H 3UEZA 1Z9LA 2JJSC 3STZA 5HPOA 3RY5A 5TDNB 3HZKB 4GQ9L 2X4NB 4G5ZL 5INDB 2EDYA 4QXGH 2HYMA 1LO2L 2Y5TB 4HBCH 3S98A 1KT2A 2AS5M 2GT9A 4RISH 4HMCA 3B2VH 3HRPA 4WY7L 1OTUD 2NLJA 4QXTA 1RK1A 3CD4A 3CFIC 1AI1H 4Z7WF 3JVGC 1JGDB 4RGMC 2OP4H 3OHXB 4OLVH 3PWPA 1JV5A 3MLXL 4U6YA 5MEND 2VIRA 4PY7A 3QXVA 3CVHH 3QT2A 3RBSA 3JTTB 2CDFB 4ZQKA 3D0LA 3O41B 1UB6A 5TQ2L 4PR5B 1ZLWK 3CX2A 2DTSA 1GGIH 2HRLA 4Z76B 1JFQL 2X4UB 1TNMA 3FQWB 1PKQE 2Y7QA 5EU6D 5EZIL 3ZLQC 2VABA 4ZAKB 4DKDC 5B8CA 2E7HA 1JWMA 4CVZA 3E0GA 1C7SA 3TNMB 5I73B 3GSUB 4GKSB 5BV7C 5EUKB 2ZCKL 1NUDA 2CIKA 1G1CA 4U1HA 3OAYH 1ZAGA 4ZUVA 5CCKL 2QHRL 4NT6B 1IAKA 1NDGB 4PY8J 3IFOB 3VW3L 9CGTA 5CIPH 5GGVL 4YK4B 1I3RB 1IQWH 2XFXA 1MAKA 1Z5LA 3IGAA 6FABH 3GIVA 5IB5B 5EBLB 2NXZB 4NZTH 3S8WA 2XPGB 2YR3A 1PZ5B 2DD8H 2HLAB 3BX7C 1N8ZA 1ORSB 4I4WA 3WHXB 1J8HE 1SJEA 3LN4B 4I9WE 4OZHB 2KKQA 4KH2A 5C08A 2PN5A 4X0KB 5F1SA 1RSFA 1BVLB 2X4PB 4MDJA 4MB4A 5AAMA 1IAIH 3I6KB 5FOBA 4NUGH 5DD6A 2ZP0T 1PG7W 3I84A 2I9LA 2HH0L 2Q8AH 4HCRL 1IEBB 2XQBL 5BZWB 4QRSA 3IAGC 3BKCL 1IM3A 5C0AB 1QSFE 2XACC 1OM3H 4LKXB 3KPPB 4PJ7B 3DUUB 4POUB 1DQMH 1DBBL 1X5YA 3QEGL 1NPUA 2A74A 2Z92B 3LIZH 4P2OA 4HWBA 1H3PH 4FFZL 5SV3A 3IF1B 2ICEA 2V2XB 1FZJB 3SDCA 4JFOA 2XV6B 2DQCL 5DQ9A 3MMEB 1K4DB 3MRBB 1N7ML 4PJIA 4R9HA 1MFAH 1Q9WB 4LAQL 15C8L 3KDMB 1MRDL 1T22A 3VH8B 5IG7B 2ESVD 3C09B 1GIGH 4XVJH 4O2FB 4MNHA 2Q8BH 5AG8A 4OJFH 1KBGL 4L9LA 2APXA 4OQTH 4FTVE 1MVUA 5FF6A 1RV6X 2AJZB 1FVEA 1U8NA 3ZE1F 2QHLA 3U7WH 3T0EE 4PGDB 4X5XA 1RVFH 2NR6D 3MRJB 3OBAA 3DVGB 1EHLL 4E42A 3MBXL 3H9ZA 3AM8C 2D9QB 3RWJB 1KB5H 4C57C 4HMDA 4LSQL 3BAEL 3MRLA 1FFPB 4XCCL 2AKRB 4Y5XB 4WHCA 4QOKA 4K23H 3RDTC 2IPUG 4YDLB 3H9SE 3S36X 4CMHB 1XF3B 2G9HA 4FQQA 3NACL 4KUCF 4RMVA 3T0BA 4H1LA 5C0CA 5ESAB 4Y4FC 4GRWB 1CFVH 5DQDH 1MJ8L 2XQYK 5T33L 2AJVL 