2JCCF

Ah3 recognition of mutant hla-a2 w167a
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
237
structure length
237
Chain Sequence
EAAVTQSPRSKVAVTGGKVTLSCHQTNNHDYMYWYRQDTGHGLRLIHYSYVADSTEKGDIPDGYKASRPSQENFSLILELASLSQTAVYFCASSDWVSYEQYFGPGTRLTVLEDLRNVTPPKVSLFEPSKAEIANKQKATLVCLARGFFPDHVELSWWVNGKEVHSGVSTDPQAYKESNYSYALSSRLRVSATFWHNPRNHFRCQVQFHGLSEEDKWPEGSPKPVTQNISAEAWGRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA CLASS I HISTOCOMPATIBILITY ANTIGEN, A-2 ALPHA CHAIN
publication title Single Mhc Mutation Eliminates Enthalpy Associated with T Cell Receptor Binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 54
structure length 237
sequence length 237
chains with identical sequence M
ec nomenclature
pdb deposition date 2006-12-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2jccF01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2jccF02
5DJXB 4ZFOL 3C5JA 4LLDB 1T03H 3MRGB 2HMIC 1ZHNB 4JFPA 4G8IA 1CLOH 5GS2H 3BD3A 5EBLB 4YIQB 4JHWH 3CPLA 2HVKA 2L0DA 5HDBF 1U8LB 1HHKA 2VQUA 1SEQL 2I25N 4EOWH 4PJ9D 1CICD 2M8XA 3TJHC 1Q38A 4HFWA 3LHPH 2H6PB 3SGKA 4NO2B 3SDXB 1CDCA 5FM5M 5ESVA 1UM4H 2CKBB 4JQIL 1UCBL 4Y16B 1LDSA 4Y5VC 2E7MA 4LHQB 3U7AA 4PY8I 3NFNA 5C0IB 1S5IH 1HYSD 1B90A 3P40A 3DUUB 5IT2H 3CSPA 2IH1B 4OFIA 5E00B 4P99A 1G0YR 3LKOB 5I73C 1P53A 1BHGA 5DEFA 4WO4B 1TIUA 3UJIL 2G2RB 3ARGB 4NZDA 4GXVL 3LKQA 2IALA 1JRHH 3H6JA 3QDAA 3QYCA 3C8KA 1KENL 4KTEL 2NTSP 4LEOB 3P9WB 3QZWB 3KPMB 1YEDB 4TQEH 4LLMA 1S7WB 5IMMB 3WIHA 1BLNB 4IDJH 3QULA 1NANI 4JFQB 3CDGA 2VC2L 3IYLW 3TYFA 5C0RL 4UNVA 2O61B 3GNML 5GRVK 3VGFA 4BQ9A 5D7IE 3RVTC 5HDOA 3FQWB 4JFFA 1JF1A 5IJVB 1D6EA 4LHUA 3WL9A 2BVTA 1AJ7L 1JZ5A 3UTZA 4CU8A 4M7LT 3UJJL 3B9KA 3DRQA 1CDGA 4L9LA 1JNLL 2EECA 4FQIL 4KZEH 3T0XA 3EHBC 5TGBB 1XZ0B 4TNWK 4CL7A 3RWFB 4WFGE 4JRWA 1WFUA 3GKZA 4HJJH 2WK2A 2BVQB 1U8MB 1CD1A 2RIKA 3ILPA 3I3DA 3JTTA 4PJAF 2LFGA 3K3QA 4OI8A 3VFRB 5GS0D 3KYKL 4NRZB 3V0VB 3JXAA 4TTDD 1T20B 2CK2A 3OF6D 4LARL 1G7IA 5CSZA 5EA0L 4WFHE 5C09A 4CVZA 3VXME 3OBAA 4IM8A 5H37H 4KMTH 2PW1A 4G6ML 5GRYA 1P4LB 3KJ6H 4JRYB 4HWBA 2ADFL 2XXCB 2P8LB 5HGHB 2V9TA 2EDBA 5CD3B 2W0FA 4YHYB 1T3FB 1JWSB 5ISZD 5DWUH 4UAOB 5INDB 4PY8J 5J11B 2DMBA 3N0PB 4M6OL 5DI8B 3K80A 4MS8D 3LVEA 4OLWH 3LEXA 2HG5A 2BDNH 4Y4HC 3BZEB 4JZJB 1CG9A 3U9UA 2HVJB 3GSNL 4NJ9H 3OZ9L 3RAJL 3Q6FB 3CMOH 2EYRB 1GZPB 3RJQB 4PGEA 3T2NL 3CVHL 4JFOB 1OSZB 2X89A 3G6AB 4HKBB 4Y5YA 1UM6L 1JHKH 2CLRA 2DM7A 7FABH 4JO1H 2CMRH 4ODHL 3LSOA 3S37H 4XNYH 3WKNA 1JF6A 2BY0A 4PJEE 5CSBA 4E41A 3VH8A 3TVMB 3FB6B 3D3VD 4L1HA 3TZVA 1I8IA 4MCZB 2VDOH 4IRSC 3VA2C 2X05A 4ZPTA 2AK4B 4HKJB 2X4OB 3JTSB 2EDHA 4R9HA 4GMSH 1DQJA 5C0JA 2BK8A 4M9PA 1Z0NA 4HCRL 3L5WA 4W70A 1WAAE 1C1EH 1BGXH 4N90E 1PEWA 4OJFL 4X9IA 1N0XL 1U6AH 2AERT 3CFCL 4XVTL 3TBSA 1SEQH 1JV5B 3REWA 3BWUC 2VLJD 2YXMA 4CU6A 3O8XC 4LCIH 2VITA 1Q9OA 2IQAA 5D71H 4PJHB 1D5MB 5D2NA 4NKIL 1UCBH 3D85D 5C0GA 5T1LD 1T4KA 1FL6B 2O5YH 2ITCA 1IE5A 1KN2L 4Y1AE 3FRUB 1SJXA 2DLTA 5C0CE 2A73A 2ICWB 1MFNA 3C5ZA 5JLZB 2A6DA 3ZYOA 4KJQC 1LDPL 3PWPB 5EN2A 4HXBL 4TOYH 1SHMA 3CH8A 4PJDF 3UJIH 2DM3A 4W6YB 4RGOL 1I1AB 3WDJA 4NN6C 3W81A 4O9HL 1KENH 4GQPH 5GRUH 3VA6A 4ZTPL 4EUPH 2E7LC 3RI5K 3RZCD 4CVUA 1X9QA 2VC2H 2QSVA 3MBEA 1LP9A 1ACYL 5GGTL 4GRWF 5B3JF 5JA8B 2O93L 1JJUA 5DJDA 5CD5D 4RQQB 1KOAA 5C70A 3H9HA 2PO6B 4LQFL 2A74B 3UJJH 1U8OA 2NY3B 4ZUTB 4ZFGL 1JNLH 2H1PL 5JHDD 4QXTB 5KVFL 3FQTB 4H20L 3WN5A 4DGYH 1GXEA 4GMTL 1HHGB 1ZT7A 4WUKH 2XWJB 1N5AB 4WUUE 5C0EB 3EZJB 3KYKH 3PWJB 3RHWK 2WINA 3DOSA 3HZYB 4I2XA 2NW3B 3OXSB 5EA0H 1P9MC 1CS6A 3VFMB 3CX2A 2XXMB 1N7MH 4PGBA 5EWIL 5IVXB 3ARYA 3LKRB 3MJ9L 3QEUB 1OP3H 4C58B 1A0QL 1DUZA 4J3OC 3VMNA 2VLRD 4ZFZB 3RKDD 2ADFH 4OAWB 5I76A 3BEWB 4YXLH 1IAKA 4GKSB 1H15B 4JG1L 4RMRA 3QUZD 1NEZG 4KUCF 1FZJB 3IFLL 2YEZA 4R90L 3U48A 1OTUD 3CSBA 3RX8A 4F7TA 4M6OH 4F80A 3BO8A 5F7WC 4OZHB 3MLWL 4ODWA 3JUYA 3IDUA 3QXUA 4U6HB 3S34H 5F1NA 3T3MF 2I07A 4KK6C 2OTPA 3TCLA 4NM4H 5HHXH 3KJ4C 2Y07L 3OZ9H 2J4WH 2VZUA 2FATL 4OGXL 5IESL 4Q7DA 3O4LD 1XF2B 1L7IL 1WGOA 1BZ9B 3S9DB 1CD9B 4G9FA 2QSCH 3T2NH 3TBYA 4ZFOA 5C0BD 4I8DA 2CXGA 1NBQA 1KTDB 3T0EB 3CDFA 1HI6B 4F9PC 4OFVA 4PBWD 3RJDA 4D3CL 1JGVL 1S9WA 1A1NA 4L5FL 3IDGA 5I1GL 1HSBA 2EKJA 2LVCA 5A3ID 3MLTA 2B5IC 3ORJA 1IGIL 1EV2E 3CU7A 1KTLA 3L5HA 1P84J 2WQRA 4RZCA 4NKOB 4C4KO 4HD9A 5IMOB 5C08B 3P77B 1CIDA 4QXWA 2JIXB 3IDYC 4NWTL 1NC4A 1SJHA 3OTTA 2GK0B 5H2BB 4OI9A 4JFDE 2GUOB 2AXFB 4G8FB 1N5YL 4PG2A 1FGNH 4X8JA 4L3CB 5ERWA 4N8VB 3WLBB 2QKIA 3I02B 3ZDYF 4BZ2L 5BOZG 1Y6NR 1OW0C 1OP3K 3MYJA 5IFJB 2R2HB 4LGRB 5KG9A 4MMZC 3WUWB 4GBXD 5DTFB 3G5YB 4Z78A 1D9KA 2D03L 1NDGB 4NZUL 1TQBB 2V2XA 3TIDA 5ABDE 2AXHA 3MV8E 3O2WH 5GSVB 1BFOB 1T89A 3VU2A 2OI9B 3VWKC 1A4JA 1LDPH 2EZ0D 2A77L 1QNZL 4HXBH 1RK0B 1U8PB 1OAYL 2OR8A 4XAKE 5HVWA 15C8L 4LVNB 3QXVA 2WW8A 4RGOH 5DHYA 2K1MA 4A6YL 3EOTL 1KJ3L 4KAQL 3VXSD 4WTZG 3TF7C 2FJGA 3WJJC 4NWUL 5GS1A 4HJ0D 2EH8L 4HZAA 4GW4B 3H9ZA 3UEZA 3QQ3A 3RWHA 2Q7YA 1QOKA 3TBTA 5FECB 1CXIA 3P9LB 4QOKA 4M4PA 5I30L 1BD2B 4YDKH 4HKZB 4U1SA 3WDIA 1MOEA 2VZVA 2GI7A 4G6AD 5E9DE 