2JCLA

Crystal structure of alpha-1,3 galactosyltransferase (r365k) in the absence of ligands
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
277
structure length
277
Chain Sequence
b'KLKLSDWFNPFKRPEVVTMTKWKAPVVWEGTYNRAVLDNYYAKQKITVGLTVFAVGRYIEHYLEEFLTSANKHFMVGHPVIFYIMVDDVSRMPLIELGPLRSFKVFKIKPEKRWQDISMMRMKTIGEHIVAHIQHEVDFLFCMDVDQVFQDKFGVETLGESVAQLQAWWYKADPNDFTYERRKESAAYIPFGEGDFYYHAAIFGGTPTQVLNITQECFKGILKDKKNDIEAQWHDESHLNKYFLLNKPTKILSPEYCWDYHIGLPADIKLVKMSWQT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords N-ACETYLLACTOSAMINIDE ALPHA-1,3-GALACTOSYLTRANSFERASE
publication title Conformational Changes Induced by Binding Udp-2F-Galactose to Alpha-1,3 Galactosyltransferase-Implications for Catalysis.
pubmed doi rcsb
source organism Bos taurus
molecule tags Transferase
total genus 101
structure length 277
sequence length 277
chains with identical sequence B
ec nomenclature ec 2.4.1.87: N-acetyllactosaminide 3-alpha-galactosyltransferase.
pdb deposition date 2006-12-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 2jclA00
2FYCB 4KRVA 1NQIB 1LZ7A 4EEOA 1FR9A 4CJCA 3U2UA 1R82A 1V84A 3F1YA 2Y4JA 5CMJA 4YS8A 4DE7A 1JYLA 5CQPA 5CMHA 1ZJ2A 4M28A 1G23A 1G93A 1FGXA 1LZ0A 4EE4A 2AH9A 2WGZA 2V0IA 3Q80A 3ZGFA 1H5SA 3CGXA 4MYBA 3BCVA 1FZWA 4FRMA 4KPZA 2AECA 5C8RA 1W55A 2DPWA 2XWMA 3V8YA 1H5SC 3FOQA 1Z90A 2CU2A 2VXLA 5FUHA 4FQWA 4AC3A 2D0JA 3SX8A 1FXOA 2Y4KA 2ZU8A 4Y9XA 1H5SD 3CKNA 4Y7TA 1GWVA 1YROB 2RJ5A 4Y7VA 2RITA 3Q4SA 1GWWA 4B5BA 3ZGGA 3I0FA 1WT0A 3SXAA 2WEEA 3IOIA 2E8BA 2AM5A 3E26A 1H5TA 1EYRA 1FR8A 4ASJA 1FWYA 2AGDA 2YQJA 1VH3A 4HO9A 1ZDFA 1HM8A 2RJ7A 2AM3A 1JYKA 4FRAA 4FCUA 1FRWA 4FREA 3GUEA 3D8VA 5DDVA 2GGOA 3OC9A 4KT7A 3T7NA 4GBPA 3V0LA 3RMVA 4KC1A 3PKQA 2AESA 3V0NA 4D11C 4Y62A 2JCKA 1ZI4A 3OAMA 3FWWA 4NAIA 3SPTA 2OEGA 2APCA 1R80A 4K6RA 1ZIZA 3V0QA 2OEFA 4KNRA 2ICYA 3RMWA 2AE7A 5C49A 3ST8A 1H7LA 4FRPA 4D48A 3DUVA 3CKOA 1H5RB 1H5SB 1G2VA 3PNNA 1IINA 1ZCTA 4EE5A 3CKQA 2Z86A 4BQHA 1WSZA 1K4VA 1HJLA 1XZ6A 4B2XA 4D0TA 1VPAA 3T7OA 4G3QA 2OI6A 1LL2A 4J18A 3IOHA 2X5SA 3CKVA 5DDTA 2P6WA 2V0JA 4HO0A 4ASYA 2V0KA 4ARWA 1YP2A 3USRA 2VSIA 5IDTA 4R7PA 1FG5N 1R7TA 2O1FA 4CJBA 1WT2A 3K8EA 1YP3A 3CU0A 1GQCA 2BO7A 2E3DA 4Y7FA 4B4MA 5EJZA 1ZJ0A 1ZJOA 3OH1A 3OH3A 4FRQA 5FYEA 1ZJ1A 2BO8A 1H5TB 5C47A 2FYAA 1H4EA 2WVLA 3EE5A 4JISA 3U2WA 1VGUA 2PGVA 2OI5A 5C1HA 2D7RA 1VICA 4KC2A 1W57A 2Z87A 5C4EA 1NWGB 1OMXA 1G95A 2RJ8A 2XMHA 4Y6UA 3E25A 1ZCVA 1QGSA 4ZDQA 1H7EA 1H7QA 2WAWA 