4OCSL 4NNPL 4LSVH 1JNNL 1RQ5A 3QQ9C 2YD9A 5KVFL 3EGSB 1JHLL 3FRPG 3W82A 4E41A 2ADIA 4KV5E 2OI9C 4FZEH 4TVPE 3D18A 1YEEL 3B9DA 1LE5B 4WIQA 4OD2B 2CKBL 3DXAD 1U8HB 5CS7A 3RVXC 5I19L 2Z91B 4M7ZB 1JPGB 2B5IB 5TE4L 1JUFB 2P5WB 3UTOA 4OLWL 3V0VA 5J89A 4X7CC 1IM9D 5C09A 4YNYB 3V6BR 2VKXA 2GJZB 3L3JB 3L7FB 3ZSTA 3R0MA 5H94A 1AO7B 2KDGA 5DR5L 2IQ9H 1CD8A 4M7JL 3U83A 4ZUTA 5GGSY 1FIGL 4YHPA 5ID1A 4ZS7H 1KXTB 1EGJL 5EO0A 5IB4B 5JPMB 3JVGA 4GXVH 2DKUA 3SKJL 1MEXH 5HHNB 5FGRA 1GGCH 2MTPA 4LBEB 1X5JA 3KLAB 4NFCA 4Y4HC 4AG4H 4C56D 3OB0H 4XH2A 5KSBF 1WTLA 2MKWA 3RVWD 2GFBB 2W9EL 1LO5B 4HUXA 4HKBA 1NAMH 4H25A 1U93A 3O9WB 2WQ8A 5DRZA 4D9LH 1BBDL 5KSVB 4AQOA 3N85L 3FOMA 3P2TA 1S9YA 3SOBH 5LXGL 1AE6L 1G0DA 4B7IA 4BUHA 4L5FH 3MUGB 2EC8A 2R56L 3TH2T 4L4JA 4HUUA 2BSRB 4WI5A 3B8YA 1Q9OB 1RUKL 4C4KT 1YNLL 1IKFH 1BLNB 1MOEA 4OF6A 3QCUH 3BZFB 2MOVA 4NC2B 3BE1L 4LARH 4TRPH 2K1MA 1H0DA 3DV6A 1C5DA 3OZ9L 1MIMH 5D2LE 5A3IC 3PXHA 3P4NB 1ETZB 1NFKA 3T3PF 3HNTL 3CK0H 3GMNB 3HB3D 1YEHL 1GJIA 1CE6A 2OS7A 5HI3D 4P4RB 3IJSA 4UNUA 3TBVB 3M07A 3F65A 4ZAKD 5HVWA 2A2QT 2VZTA 4P0DA 3PGDA 4HAGA 3P40A 5KSAC 3Q1SH 4JM2A 4OM1L 3LPWA 1R24A 2AJUH 1OAXH 3LH2H 5JZ7D 2FX8L 5DK0A 5BJTA 2NX5B 4OLZL 1I7UB 4MJIE 2NXZD 5GRWA 5HHXH 2XN9E 3MFFB 4NO3A 1JYXA 3QDGB 2BOCA 1N64L 4U1NB 4AEEA 3MV9A 5EPMA 4Z77A 3EJZC 5DJAA 1FE8L 2JIXB 4LPTA 4NN7B 4N5ED 1UB5B 1ZGLA 1KTKE 4JE4B 3VXUB 2JB6A 3ARXA 3C6LA 5KVDH 2X89D 1ZVSB 3N0PB 1KFAH 1WV7T 3GM0A 1LNUA 4ZD3L 1U95A 4NO0D 2AEPL 4ODTL 3DRQA 5D7IA 3AM8A 5HY9A 3HI5H 4PLKD 4H8WL 4XBGA 1RIVH 2EO9A 5GGTL 5FYJD 4TUOB 3OTTA 3RDTA 3T2QA 4Y8DC 4O00A 1WISA 1QRKA 3UX9B 5ILTH 2C3VB 2KQMA 2ED8A 3NCEB 3ZDXF 3A6OA 1DLFH 3TPKA 5KW9L 1QR1B 3SO5A 2VQUA 4GSDH 2N4IA 4Y19E 4KMQA 5JUEH 2BSTA 3B8SA 2A6JB 3AC0A 3L6FB 4PJCA 4YZFE 2BXZA 3C8DA 4OCMC 2VO5A 3S36L 