2ZSWB 1A9EA 1LO2L 4FXKA 3H0TB 5EOQH 2UWEF 3V6OE 1MCNA 4LQFH 4LVHC 1D3CA 2IMMA 1J0YA 3DGCR 4F7EB 5KVFH 1UB5B 4H20H 2YD3A 1WIUA 4HC1L 4OGYL 1LO5A 5HYSG 2H3NA 3RWIB 5TPWH 3QFJA 2YD8A 5KOVC 5C0DB 4RMWA 3KAAA 4XPFL 2DMKA 3AREA 3PP4L 3PDOB 3TO4D 3RX5A 3IJYA 4YEEA 1FFPB 2BRQA 1UJ3A 5T3XL 1DBKL 1R5WA 2FBJH 3GGWA 3VG9C 5CJXA 4QGTA 1KYOK 2KL6A 2R9HC 5E6ID 3R0MA 2HT3D 4YAQB 3RGVC 1KLUB 1BBJA 1W72A 4MD5A 2VSDA 4D9QD 3GIVB 4C56D 4JFEB 1T2XA 2X4PA 4L3AA 1P4IL 3GSNA 5EUOF 1MREL 1FBIL 4NZTL 1IAMA 4XC3L 4HIEA 3FQRB 4ZO9A 2OTUA 3IFLH 1TJGH 5TE7L 1NUDA 1FZKB 3C09B 3CVHA 1ES0A 2R8SL 3QDGE 4NC1C 4IEFB 3PQYA 4KKBC 3L9RB 4LASH 5IQ7L 1MHEB 2HFEB 3CSYA 3N1QC 3BYTA 3ZE2E 2VL5A 3SCMC 3MRBA 1MIML 2YN3A 3LN4A 1OGAE 2ARJA 5E2UL 1YMHB 2FATH 5E99H 4OGXH 5IESH 1KCVH 3QA3A 1RJZA 4QRSA 1HCFX 5EU3A 4HCRA 3SDXF 4QRUA 3DBXB 5B22A 4D3CH 1RURL 4PFEA 1K5NA 5EBWA 2NX5E 5FYJE 4ELME 3I9GL 3QIBA 4L5FH 2NZ9C 1EFXB 3FO0L 1FAIL 4CU7A 1F6AB 1CE6A 4I48A 3UBXG 3NIDE 1IGIH 4FXGB 1CXKA 3O3BB 1H5BB 1U8QA 3V5KB 4Q97A 4HV8A 4JM4L 4NWTH 3KPQB 4ONGL 4OLZL 3K81A 1U93A 4XPAL 4M7LL 4HUXA 5E8NA 1U58A 4QRRE 4WWKB 1IKNA 5C9JA 4Z7UF 3WXVL 1JVKA 3NZ8A 3K74B 1A6VH 4XMPH 5D6CB 1QBML 4O58L 1RUPH 4QRTB 2PR4H 4G43A 4IMLA 4N8CL 5D9SB 1KNOA 3RWEB 2D4FA 2R1XA 5DD3L 5FKAB 3SDAC 4KKNA 1OLLA 3SGDH 1QBLH 1Y0LA 3C5SA 5DC0A 4E5XB 1U8IB 5SWZD 4YPJA 2D03H 4MJ6A 4QHUB 3GUTB 4MJIB 3A6BL 4ETQA 4N0FB 3FOMA 1KJ2L 1G7HB 2EEBA 2X1OA 2C3GA 5DJXA 5ILTL 1NL0H 2P7TA 4NP4L 2N4IA 4GG8B 2A77H 4PJCB 1QNZH 5GGTA 1YY8A 3AY4C 1OAYH 4P4KA 1SMOA 5EBLA 4G6KL 1L6XA 3WFEH 1IM9A 1I1FB 3BWAB 5KANI 3EOTH 2V5YA 5CGYC 4EXKA 2D9QB 3MRMB 3EOAA 5CWSB 4J1UB 4NO2A 5CZXD 5B4MC 1HN1A 4JFHD 1V7NL 2W9LA 2QEJA 4MNGA 1DP0A 2IBZY 1TTFA 4XNMB 4NQDD 2V6HA 1LO2H 3E2HB 5IMLB 1YYLH 1HXMB 4MA3B 4XCEB 1MCIA 4FRWA 5E00A 3ARDC 4KHXL 4NC1E 1MWAB 2G2RA 1ORQB 3MUHL 1OOAA 3MJ9A 4JG0L 1X5LA 1ZA3A 4OGYH 4XCNB 5EU5A 4F2MA 5IM7A 5LGKA 5EPMA 1RI8A 1YEDA 2FEDD 4Y5VA 1BLNA 4JFQA 2O61A 5BZWB 3GMNB 3KXFB 4IHOB 3PP4H 1M6OB 1F2QA 3S36X 3B83A 3FQWA 2BNUB 3R06B 3S3PA 5SWSE 5IJVA 4GH7B 3DO7B 2NR6C 2X4RB 5I0ZA 1F3JB 4S11A 4L9DA 2DAVA 4WI6A 3SJVE 5TGBA 3D25B 1EEYB 5IEKB 4QTIL 1WAAA 2OR7A 2VTFA 5TE7H 5FYJL 4I77L 4LPUA 1BIIB 1UWGH 3ARUA 3V5HA 1T20A 4LL9A 3QUXC 5EOCH 1CGWA 3SGEI 3ZT7A 2GCYB 4J6RL 5AUMB 4TNVF 2PYEE 4RGNC 1ED3A 4PRPD 3UYPA 4UDUA 3L7EB 5C2BL 4P9HH 1P4LA 4JRYA 5F21B 3BAEH 1E4WL 4FTVD 2P8LA 4NT6B 5HY9A 3VI4F 3VXPB 5HVHB 2GJ6B 4X80H 4UDTA 1YA5A 4IOSD 3QI9B 3QDME 4U1HA 1I9JL 2I27N 5DZOA 1UADC 5INDA 2Y4SA 4PJHF 1MFEL 1RURH 1RULH 4L8DB 5H8DA 3I9GH 1YNLL 4NQXA 1FAIH 3DROA 4Q2ZB 5MENE 4HQQL 4YPGA 3HS0A 1RIUL 4U05A 5I15H 3EO9L 4JZJA 4RSVA 5DQDH 3P11L 2CUIA 1Y18A 3QSKB 5D7KD 1UVQB 1NJ9B 2R2BB 4ONGH 3FFCA 4LPVA 1AO7D 5JPNB 1MRCL 3NVQA 3V6ZB 4M7LH 1EJ6A 4JFOA 4JEGB 5KVMC 1NC2D 2V5TA 2KKQA 4HPOL 3H7BA 1QBMH 4ZQKB 4O58H 5B38A 2X70B 2ESVB 3DIFB 4PLKC 2F54D 1JTTA 4A6YA 3BGMB 5DSCB 3VW3H 5DD3H 2ZUYA 4DW2L 3FB6A 4G9DB 4Y4HA 4NM8L 3QNZA 1YEFH 1CGUA 2X9WA 2FX7L 1BVKB 4ZPVA 5KVDH 3PGCB 3VWJD 2EXWD 3A6BH 4I0PC 4WHTB 4H88L 1KJ2H 2AK4A 1E28A 1E4XL 3JTSA 3AVEA 3CU1A 3SPVB 2GT9A 1MCKA 2JJTC 4NQUA 1NEUA 5DJYA 5HVGB 4Y5XC 1WBZA 2N7AA 5IHZB 4AEHL 3QUKA 3BP6B 1RZ8A 4R7DB 5F9WC 5D7LB 3I6KB 4OLEA 1MAKA 3HB3D 1JV5A 5JQ6H 4YHOL 4JO4L 1EUTA 5FYLL 1TZIA 3QG6B 1MNUL 1R3JA 1HKLH 4JHBA 2IBZX 3DARA 1D5MA 4OFYD 1OAXL 1K2DA 3B2VL 4HC1A 4IRSA 4I3SL 1LILA 5JW3H 4Q9QL 3P4OB 2WWKO 5ID1A 3MO1A 1NPUA 1MI5E 4Y5XB 4ORZC 1BQHA 4PY7A 4OF0A 3MROA 4PRIB 3S7GA 5ACLA 3C08L 1ZXQA 5CIPA 4WW2B 5F9WB 1Z0MA 3BKJH 4KHXH 2ZCLH 4QNPF 4X4YB 3AMLA 4ZFFB 1NGXA 3O8XA 3GRWL 1QRNA 2FEEL 5F6IB 1WFOA 4TSBH 1L9MA 4XP1L 1F6FB 5ID0B 4UI2A 4DCQB 4JPWH 2YKLH 3CFDB 5AYUL 4BELD 1VFOA 2WUCL 4EUPB 4X6BA 5I1KL 1M7DB 1FIGL 1K4CA 3BIAX 3OHXA 4CNIB 3CFJA 4U1LA 4NQTA 1IT9H 4X9GA 4KJWC 2P47B 3PWUB 4M3JA 2ZUVA 1MQ8A 1S7RA 3ALPA 3FQTA 5MEQB 4ZOBA 1KCSH 4JN2B 1HHGA 1EHAA 1YPZA 3U2SA 2E7LA 3BRGC 3O41B 5ALBL 1NGYA 4QTIH 1HHIA 1RY7B 5E5MA 5FYJH 1WK0A 4ZUVA 4Z9KB 2BSRB 5D8JH 3T65B 5KAQG 2MQCA 5C6WH 3ULSA 4TUJA 1NBYB 4L4VD 2NW3A 4J6RH 4YGVB 1WBYB 3IXAB 3UTSD 3FFDA 1RZFL 1LEGA 2Y9RT 3QEUA 1WTGT 3G6DH 4GRLB 4X98B 5F9OL 1I8LC 3DVFA 1A6UH 4U2YA 1KLFA 3EJZC 3O4OC 4Z0BL 4S1RH 4DN4L 2NW2B 2C3XA 4GKSA 1S7SA 5D2LE 1H15A 4OCMC 4JRXD 4P3CL 4J4PD 4JDZB 5DJ8B 1FZJA 3PE9A 3MCLH 5BO1L 4TVPD 3INUH 2MKWA 4OZHA 1KCRL 3LRHA 3LEVL 1E6OH 5D70L 2Z31B 1B4JH 4JHZA 2V7HB 5MEOB 2DQJL 4MA8L 1SJVA 2JB6B 2VXVH 4Q6IB 4AT6A 1NUFA 1NFDE 3BT2H 1UT9A 5KTEH 1FN4B 2CXKA 1INQA 1JL8A 4H26A 2R0ZL 4GRMB 5BXFB 4HBCL 1CICC 1J8HE 1KJ2A 4PJ9C 3BEVB 3KWWB 4ZXBB 3UPAA 4Z6AT 1S7QB 1A9BA 4PUBH 4YFDB 5I71B 1TTGA 2QJDA 3FTGB 4FQCH 5J6HB 1B2WH 1HYSC 3PABB 3O9WD 4DW2H 3X12A 4Y19A 3W0WB 4HUVA 2GY7B 4NM8H 2GSIA 5EOTA 1BFVL 2FX7H 2LU4A 4RX4A 4D94A 4JDVA 4QY8A 3ET9F 3V4PL 5CEZD 1FYHB 2V17L 2D4DA 1VFAA 4PBVC 3MLVL 4APQD 1ZSDA 1E4XH 4GJTB 3BKYH 2ZOKB 1CICB 4MCYA 2R23B 2DOCA 3CUPB 3CZFB 1ZHBA 4M5YH 2DYPD 3IDMA 3MGOA 3U7YH 4L3CA 4G5ZH 4F9PA 1ZWIA 3OKMA 1P7QB 2G9HB 1JBJA 4DZBB 2Y1VA 1AP2A 1A6AB 2EE2A 4PJFE 5CJOL 4YHOH 2I9LB 3JV4B 5IFJA 3Q1SL 3U1SH 3T1WA 