2JCKA

Crystal structure of alpha-1,3 galactosyltransferase (r365k) in complex with udp and 2 manganese ion
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
278
structure length
278
Chain Sequence
LKLSDWFNPFKRPEVVTMTKWKAPVVWEGTYNRAVLDNYYAKQKITVGLTVFAVGRYIEHYLEEFLTSANKHFMVGHPVIFYIMVDDVSRMPLIELGPLRSFKVFKIKPEKRWQDISMMRMKTIGEHIVAHIQHEVDFLFCMDVDQVFQDKFGVETLGESVAQLQAWWYKADPNDFTYERRKESAAYIPFGEGDFYYHAAIFGGTPTQVLNITQECFKGILKDKKNDIEAQWHDESHLNKYFLLNKPTKILSPEYCWDYHIGLPADIKLVKMSWQTKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords N-ACETYLLACTOSAMINIDE ALPHA-1,3-GALACTOSYLTRANSFERASE
publication title Conformational Changes Induced by Binding Udp-2F-Galactose to Alpha-1,3 Galactosyltransferase-Implications for Catalysis.
pubmed doi rcsb
source organism Bos taurus
molecule tags Transferase
total genus 101
structure length 278
sequence length 278
ec nomenclature ec 2.4.1.87: N-acetyllactosaminide 3-alpha-galactosyltransferase.
pdb deposition date 2006-12-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 2jckA00
4HOCA 4P02A 2Y4KA 1FGGA 3ZGGA 2RJ1A 4IRQA 4FQWA 3EE5A 3U2TA 1GWVA 1H5SA 1H4EA 1VGUA 3ZLLA 3SXAA 2XWLA 4Y64A 3OH0A 3U0XA 4FRPA 1G9RA 3PKQA 3V0QA 2PGVA 5C4EA 1ZJ0A 3BRKX 1H7GA 2FYBA 1VGWA 2CU2A 1FOAA 1W77A 3T7OA 3D98A 1ZCVA 2BO4A 2RIXA 1INIA 4B4BA 2PGYA 3I0IX 1OQMB 1VPAA 3IOHA 5C38A 2OI7A 2Y4LA 3SX5A 2ZU8A 1ZDFA 3I0CA 1SS9A 4B4MA 3OH1A 3R3IA 1VGZA 2VXMA 5C1GA 2RIZA 1GX0A 1GQCA 4AAWA 3V0NA 1R80A 3V0PA 2D7IA 1HM8A 1XHBA 1H5SC 1W57A 4ZDQA 2QGIA 5AJOA 2MZBA 1R7VA 5FU8A 4D0TA 4M28A 2XMEA 3I0LA 3OAMA 2BO7A 5CQLX 1WT1A 4ECMA 4HO3A 1H5RB 2O1FA 5IFYA 1MP3A 1VH1A 2WVMA 2GGOA 5FYEA 3CU0A 4G3SA 3ZF8A 3SXGA 3Q4SA 3QVBA 3USQA 1ZJ1A 2YQJA 3V8ZA 3USRA 5C3DA 1O0RA 1TZFA 2JCKA 1LZ0A 4Y7UA 4FCUA 2Z86A 4KNXA 5AJPA 1MP4A 1GA8A 1ZCYA 4D48A 2VS5A 1NF5B 1HV9A 1H7LA 1ZJ3A 1JYKA 4LW6A 3FWWA 1ZIZA 4Y6UA 2V0IA 2FYDB 1TW5A 3PNNA 4KXOA 4HO9A 1ZI5A 5CMFX 1H7HA 1KWSA 2ZU9A 4JISA 2ICXA 3V0MA 4J18A 1H5TB 3NGWA 1R7UA 4B2WA 1G1LA 1H4DA 4HO0A 5CMJA 2ZU7A 4ARWA 2AE7A 1H5SD 5I1FA 2XWMA 3GUEA 4GBPA 5JQQA 2PX7A 3F1CA 3ZGFA 2D0JA 3V0OA 4HCQA 1LZJA 2RIYA 2Y7AA 5CMIA 5IDTA 5CMGX 2OI5A 2FYCB 1OMZA 2RJ9A 1V84A 1GWWA 1G23A 1H3MA 4Y9XA 4MNDA 4Y62A 1G97A 2YQSA 3DUVA 3OH3A 1ZI4A 2APCA 2JCOA 1H5SB 4C2SA 3HL3A 2YCMA 4IRPA 1ZI3A 4HG6A 1ZJOA 4EEAA 2JCLA 3I0EA 4FREA 4K6RA 1NHEB 1R82A 4AYLA 1O23B 1TW1A 1YP4A 4KRVA 1LZIA 4HO2A 3O3PA 1QGSA 1WT0A 3CKOA 3I0DA 3TZTA 4BMAA 4DECA 1ZHJA 3SX3A 4ASYA 2A8WA 2P6WA 1NWGB 4EVWA 5C8RA 2JCJA 3I0HA 2E8BA 1WT2A 1JYLA 3SXCA 2XWNA 4L41C 2RJ8A 4HO5A 3KIAA 2Z87A 1WSZA 1JV3A 3T7MA 5C4BA 4Y7TA 5CQNX 3ZLKA 4NANA 3R2WA 2WE9A 3JTJA 2RJ6A 1K4VA 1ON6A 4NAKA 4D11A 1ZCUA 3IOJA 4Y7GA 4JD0A 2A8UA 4CVHA 2WGZA 4M2BA 3V8YA 2V0KA 1MC3A 1FRWA 4FRHA 4B42A 3Q7UA 1G95A 3FOQA 2OEFA 2X60A 1ZJPA 3CKQA 3U2VA 5DDVA 1G93A 1NQIB 3F1YA 2VS3A 5C48A 2VSIA 2X5SA 5C36A 2UX8A 4NAIA 1ZDGA 5CQPA 5C49A 2VS4A 1VICA 3SXDA 1NMMB 2FFUA 1IINA 3CKNA 4AC3A 1V82A 2PA4A 1R7TA 3OKRA 5EJZA 4DE7A 2O1HA 2V0LA 2VFZA 4BQHA 3LW6A 4B3UA 1WT3A 4FRAA 1O7OA 3RMVA 3U2XA 1YP3A 4G3QA 1ZJ2A 5IDSA 2WVLA 1G0RA 5L6SA 4D11C 1G3LA 3N9WA 4G87A 2AH9A 4EEGA 2W0WA 2RJ0A 1VGTA 3V90A 5FTVA 1H4CA 4B4GA 1VH3A 2X5ZA 3K8EA 1EYRA 5CMHA 2VXLA 4NALA 2FYAA 1YP2A 1ZCTA 2O1GA 4MYBA 2VSHA 5EIYA 4Y7FA 4CJBA 1EZIA 5DDTA 2P72A 4KPZA 1VZUA 1S4OA 3SPTA 4EE4A 5HS2A 1XZ6A 4ASJA 1G2VA 2XMHA 1VZTA 5C3BA 2OEGA 2V0JA 5CQMX 5C1HA 4E1KA 2V0HA 4CJ8A 1INJA 4B5BA 3E25A 5L6VA 1H7QA 2I5EA 2ICYA 1LL2A 3SXEA 2RJ7A 2FY7A 1R7YA 1V83A 4CJCA 5EJ1A 3DJ4A 4UEGA 5BXCA 4M4KA 3DK5A 2YQCA 5C4DA 1QWJA 