3T8XB 4BFGA 1FSKB 5ESQA 1YC8A 3QUKA 1EFQA 5E5MA 4Q97A 2VUYA 1A1NA 3OR6B 3CFBB 3MLUL 2H2PC 3OJVC 4GG8B 4KI1A 3I75B 4LCUA 4Y2DC 1BJ1H 3OJDA 1N26A 1CXEA 3MCLH 5C07B 3CSPA 4TPRH 3X14A 4HPYH 1T2QL 3QFJB 3W9EB 3JZ7A 3FO9A 3EYSH 1KV3A 1CR9L 2RB8A 3IFNH 4Y4HA 5CEXA 1CFNB 2DJUA 4XMKH 5ACLA 1G7LB 1RIUH 2E6JA 4U6VL 2WQRA 4M43L 2B0SH 1UZ8A 4AQ1B 4GG6A 3HPLA 5I1LA 1I7TA 3RVVC 1S7VA 3ZKMD 4IOFC 5JNYB 2V9RA 4Y5VC 2MWCA 5HDOA 2VLJB 1T04B 4S1QL 3ZT7A 4QT5B 4NC0B 1KEGL 5CEZL 5TDPA 1X7QA 2AK4A 4NJ9H 4OZFG 4IMLA 5FUCE 1U91A 1AO7D 3N1MC 1FHGA 4N68A 2X1WL 2RAMA 3OKLB 3PL6C 4N90D 5DURB 4PV9B 5BQ7B 4WEMB 4ZPVB 3SHSA 3HE7A 4YHIA 4NOBA 4ZPTB 3T65A 5B39A 1W0YT 5IVOA 4NZDA 1BFVH 2IALB 3OXSB 4F7MA 3WMSA 4U6HB 2BNRE 3DX8B 4WWKC 4UNVA 4XP6H 3O9WD 1CD1A 4G6JL 1KIUA 3SKMB 3X3GL 2VDKL 2GW5A 4KXZH 4LRNL 1AXSA 1U8JA 3RTQC 5MERB 1HEZA 4OCRL 1OD9A 12E8H 2DWDA 1I1AC 5HHQB 3UTZB 1C8PA 2WMPA 3DO7B 4MD4B 2V7HB 1LVEA 3QQNA 5CILL 1KTLA 5HI4D 2YC1B 1FGVH 4WW2C 5BVPL 3KPRB 3W81A 2HVKB 4RGOL 3SO3C 1JN6A 4MCZB 4M1DH 2VL5B 3ZE0F 3WUWB 5C1MB 2H32B 3WV0A 4K7FB 3WKML 2FGZA 3IAQA 2ZUWA 4G9DA 5DSCB 1GSMA 4R8WH 4WUUE 4Z8FL 4NKOB 5DUML 4UT7H 5K59F 4HWNA 4JRWA 4TTDC 1HE7A 5F6HJ 4QXUH 5GIRA 4NSKA 1C08A 2AJSL 3QXAA 1FNGB 3RWHB 1ZS8B 4GS7B 3QPQC 1ADQA 3IDGB 2NYYD 3G6JB 4OGZA 3TJEH 3VWKD 5I16A 4XBEL 4OM0L 2NX5D 2O93L 3ZTJH 5FIEA 1CTNA 1I1FA 1KACB 1WLHA 4HJGA 5I9QB 3UTTA 3QWOB 5IGXH 1DQJA 1XT5A 4RCAA 3QIUC 3QDGD 4KVNH 3BRFA 2Y6SD 1MCIA 2XTJE 2OCFD 3RWCA 3UDWC 2JIXD 3CLFH 3P77A 3W9DA 5FFLA 3HMXH 4U05A 3S96A 4RAHA 2J2ZA 1XGUA 1UQSA 2YPLB 3KJ4B 3CSGA 4KRNA 5FYKU 3VXUD 4EOWH 3C5ZC 4X83A 3AXLB 2GITA 1KJ2H 3N1GC 1HHHA 1W8NA 1BQHB 4IRSC 4Y2DA 4LLVB 3VRJB 2A73A 1NCAL 2AP2A 2XRAL 1GL4B 5IBTL 1U2CA 4MGXA 3MLYH 2V7NB 4P5TC 1MI5B 4G7YL 5HHVL 3BQUB 4R7DB 4PGJA 5I1IL 3RWIA 4L8DA 1AD9A 