3DX6A 5FGSA 5I9QC 4XWOD 2PXYD 4Q9QH 1F00I 4BFIB 5DRWB 3EDKA 2CR6A 5GSVA 4U33A 3THML 3QJFB 5D7IB 1C12B 3C08H 5E1AA 3BISA 1TVBA 1ZVYA 4QHNB 1RK0A 1U8PA 4HIXL 3SE8L 4QRPE 2WWMD 4FQHA 1OW0A 2FLRT 4K7PX 1LHZA 5GS0C 1VFUA 3JWOH 5MERB 4TTDC 1SY6L 4GW4A 4UBDD 3SO5A 3GBNL 3CVIL 2XG4A 1NCAL 2NPLX 4OZGE 1XIWD 3P9LA 2X6MA 4EXPX 5K9JH 5AYUH 4NHUB 5TF1H 3RWGB 4HKZA 2MHAB 5I1KH 1WCQA 3VWKA 5BZDB 5KS9B 1U3HB 1RIVL 3HC3L 3H0TA 3G04B 1NH6A 3MFFB 1HOCB 5L2JB 4OZFG 4PB9H 1WZMA 3MNZB 2CSPA 4PTUA 4TSCL 3VXMB 1Q94B 3NPSB 4ZO6A 2J1KA 2BNRD 3UTQB 3WJJA 5DFVD 4ZUWB 1H0DB 5ENWB 1OD7A 3TYGH 3RBGA 3TNMB 1JUFB 4MS8C 4CJ1A 4UTBL 4L8CB 2HJFA 3KLDA 3D18B 4S0SD 3NGBB 5C0DA 3FQNA 1MCWW 2OXHA 4QHMB 4R7NB 3PDOA 1OB1A 1UH2A 4YHPB 5IK3B 4U1MB 4KHTL 1IGML 1W0WA 2OYPA 1C16B 1L7TL 3DETD 4AQ1B 5BV7C 1DQML 3OGCA 1T7YA 5ICYA 1AHWB 4YXHH 1K8IB 1KLUA 4M8QA 1KACB 1TNMA 3MRRB 4YC2C 5FO7B 4NPYB 3VGBA 2APWA 1A1OA 4PPTA 4F7CB 3OKLA 1FFNB 2VABB 1JHLL 4NO0B 3FQRA 4P3CH 3TNNB 3P4NB 5BRZD 3BVNB 5JNYA 3PV7A 3ZKXB 1HKFA 3KPPB 2NY2B 2C26A 1EO7A 5IB5B 3F5WA 4HPYH 4BK5A 3IXTB 2XN9E 4PJEB 3L9RA 3QEHB 4ZYKA 4Y89A 1BVLA 3RGVA 4OZIF 1NFIB 5KJRH 4TNWF 5IB4A 4PJCF 4I18B 4MA8H 3RNKB 3GSVA 4G8GA 4LCYB 4ODUB 3RTQB 1EHNA 1P6AB 1KTKE 2XQYG 3HE7D 4EDWH 1DFBL 5I1JL 1T0NB 4PJ5A 4U1GC 2RHEA 2OL3H 4XAWH 3K8LA 3DBXA 1A47A 3O6ML 1HILB 3ZHDA 3LQZA 4RFOH 3C2AL 1EFXA 2OP4L 2XZQL 1F6AA 4TSAH 2FGWL 3PHOB 3SCMA 4NRYA 2ZG2A 3V4PH 2QHRL 1MVUA 2DIBA 5MHSE 4UV7L 3T08A 2FL5B 1AGFB 3MLVH 4JN1L 4Y1AB 3U7WL 1CWVA 1P2CB 5C0CB 4AL8L 1YEEL 4Z0XB 2QQKL 4J8RA 3DRTA 3U4EB 2BFVH 5CJ5A 4WWKA 2DL2A 3S5LA 4UTAH 4U1GB 5EU6A 1F5WA 2Y5EA 5EZOL 5T1LB 1C5BL 1ADQL 3RZCC 1VEPA 3ARPA 2X4UA 4ESKA 4DWHA 4QF1B 1PLGH 1BQSA 5CJOH 1OPGL 3Q1SH 5FKAA 3FHAA 1WEJL 2VDKH 4I0KA 3AAZB 3GRWA 2P24A 2VAJA 1B88A 3F7YA 3WNOA 4R97C 5CD5C 5IWLC 1XR8A 1II4E 3PWNA 1ZVHA 3MMEA 3RX7A 1Z5LA 4N0FA 1G7HA 3ZDXE 4LCWA 1JGLH 4NN5B 4PRHE 3VMOA 1KCUL 4X4XA 5IHUH 2Y06H 1G7JB 4GG8A 4PREB 3FZUD 4P3WA 3T2QA 1Q72H 1I1FA 1CFVL 1H3UA 4DGIH 1FNEB 4U0QB 1JYXA 1HSAB 2NNAA 4WI7A 2OCFD 3SDAA 2AV1A 5F96L 4P23B 4C4KT 1SY6H 2B8OT 4J1UA 5IVZB 4TUOB 4LMQE 4X7TB 1NCAH 1GPOL 1MCSA 2HFGL 4YBHA 4AEIH 4R4BA 1ZGLM 4FQXD 4AK1A 4P5KB 3PL6D 3FB7B 4G6JL 1AXSB 3QDJB 4Z77A 4X7SL 3BJ91 5J13C 3RKDC 4RWHA 5CFHA 4XCEA 1BF8A 1EXUB 4R8WH 3AY4A 2HAZA 3H8NA 4YDLB 4X99A 5HHOD 2OK0H 4XB7A 3VXUD 4Z7OF 2ORBL 3STLA 3O3EB 3UYOD 3V5DB 2DLFL 1OTUC 4XBGA 1RZJC 2QSTA 4XCNA 3BPLC 4N5ED 5ITBH 3NABL 1F4WL 4UT9L 1UZ6E 3BGAA 3KYNA 5CHNB 3MA9L 4JZOB 2VLLA 2EE9A 3KXFA 3QNYB 4Z7VB 5BZWA 2I26N 5E24E 4FXLA 5GISH 5J1AB 2VLJE 3QIUD 1R3KB 4EN3D 3DX7B 2L4OA 2BNUA 2XTJD 1VGKA 3V9FA 3QNXA 1DJSA 3ARDA 3HI6L 1AKJB 4JO2L 4NOFA 4H1LA 3QUZB 1SBSH 3GMLB 1ZHKB 3KPRE 5IF0B 1F3JA 3RI5F 5HXMA 1CK0L 5BS0A 4PJ8D 3OAYH 1FP5A 2GSGB 2ICEA 3P2TA 3TFKD 4PJAE 5JORB 5IEKA 4YE4H 3SDDB 3LN9A 4WIQA 1ZVSB 5A3IC 3NCBB 1ZS8B 3D48R 1MIEL 1CU4H 2X4TA 2OZ4L 5FGBC 1EFQA 2ADIB 4FFWD 5KSUB 2FJFB 4UQ2B 4UIMA 1RJYB 3UO1H 3O4LB 1HZHH 4NQVB 2MPAH 1SM3H 3MRDA 4WCYL 4NQCD 1CXHA 3VXRD 1FV1A 3LOWA 4K9EH 4MD0B 3U4BL 5GS0L 3VGAB 4N1EA 4LOUD 4TYUA 1TDQA 1MCPH 3IDJA 3T8XA 1IC1A 1FNFA 4LCUA 1VKXB 2V9QA 3RPIA 4NT6A 1CGTA 1OARH 1GC1H 3ARFD 5E70A 3RHWF 1WLHA 4JFDB 4LLVB 1DFBH 4GBXC 4H0HB 1Q9LA 2B1HL 2FO4A 3PNWB 3TN0D 3MCKA 4LSPL 4P9ML 4L8DA 1OQOA 3PV6B 3QUXA 3LAFA 4Q2ZA 25C8H 4L4TD 5F3HB 2BC4B 1I8MB 2EZ0C 2ICWI 5ADPL 5DMGD 1JFQL 4UV7H 4AIOA 2XI9A 4XNXH 2JKXA 1UVQA 3GZKA 4WW2F 2R2BA 3OB0H 1YEEH 2QQKH 3V6ZA 3MV8B 4WEBL 2VMFA 1XF4A 4O4YH 4HJ0C 2OM5A 5C07D 2Z9TA 5TH2B 4B0MM 3UYRL 5EZOH 3STZA 2DIJA 2QADB 2J3SA 1ADQH 3C60C 1G9MH 4NN7B 5BV7L 5K9QI 4YWGL 1LO3L 5EO9B 4PJIA 1ZT1A 4I1NB 2P5ED 1OPGH 2YA0A 1URLA 4G6AC 3W9DA 5J9PB 2FZ3B 3MREA 2QV2A 4QTHA 1BX2B 3OAYK 1BVKA 5I0DA 3DMMD 4S1DD 1F45A 4HGKC 4K2UL 5IQ9A 2MJWA 2IAMB 1I7TA 1LEIB 3SPVA 1KCUH 2E27L 1D5BA 4KDWA 1S9VB 3QIWD 1H8SA 4CMMA 3NH7L 1MJJA 2H26B 1U8JA 4U7MA 3ZE1F 1HNGA 2W0KA 1CFVH 3OMZA 5HHVL 4MA1C 1QBBA 5D7LA 1YDPB 4X6DE 1EO8L 4YZFE 5AD0B 3TO4C 4NKMB 1CZ8L 3VGHA 5F96H 4MJ5B 1RIHL 1K3ZA 2VN7A 1XGQB 5LQBL 1G7LA 3LKPA 3C2SA 3HNSL 4I0PA 4U0RC 5E6IC 5KN5A 2HT3C 4ZUUB 1GCFA 4CDGC 1I7ZB 1S9YB 2JJTA 1G9EA 1UM5L 1IJ9A 3WNPA 4X7SH 4Y5XA 1FAKT 3MRJB 2R4SL 3BGFC 5CAYB 1IGYB 3OR6A 5J1SC 5F44A 4MZ3A 2PTVA 5E8PB 1FL5B 3BUYB 2D2OA 1FYTD 2P48B 3O0RL 3ZO0A 1YN6A 2YA1A 3GKWH 3REVA 3IU3B 3FMGH 2DLFH 2ZOLB 3GJFA 2DWDA 3R4DA 4L3ED 5HPMB 1AQKH 1JWMB 2ADJB 1CFNB 5HYJD 1E27B 3ES6B 4LDEB 3OB0K 5D96B 3T77A 4UT9H 1J5OL 2A6IB 1BOGA 2HFFB 1INEH 4WENB 3CFDA 4FQ1L 1LD9A 4GRWE 3UXFA 4ELKB 3MRKB 5L8LB 1MRDH 1FVCA 5CSGA 3QDGB 4TULL 5I1HH 5I74C 5LXGH 3WSQH 3MXWL 4BZYA 4MXWL 4W81A 1TETL 4YBQD 5KSBE 1A2YA 1UXWB 1KXQE 2YS4A 3LS4L 3DVNA 1RUAH 5DK2A 5DUPL 2G5BB 1OGAB 5MEQA 1CK0H 2NY4D 2W9DH 5FO9B 2XACC 1LE9A 4NRXA 1IGJB 3O6FB 1X4YA 3KYMB 3TBWA 3FRPA 2XNAB 4PRDA 4X5XA 3IJHA 3WO4B 1CE1H 3MR9B 1IC4L 4ELMB 1FGVL 4K3GA 3EYVB 5D5MA 4KPHL 5TFSL 2D0HA 4YGVA 3U4BH 1IEBA 3OJVC 5BMFH 3VI3E 4K55A 1KG0B 2AJ3B 2VLKE 5L88L 4OQTL 2FYYA 3RA7H 5FO8A 2NW2A 4DGVH 1IL1A 4MDJA 4QRRB 1HK6A 4MNQD 3F65A 1AGCA 2VZOA 5MI0C 3MUGB 