3OH4A 4KC2A 3CGXA 3PKPA 3TQDA 4FRDA 2AM5A 1FR8A 5FTSA 1R7XA 1E5KA 3CKJA 1FG5N 3T7NA 1S4NA 2Y6PA 1VZXA 1PZTA 3E26A 4XWIA 2YC3A 4EEOA 1GX4A 3U2WA 1YROB 1IIMA 2OI6A 4Y6NA 1HJLA 3OC9A 2AGDA 5J49A 1JVDA 1WVCA 5FUHA 1LZ7A 2AESA 2QH5A 1H7FA 3OGZA 4FRLA 2WVKA 4FCEA 1VM8A 4FRBA 2BO6A 5C3AA 2Y4MA 2YQHA 4KNRA 1H7TA 1R81A 2NXVA 3POLA 2BO8A 4KPXA 1HM0A 4KT7A 4KC4A 3V91A 3JUKA 1LVWA 2X65A 4FROA 3I0GA 3U0YA 2E3DA 2RJ5A 2YESA 1PZYB 3IOIA 5AJNA 5C47A 1H5RA 1FGXA 4DDZA 4YS8A 2Y4JA 4EE5A 4KQLA 1H7EA 3SX7A 3JUJA 1OMXA 4D0ZA 3K8DA 4EE3A 1HM9A 3RSBA 4G3PA 3D5NA 4EEMA 5C4FA 1G8OA 4Y7VA 1FO8A 5C4CA 1JV1A 2VD4A 4FRMA 2FFVA 1HJJA 1I52A 5FV9A 4M2AA 3I0FA 2AECA 3U2UA 4AYJA 2RJ4A 2W0VA 3I0KA 1Z90A 1GQ9A 1QG8A 4P00A 3ST8A 1FXOA 1LL0A 2YC5A 4LW3A 1FO9A 4HO8A 2D7RA 4FRQA 1NKHB 4HO4A 1ZI1A 1O7QA 3D8VA 2RITA 3SXBA 4KC1A 3Q80A 1H5TA 2GGQA 1W55A 4Y63A 3OH2A 3CKVA 2AM4A 1TVYA 2AM3A 2I5KA 1JVGA 1QGQA 2WAWA 4R7PA 3I0JA 3SX8A 4B2XA 3RMWA 2P73A 2I7BA 2QKXA 3V0LA 1ON8A 1LL3A 3BCVA 2Q4JA 1FZWA 1S4PA 1MP5A 1FR9A 1FXJA 4HO6A 5FU0A 5C1LA 2WEEA 2DPWA 1FWYA 5CQOA
chains in the Genus database with same CATH superfamily
4HOCA 4P02A 2Y4KA 1FGGA 3ZGGA 2RJ1A 4IRQA 4FQWA 3EE5A 3U2TA 1GWVA 1H5SA 1H4EA 2J0BA 1VGUA 3ZLLA 3SXAA 2XWLA 4Y64A 3OH0A 3U0XA 4FRPA 1G9RA 3PKQA 3V0QA 2PGVA 5C4EA 1ZJ0A 3BRKX 1H7GA 2FYBA 1VGWA 2CU2A 1FOAA 1W77A 3T7OA 3D98A 1ZCVA 2BO4A 2RIXA 1INIA 4B4BA 2PGYA 3I0IX 1OQMB 1VPAA 3IOHA 5C38A 2OI7A 2Y4LA 3SX5A 2ZU8A 1ZDFA 3I0CA 1SS9A 4B4MA 3OH1A 3R3IA 1VGZA 2VXMA 5C1GA 2RIZA 1GX0A 1GQCA 4AAWA 3V0NA 1R80A 3V0PA 2D7IA 1HM8A 1XHBA 1H5SC 1W57A 4ZDQA 2QGIA 5AJOA 2MZBA 1R7VA 5FU8A 4D0TA 4M28A 2XMEA 3I0LA 3OAMA 2BO7A 5CQLX 1WT1A 4ECMA 4HO3A 1H5RB 2O1FA 5IFYA 1MP3A 1VH1A 2WVMA 2GGOA 5FYEA 3CU0A 4G3SA 3ZF8A 3SXGA 3Q4SA 3QVBA 3USQA 1ZJ1A 2YQJA 3V8ZA 3USRA 5C3DA 1O0RA 1TZFA 2JCKA 1LZ0A 4Y7UA 4FCUA 2Z86A 4KNXA 5AJPA 1MP4A 1GA8A 1ZCYA 4D48A 2VS5A 1NF5B 1HV9A 1H7LA 1ZJ3A 1JYKA 4LW6A 3FWWA 1ZIZA 4Y6UA 2V0IA 2FYDB 1TW5A 3PNNA 4KXOA 4HO9A 1ZI5A 5CMFX 1H7HA 1KWSA 2ZU9A 4JISA 2ICXA 3V0MA 4J18A 1H5TB 3NGWA 1R7UA 4B2WA 1G1LA 1H4DA 4HO0A 5CMJA 2ZU7A 4ARWA 2AE7A 1H5SD 5I1FA 2XWMA 3GUEA 4GBPA 5JQQA 2PX7A 3F1CA 3ZGFA 2D0JA 3V0OA 4HCQA 1LZJA 2RIYA 2Y7AA 5CMIA 5IDTA 5CMGX 2OI5A 2FYCB 1OMZA 2RJ9A 1V84A 1GWWA 1G23A 1H3MA 4Y9XA 4MNDA 4Y62A 1G97A 2YQSA 3DUVA 3OH3A 1ZI4A 2APCA 4FIXA 2JCOA 1H5SB 4C2SA 3HL3A 2YCMA 4IRPA 1ZI3A 4HG6A 1ZJOA 4EEAA 2JCLA 3I0EA 4FREA 4K6RA 1NHEB 1R82A 5D91A 4AYLA 1O23B 1TW1A 1YP4A 4KRVA 1LZIA 4HO2A 3O3PA 1QGSA 1WT0A 3CKOA 3I0DA 3TZTA 4BMAA 4DECA 1ZHJA 3SX3A 4ASYA 2A8WA 2P6WA 1NWGB 4EVWA 5C8RA 2JCJA 3I0HA 2E8BA 1WT2A 1JYLA 3SXCA 2XWNA 4L41C 2RJ8A 4HO5A 3KIAA 2Z87A 1WSZA 1JV3A 2J0AA 3T7MA 5C4BA 4Y7TA 5CQNX 3ZLKA 4NANA 3R2WA 2WE9A 3JTJA 2RJ6A 1K4VA 1ON6A 4NAKA 4D11A 1ZCUA 3IOJA 4Y7GA 4JD0A 2A8UA 4CVHA 2WGZA 4M2BA 3V8YA 2V0KA 1MC3A 1FRWA 4FRHA 4B42A 3Q7UA 1G95A 3FOQA 2OEFA 2X60A 1ZJPA 3CKQA 3U2VA 5DDVA 1G93A 1NQIB 3F1YA 2VS3A 5C48A 2VSIA 2X5SA 5C36A 2UX8A 4NAIA 1ZDGA 5CQPA 5C49A 2VS4A 1VICA 3SXDA 1NMMB 2FFUA 1IINA 3CKNA 4AC3A 1V82A 2PA4A 1R7TA 3OKRA 5EJZA 4DE7A 2O1HA 2V0LA 2VFZA 4BQHA 3LW6A 4B3UA 1WT3A 4FRAA 1O7OA 3RMVA 3U2XA 1YP3A 4G3QA 1ZJ2A 5IDSA 2WVLA 1G0RA 5L6SA 4FIYA 4D11C 1G3LA 3N9WA 4G87A 2AH9A 4EEGA 2W0WA 2RJ0A 1VGTA 3V90A 5FTVA 1H4CA 4B4GA 1VH3A 2X5ZA 3K8EA 1EYRA 5CMHA 4MIXA 2VXLA 4NALA 2FYAA 1YP2A 1ZCTA 2O1GA 4MYBA 2VSHA 5EIYA 4Y7FA 4CJBA 1EZIA 5DDTA 2P72A 4KPZA 1VZUA 1S4OA 3SPTA 4EE4A 5HS2A 1XZ6A 4ASJA 1G2VA 2XMHA 1VZTA 5C3BA 2OEGA 2V0JA 5CQMX 5C1HA 4E1KA 2V0HA 4CJ8A 1INJA 4B5BA 3E25A 4O6NA 1H7QA 2I5EA 2ICYA 5L6VA 