4JFDB 2C3WA 3RX7A 1NLDH 5AWNH 4Z5RA 2P45B 2BZDA 3KNBA 4RA3A 1R5WA 2L0DA 3HMWH 3GGWB 2P8PA 3QZWA 5FYKL 2CR3A 2WBWB 3SJVD 4M00A 1H3TA 5IEKB 1YMMA 4LSRH 4HK3N 5E99H 5I17B 4OZIB 3RI5K 4Z7UB 5LAXA 3D69A 1VFAA 1YN6B 3MRMA 2J6EA 5L2JB 5C0BB 4IM8A 1OPGH 4LASH 4MNGA 1U92A 3S5LG 1QFHA 4ZNCD 4LSTL 4HIIA 1E6OH 2VR9A 1Y6MR 3T2NL 1BQSA 1N5AB 3ARDC 3JWDC 2VLRE 1A4JB 1DQQA 1ZLUH 1M7DA 5C07D 4F3FA 3SY0A 2EH8H 3ILQC 3PL6A 2YPKB 3QFJD 4NRZB 1LDSA 3MLTA 4ONFH 4G9FE 2L7JA 1GC1C 4OV5B 2DLFH 3HC0B 2DAVA 4DVBA 4YHLL 4WWKA 1F11A 5IMLA 5JLZA 1HNFA 3F6IA 3CZFB 4YDKL 2VQ1A 2WWKT 4X7EC 4QNPF 4HPOH 3U0PB 1G9NH 4JR9H 3VXMA 1WZ1H 2BVYA 4M62L 2V6HA 1I1AA 5JR1L 2VLJD 2EE2A 5IR1B 1CGVA 2J8UF 2VLLB 2OJZL 1MRCH 1WAAF 3K80A 4YXHH 3RA7L 2D03L 5JHLH 4PJFF 5F9DC 3FB6A 1LHZA 4AM0A 3L3GA 3MYZA 2W60B 5JOPD 2BRQA 3ULVC 2XWJA 3BT2L 1CK0H 3P0VH 5DURD 3LRHA 2EXYC 3ARTA 5BV7L 2F54E 1HQRA 4UIMB 2IJ0C 1T1WA 2HLFC 2F5AH 1HXYB 3G5ZB 2BXYA 1MCNA 5GS0D 5GS2H 4HIJA 4X5WA 1I8LC 3O0RL 4MLSA 3S9DB 1K8IB 5F88A 1GXEA 1A6VL 4QHMA 4LCYA 3IS1X 4HGWA 4FS0A 4OGXL 4TOYH 1J0HA 2HMIC 4JREB 1JPSH 1NMAL 2X5PA 3CH1B 3PWUA 3E6FA 3MXWL 3STZB 1KB9K 5CP3H 1S9WB 3QIUA 5KVMC 4HIXH 2GT9B 1TQCC 4L29A 4JO3H 3LN5A 2NLJB 3QDJA 4QXTB 3ARGA 1XEDA 4ZFOB 3H42H 4AH2A 1RK1B 3UDWA 3VFWA 4EN3C 4G7VL 1YYML 3SGEH 3PWPB 2DQGH 1JV5B 1U6AL 2YKLL 4U6YB 2VIRB 3VJ6A 1UKTA 2OK0L 2XG4A 1QQDA 4PY7B 3G04A 1D6EA 3AAZA 3C5ZA 4ZQKB 5D93C 1UB6B 1IVLA 3AREA 1X6NA 4S1SH 1UJ3C 1J1XH 5FYLL 2Y7QB 1P69B 2VABB 5D72L 5B8CB 1JWMB 3TF7C 4CVZB 1T2XA 3NABH 4P5TA 4NKMA 3SGJC 3GI8L 2CIKB 4BFEA 4U1HB 4ZUVB 3H7LA 3KJ6L 4P5MA 1IAKB 2CPCA 2AI0H 4OCWL 3T08A 1S3KH 2DQHH 4MDIA 3U1SL 1X5ZA 2XFXB 5D96B 1P7QA 1NCWL 1Z5LB 3DWTA 3WL9A 1D9KC 4X5LA 2CQVA 5E5UB 3IGAB 3GIVB 3KGRA 4XNXH 2IFFH 4X6DE 1RULH 1I4FA 4ALAH 1G7IA 1A3RL 1LO4H 4I4WB 1SJEB