3JV5A 4LSPH 4P9MH 1ADQA 3J7HA 5IIEB 4JPKH 1D6VL 3T3ME 3MLRH 4PJBA 3KPNB 4BH8B 4YQXL 3DV4B 5GGVY 5D7IF 1RZJL 3BP4B 5ADPH 4D0CA 4EQ2A 1JFQH 4MGXA 4LKXB 3L3DA 3EOBB 1JPGA 1I8LA 3VFNB 1NMBH 1YECL 3S36L 4KRMB 4PV8B 1NBZA 3MRFA 4RMVA 3LH2L 4WEBH 5BXFA 2YD4A 5LJYH 1ZAGA 3KWWA 2NY1D 3OPZL 2XPGB 3U36A 4IS6A 1T1ZA 2HP4A 5CZXC 3EYFB 2D7QA 2IANE 5MEPB 5MI0B 3UTPD 3QEQE 4D0DB 5HTSA 3GSUA 3CLFL 4C56E 1LO3H 3CMGA 3ZT5A 1KFAL 5J6HA 1U8HB 3GI8L 5GSRB 2APXA 2NLJB 2BNQD 4RAUB 3W0WA 3KLHD 4NNPL 1JHTB 1ZOXA 2N1KA 5EBGA 1AY1H 3H9SD 3H7LA 4L8BA 2D9CA 2WLZA 1CGXA 4G3YH 4KQ4L 1FNAA 4J3SA 1P69B 3ARED 3ARTA 4NYLB 2R69L 1NEZB 4PJ9A 1CICA 3D0VA 4XP6H 2VZSA 1DQDL 2MQ0A 2PW2B 1ZA6A 5F89B 2FEDC 3IF1B 1YEGH 2G9HA 4ODTL 4DZBA 5JPMB 1EO8H 1A6AA 2R1WB 3IDXL 4JJHA 2I9LA 2YPLE 1CZ8H 5JOFB 3C8HA 4MA7L 3HUJA 1RIHH 5DO2D 5DLML 3BDYL 2FD6L 4KRLB 2IQ9H 5T1KB 4M48L 5I17B 3CK0H 5E7FA 2MMXA 2VJXA 4OUUB 1NLDH 3DXAE 1JE6A 2A6JA 4XRCA 2GITB 5IFHL 4LLQB 1MH5A 3OKOB 5SWSB 4LCCB 4CMHB 4DQOH 5L2KB 5T1MA 3BPOC 4BKLB 1N3NA 4LLUB 4N9GB 5JW5B 3CAFA 3HLAB 1ZANL 2DLHA 2KQMA 5F93C 1CFQA 2BP3A 2OXGA 3SJVB 3G5XA 4PJEF 4KK5D 1D5XB 2P5WE 1FPTH 2E6JA 4FQ1H 3MRLA 5DD5H 3ZT6A 3IETA 2OZ4A 1VDGA 3FO1B 5BZDA 5KS9A 5ACMA 4POZD 1HOCA 3MXWH 4MXWH 4AMKL 3MUZ1 4NC2B 1KGCD 1TZGL 2Z8RA 3HPJA 3DV6B 5IB2B 3UTQA 1PW3A 2Q7NA 1WAAF 4LLWA 2JTDA 4UV4H 1H0DA 2R39A 2W38A 3OF6A 5IFAL 4OQ1A 2WWKT 4OLYH 3I2CL 4L8CA 2HLAA 4LVOC 1KN4H 2RFXA 2DI9A 3D18A 3EFFB 3QDMB 2WUBL 4YNYB 5C8JB 4Z95H 3MV9E 4R7NA 5IK3A 4FTVB 1FGVH 2F53D 1C16A 2OTWA 4KPHH 1T04B 5MENB 1ROWA 5GRJH 5DK0B 5F1SA 1C5DB 4F7PB 5IBLD 2YRLA 3BHBA 4AENB 5ISZA 4Z7QE 1A6TA 5GRXG 4YDVB 4P46D 5A16B 5E56A 5H35A 1W0VB 4OQTH 5L88H 2CJUL 3VE0B 1YMME 3FB8A 3HAEG 4GW5B 1FFNA 4OZFH 1DQTA 2IH3A 4LLAA 1PG7X 1I4FB 3EYOB 3MTRA 4AIZA 5EC1A 5I16A 4YK4C 1CVSC 3VWJC 2EXWC 3BP5B 1KUMA 5IB5A 3RUGA 5AAWA 2I5YL 3IXTA 4MD4B 4QYOB 2XZAL 4B7LA 3QEHA 1CQYA 3FAXA 3QXDB 1QLFB 3MJ7A 4YQXH 5LBSL 1RZJH 4P2QE 4HJGA 5CGTA 4Y16D 4ERSH 5HYSB 2KH2B 1YECH 1MEXL 4JZNB 2RJMA 3S36H 2R2CA 3MV7E 3L3KA 1F42A 3HB3C 4UQ3B 2R1YA 3HG1E 3D3VA 1JGEB 2F74A 4HS8L 3FL7A 5DDHB 2HJLB 5CS7A 5ESAA 2Y7QB 4Z76A 3VWJB 2XV6B 4WO4D 3ARGD 3CLFH 4ZOAA 1KFAH 2HLFD 3OX8A 4KKLD 2OL3B 1QSEE 4WFFD 3RRQA 2W0PA 4ZOEA 4NNPH 4BQ8A 2C3WA 4BSVB 2MNUA 2C4FT 2ZUQB 4A2MA 1TXKA 3VFVB 5A2FA 2HH0H 4P3DB 2FL5A 1MAMH 4AEEA 3KYOB 3QFDB 2H32H 2AQ3A 2DQFB 2CK0H 2R69H 1P2CA 3L3HB 4ZSOB 2CRIA 3U4EA 1M1SA 5I2IB 3PJSA 4Y4KB 4IRZL 1CD8A 5HHQB 3D85A 5T1LA 4ODTH 5C0AE 4DJMA 3IDXH 1JZ8A 4OUOA 5EZIL 2WIIA 2EE3A 1DVFB 4MA7H 3BDYH 3I6GB 2PCPA 3WLWD 5EIVA 2FX8L 1JPST 4LRIC 2CO7B 4HIHA 3O6KL 3VFSB 4ODVL 3GMQB 1TJHL 5IFHH 1S5HB 4GKZA 4PREA 3QG7H 5IROC 4S10A 1NDMA 5F7FA 5DJ2B 3UBXB 4YO0B 4ZTOH 5E2TH 3UMTA 4JRYD 1ZANH 2Q1EA 4POUB 2DICA 5IG7B 3UPRA 2EO1A 3QO1B 3ARBB 3CZJA 4JM2B 4LAQL 4WFED 3WFDL 5IWLA 3TBVB 3CC5B 3EGSA 3WFBL 3KPLA 4XGZB 4E42A 2NY6B 1G9NC 3IGAB 5JHDA 4XCCL 3MYZA 1JCKA 4TPRH 3BIKB 2RGSA 3VRJB 1SJEA 1EXUA 5ANMB 4XPBH 1NGPH 4OF3A 4XMKH 1MHCA 1KC5L 2DM2A 4J4PC 3O3EA 4JKWA 2AI0H 3SDYH 4C59B 3I75B 1A02N 4GG6A 4OBSA 1IQDB 2E9JA 3S6CA 4OQTA 2ZUUA 4XVJL 3TV3H 4LF3A 2WUBH 5T3ZE 1A3RH 5FFLA 5DEGB 4CADB 3ULVE 1G6RB 1DN0B 4Z7VA 1ZLVH 2BSTA 1ERNA 2VLRA 5J1AA 3O2DA 3DX7A 4KUZH 3X13B 5L9DH 1CT8B 1OGTA 4LPYA 3TVMD 3PXHA 4RMTA 3QUZA 2P43B 1IEAA 1ZHKA 1BZQK 2XQYK 1AD0A 1BWMA 2CIKA 5IF0A 4UU9A 2NY7L 5DHVH 1FDLL 4NNYB 1NFDB 3TC9A 1S7XB 4D9LL 2DKUA 3HMWH 3O9WC 2BOBB 1G7MB 1ZVSA 1IAIH 4WI2A 5CKGA 2ADIA 3AFLA 4HMEA 3WFCH 1EEQA 3WEXB 5IOPA 4DUVA 4K7PL 2FJFA 5HDQH 1AH1A 5F7MC 4APQC 2UV3A 5HYQB 3KDMB 5D72L 3O4LA 1KCKA 3IVKB 2H2SD 1HIML 4MWFB 1ZHLA 4CAGA 1DQQB 3Q0HA 4XT1C 2YPVL 5E94B 5LBSH 4MD0A 5C0BA 2R0KL 3VRIA 4NHCH 3L3JA 4OD2B 2X2YA 3W5MA 1EK3A 5KZCB 4LHUG 3T3PE 2VIRB 1KF9B 1KIQB 1FH5L 2FR4A 3N85L 4P2RE 3QWRA 1NCBL 1IEHA 2JCCA 3G5VB 1Q9WB 3PWPD 3VXQA 4F3FB 5FGBA 2JJVA 4Z7WB 1FORL 4XWOC 3PGFH 2PXYC 1I1AD 1MRFL 1IGFH 4X5LA 4PJFB 2X4SB 1FG9C 1MHPL 4IRJB 2Y6SD 2DYPB 2XWTA 3KPOA 4M61B 5F3HA 2BC4A 2C1OB 2YD7A 1NCWL 3M1BB 3FT3B 2WWMC 1YEIL 1V5JA 4L4VE 1ZLVK 1EHXA 2CIIA 4UBDC 1EUUA 4IRZH 1V05A 2PO6D 2YD5A 2VKXA 4KI5E 1XIWC 4KJYB 2NY3D 4IOIA 3D39E 1YNKL 1F8TH 5EZIH 4FZEL 4HS6A 2BSSA 1LE5B 2FZ3A 4HS3B 4XX1G 1XGRB 4WNQB 1FFRA 2FX8H 1INDH 3CFBA 3O11B 3O2VL 2AJZB 3SBWC 5E0QA 4OZGB 1QUNA 4HT1H 1NKOA 5CCKH 3VXSA 1LEIA 3G6JB 4XVUD 1TJHH 5DFVC 1S9VA 3ARWA 1UC6A 4HEPG 5ESQB 2QQLL 4K7FB 5D7JB 2XYCA 4XNZC 3TJEL 3HRZA 5D1ZB 4HAFA 5F9AC 4PJGA 5E4EB 2CGRH 5IMKA 4MJ5A 5T5FL 2EDWA 1GGBL 3GMPB 4GW1A 3WFDH 4ELMF 3DETC 3QCUL 1VFBB 5HHMD 3WFBH 3KGRA 3HI1B 2DF3A 5FM8A 4RAHA 3VH8G 2BNRB 3NIDF 4JPIB 1I7ZA 5FB8B 5I75C 4FOMA 1CD0A 3QUYB 4HBQA 1WCBA 1IGYA 3JV0A 1UZ8A 4UOW0 3WS3A 2HN7B 5L6YL 3HMXH 2AQ1A 3IJSB 2O26U 1KC5H 2DQEH 2E7BA 43CAB 1NANH 3QAZC 3TO4A 2COQA 5GGQH 4CN6A 4V1DE 3QPXL 4LVEA 3KPTA 3QHFH 2WNGA 1MF2H 5GZND 5E6IA 3SGKC 1WWCA 2XWBA 3T0ED 1CBVH 3SE3A 1UB6A 3GHBL 4M6AA 4DVRL 4MXQD 1EAPA 4C56A 3GSOB 4HGMA 4HIIB 1F4XL 1J0JA 1X7QB 4W68A 2NY5C 1PSKH 1QYGL 3TIEB 3D0LA 3HE7C 3D69B 1RK1A 2EKSB 2OSLA 5C08D 2IADA 3ILQD 1FDLH 4XWGL 2JIXD 