1LL2A 3SXEA 2RJ7A 2FY7A 1R7YA 1V83A 4CJCA 5EJ1A 3DJ4A 4UEGA 5BXCA 4M4KA 3DK5A 2YQCA 5C4DA 1QWJA 3OH4A 4KC2A 3CGXA 3PKPA 3TQDA 4FRDA 2AM5A 1FR8A 5FTSA 2VK9A 1R7XA 1E5KA 3CKJA 1FG5N 3T7NA 1S4NA 2Y6PA 1VZXA 1PZTA 3E26A 4XWIA 2YC3A 4EEOA 1GX4A 3U2WA 1YROB 1IIMA 2OI6A 4Y6NA 1HJLA 3OC9A 2AGDA 5J49A 1JVDA 1WVCA 5FUHA 1LZ7A 2AESA 2QH5A 1H7FA 3OGZA 4FRLA 2WVKA 4FCEA 1VM8A 4FRBA 2BO6A 5C3AA 2Y4MA 2YQHA 4KNRA 1H7TA 1R81A 2NXVA 3POLA 2BO8A 4KPXA 1HM0A 4KT7A 4KC4A 3V91A 3JUKA 1LVWA 2X65A 4FROA 3I0GA 3U0YA 2E3DA 2RJ5A 2YESA 1PZYB 3IOIA 5AJNA 5C47A 1H5RA 1FGXA 4DDZA 4YS8A 2Y4JA 4EE5A 4KQLA 1H7EA 3SX7A 3JUJA 1OMXA 4Q7CA 4D0ZA 3K8DA 4EE3A 1HM9A 4O6MA 3RSBA 4G3PA 3D5NA 4EEMA 5C4FA 1G8OA 4Y7VA 1FO8A 5C4CA 1JV1A 2VD4A 4FRMA 2FFVA 1HJJA 1I52A 5FV9A 4M2AA 3I0FA 2AECA 3U2UA 4AYJA 2RJ4A 2W0VA 3I0KA 1Z90A 1GQ9A 1QG8A 4P00A 3ST8A 1FXOA 1LL0A 2YC5A 4LW3A 1FO9A 4HO8A 5D92A 2D7RA 4FRQA 1NKHB 4HO4A 1ZI1A 1O7QA 3D8VA 2RITA 3SXBA 4KC1A 3Q80A 1H5TA 2GGQA 1W55A 4Y63A 3OH2A 3CKVA 2AM4A 1TVYA 2AM3A 2I5KA 1JVGA 1QGQA 2WAWA 4R7PA 3I0JA 3SX8A 4B2XA 3RMWA 2P73A 2I7BA 2QKXA 3V0LA 1ON8A 1LL3A 3BCVA 2Q4JA 1FZWA 1S4PA 1MP5A 2C0NA 1FR9A 1FXJA 4HO6A 5FU0A 5C1LA 2WEEA 2DPWA 1FWYA 5CQOA
chains in the Genus database with same CATH topology
4HOCA 4P02A 2Y4KA 1FGGA 3ZGGA 2RJ1A 4IRQA 4FQWA 3EE5A 3U2TA 1GWVA 1H5SA 1H4EA 2J0BA 1VGUA 3ZLLA 3SXAA 2XWLA 4Y64A 3OH0A 3U0XA 4FRPA 1G9RA 3PKQA 3V0QA 2PGVA 5C4EA 1ZJ0A 3BRKX 1H7GA 2FYBA 1VGWA 2CU2A 1FOAA 1W77A 3T7OA 3D98A 1ZCVA 2BO4A 2RIXA 1INIA 4B4BA 2PGYA 3I0IX 1OQMB 1VPAA 3IOHA 5C38A 2OI7A 2Y4LA 3SX5A 2ZU8A 1ZDFA 3I0CA 1SS9A 4B4MA 3OH1A 3R3IA 1VGZA 2VXMA 5C1GA 2RIZA 1GX0A 1GQCA 4AAWA 3V0NA 1R80A 3V0PA 2D7IA 1HM8A 1XHBA 1H5SC 1W57A 4ZDQA 2QGIA 5AJOA 2MZBA 1R7VA 5FU8A 4D0TA 4M28A 2XMEA 3I0LA 3OAMA 2BO7A 5CQLX 1WT1A 4ECMA 4HO3A 1H5RB 2O1FA 5IFYA 1MP3A 1VH1A 2WVMA 2GGOA 5FYEA 3CU0A 4G3SA 3ZF8A 3SXGA 3Q4SA 3QVBA 3USQA 1ZJ1A 2YQJA 3V8ZA 3USRA 5C3DA 1O0RA 1TZFA 2JCKA 1LZ0A 4Y7UA 4FCUA 2Z86A 4KNXA 5AJPA 1MP4A 1GA8A 1ZCYA 4D48A 2VS5A 1NF5B 1HV9A 1H7LA 1ZJ3A 1JYKA 4LW6A 3FWWA 1ZIZA 4Y6UA 2V0IA 2FYDB 1TW5A 3PNNA 4KXOA 4HO9A 1ZI5A 5CMFX 1H7HA 1KWSA 2ZU9A 4JISA 2ICXA 3V0MA 4J18A 1H5TB 3NGWA 1R7UA 4B2WA 1G1LA 1H4DA 4HO0A 5CMJA 2ZU7A 4ARWA 2AE7A 1H5SD 5I1FA 2XWMA 3GUEA 4GBPA 5JQQA 2PX7A 3F1CA 3ZGFA 2D0JA 3V0OA 4HCQA 1LZJA 2RIYA 2Y7AA 5CMIA 5IDTA 5CMGX 2OI5A 2FYCB 1OMZA 2RJ9A 1V84A 1GWWA 1G23A 1H3MA 4Y9XA 4MNDA 4Y62A 1G97A 2YQSA 3DUVA 3OH3A 1ZI4A 2APCA 4FIXA 2JCOA 1H5SB 4C2SA 3HL3A 2YCMA 4IRPA 1ZI3A 4HG6A 1ZJOA 4EEAA 2JCLA 3I0EA 4FREA 4K6RA 1NHEB 1R82A 5D91A 4AYLA 1O23B 1TW1A 1YP4A 4KRVA 1LZIA 4HO2A 3O3PA 1QGSA 1WT0A 3CKOA 3I0DA 3TZTA 4BMAA 4DECA 1ZHJA 3SX3A 4ASYA 2A8WA 2P6WA 1NWGB 4EVWA 5C8RA 2JCJA 3I0HA 2E8BA 1WT2A 1JYLA 3SXCA 2XWNA 4L41C 2RJ8A 4HO5A 3KIAA 2Z87A 1WSZA 1JV3A 2J0AA 3T7MA 5C4BA 4Y7TA 5CQNX 3ZLKA 4NANA 3R2WA 2WE9A 3JTJA 2RJ6A 1K4VA 1ON6A 4NAKA 4D11A 1ZCUA 3IOJA 4Y7GA 4JD0A 2A8UA 4CVHA 2WGZA 4M2BA 3V8YA 2V0KA 1MC3A 1FRWA 4FRHA 4B42A 3Q7UA 1G95A 3FOQA 2OEFA 2X60A 1ZJPA 3CKQA 3U2VA 5DDVA 1G93A 1NQIB 3F1YA 2VS3A 5C48A 2VSIA 2X5SA 5C36A 2UX8A 4NAIA 1ZDGA 5CQPA 5C49A 2VS4A 1VICA 3SXDA 1NMMB 2FFUA 1IINA 3CKNA 4AC3A 1V82A 2PA4A 1R7TA 3OKRA 5EJZA 4DE7A 2O1HA 2V0LA 2VFZA 4BQHA 3LW6A 4B3UA 1WT3A 4FRAA 1O7OA 3RMVA 3U2XA 1YP3A 4G3QA 1ZJ2A 5IDSA 2WVLA 1G0RA 5L6SA 4FIYA 4D11C 1G3LA 3N9WA 4G87A 2AH9A 4EEGA 2W0WA 2RJ0A 1VGTA 3V90A 5FTVA 1H4CA 4B4GA 1VH3A 2X5ZA 3K8EA 1EYRA 5CMHA 4MIXA 2VXLA 4NALA 2FYAA 1YP2A 1ZCTA 2O1GA 4MYBA 2VSHA 5EIYA 4Y7FA 4CJBA 1EZIA 5DDTA 2P72A 4KPZA 1VZUA 1S4OA 3SPTA 4EE4A 5HS2A 1XZ6A 4ASJA 1G2VA 2XMHA 1VZTA 5C3BA 2OEGA 2V0JA 5CQMX 5C1HA 4E1KA 2V0HA 4CJ8A 1INJA 4B5BA 3E25A 4O6NA 1H7QA 2I5EA 2ICYA 5L6VA 1LL2A 3SXEA 2RJ7A 2FY7A 1R7YA 1V83A 4CJCA 5EJ1A 3DJ4A 4UEGA 5BXCA 4M4KA 3DK5A 2YQCA 5C4DA 1QWJA 3OH4A 4KC2A 3CGXA 3PKPA 3TQDA 4FRDA 2AM5A 1FR8A 5FTSA 2VK9A 1R7XA 1E5KA 3CKJA 1FG5N 3T7NA 1S4NA 2Y6PA 1VZXA 1PZTA 3E26A 4XWIA 2YC3A 4EEOA 1GX4A 3U2WA 1YROB 1IIMA 2OI6A 4Y6NA 1HJLA 3OC9A 2AGDA 5J49A 1JVDA 1WVCA 5FUHA 1LZ7A 2AESA 2QH5A 1H7FA 3OGZA 4FRLA 2WVKA 4FCEA 1VM8A 4FRBA 2BO6A 5C3AA 2Y4MA 2YQHA 4KNRA 1H7TA 1R81A 2NXVA 3POLA 2BO8A 4KPXA 1HM0A 4KT7A 4KC4A 3V91A 3JUKA 1LVWA 2X65A 4FROA 3I0GA 3U0YA 2E3DA 2RJ5A 2YESA 1PZYB 3IOIA 5AJNA 5C47A 1H5RA 1FGXA 4DDZA 4YS8A 2Y4JA 4EE5A 4KQLA 1H7EA 3SX7A 3JUJA 1OMXA 4Q7CA 4D0ZA 3K8DA 4EE3A 1HM9A 4O6MA 3RSBA 4G3PA 3D5NA 4EEMA 5C4FA 1G8OA 4Y7VA 1FO8A 5C4CA 1JV1A 2VD4A 4FRMA 2FFVA 1HJJA 1I52A 5FV9A 4M2AA 3I0FA 2AECA 3U2UA 4AYJA 2RJ4A 2W0VA 3I0KA 1Z90A 1GQ9A 1QG8A 4P00A 3ST8A 1FXOA 1LL0A 2YC5A 4LW3A 1FO9A 4HO8A 5D92A 2D7RA 4FRQA 1NKHB 4HO4A 1ZI1A 1O7QA 3D8VA 2RITA 3SXBA 4KC1A 3Q80A 1H5TA 2GGQA 1W55A 4Y63A 3OH2A 3CKVA 2AM4A 1TVYA 2AM3A 2I5KA 1JVGA 1QGQA 2WAWA 4R7PA 3I0JA 3SX8A 4B2XA 3RMWA 2P73A 2I7BA 2QKXA 3V0LA 1ON8A 1LL3A 3BCVA 2Q4JA 1FZWA 1S4PA 1MP5A 2C0NA 1FR9A 1FXJA 4HO6A 5FU0A 5C1LA 2WEEA 2DPWA 1FWYA 5CQOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HOC A;  4P02 A;  2Y4K A;  1FGG A;  3ZGG A;  2RJ1 A;  4IRQ A;  4FQW A;  3EE5 A;  3U2T A;  1GWV A;  1H5S A;  1H4E A;  1VGU A;  3ZLL A;  3SXA A;  2XWL A;  4Y64 A;  3OH0 A;  3U0X A;  4FRP A;  1G9R A;  3PKQ A;  3V0Q A;  2PGV A;  5C4E A;  1ZJ0 A;  3BRK X;  1H7G A;  2FYB A;  1VGW A;  2CU2 A;  1FOA A;  1W77 A;  3T7O A;  3D98 A;  1ZCV A;  2BO4 A;  2RIX A;  1INI A;  4B4B A;  2PGY A;  3I0I X;  1OQM B;  1VPA A;  3IOH A;  5C38 A;  2OI7 A;  2Y4L A;  3SX5 A;  2ZU8 A;  1ZDF A;  3I0C A;  1SS9 A;  4B4M A;  3OH1 A;  3R3I A;  1VGZ A;  2VXM A;  5C1G A;  2RIZ A;  1GX0 A;  1GQC A;  4AAW A;  3V0N A;  1R80 A;  3V0P A;  2D7I A;  1HM8 A;  1XHB A;  1H5S C;  1W57 A;  4ZDQ A;  2QGI A;  5AJO A;  2MZB A;  1R7V A;  5FU8 A;  4D0T A;  4M28 A;  2XME A;  3I0L A;  3OAM A;  2BO7 A;  5CQL X;  1WT1 A;  4ECM A;  4HO3 A;  1H5R B;  2O1F A;  5IFY A;  1MP3 A;  1VH1 A;  2WVM A;  2GGO A;  5FYE A;  3CU0 A;  4G3S A;  3ZF8 A;  3SXG A;  3Q4S A;  3QVB A;  3USQ A;  1ZJ1 A;  2YQJ A;  3V8Z A;  3USR A;  5C3D A;  1O0R A;  1TZF A;  2JCK A;  1LZ0 A;  4Y7U A;  4FCU A;  2Z86 A;  4KNX A;  5AJP A;  1MP4 A;  1GA8 A;  1ZCY A;  4D48 A;  2VS5 A;  1NF5 B;  1HV9 A;  1H7L A;  1ZJ3 A;  1JYK A;  4LW6 A;  3FWW A;  1ZIZ A;  4Y6U A;  2V0I A;  2FYD B;  1TW5 A;  3PNN A;  4KXO A;  4HO9 A;  1ZI5 A;  5CMF X;  1H7H A;  1KWS A;  2ZU9 A;  4JIS A;  2ICX A;  3V0M A;  4J18 A;  1H5T B;  3NGW A;  1R7U A;  4B2W A;  1G1L A;  1H4D A;  4HO0 A;  5CMJ A;  2ZU7 A;  4ARW A;  2AE7 A;  1H5S D;  5I1F A;  2XWM A;  3GUE A;  4GBP A;  5JQQ A;  2PX7 A;  3F1C A;  3ZGF A;  2D0J A;  3V0O A;  4HCQ A;  1LZJ A;  2RIY A;  2Y7A A;  5CMI A;  5IDT A;  5CMG X;  2OI5 A;  2FYC B;  1OMZ A;  2RJ9 A;  1V84 A;  1GWW A;  1G23 A;  1H3M A;  4Y9X A;  4MND A;  4Y62 A;  1G97 A;  2YQS A;  3DUV A;  3OH3 A;  1ZI4 A;  2APC A;  2JCO A;  1H5S B;  4C2S A;  3HL3 A;  2YCM A;  4IRP A;  1ZI3 A;  4HG6 A;  1ZJO A;  4EEA A;  2JCL A;  3I0E A;  4FRE A;  4K6R A;  1NHE B;  1R82 A;  4AYL A;  1O23 B;  1TW1 A;  1YP4 A;  4KRV A;  1LZI A;  4HO2 A;  3O3P A;  1QGS A;  1WT0 A;  3CKO A;  3I0D A;  3TZT A;  4BMA A;  4DEC A;  1ZHJ A;  3SX3 A;  4ASY A;  2A8W A;  2P6W A;  1NWG B;  4EVW A;  5C8R A;  2JCJ A;  3I0H A;  2E8B