2EIBA 8CGTA 3PUCA 2QBWA 4D9LH 3GIZL 3KYMA 1VGEL 4L1DA 2F15A 4F15C 1YNTA 3P4MA 3MGTA 4R96B 5DRXA 2QLVB 3U9PH 2R0WH 4HZLB 4PS4H 1I3GH 5D72H 1HIMH 2WLYA 3MLSL 4HK0A 1UXSA 2ATPB 4R0LB 2YPVH 3OG4B 1JTOA 4NCC2 3K1DA 2VXTL 1DL7L 4X9FA 4PV9B 4HDIB 4PJXE 3SHSA 2ICES 3N85H 1BZ7B 1WT5C 1G9NL 1NCBH 5LGJA 4GT7A 4NQSB 2EIEA 1QSVA 4EI5B 5FA4A 1GHFL 2VWEE 1OP5H 5GGSA 5ICXA 5T1DL 1TPXC 3PDGA 3MUGA 1QD0A 3H3BC 4QT5A 1DSFH 1QSFE 3TPUA 5DMJB 4HWNA 2F8OA 1MHPH 2FSEB 3EIFA 4ALAL 1KPUA 4HK3N 1J0HA 3FZUC 3BP4A 4B41A 1NCWH 1N26A 1RU9H 4TVPL 2IMNA 3MJ6A 3O3UN 1YJDH 1YEIH 5IVNA 3VFNA 1BD2D 4CRPA 4KJPC 2UVEA 4PV8A 3EAKA 3UTTE 1QACA 3GMOB 4PRHB 3SKNA 3UROR 2I9TB 4P0DA 2XPGA 1AD9A 5SWZA 2CRZA 1P7HL 1TPXB 3RL2A 4D0DA 1KCLA 1EGJH 4K3HA 1T22B 4WDIA 4D9RD 1CFTA 1A5FL 3PL6C 5GSRA 5AYQA 1A7OH 5FK9A 3WE6A 5JIPA 5E6ZA 2B2XL 4POYA 1MLCA 4FABH 3FCTB 2GJZA 5HVFB 3O2VH 3L3IB 4M6MH 4XPTL 1ZLSL 4F57L 1TVHA 3LPFA 4NYLA 2CLZB 5FUCC 5HPOA 4BH7A 1MJ8L 3RVVD 3QCTH 2GEEA 5CEZL 2QQLH 5C0FB 4N5EC 1R24B 3E0GA 2AEPH 1A6WL 1WWAX 4FQXB 3B4NA 4NQDA 5JPMA 5CBEB 5IW6A 2B4CC 5JXAL 2Z92B 1RJLB 4JFED 4O2CB 3TP4A 5J6GB 1EPFA 2MQ3A 3QIUC 4QCIA 5T5FH 1MFCL 4EN3C 5T3ZH 2HTLD 5EB9A 1GGBH 5BW7C 2XTJC 2PF6A 3P0YL 3QCUH 2X7LA 3ULVH 5EORH 5T1KA 4NDMB 3MA7A 2IFGA 5HHOB 4O51B 3VXUB 5TQ2L 2HWZL 1TENA 2D7OA 2C4XA 4KDVA 4NGHL 4OCRL 3G5ZB 1OP5K 2JELL 1U8NB 4MVBD 3GB7B 4XPHL 4PJ8C 3NMEA 2PNDA 3GO1L 3TFKC 5I18H 4LCCA 1MUJA 5L6YH 4LBEB 5L2KA 4M7JH 3TA3B 4L29B 2VE6A 1ONQA 3KPRB 4FFWC 3ULUC 3UX9B 2YRZA 5IR1B 3HLAA 2WBKA 2YR3A 3MFGB 4Q0XL 2PUQT 3QPXH 3VFGH 4JFFE 3QH3B 4JFZL 1W8OA 1S8DB 2FLBT 4JGUA 4PJAB 3QHTC 3RWJA 1AGEA 3HCVA 5F7LB 1D5XA 5GIRB 3D1MC 3GHBH 4LOUC 3KR3L 4WV1B 4MNHB 4PYGA 3WXWH 3P9MA 3RIAF 3FO2A 4X5WB 1F4XH 2J6EL 3OB8A 1EFXD 1OM3H 4N0UA 5FV2A 4Q9RL 1QYGH 3ARFC 3WFHB 1M7IA 1RHHB 4U1IB 1FLRL 5EO1B 1AIFA 1T83C 4XWGH 3SKMB 3TN0C 2DJUA 1NCCL 2DM4A 3ARSA 3GIZH 5BQ7B 5C09E 4KRPB 4WWKD 1DEEA 1VADA 1HEZA 4QEGA 4QXGL 3C87A 3U30C 3ELAT 4X7EC 5FUOL 4PRPA 3BZ4B 5DMGC 1K6QL 1X4XA 2KZ1B 4PG9A 4FTVA 2ZCHH 5FV1L 4D8PB 1NSNL 3MLSH 2NXYB 5EC2A 1T0MB 5DK0A 1R5IA 1C5DA 4F7PA 4AENA 2VXTH 4XNQA 3QBTB 5AWNL 4XX1E 3I3EA 3EBAA 1KELL 2MTPA 4XPGL 2Q86B 4MJID 1UGNA 2AV7B 5B39B 4DKEL 1W0VA 1MHHB 4JAMA 5TDNB 4PRBA 1EVUA 3EFDL 5DR5L 1G9NH 3QUMH 1RZ7H 3P0VL 3ZTNH 4G6FB 3IAGC 3U30B 1F58L 1SVCP 1GHFH 4OM0L 2HT2D 2VB5A 3DMMC 4OZFB 4S1DC 5DYOA 5LG1A 1AGBB 5GS2D 3S4SA 4K23H 5SX4I 1QR1A 4PJ7A 1AO7A 2FNBA 3EDDA 4QYOA 5JUEL 1FG2A 3KLAB 5CEYA 3QIWC 5LKNA 1SBBA 4GAGH 4R2GC 1NC2A 1C08B 1JPTH 1I9RL 4AYFA 4PP2A 5EZLB 2AEWA 4I5BA 5CJ8A 5TF0A 4E41E 2F54A 1P84K 3HPLA 3NN8A 2XTJE 3UC0L 4LSSL 1JGEA 2F5BH 4PJIF 3EO1A 3RDTD 3DECA 4JM2F 4RNRB 5EU4A 1SYSB 4S2SB 4DK3A 3VWJA 1TJIL 1Z3GL 2YHGA 3N9GL 2NY5L 1LQSR 5IKCB 1T21B 3IKCB 3PHQB 4QHKI 3F12B 4AY0A 4Y0GA 3E1F1 1QFUH 4BSVA 3FOLA 1QKZL 2GAZB 3ULUE 1DQLL 4XPTH 2MFNA 1N59B 1T1WB 5INCA 3KXFD 5BJTB 2SEBA 1YN7B 4M7KH 4ZSOA 1MJ8H 1MFAL 5HGBB 4RFEB 1A22B 4BQCA 5D2NE 4OFYA 4Z5RB 2YD1A 1XF1A 1DBMH 5KSAB 1A6WH 1EEZA 4PBXA 4BUGA 3B6SA 5D93C 3V4VL 5J12C 1J9CT 5I8KH 5D2LF 1AQDB 4MQTB 2D7TL 3HC0B 2IBBA 1MFCH 1JK8A 1FO0B 3P0YH 1JN6A 5MP6L 1EAJA 2WIMA 2CDFA 4YBQC 5TQ2H 5DMKB 2HWZH 3E8UL 4IIQB 5IW1B 4GRWB 4OCRH 2A6KA 2JELH 4LSQL 2NY4C 2GFBB 3VCLB 4XPHH 3BPNB 3HZMB 1NFDF 1J11A 4Q6YA 1NGQL 1Q1JL 4I9WD 4Y4FB 5DJ2A 5DUML 2H8PB 4P57A 1LP9E 4I3RH 3C6LB 4U1KB 4OTXL 4Q0XH 4JFZH 5CJQL 2GJ6D 2C5DC 1JGDB 4LRIA 3QI9D 3ZSTA 3CC5A 1VENA 2C3VB 4X6CA 3IGAA 1X5FA 2Q6WB 4IOFD 2O5ZL 3GSRA 3P73B 1FZMA 3QQ4B 4FP8H 3MRQA 5DFWH 2J6EH 3HKFA 1XCTA 5C3LD 5ANMA 4Z7OE 5IV2A 5EO0A 2KBGA 2Y25A 3NACL 1FLRH 4EVNB 3DSNA 1ZT4A 2PYFB 3MJGX 2VLKB 1TFHA 4ISVB 4I2XE 4QHKJ 4RIRA 5EZJA 5JDSB 3MOBL 2YD9A 2YPKA 5GS1C 4XNUH 3VFTA 4PJFF 4DOHB 2UZIH 3DVGA 1QPXA 2R2EA 3LDBC 2ZJSL 3UTSA 1I8KB 1R3HB 3RQ3A 1G6RA 2GHWB 4H0GA 5FYJU 4U7KA 4KVNH 4YHNB 5E2WL 2ESVD 4ORGA 2VXUL 1NSNH 3NCMA 3X13A 3IDNB 3T2PA 2OS7A 3VXTB 5F7YC 3UJTH 2B4CL 4JRXA 2EC9T 5DGRA 4J4PA 5AWNH 4ZMAT 4JDTL 1KELH 1KJMB 1A7NL 3GSXA 4DKEH 3EYQD 5DR5H 1QLRB 3P0VH 1R0AL 3VJ6B 1AE6L 5DD1L 5GHWH 5ACZA 5L0QC 4GUPB 1F58H 1G7MA 2P8MB 4XHQA 5C3TA 5KSVB 2IANB 2VLMD 3WEXA 2UY6A 2JF1A 3QEQB 3OSKA 4C83A 3QZWG 4OZGF 4HG4J 3KDMA 3AREC 4URTB 1I7RB 1MFDL 5JUEH 2A9NL 4DVBA 4G9FE 2NY1B 3ULUL 3U0PB 1DLHA 3L6FA 1MJUL 5E94A 3IS0X 2ZWLT 3DVIA 4LDOB 1I9RH 5CMAB 3X11A 2W60A 4LAJH 1UQSA 1TZHA 4OLVL 3GSQB 2X10A 1A1MB 3O9WA 3W5NA 3UC0H 4LSSH 4MYWB 4PRID 3OXRA 1QP1A 5DO2C 1J05B 1J8KA 3G5VA 4Z7WA 5BVJA 2D7PA 3I3BA 4OB5L 3V79C 1TJIH 1Z3GH 3N9GH 4IJ3B 4APQA 5J89A 3DYOA 3S88L 4X7FC 2DJSA 1Q0XL 3MOAH 4ONOA 3P3YA 4JREC 3SDCB 2UUDH 2DYPA 1XGPA 1OAUL 3HE6B 2UYLB 3N1FC 1D5ZB 1DQLH 2D31B 5E1HB 4U3CA 1CTOA 1J1OL 3H42H 3T4AB 3U6RB 2VDQH 4U2ZA 2RAMA 3DXAB 1MFAH 3SKOA 2VQTA 3KPSD 2Z93A 4D0BA 3BXNA 2VOTA 1HQ4B 3DHMA 1ITCA 2PXYA 4QO1A 4OFPA 4TUKH 3V4VH 4KK5C 1KB5B 4KJYA 3P0GB 2DIAA 4CW1B 5EIQA 1DUYB 3FT2B 2XRAL 2D7TH 4JREB 1LE5A 3Q5YA 4LLYA 4POZC 1HHHA 1IZJA 4FFYL 4JGJA 4K3JL 5C6TH 2AJZA 2JB5L 4QWWD 3E8UH 2N56A 4XBEL 2EIZB 3G6JA 4LSQH 1EDQA 3OJDB 1R3LA 2YUVA 4ODSL 4RFNC 3H3PL 1WC7A 