A;  1WT2 A;  1JYL A;  3SXC A;  2XWN A;  4L41 C;  2RJ8 A;  4HO5 A;  3KIA A;  2Z87 A;  1WSZ A;  1JV3 A;  3T7M A;  5C4B A;  4Y7T A;  5CQN X;  3ZLK A;  4NAN A;  3R2W A;  2WE9 A;  3JTJ A;  2RJ6 A;  1K4V A;  1ON6 A;  4NAK A;  4D11 A;  1ZCU A;  3IOJ A;  4Y7G A;  4JD0 A;  2A8U A;  4CVH A;  2WGZ A;  4M2B A;  3V8Y A;  2V0K A;  1MC3 A;  1FRW A;  4FRH A;  4B42 A;  3Q7U A;  1G95 A;  3FOQ A;  2OEF A;  2X60 A;  1ZJP A;  3CKQ A;  3U2V A;  5DDV A;  1G93 A;  1NQI B;  3F1Y A;  2VS3 A;  5C48 A;  2VSI A;  2X5S A;  5C36 A;  2UX8 A;  4NAI A;  1ZDG A;  5CQP A;  5C49 A;  2VS4 A;  1VIC A;  3SXD A;  1NMM B;  2FFU A;  1IIN A;  3CKN A;  4AC3 A;  1V82 A;  2PA4 A;  1R7T A;  3OKR A;  5EJZ A;  4DE7 A;  2O1H A;  2V0L A;  2VFZ A;  4BQH A;  3LW6 A;  4B3U A;  1WT3 A;  4FRA A;  1O7O A;  3RMV A;  3U2X A;  1YP3 A;  4G3Q A;  1ZJ2 A;  5IDS A;  2WVL A;  1G0R A;  5L6S A;  4D11 C;  1G3L A;  3N9W A;  4G87 A;  2AH9 A;  4EEG A;  2W0W A;  2RJ0 A;  1VGT A;  3V90 A;  5FTV A;  1H4C A;  4B4G A;  1VH3 A;  2X5Z A;  3K8E A;  1EYR A;  5CMH A;  2VXL A;  4NAL A;  2FYA A;  1YP2 A;  1ZCT A;  2O1G A;  4MYB A;  2VSH A;  5EIY A;  4Y7F A;  4CJB A;  1EZI A;  5DDT A;  2P72 A;  4KPZ A;  1VZU A;  1S4O A;  3SPT A;  4EE4 A;  5HS2 A;  1XZ6 A;  4ASJ A;  1G2V A;  2XMH A;  1VZT A;  5C3B A;  2OEG A;  2V0J A;  5CQM X;  5C1H A;  4E1K A;  2V0H A;  4CJ8 A;  1INJ A;  4B5B A;  3E25 A;  5L6V A;  1H7Q A;  2I5E A;  2ICY A;  1LL2 A;  3SXE A;  2RJ7 A;  2FY7 A;  1R7Y A;  1V83 A;  4CJC A;  5EJ1 A;  3DJ4 A;  4UEG A;  5BXC A;  4M4K A;  3DK5 A;  2YQC A;  5C4D A;  1QWJ A;  3OH4 A;  4KC2 A;  3CGX A;  3PKP A;  3TQD A;  4FRD A;  2AM5 A;  1FR8 A;  5FTS A;  1R7X A;  1E5K A;  3CKJ A;  1FG5 N;  3T7N A;  1S4N A;  2Y6P A;  1VZX A;  1PZT A;  3E26 A;  4XWI A;  2YC3 A;  4EEO A;  1GX4 A;  3U2W A;  1YRO B;  1IIM A;  2OI6 A;  4Y6N A;  1HJL A;  3OC9 A;  2AGD A;  5J49 A;  1JVD A;  1WVC A;  5FUH A;  1LZ7 A;  2AES A;  2QH5 A;  1H7F A;  3OGZ A;  4FRL A;  2WVK A;  4FCE A;  1VM8 A;  4FRB A;  2BO6 A;  5C3A A;  2Y4M A;  2YQH A;  4KNR A;  1H7T A;  1R81 A;  2NXV A;  3POL A;  2BO8 A;  4KPX A;  1HM0 A;  4KT7 A;  4KC4 A;  3V91 A;  3JUK A;  1LVW A;  2X65 A;  4FRO A;  3I0G A;  3U0Y A;  2E3D A;  2RJ5 A;  2YES A;  1PZY B;  3IOI A;  5AJN A;  5C47 A;  1H5R A;  1FGX A;  4DDZ A;  4YS8 A;  2Y4J A;  4EE5 A;  4KQL A;  1H7E A;  3SX7 A;  3JUJ A;  1OMX A;  4D0Z A;  3K8D A;  4EE3 A;  1HM9 A;  3RSB A;  4G3P A;  3D5N A;  4EEM A;  5C4F A;  1G8O A;  4Y7V A;  1FO8 A;  5C4C A;  1JV1 A;  2VD4 A;  4FRM A;  2FFV A;  1HJJ A;  1I52 A;  5FV9 A;  4M2A A;  3I0F A;  2AEC A;  3U2U A;  4AYJ A;  2RJ4 A;  2W0V A;  3I0K A;  1Z90 A;  1GQ9 A;  1QG8 A;  4P00 A;  3ST8 A;  1FXO A;  1LL0 A;  2YC5 A;  4LW3 A;  1FO9 A;  4HO8 A;  2D7R A;  4FRQ A;  1NKH B;  4HO4 A;  1ZI1 A;  1O7Q A;  3D8V A;  2RIT A;  3SXB A;  4KC1 A;  3Q80 A;  1H5T A;  2GGQ A;  1W55 A;  4Y63 A;  3OH2 A;  3CKV A;  2AM4 A;  1TVY A;  2AM3 A;  2I5K A;  1JVG A;  1QGQ A;  2WAW A;  4R7P A;  3I0J A;  3SX8 A;  4B2X A;  3RMW A;  2P73 A;  2I7B A;  2QKX A;  3V0L A;  1ON8 A;  1LL3 A;  3BCV A;  2Q4J A;  1FZW A;  1S4P A;  1MP5 A;  1FR9 A;  1FXJ A;  4HO6 A;  5FU0 A;  5C1L A;  2WEE A;  2DPW A;  1FWY A;  5CQO A; 
#chains in the Genus database with same CATH topology
 4HOC A;  4P02 A;  2Y4K A;  1FGG A;  3ZGG A;  2RJ1 A;  4IRQ A;  4FQW A;  3EE5 A;  3U2T A;  1GWV A;  1H5S A;  1H4E A;  2J0B A;  1VGU A;  3ZLL A;  3SXA A;  2XWL A;  4Y64 A;  3OH0 A;  3U0X A;  4FRP A;  1G9R A;  3PKQ A;  3V0Q A;  2PGV A;  5C4E A;  1ZJ0 A;  3BRK X;  1H7G A;  2FYB A;  1VGW A;  2CU2 A;  1FOA A;  1W77 A;  3T7O A;  3D98 A;  1ZCV A;  2BO4 A;  2RIX A;  1INI A;  4B4B A;  2PGY A;  3I0I X;  1OQM B;  1VPA A;  3IOH A;  5C38 A;  2OI7 A;  2Y4L A;  3SX5 A;  2ZU8 A;  1ZDF A;  3I0C A;  1SS9 A;  4B4M A;  3OH1 A;  3R3I A;  1VGZ A;  2VXM A;  5C1G A;  2RIZ A;  1GX0 A;  1GQC A;  4AAW A;  3V0N A;  1R80 A;  3V0P A;  2D7I A;  1HM8 A;  1XHB A;  1H5S C;  1W57 A;  4ZDQ A;  2QGI A;  5AJO A;  2MZB A;  1R7V A;  5FU8 A;  4D0T A;  4M28 A;  2XME A;  3I0L A;  3OAM A;  2BO7 A;  5CQL X;  1WT1 A;  4ECM A;  4HO3 A;  1H5R B;  2O1F A;  5IFY A;  1MP3 A;  1VH1 A;  2WVM A;  2GGO A;  5FYE A;  3CU0 A;  4G3S A;  3ZF8 A;  3SXG A;  3Q4S A;  3QVB A;  3USQ A;  1ZJ1 A;  2YQJ A;  3V8Z A;  3USR A;  5C3D A;  1O0R A;  1TZF A;  2JCK A;  1LZ0 A;  4Y7U A;  4FCU A;  2Z86 A;  4KNX A;  5AJP A;  1MP4 A;  1GA8 A;  1ZCY A;  4D48 A;  2VS5 A;  1NF5 B;  1HV9 A;  1H7L A;  1ZJ3 A;  1JYK A;  4LW6 A;  3FWW A;  1ZIZ A;  4Y6U A;  2V0I A;  2FYD B;  1TW5 A;  3PNN A;  4KXO A;  4HO9 A;  1ZI5 A;  5CMF X;  1H7H A;  1KWS A;  2ZU9 A;  4JIS A;  2ICX A;  3V0M A;  4J18 A;  1H5T B;  3NGW A;  1R7U A;  4B2W A;  1G1L A;  1H4D A;  4HO0 A;  5CMJ A;  2ZU7 A;  4ARW A;  2AE7 A;  1H5S D;  5I1F A;  2XWM A;  3GUE A;  4GBP A;  5JQQ A;  2PX7 A;  3F1C A;  3ZGF A;  2D0J A;  3V0O A;  4HCQ A;  1LZJ A;  2RIY A;  2Y7A A;  5CMI A;  5IDT A;  5CMG X;  2OI5 A;  2FYC B;  1OMZ A;  2RJ9 A;  1V84 A;  1GWW A;  1G23 A;  1H3M A;  4Y9X A;  4MND A;  4Y62 A;  1G97 A;  2YQS A;  3DUV A;  3OH3 A;  1ZI4 A;  2APC A;  4FIX A;  2JCO A;  1H5S B;  4C2S A;  3HL3 A;  2YCM A;  4IRP A;  1ZI3 A;  4HG6 A;  1ZJO A;  4EEA A;  2JCL A;  3I0E A;  4FRE A;  4K6R A;  1NHE B;  1R82 A;  5D91 A;  4AYL A;  1O23 B;  1TW1 A;  1YP4 A;  4KRV A;  1LZI A;  4HO2 A;  3O3P A;  1QGS A;  1WT0 A;  3CKO A;  3I0D A;  3TZT A;  4BMA A;  4DEC A;  1ZHJ A;  3SX3 A;  4ASY A;  2A8W A;  2P6W A;  1NWG B;  4EVW A;  5C8R A;  2JCJ A;  3I0H A;  2E8B A;  1WT2 A;  1JYL A;  3SXC A;  2XWN A;  4L41 C;  2RJ8 A;  4HO5 A;  3KIA A;  2Z87 A;  1WSZ A;  1JV3 A;  2J0A A;  3T7M A;  5C4B A;  4Y7T A;  5CQN X;  3ZLK A;  4NAN A;  3R2W A;  2WE9 A;  3JTJ A;  2RJ6 A;  1K4V A;  1ON6 A;  4NAK A;  4D11 A;  1ZCU A;  3IOJ A;  4Y7G A;  4JD0 A;  2A8U A;  4CVH A;  2WGZ A;  4M2B A;  3V8Y A;  2V0K A;  1MC3 A;  1FRW A;  4FRH A;  4B42 A;  3Q7U A;  1G95 A;  3FOQ A;  2OEF A;  2X60 A;  1ZJP A;  3CKQ A;  3U2V A;  5DDV A;  1G93 A;  1NQI B;  3F1Y A;  2VS3 A;  5C48 A;  2VSI A;  2X5S A;  5C36 A;  2UX8 A;  4NAI A;  1ZDG A;  5CQP A;  5C49 A;  2VS4 A;  1VIC A;  3SXD A;  1NMM B;  2FFU A;  1IIN A;  3CKN A;  4AC3 A;  1V82 A;  2PA4 A;  1R7T A;  3OKR A;  5EJZ A;  4DE7 A;  2O1H A;  2V0L A;  2VFZ A;  4BQH A;  3LW6 A;  4B3U A;  1WT3 A;  4FRA A;  1O7O A;  3RMV A;  3U2X A;  1YP3 A;  4G3Q A;  1ZJ2 A;  5IDS A;  2WVL A;  1G0R A;  5L6S A;  4FIY A;  4D11 C;  1G3L A;  3N9W A;  4G87 A;  2AH9 A;  4EEG A;  2W0W A;  2RJ0 A;  1VGT A;  3V90 A;  5FTV A;  1H4C A;  4B4G A;  1VH3 A;  2X5Z A;  3K8E A;  1EYR A;  5CMH A;  4MIX A;  2VXL A;  4NAL A;  2FYA A;  1YP2 A;  1ZCT A;  2O1G A;  4MYB A;  2VSH A;  5EIY A;  4Y7F A;  4CJB A;  1EZI A;  5DDT A;  2P72 A;  4KPZ A;  1VZU A;  1S4O A;  3SPT A;  4EE4 A;  5HS2 A;  1XZ6 A;  4ASJ A;  1G2V A;  2XMH A;  1VZT A;  5C3B A;  2OEG A;  2V0J A;  5CQM X;  5C1H A;  4E1K A;  2V0H A;  4CJ8 A;  1INJ A;  4B5B A;  3E25 A;  4O6N A;  1H7Q A;  2I5E A;  2ICY A;  5L6V A;  1LL2 A;  3SXE A;  2RJ7 A;  2FY7 A;  1R7Y A;  1V83 A;  4CJC A;  5EJ1 A;  3DJ4 A;  4UEG A;  5BXC A;  4M4K A;  3DK5 A;  2YQC A;  5C4D A;  1QWJ A;  3OH4 A;  4KC2 A;  3CGX A;  3PKP A;  3TQD A;  4FRD A;  2AM5 A;  1FR8 A;  5FTS A;  2VK9 A;  