2Y5TB 1PZ5B 2EC8A 4K7FA 4B50A 3AXLA 1XIWA 2V7NB 3IRZA 1NGQH 1Q1JH 3HNVL 3KNBB 4QOKE 3L3OA 5DUMH 5TDOA 1WFNA 4GRLD 4K71C 3CCHA 1A14L 4G42B 4PGCA 2GYSA 1ZEAL 1H3PH 5I1CL 1R5VB 1HH6A 2C1PB 3GMPA 3SBWA 3DUHA 5B38G 1VFBA 5IBLC 4HWBH 1S7VB 2BNRA 2BOCB 35C8H 4P46C 3MV9B 5DUBB 2OJZH 1VPOL 1DANU 1GOGA 4UINH 1T1XA 1FJ1B 3BX7C 2VO5A 5K9OB 4M4RA 4ZS7H 4JVWA 3QFJE 1KLGB 3D9AL 1IARB 2Z31D 1CVRA 3NCFB 4LP4A 2DLGA 1LEKB 2UUDK 1J87A 1I3RA 5A2LH 5KOMC 3G9AB 4NUJA 3ZKND 3Q2CA 5JO5A 1HXYB 1SYVA 2Z91B 2F53B 2GTZB 1IC7H 3MOBH 1YMMB 4LEXL 5FCUH 1NMAL 3AU1B 3MACL 4YFLF 4XZUB 4ZXBD 4AIXA 1PDKA 2ZJSH 2DQCH 2J88H 4Y16C 2DQIL 1OQXA 5E2VH 2HRPL 5DRNB 3LQAC 5E2WH 1NGWA 1DBBH 4L8SB 5HGAB 4HIIA 4WU5A 2RBLA 1OF2A 1OY3B 4LPCA 1F13A 3W0WD 4MAYB 3ZDXF 4JY5L 2B4CH 1N6QL 1T66D 3MQIA 5BRZA 5ICZA 4JDTH 2G60L 1MY5A 3QEGL 3WHXB 5KAQF 1BQHG 1O0VA 4HK3J 4WO4C 3PQYE 3ARGC 1YEKL 3HNTH 3MV7B 2DQHH 2HLFC 4P2OB 4KKLC 4R26H 5EUKB 3B2UD 4G7YH 1GRWA 5I1DA 1AE6H 3HG1B 4W4OC 2IPKA 1MCWM 1SEBB 5DQ9B 3FKUS 4YX2L 5IBTH 2R29L 3IDIA 3VFUB 3DGGB 4F8TA 1I85C 4NSKB 4UILL 5K9QG 1P7QD 5LGHL 1T2QL 3WIFA 1QA9B 4YR6B 1QSEB 5A40E 3VXOA 1Q9KB 1MCDA 5JOPE 4LNVA 3ULUH 3HE7A 3IFPA 4R0LA 3G08B 2ZNXA 5GJSH 4F33B 4QKXB 4HDIA 4OCWL 3SE9L 4OLVH 1KPRB 4Z7UB 3FQXB 1BZ7A 3L7FB 1ZGLA 1DCLA 1NAML 1IM3A 1UWEH 3WLWC 4OB5H 1UEYA 4RWYL 3TT3L 1DBAL 5DZNA 1XMWA 2YK1H 3BKCL 1UZ6F 4MJ4A 3FB5B 3IFNL 4HWEL 2WBJB 1PKQA 3A67L 3GK8L 2FSEA 5HD8D 1OAUH 4WFGD 2AJVL 1NMCB 3MLYL 1J1OH 3RWDA 1WFTA 4WY7L 4FQJH 2HJKA 2YMXL 1WT5A 2AXGA 2IPTL 3GMOA 5EU7C 4GSDL 2BVPB 4UIKL 1U3HD 3AUVA 5ELIA 1WF5A 1IKFH 4LU5H 3IFOA 4Z8FL 4JGMA 3OKDB 4YHIA 3VXMD 4YHYC 4H0IA 2VNCA 4UT7H 5KBNC 5ETUA 1LGVA 1IFHH 3C9NB 4UAOC 1HH9B 1J18A 5J11C 3ESUF 4AM0B 8FABA 2R0LH 3FCTA 4KU1A 1J0ZA 4FFYH 4K3JH 2DQTL 4JZJC 4XBEH 2MWCA 5IEHB 3JWDC 3RWCA 1OT2A 3B9EA 3E6FB 4ODXB 1ZV5A 1EERB 2VAAA 4HX1A 1T7WA 4H5SA 4MXVF 4MNGE 3ME0A 4HXAL 4FQXA 4HIJB 1GZQA 3PL6A 4MDIB 1I9IH 4KROB 5I8CB 4O2CA 4WW1B 1A4KB 1ZEAH 3LS5L 4WU7A 1ZLUH 5I1CH 1W72L 3TVMC 3BQUB 4NO0D 3K7UA 3PWVA 5HHOA 1ND0A 4MX7B 1RPQA 4O51A 4HKXA 3VXUA 4BQBA 4JKPH 4F7MA 4NUGL 2NY2D 3HZVA 1VPOH 3S37X 2WSKA 4FMFA 5EH1A 3Q5TA 4Y2OA 3D9AH 3PWLB 4HGWB 1TCRA 4GG6F 4LBEA 1FVDA 4ZNEA 5JHLH 5F1IA 1SMAA 5IUSA 3QIUA 3RTQD 2AEIT 4EN3A 3GDBA 4Y2DB 5BW7A 5I1AA 2H2SC 1NMAH 1S8DA 4P5TB 2ADGA 4MSWB 4JJ5B 1EMTL 1AFVL 1IBGL 4BZ1H 4JY4A 4EBQH 2DQIH 4GS7B 3CH1B 2HRPH 3HHRB 3WUWG 1OAQL 3K8MA 1QVOB 4MNHA 2HKFL 3JSSA 4PJ8A 32C2B 4KK9C 5FA3B 4RAVB 1PVHA 3V6FA 1IQWL 4GKOA 1JPFA 3OKNA 3QEGH 5ITFB 4HUKB 3F7VB 1HYRC 5FUZL 5I1LB 3EDJA 4Y1AD 1YEKH 1I1AC 5IB3A 5C0CD 1XGUB 3MXVL 4U6XB 4P2YA 2XICA 3DTXB 4EIZC 4NQCA 4ONHB 4P2RB 1C7TA 3VXRA 1NGZB 2ZNWA 2Y6SC 4X6DF 1F97A 4ZAKB 4YZFF 4JQIH 1U8KB 2R29H 1Z2KA 3DUSB 2FWOA 3BZ4A 4KKAD 4JRYE 3C6SB 5IB1B 1KULA 4F8QA 2C7UB 4YDJB 5DJZB 2J8UA 3MNWB 3ARFA 4U1JB 1QO3A 1T0MA 4R3SA 4B5EA 1IAOB 5F88B 2FIKB 1MLBB 3UZEA 3IAPA 1JNHA 1ZLUK 2PO6C 2QSQA 1T83A 2JCCF 2AJYL 1CFSB 4X6EA 4I3GA 2YC1A 4U1NA 3TN0A 4OCWH 2NY3C 4GXVH 2G5RA 2AV7A 5B39A 3MJ8B 5TDNA 4UT6L 5HJ3A 4CGTA 5JW4Q 4KTEH 2XTLA 4L4TA 5FIEA 1EZVY 4LKCB 3TM6A 3O45B 1BFTA 4NJAL 4LNRB 3QUMB 4RWYH 5C0RH 4KGJA 3TT3H 3GNMH 1MFBL 3ZSSA 2JK5B 3BKCH 2X1WL 3FFCE 3T0DA 2CDGB 3D39B 3IFNH 2BRRL 4BYHA 2HKHL 5IP4A 4I0CC 3N1PC 4P23D 3A67H 4XVUC 3GK8H 1JWUA 1YUHB 4JLRB 1AJ7H 5C07A 6FABL 3EO0B 2AJVH 2D7MA 1A6ZA 4PRNB 3TEUA 3MLYH 4WUUD 4HULB 3AC0A 5C7XL 1K85A 2EDLA 5ADOL 4FQIH 1QG3A 5KSBF 2P5EA 3QDJD 2IPTH 3DWTA 2CKBL 3FO9B 4JY6A 3UBXI 1IILE 4FG6D 5CILL 1UG9A 3MRIB 5GGUA 3LQAL 3ROOB 4FQQB 4RNRA 1Z9LA 3DMMA 3E3QC 3FN0L 4N0RA 3CNKA 5FEBA 1KIRB 2AK4E 1OCWL 5DA0B 1F4AA 5T5NG 3RZWA 5EIIB 3PHQA 4LARH 5E8EB 3QIWA 4D2NA 3F12A 1C5CL 5F8RC 4HH9A 4JFYB 2CKNA 3U0TB 3KLSA 3BRFA 3HAEB 1T1WA 4C54A 4PRAA 4G6MH 3P30L 3LKNB 4M7ZC 3VI3F 5HGBA 3LN5A 4QLRA 3EW3B 4PJDA 1AKJD 2E6QA 5HHMB 2OR9L 4P2CG 5GZNC 1FVEB 3VMPA 3MRCA 3T0EC 3EYSL 4MXQC 3CSGA 1OAZL 3WIIL 2DKSA 3HC0A 4MQ7B 1T5WB 3LS5H 4V1DB 1J10A 1I1YB 5EFIA 3L3GB 3R1GL 3AB0B 1M71B 1W72H 3TO2B 1FO0A 3NZHL 3SDDD 1XF3A 1FYTA 3O3DB 1CR9L 1K4DA 3K2UL 2IPUG 4LIQL 1G7PA 1V7ML 4HHAB 5T3XE 1G7QA 1PQZA 3GSNH 5EDXA 4CVXA 4NUGH 2VQ1B 3RAJH 1VACB 3B8SA 4L3EA 3HZKB 4M7ZB 1QEWB 3ILQC 1QRNE 2B39A 2GFBA 3VCLA 3ZYJA 5HYJA 4WJ5B 3VFPB 3CVHH 3W9EA 3V7MA 3S96B 1UM6H 2ITDA 4OZ4A 1N2RA 2H8PA 2YA2A 4ODHH 3SKJL 4M03A 4TN9A 3K0WA 3K46A 3X3FL 5CZVL 3S5LG 4ZDHA 4U1KA 4CUCA 1M05A 4NCDA 4RBPH 5D1XB 3QWRD 4DKFL 4JFDD 4YHLL 3JV6B 4NNXB 1I1CA 2C3VA 1EMTH 2QL1A 4OSUL 1TQBC 4XVSL 1OAKL 3MNVA 2HKFH 3P73A 3QQ4A 5DJAB 1XF5B 1YPZE 5F7EL 4OFDA 4QGYA 1JZ7A 1JYWA 1IQWH 3MRNB 2OI9C 1KT2A 4HCRH 1BECA 4JR9L 2RQ8A 3E6HB 2PN5A 5L8KB 1R3IL 4OJFH 2X4QA 4P4RB 4ZUSB 3NIGE 1P7KA 3W39A 1JI2A 1N0XH 3CFCH 4XVTH 4LVNC 2PYFA 4PJXB 3MXVH 3D5OF 1KV3A 3MV8D 2G75B 3FJTA 4WTXA 4EI6A 1X5KA 2P44B 2MCPL 1FL3B 3IU4L 4NKIH 3ZKSD 1NAMA 2QADD 5FDWB 1FSKB 1BP3B 4XAKD 5DQJB 4XCYA 5CBAB 1EO5A 3VXNB 1KN2H 5J57B 3T4YA 3LV3B 3QXAB 1QSFB 3F8UB 3IDNA 1I75A 1GAFL 4NQEB 3VDBA 1XCQA 1RZGB 2J7LA 3BN9D 4LSVL 4J3VA 5FKPA 3WV0A 4BSWB 1VA9A 4MNQA 3CDYA 5LCVL 1KJMA 2MKLC 