1R7X A;  1E5K A;  3CKJ A;  1FG5 N;  3T7N A;  1S4N A;  2Y6P A;  1VZX A;  1PZT A;  3E26 A;  4XWI A;  2YC3 A;  4EEO A;  1GX4 A;  3U2W A;  1YRO B;  1IIM A;  2OI6 A;  4Y6N A;  1HJL A;  3OC9 A;  2AGD A;  5J49 A;  1JVD A;  1WVC A;  5FUH A;  1LZ7 A;  2AES A;  2QH5 A;  1H7F A;  3OGZ A;  4FRL A;  2WVK A;  4FCE A;  1VM8 A;  4FRB A;  2BO6 A;  5C3A A;  2Y4M A;  2YQH A;  4KNR A;  1H7T A;  1R81 A;  2NXV A;  3POL A;  2BO8 A;  4KPX A;  1HM0 A;  4KT7 A;  4KC4 A;  3V91 A;  3JUK A;  1LVW A;  2X65 A;  4FRO A;  3I0G A;  3U0Y A;  2E3D A;  2RJ5 A;  2YES A;  1PZY B;  3IOI A;  5AJN A;  5C47 A;  1H5R A;  1FGX A;  4DDZ A;  4YS8 A;  2Y4J A;  4EE5 A;  4KQL A;  1H7E A;  3SX7 A;  3JUJ A;  1OMX A;  4Q7C A;  4D0Z A;  3K8D A;  4EE3 A;  1HM9 A;  4O6M A;  3RSB A;  4G3P A;  3D5N A;  4EEM A;  5C4F A;  1G8O A;  4Y7V A;  1FO8 A;  5C4C A;  1JV1 A;  2VD4 A;  4FRM A;  2FFV A;  1HJJ A;  1I52 A;  5FV9 A;  4M2A A;  3I0F A;  2AEC A;  3U2U A;  4AYJ A;  2RJ4 A;  2W0V A;  3I0K A;  1Z90 A;  1GQ9 A;  1QG8 A;  4P00 A;  3ST8 A;  1FXO A;  1LL0 A;  2YC5 A;  4LW3 A;  1FO9 A;  4HO8 A;  5D92 A;  2D7R A;  4FRQ A;  1NKH B;  4HO4 A;  1ZI1 A;  1O7Q A;  3D8V A;  2RIT A;  3SXB A;  4KC1 A;  3Q80 A;  1H5T A;  2GGQ A;  1W55 A;  4Y63 A;  3OH2 A;  3CKV A;  2AM4 A;  1TVY A;  2AM3 A;  2I5K A;  1JVG A;  1QGQ A;  2WAW A;  4R7P A;  3I0J A;  3SX8 A;  4B2X A;  3RMW A;  2P73 A;  2I7B A;  2QKX A;  3V0L A;  1ON8 A;  1LL3 A;  3BCV A;  2Q4J A;  1FZW A;  1S4P A;  1MP5 A;  2C0N A;  1FR9 A;  1FXJ A;  4HO6 A;  5FU0 A;  5C1L A;  2WEE A;  2DPW A;  1FWY A;  5CQO A; 
#chains in the Genus database with same CATH homology
 4HOC A;  4P02 A;  2Y4K A;  1FGG A;  3ZGG A;  2RJ1 A;  4IRQ A;  4FQW A;  3EE5 A;  3U2T A;  1GWV A;  1H5S A;  1H4E A;  2J0B A;  1VGU A;  3ZLL A;  3SXA A;  2XWL A;  4Y64 A;  3OH0 A;  3U0X A;  4FRP A;  1G9R A;  3PKQ A;  3V0Q A;  2PGV A;  5C4E A;  1ZJ0 A;  3BRK X;  1H7G A;  2FYB A;  1VGW A;  2CU2 A;  1FOA A;  1W77 A;  3T7O A;  3D98 A;  1ZCV A;  2BO4 A;  2RIX A;  1INI A;  4B4B A;  2PGY A;  3I0I X;  1OQM B;  1VPA A;  3IOH A;  5C38 A;  2OI7 A;  2Y4L A;  3SX5 A;  2ZU8 A;  1ZDF A;  3I0C A;  1SS9 A;  4B4M A;  3OH1 A;  3R3I A;  1VGZ A;  2VXM A;  5C1G A;  2RIZ A;  1GX0 A;  1GQC A;  4AAW A;  3V0N A;  1R80 A;  3V0P A;  2D7I A;  1HM8 A;  1XHB A;  1H5S C;  1W57 A;  4ZDQ A;  2QGI A;  5AJO A;  2MZB A;  1R7V A;  5FU8 A;  4D0T A;  4M28 A;  2XME A;  3I0L A;  3OAM A;  2BO7 A;  5CQL X;  1WT1 A;  4ECM A;  4HO3 A;  1H5R B;  2O1F A;  5IFY A;  1MP3 A;  1VH1 A;  2WVM A;  2GGO A;  5FYE A;  3CU0 A;  4G3S A;  3ZF8 A;  3SXG A;  3Q4S A;  3QVB A;  3USQ A;  1ZJ1 A;  2YQJ A;  3V8Z A;  3USR A;  5C3D A;  1O0R A;  1TZF A;  2JCK A;  1LZ0 A;  4Y7U A;  4FCU A;  2Z86 A;  4KNX A;  5AJP A;  1MP4 A;  1GA8 A;  1ZCY A;  4D48 A;  2VS5 A;  1NF5 B;  1HV9 A;  1H7L A;  1ZJ3 A;  1JYK A;  4LW6 A;  3FWW A;  1ZIZ A;  4Y6U A;  2V0I A;  2FYD B;  1TW5 A;  3PNN A;  4KXO A;  4HO9 A;  1ZI5 A;  5CMF X;  1H7H A;  1KWS A;  2ZU9 A;  4JIS A;  2ICX A;  3V0M A;  4J18 A;  1H5T B;  3NGW A;  1R7U A;  4B2W A;  1G1L A;  1H4D A;  4HO0 A;  5CMJ A;  2ZU7 A;  4ARW A;  2AE7 A;  1H5S D;  5I1F A;  2XWM A;  3GUE A;  4GBP A;  5JQQ A;  2PX7 A;  3F1C A;  3ZGF A;  2D0J A;  3V0O A;  4HCQ A;  1LZJ A;  2RIY A;  2Y7A A;  5CMI A;  5IDT A;  5CMG X;  2OI5 A;  2FYC B;  1OMZ A;  2RJ9 A;  1V84 A;  1GWW A;  1G23 A;  1H3M A;  4Y9X A;  4MND A;  4Y62 A;  1G97 A;  2YQS A;  3DUV A;  3OH3 A;  1ZI4 A;  2APC A;  4FIX A;  2JCO A;  1H5S B;  4C2S A;  3HL3 A;  2YCM A;  4IRP A;  1ZI3 A;  4HG6 A;  1ZJO A;  4EEA A;  2JCL A;  3I0E A;  4FRE A;  4K6R A;  1NHE B;  1R82 A;  5D91 A;  4AYL A;  1O23 B;  1TW1 A;  1YP4 A;  4KRV A;  1LZI A;  4HO2 A;  3O3P A;  1QGS A;  1WT0 A;  3CKO A;  3I0D A;  3TZT A;  4BMA A;  4DEC A;  1ZHJ A;  3SX3 A;  4ASY A;  2A8W A;  2P6W A;  1NWG B;  4EVW A;  5C8R A;  2JCJ A;  3I0H A;  2E8B A;  1WT2 A;  1JYL A;  3SXC A;  2XWN A;  4L41 C;  2RJ8 A;  4HO5 A;  3KIA A;  2Z87 A;  1WSZ A;  1JV3 A;  2J0A A;  3T7M A;  5C4B A;  4Y7T A;  5CQN X;  3ZLK A;  4NAN A;  3R2W A;  2WE9 A;  3JTJ A;  2RJ6 A;  1K4V A;  1ON6 A;  4NAK A;  4D11 A;  1ZCU A;  3IOJ A;  4Y7G A;  4JD0 A;  2A8U A;  4CVH A;  2WGZ A;  4M2B A;  3V8Y A;  2V0K A;  1MC3 A;  1FRW A;  4FRH A;  4B42 A;  3Q7U A;  1G95 A;  3FOQ A;  2OEF A;  2X60 A;  1ZJP A;  3CKQ A;  3U2V A;  5DDV A;  1G93 A;  1NQI B;  3F1Y A;  2VS3 A;  5C48 A;  2VSI A;  2X5S A;  5C36 A;  2UX8 A;  4NAI A;  1ZDG A;  5CQP A;  5C49 A;  2VS4 A;  1VIC A;  3SXD A;  1NMM B;  2FFU A;  1IIN A;  3CKN A;  4AC3 A;  1V82 A;  2PA4 A;  1R7T A;  3OKR A;  5EJZ A;  4DE7 A;  2O1H A;  2V0L A;  2VFZ A;  4BQH A;  3LW6 A;  4B3U A;  1WT3 A;  4FRA A;  1O7O A;  3RMV A;  3U2X A;  1YP3 A;  4G3Q A;  1ZJ2 A;  5IDS A;  2WVL A;  1G0R A;  5L6S A;  4FIY A;  4D11 C;  1G3L A;  3N9W A;  4G87 A;  2AH9 A;  4EEG A;  2W0W A;  2RJ0 A;  1VGT A;  3V90 A;  5FTV A;  1H4C A;  4B4G A;  1VH3 A;  2X5Z A;  3K8E A;  1EYR A;  5CMH A;  4MIX A;  2VXL A;  4NAL A;  2FYA A;  1YP2 A;  1ZCT A;  2O1G A;  4MYB A;  2VSH A;  5EIY A;  4Y7F A;  4CJB A;  1EZI A;  5DDT A;  2P72 A;  4KPZ A;  1VZU A;  1S4O A;  3SPT A;  4EE4 A;  5HS2 A;  1XZ6 A;  4ASJ A;  1G2V A;  2XMH A;  1VZT A;  5C3B A;  2OEG A;  2V0J A;  5CQM X;  5C1H A;  4E1K A;  2V0H A;  4CJ8 A;  1INJ A;  4B5B A;  3E25 A;  4O6N A;  1H7Q A;  2I5E A;  2ICY A;  5L6V A;  1LL2 A;  3SXE A;  2RJ7 A;  2FY7 A;  1R7Y A;  1V83 A;  4CJC A;  5EJ1 A;  3DJ4 A;  4UEG A;  5BXC A;  4M4K A;  3DK5 A;  2YQC A;  5C4D A;  1QWJ A;  3OH4 A;  4KC2 A;  3CGX A;  3PKP A;  3TQD A;  4FRD A;  2AM5 A;  1FR8 A;  5FTS A;  2VK9 A;  1R7X A;  1E5K A;  3CKJ A;  1FG5 N;  3T7N A;  1S4N A;  2Y6P A;  1VZX A;  1PZT A;  3E26 A;  4XWI A;  2YC3 A;  4EEO A;  1GX4 A;  3U2W A;  1YRO B;  1IIM A;  2OI6 A;  4Y6N A;  1HJL A;  3OC9 A;  2AGD A;  5J49 A;  1JVD A;  1WVC A;  5FUH A;  1LZ7 A;  2AES A;  2QH5 A;  1H7F A;  3OGZ A;  4FRL A;  2WVK A;  4FCE A;  1VM8 A;  4FRB A;  2BO6 A;  5C3A A;  2Y4M A;  2YQH A;  4KNR A;  1H7T A;  1R81 A;  2NXV A;  3POL A;  2BO8 A;  4KPX A;  1HM0 A;  4KT7 A;  4KC4 A;  3V91 A;  3JUK A;  1LVW A;  2X65 A;  4FRO A;  3I0G A;  3U0Y A;  2E3D A;  2RJ5 A;  2YES A;  1PZY B;  3IOI A;  5AJN A;  5C47 A;  1H5R A;  1FGX A;  4DDZ A;  4YS8 A;  2Y4J A;  4EE5 A;  4KQL A;  1H7E A;  3SX7 A;  3JUJ A;  1OMX A;  4Q7C A;  4D0Z A;  3K8D A;  4EE3 A;  1HM9 A;  4O6M A;  3RSB A;  4G3P A;  3D5N A;  4EEM A;  5C4F A;  1G8O A;  4Y7V A;  1FO8 A;  5C4C A;  1JV1 A;  2VD4 A;  4FRM A;  2FFV A;  1HJJ A;  1I52 A;  5FV9 A;  4M2A A;  3I0F A;  2AEC A;  3U2U A;  4AYJ A;  2RJ4 A;  2W0V A;  3I0K A;  1Z90 A;  1GQ9 A;  1QG8 A;  4P00 A;  3ST8 A;  1FXO A;  1LL0 A;  2YC5 A;  4LW3 A;  1FO9 A;  4HO8 A;  5D92 A;  2D7R A;  4FRQ A;  1NKH B;  4HO4 A;  1ZI1 A;  1O7Q A;  3D8V A;  2RIT A;  3SXB A;  4KC1 A;  3Q80 A;  1H5T A;  2GGQ A;  1W55 A;  4Y63 A;  3OH2 A;  3CKV A;  2AM4 A;  1TVY A;  2AM3 A;  2I5K A;  1JVG A;  1QGQ A;  2WAW A;  4R7P A;  3I0J A;  3SX8 A;  4B2X A;  3RMW A;  2P73 A;  2I7B A;  2QKX A;  3V0L A;  1ON8 A;  1LL3 A;  3BCV A;  2Q4J A;  1FZW A;  1S4P A;  1MP5 A;  2C0N A;  1FR9 A;  1FXJ A;  4HO6 A;  5FU0 A;  5C1L A;  2WEE A;  2DPW A;  1FWY A;  5CQO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...