2AJYH 4NO5A 5FYKD 3L95B 3CDCA 2A38A 3U83A 2BHYA 5E2JA 2IAMD 2X5PA 3QJHB 4O9HH 1AGDB 4OZHE 4UT6H 1QLRA 3VJ6A 3C8DA 4GUPA 4ZTPH 5GRWA 3V6BR 1HDMB 2V2TA 3BKML 2XA8L 5HHPB 3ZL4L 1S9XB 5EBMA 4HUWB 1KJVB 4O2FB 1ACYH 1I7RA 2HKHH 3MLXL 5GGTH 3C5JB 2K3TA 5F6HI 3RVVC 3TT1L 4JFPB 3U0PA 1S7TB 4G8IB 3WNMA 3M17A 4A2LA 1T5XA 3D2UD 1SQ2N 4RBPK 4RMSA 4ZFGH 3CPLB 2H1PH 2HVKB 5EG6C 3JUZA 1HHKB 1AXTL 1FLTX 4GMTH 1MCRA 1GGIL 4H1LG 2ILLA 4Y19E 3LB6D 2BNQA 1KB9J 1H3VA 4HFWB 3BFOA 3LRSA 1C8PA 5JIKA 1OSPL 1J05A 2FCBA 4R4ND 2IJ0C 2HTLC 3LQAH 3H9SA 5FAAA 1BIHA 4G80A 1YEJL 3C09C 4MJ2A 3NFNB 3DURB 2BJML 1B4RA 1NCTA 4ZD3L 4MVBC 1DLFL 3SDCA 5CEXA 5EWIH 5DJ0A 5HGDB 3MJ9H 5DEFB 1U95A 1A0QH 5KVEL 1A6PA 3NAAL 4HSQA 2YZ8A 1QFWI 2R15A 3P30H 3EJYD 2IALB 4Z7QF 3QDGD 4YHKL 1CF8L 2AJUL 4KKCD 4ZS6D 4JG1H 1HQ4A 5JIHA 4LLMB 2OR9H 1QR4A 1U3JA 3QULB 1KB5A 3TYFB 1FZOB 4R90H 1OGAD 4RGMC 1OAZH 1RQ5A 3GEWB 1HWGB 1K8DA 3O6FD 3MLWH 3R1GH 4JFFB 1JF1B 4P5MA 1D6EB 4LHUB 3WL9B 1H3XA 3UTZB 2LE9A 1E6JL 3K2UH 4LIQH 5GGRA 2W59A 1GVIA 3B9KB 3DRQB 1H5BC 2Y07H 1N6VA 3QHZL 2R4RL 4IBLT 1EHLL 3TH3T 3JBG7 2NX5D 4OLXL 2UWEA 5FYJD 1L7IH 3FHQA 1XR9A 5C92A 2Z4QA 4JFXA 2Y23A 4DKAA 2LU3A 4WWKC 5E8OA 3I6LE 1TVDA 2MOVA 3ILPB 1WBXA 4RGMB 3SKJH 5CZVH 3X3FH 1JGVH 1S3KL 3GJEA 3V0WL 1QFPA 5I1GH 5F6HJ 4J3TA 1X5XA 1G7IB 5CSZB 1LNUA 3ARXA 5C09B 4QRRD 4CVZB 4YBLB 4DEPB 3GM0A 3VD5A 1T7XA 4XVSH 1OAKH 1PEZA 5F7EH 5IJKC 3ISWA 1QFOA 1N5YH 3MLZL 2CRYA 4JR9H 1BAFL 3T1FA 4K8RD 3KVQA 4H8WC 4K3EL 5DD6A 2JE8A 1OT1A 4BZ2H 3QDHA 2HT2C 5F9JA 4EDXA 5EUOA 1HXYA 1DDHB 4E0RB 4S1SL 2F53A 4XH2B 1P4BL 2WZPD 4CDHA 1PFCA 3LEXB 2HG5B 2MCPH 1CGYA 1UACL 2DDQL 3RL1A 2CDEB 1BBDL 1JZ2A 1CG9B 4PP1D 4P46A 3U9UB 4NZUH 4UUJA 3OAZH 1DR9A 1ITBB 3OKYA 1G0XA 5HGAA 5E08L 4J23A 4LLDA 5DMIL 3MRGA 4OZIB 1ZHNA 1GAFH 1A3LL 3E2HC 3T0VA 4MAYA 1DBJL 4PGEB 1NQBA 4LSVH 2VXQL 15C8H 2CLRB 4YIQA 5LCVH 2BHUA 4G8EB 4A6YH 1KJ3H 1U8LA 4KAQH 4NWUH 2EH8H 4E41B 3VH8B 4PLJD 2H6PA 4PJ7F 3TZVB 3SDXA 1I8IB 2CKBA 4Y16A 2XA8H 4G8GE 4P59L 5I30H 1CDHA 4ZPTB 4HFUL 5C0IA 2FB4L 4LMQI 3DUUA 3MLXH 1QA9A 2AKRB 4YR6A 1DQJB 4OIIL 5C0JB 2IH1A 3RDTB 3L5WB 3LKOA 4PJ5E 1NLBL 5T1KD 1RMFL 3QXTA 2A1WL 4WO4A 3ARGA 3A6CL 4KQ3L 3TBSB 1AXTH 3REWB 3FQXA 3L7FA 2ZPKL 4HC1H 4W4OA 4MAUL 2VITB 4LEOA 1Q9OB 1OHQA 3QZWA 3KPMA 5FYLE 5SWSD 4KC3B 5D2NB 5J3HD 1S7WA 5IMMA 1I85A 2FX9L 5L2KD 4AEFA 1T4KB 5FGCE 2ITCB 4XPFH 2DMCA 5LAXB 3OV6A 1FFQA 1EJOL 2BJMH 1ZK9A 5CIPH 3C5ZB 3ULVF 4ZD3H 3QWOB 2WBJA 3FRPG 2A6DB 4X9HA 3OL2A 1FCCA 5T3XH 1DBKH 2AJXL 3DSFL 5EU6E 3SJVD 3S35L 5EN2B 5DURB 2H9GB 1KXTB 2GTWB 5I8EB 3LEYL 4TRPL 2F58L 3NAAH 3BI9X 1X5GA 4OT1L 1P4IH 4OM1L 2BVPA 2DI8A 3OAZK 1MREH 1FBIH 4NZTH 5HVHC 1XZ0A 2AJUH 3RWFA 2VDRL 4XC3H 3QI9C 2BVQA 1U8MA 1JNJA 2Z8SA 2J5LB 2PYED 2FRGP 2DBLL 4FNLL 4MB5A 3MBEB 1UYWL 3RVUD 4OCXL 3C9NA 2R8SH 3VFRA 1LP9B 4NRZA 3K1KC 4LCWE 3ROLB 3V0VA 4IOFC 1FNGB 5IQ7H 4AM0A 3QDMD 1MIMH 2UVFA 2EYSB 2H41A 5E2UH 5K59E 4O2EB 2PTUA 4XB8A 2VDML 4OLXH 1CDUA 3AMKA 1ZMYA 1ZT7B 5HGHA 5CD3A 5MEND 3T3PF 1B0RB 1T3FA 1JWSA 4R4FL 1E4JA 4JHAL 5DI8A 4PLOB 3FO0H 2WINB 1L9NA 1XGYL 4NBYB 3BQUA 3V95A 5F7UA 3BZEA 1QTYT 4MX7A 4N8PA 2HVJA 4JM4H 1DUZB 3Q6FA 1TQCB 4OLZH 3PXJA 4XPAH 1TITA 3EYQC 3BE1L 5FM4A 5I76B 2EYRA 1GZPA 3PG2A 3BMVA 3WXVH 1OSZA 3G6AA 4HKBA 4K3EH 2YEZB 2IBGA 3KXFE 4F7TB 4S1SH 3Q6GL 4N8CH 1P4BH 1UCTA 1WZ1L 3BO8B 4KI5F 5E8DL 3TVMA 3K8KA 2KQNA 4ODWB 2BY3A 2DDQH 4KI1A 4MCZA 1BBDH 4KK8D 1WICA 5F1NB 2I07B 3TCLB 2VUOA 4HKJA 2X4OA 1QVOA 5BS0E 4CJ0A 2XY2A 5ILTH 4NP4H 1F90L 5FA3A 4RAVA 1JI1A 2VDLL 1DBJH 4G9FB 1N64L 4ZFOB 4WHYG 2VXQH 4G6KH 2UY7A 4WW2C 4UOW1 1S9WB 1A1NB 2CO6B 2FBOJ 1XGUA 3IDGB 1MI5D 1HSBB 4ONHA 2J8OA 5F6IC 3MLTB 4PJHA 4Y4KD 4LSDA 1I1RA 1KTLB 1U8KA 1QLEL 3MOQA 1FL6A 1V7NH 4RZCB 3HC4L 12E8L 3FRUA 4M02A 3LD8B 3C6SA 1RAMA 4KZDL 2ICWA 5IB1A 2FB4H 1UKQA 1NC4B 3NCYP 5JLZA 5DJZA 4OIIH 1DVFD 5AG8A 3PWPA 4PIRF 3WJLA 3ALXA 1IAOA 1RMFH 2WAHA 3MCG1 1MLBA 3D6GA 2DBJA 1I1AA 2QKIB 2GJJA 4JG0H 5I19L 3MYJB 2E5EA 1KSRA 2VZTA 1E4KC 5KG9B 4RGNE 3U46B 5T33L 4YGAB 1MQKL 2FX9H 2UZYB 4YXKL 3X3GL 1D9KB 2B1AL 4Z78B 4OBRA 2VH5L 2V2XB 4QWWC 3TIDB 3HRPA 4H8WL 1F11B 1NCDL 3MZGB 3KPSB 3ARBD 4JM2D 1A4JB 2AJXH 1QPPA 3S35H 1CLOL 1XFPA 4RQQA 2PO6A 2A74A 5FM5O 1X6LA 2NY6D 4JHWL 4ZUTA 5DHYB 4QXTA 4PJIE 4GRLC 4EOWL 2LABA 3T09A 2FJGB 2XOTA 1BREA 1FC2D 3LHPL 1GGYA 2VDRH 2XWJA 3QQ3B 1N5AA 5C0EA 2NYYD 4QOKB 4FNLH 2DBLH 4I77H 4KMQA 3TWCL 4OCXH 4U1SB 4PLKD 3N50A 3PWJA 1EA9C 1S5IL 2E7HA 1A9EB 3HZYA 4FXKB 2VKWA 3OXSA 3VFMA 5JOEA 5IVXA 1MWAL 3LKRA 1O5DT 2Z31C 2BVOB 2Y36L 5D7LE 5C2BH 2RB8A 2YZ1A 2HFTA 2BX5A 1ZKAA 4OFKA 4ZFZA 3ZKNC 4Q6IC 2VDMH 3GMMB 1E4WH 1JRHL 5C1MB 3V2AR 4KTDL 1S7UB 4OAWA 3BEWA 1H9VA 4PJXF 1DZBA 3QFJB 1I9JH 4OGAD 2NTFB 4TQEL 5F7DB 4ZXBC 2P46B 4UB0L 2AEQL 2YD2A 4R4FH 1MFEH 2EDQA 5FOBB 5I71C 1L0YA 4K94C 1J1PL 1YNLH 2XY1A 3BZFB 2VN4A 4M93B 4NCC1 4HQQH 1M71A 1B9ZA 1UJ3B 1J8HD 2VDNL 1R5WB 3GGWB 4U6HA 1RIUH 4C55A 3BP7B 3DPBA 3EO9H 4WI4A 1BBJB 1T66C 3CFEB 4MD5B 3P11H 3TLRA 1QEWA 4J3UA 4LHJB 2X4PB 1MRCH 1XF2A 3BZDA 3GSNB 1BZ9A 2W07A 3M8OL 1JIBA 3B2UC 1MPAL 3S96A 4HIEB 2DI7A 1KTDA 3T0EA 2CUHA 4HPOH 1HI6A 3CVHB 1OP9A 3K4DA 2OLDA 1ES0B 5KZCD 1S78D 3PQYB 1WZ1H 3UCRA 1GSMA 3CSYB 1X5AA 5AZ2L 1IAII 3NPZB 4NNXA 2VL5B 3AM8A 1FNLA 2ZSVB 3LN4B 1X5JA 4NKOA 2ARJB 4KMTL 5IMOA 5C08A 4H88H 3P77A 3KJ6L 2JIXA 1BPVA 2GK0A 1F90H 5H2BA 4IRJD 2GUOA 2A83B 2AXFA 4G8FA 4AEHH 3MRNA 3G9VA 3QA3B 3NCJL 1RJZB 4BFGA 3E6HA 3KYAA 4QRSB 4N8VA 5EU3B 3WLBA 2P1YA 5DWUL 5C0ND 3I02A 4QRUB 3LIZL 5D5ME 1CL7I 3QIBB 2AJSL 4JO4H 4HW6A 5FYLH 1X3DA 2G75A 1MNUH 2R2HA 4OLWL 1CE6B 4I48B 1X5YA 2BDNL 3WUWA 3T0WA 1OAXH 5DTFA 3B2VH 3G5YA 5HD8C 1QLEH 4I3SH 1U8QB 4KGLA 5DQJA 4QRPD 1NDGA 4HV8B 3HC4H 3PGDB 2XQBL 1EIBA 3MLPA 3IT8D 3SO3B 3UTOA 3AS3A 1BFOA 1U93B 3LMJL 1U58B 1TLKA 4NQEA 1U3HC 5I6XB 5C9JB 1I9EA 4X83A 3NZ8B 1YQ2A 3T04D 7FABL 2F8VA 1W2KT 3L95A 3NPSC 3S37L 4XNYL 4IMLB 3GRWH 1KNOB 1NBVL 4PJBE 2R1XB 4X0KB 4XP1H 1Y0LB 3U0WL 5T33H 3BH9B 5D7JD 2LTQB 3C5SB 3OQ3B 3WHE0 5FECA 1MQKH 4YLQT 1HDMA 2Q3ZA 5D1ZD 2WUCH 4XXDB 3NGBC 1FNHA 1BD2A 2VH5H 4ETQB 3FOMB 4XMLL 1FIGH 2MSPA 2ZSWA 3R0NA 4H8WH 1NCDH 2P7TB 4GMSL 4KXZI 3PF2A 1S7TA 1YY8B 1BGXL 1C1EL 4P4KB 1AHWC 1CXEA 1IM9B 4F7EA 1UB5A 1U6AL 2HT4D 3QUYD 1GOFA 2WANA 3W0WE 4LCIL 3EOAB 3RWIA 3MC0A 5D71L 5ALBH 3F6IA 2O5YL 3TWCH 4MNGB 1MCBA 3ZKXC 3DURA 2J2ZA 2NY2C 2IPUK 1FFPA 5L7XL 4WI9A 4U31A 1MWAH 4YAQA 4TOYL 5HGDA 4KVCL 1RZFH 2Y36H 1MCEA 3GIVA 4I18C 5F9OH 4GAFB 4JFEA 3RTQC 3HUJE 3N06B 3BUTA 1ZA3B 4KTDH 4Z0BH 2CUMA 2XN9D 4DN4H 5EU5B 5IM7B 5GRUL 4F2MB 5EPMB 1FFOB 4Y5VB 4UB0H 2AEQH 3BIBX 2A9ML 1FZKA 1FZOA 4PGDB 1J1PH 5BO1H 3QPQD 4LPTA 1T1YB 4H1LH 3OR7B 1KCRH 4HMCA 1MHEA 2HFEA 3LEVH 2VDNH 4N1CA 5D70H 5I73B 4EIGB 1BM3L 2DQJH 5D4QA 2DS4A 3LPWA 1YMHA 4ONFL 4DGYL 2R0ZH 3QRGL 4HBCH 4B7IA 2D7NA 3M8OH 3ZE0E 4WUKL 3VRLE 1MPAH 2YOCA 2FHBA 1W0YT 4YHZL 4X9BA 4BSJA 1J0IA 2X44D 5MHSD 3BD5A 1QFWM 5J1TC 4KKAC 3FAWA 5KS9E 3V5HB 5FHBL 5D1QD 5B21A 1BFVH 2D3VA 5AZ2H 1N7ML 1JZ6A 4FXGA 3O3BA 4EI5D 1H5BA 2V17H 4U6TA 3V5KA 5J4MA 1ED3B 1XH3B 4UDUB 5F70A 1OVZA 4GOSA 1YZZA 3KPQA 3ULUF 5AAMA 5HY9B 4NN5C 4UDTB 4YXLL 2BXZA 1MCOL 3NCJH 4U1HB 5F7HA 2WV3A 5D6CA 4QRTA 2XZZA 1DDHA 3LIZH 4CN4A 4E0RA 1YEHL 4XH2A 2AJSH 5D9SA 2L7UA 3RWEA 4NQXB 4PRHD 3DROB 4YPGB 3HS0B 4P23C 4WGWB 4S1QL 2CDEA 5AEAA 4E5XA 5ISZE 2J8UF 4QXUL 1U8IA 3S34L 1H3WM 4QHUA 2V5MA 3GUTA 4MJIA 2XQBH 1Y18B 4NM4L 5HHXL 2J4WL 2Z8VC 3FFCB 5IJKA 4OF7A 2DTML 3THMH 1QBAA 4OZIA 3LMJH 4XP4L 4PJCA 2QSCL 1L6ZA 4K94L 1MCCA 4HIXH 3SE8H 4FG6C 4YDLC 3NFSL 4PGJA 3H7BB 4G8EA 3BWAA 3RIAK 3WBDA 4FQLL 1JMZA 5B38B 3RUGE 1NBVH 3MRMA 4A6YB 1CI5A 1LP9F 4RRPA 5CWSA 3GBNH 4Y4HB 3U0WH 3CVIH 3QNZB 3WNLA 4WUUB 4ZPVB 4KFZC 2FDBP 4XNMA 4NZJA 4XMLH 1E28B 5K9KB 2GT9B 2AKRA 5IMLA 3D3VE 5DJYB 1HXMA 1HHJB 1RIVH 3HC3H 4MA3A 1WBZB 1GGUA 3RDTA 1FGNL 3QUKB 4TSCH 2YWZA 1RZ8B 3QUZC 1MWAA 4MHHG 1T7VA 1ORQA 1Q8MA 1WZLA 1RV6X 1TZIB 1R3JB 4UTBH 1OD9A 2DD8L 1K2DB 3SDDC 3U79A 2XG5A 4IRSB 2K7QA 3TA3D 4DFIA 4JCMA 5ID1B 3GMNA 3KPRD 5LAXA 4IHOA 3MO1B 1M6OA 3O2WL 4KHTH 3QWOA 1BQHB 1IGMH 4PY7B 3MROB 3R06A 4HUUB 1L7TH 1DQMH 5L7XH 5CIPB 3DO7A 4KVCH 3GJFH 2H9GA 2GTWA 2X4RA 3VGAC 2BVYA 5I8EA 1ORSB 1NGXB 3O8XB 5GZOD 1QRNB 3D25A 4LPXA 1EEYA 1WITA 4W6WB 1JHLH 2AGJL 4P9HC 2EE6A 1G1CA 3QWQB 4EEEA 2A9MH 2X9XA 4YDKL 1BIIA 3ROLA 4X6BB 5DF0A 1K4CB 1FNGA 3OHXB 3WMSA 5EOQL 3CFJB 4U1LB 4X4MA 4KRPD 4FS0A 2GCYA 4OV6F 5AUMA 1CLCA 1BM3H 5JW4N 4NN6B 2EYSA 3L7EA 3NA4A 1S7RB 4O2EA 4ONFH 5AZEL 3QRGH 3VXPA 1WVZA 2GJ6A 4MXVE 2NXYD 1YPZB 2ZP0T 3QI9A 3U2SB 1JNNL 5TPWL 1B0RA 3CJJA 5I1JH 1NGYB 1HHIB 5E5MB 4YHZH 5JHDE 1KBGL 2QADC 4HLJA 4ZUVB 3O6MH 3QDJE 4NN7C 3SEPA 5FHAL 3C2AH 4KH2A 4ODBD 2OP4H 2XZQH 5FHBH 3ULSB 4TUJB 2FGWH 4G6FD 2FBJL 4GLRH 5JR1L 2QHRH 3BN9C 3FFDB 1LEGB 5B3NA 4JN1H 3WNKA 1NJ9A 3U7WH 3DX8B 4AL8H 2VR5A 2Q20A 5JPNA 4GG6E 2IAMC 2C4FU 2YBRB 1PY9A 5CP7B 2NXZD 1S7SB 1GOHA 1MCOH 1C5BH 3V6OC 4ZQKA 1TJGL 4Z7VE 5JW4R 5TDPB 2VLRE 2X70A 3GJFK 1YC7A 1YEHH 2ESVA 3DIFA 3DNKA 3MSPA 3BGMA 5DSCA 4G9DA 1WEJH 4LASL 2NY0D 1DN2A 4I13B 4S1QH 1YQVL 4FQ2L 4QXUH 4KDTC 3PGCA 2O5XL 4WHTA 4AT6B 5JXED 5E99L 3ZDZF 1TMCB 2DTMH 1INQB 5GS3A 5E9DB 4H26B 2VXSL 1KJ2B 4XP4H 1KCVL 5IHZA 3LB6C 1X4ZA 3DYPA 3ARVA 1I3VA 4K94H 3BP6A 4R4NC 3NIFE 1A9BB 3NFSH 4R7DA 2QQQA 4FQLH 1G0DA 3I6KA 3O4LE 2R56L 3QG6A 3X12B 4Y19B 4HUVB 4FQPA 5C0BE 5EOTB 2GSIB 1DANT 2DN7A 1GPOH 4GXUN 3D2UB 3MV01 4JDVB 2HFGH 4QY8B 5D96C 5KSAD 4U7SA 3KJ4B 5E03A 3P4OA 1VFAB 3MUJA 1ZSDB 3SE3C 4G6JH 2XZCL 4MCYB 3EJYC 4PRIA 1ZHBB 2JCCE 3FQUB 3IDMB 3MGOB 4KKCC 2GW5A 3NOIA 4ZS6C 4WW2A 1A6VL 5F72S 1U0QA 2ORBH 1ZWIB 4XMPL 3OKMB 4X4YA 1RUPL 4CKVX 2EDRA 2PR4L 1AP2B 4ZFFA 3VFWB 2B5IB 3WS6C 1DE4B 3O6FC 1QBLL 3NABH 3U46A 2W1NA 1F4WH 4JO3L 5ID0A 2DD8H 2ICWJ 3DX6B 4NO3B 4WHYH 3BOVA 3VGEA 4DCQA 2OQJB 3MA9H 1UA6L 2YUZA 4Y4FD 3RVWD 4EUPA 1KIPB 3IDYB 1M7DA 2M2DA 3C6LD 3MPCA 3WO4C 4Q74A 1F11A 1NL0L 3KPSA 4CNIA 5E1AB 2VZ3A 3HI6H 1TVBB 4JO2H 4Y8DC 2BVEA 3F7QA 4FQHB 3PWUA 3WFEL 3OJ2C 4JN2A 1E4KA 4KRNA 4GAYB 2AGJH 3O41A 5CKAA 1B3JA 1MIEH 1KPVB 2OZ4H 3C60D 3CX5J 5FYKE 5I66B 1MSPA 3VXSE 1RJCA 2BSRA 4RDQG 3T65A 2NX5B 2VLKD 3BSZL 3VWKB 1NBYA 1YYLL 4WCYH 4FFZL 4KUCD 4OV5B 2XFXB 3RIFK 1WBYA