3LW6A 5C1LA 1JVDA 2W0VA 1O7QA 3PKPA 1ZJPA 4IRPA 2QGIA 4LW6A 1O0RA 5J49A 4B4GA 1VGZA 3D98A 2YQHA 1LL3A 2A8UA 4HO3A 1H7HA 1YP4A 2Y4LA 4FCEA 1HJJA 2JCJA 1IIMA 3JUKA 2OI7A 1R7XA 1NF5B 3KIAA 1ZI1A 1QGQA 1JV3A 2AM4A 2W0WA 4FRBA 1ZJ3A 1INJA 3JTJA 3ZF8A 4EEAA 3F1CA 3Q7UA 1R81A 1FOAA 5JQQA 3OH2A 3SXGA 3ZLLA 4M4KA 1H7FA 3K8DA 1G97A 5CQMX 1PZTA 1JV1A 2UX8A 2P72A 1NHEB 3I0KA 4NALA 2X60A 5HS2A 4EEMA 1O23B 1S4NA 5C3DA 2ICXA 5FU8A 2YC5A 1ZI5A 4FRHA 5C4DA 3T7MA 1LZIA 2RIZA 3NGWA 1H7GA 4G87A 1W77A 1TW1A 4UEGA 1ZI3A 5FU0A 4HO6A 1V83A 3N9WA 2RJ9A 3I0EA 1H4CA 2RJ4A 1VZUA 2RIXA 2RJ0A 5C36A 2YCMA 3R2WA 1MP3A 4CJ8A 3U0YA 2I7BA 1G3LA 2FYBA 1NMMB 3V0OA 1VM8A 3I0LA 1ZHJA 5CMGX 5I1FA 1ON8A 3OKRA 2XMEA 5AJPA 5FV9A 4E1KA 4B2WA 1VZXA 1MP5A 2PGYA 5AJNA 2Y4MA 3USQA 1VH1A 3CKJA 5EIYA 2RJ6A 3I0IX 2VXMA 4NAKA 3SX3A 2X65A 1PZYB 5L6SA 1LL0A 3SXEA 4D0ZA 1OQMB 3OH4A 2FFUA 2PX7A 2RIYA 4CVHA 3JUJA 5C1GA 2VSHA 4NANA 1FO8A 1ZCUA 2QH5A 3SX5A 3U0XA 2WE9A 5CQOA 2VD4A 1SS9A 2YQCA 2O1HA 2MZBA 2VS3A 4FRLA 1ZDGA 1GX4A 2D7IA 3U2XA 4DDZA 4HG6A 1S4PA 3D5NA 1FXJA 2RJ1A 4ECMA 1FO9A 1LZJA 2I5EA 1I52A 5CMFX 2I5KA 5IDSA 4LW3A 5C4BA 2WVKA 1JVGA 3V0MA 1WVCA 4Y7UA 2BO6A 4DECA 3I0DA 1LVWA 1H3MA 2QKXA 5C4FA 4FROA 1ZCYA 1E5KA 5EJ1A 1MC3A 3IOJA 1H5RA 1NKHB 3I0JA 4FRDA 2XWLA 4AYJA 1R7YA 2WVMA 4M2BA 2NXVA 3V0PA 4G3SA 1EZIA 2P73A 1GA8A 2X5ZA 1WT1A 4KPXA 2YC3A 3SX7A 3I0GA 1H4DA 2JCOA 4C2SA 5C38A 4KC4A 2ZU7A 5C48A 2YQSA 1HM0A 1HV9A 3I0HA 1O7OA 2Y6PA 4JD0A 5CMIA 5FTSA 3O3PA 1R7UA 4HO2A 3QVBA 5C3BA 3V91A 4B3UA 1HM9A 4HOCA 3HL3A 4HO8A 4IRQA 1ON6A 1QG8A 3RSBA 4AAWA 3R3IA 1KWSA 1WT3A 2VS5A 4EEGA 5BXCA 4HCQA 4B4BA 3TZTA 5CQNX 2Y7AA 2FFVA 3U2VA 3OGZA 2V0LA 4D11A 2O1GA 3V8ZA 4Y63A 1INIA 5CQLX 1G0RA 2Q4JA 4KNXA 3ZLKA 5L6VA 4MNDA 2V0HA 1OMZA 4Y64A 2YESA 4Y6NA 1GX0A 1VGWA 3SXBA 1V82A 1G9RA 1S4OA 4L41C 4AYLA 3SXDA 3DK5A 4HO5A 4B42A 4EE3A 2ZU9A 1GQ9A 1VGTA 4KQLA 2VFZA 1G8OA 5IFYA 5FTVA 1VZTA 1QWJA 4XWIA 3POLA 4Y7GA 2FY7A 4P00A 1TW5A 1G1LA 4HO4A 2VS4A 3BRKX 4G3PA 5AJOA 3U2TA 5C4CA 1MP4A 4M2AA 2FYDB 1TVYA 1TZFA 2JCLA 2BO4A 2XWNA 4BMAA 3TQDA 3SXCA 1H7TA 2GGQA 3DJ4A 3V90A 3OH0A 1XHBA 1R7VA 4P02A 4KXOA 2PA4A 4EVWA 2A8WA 1FGGA 3I0CA 5C3AA
chains in the Genus database with same CATH superfamily
2FYCB 4KRVA 1NQIB 1LZ7A 4EEOA 1FR9A 4CJCA 3U2UA 1R82A 1V84A 3F1YA 2Y4JA 5CMJA 4YS8A 4DE7A 1JYLA 5CQPA 5CMHA 1ZJ2A 4M28A 1G23A 1G93A 1FGXA 1LZ0A 4EE4A 2AH9A 2WGZA 2V0IA 3Q80A 3ZGFA 1H5SA 3CGXA 4MYBA 3BCVA 1FZWA 4FRMA 4KPZA 2AECA 5C8RA 1W55A 2DPWA 2XWMA 3V8YA 1H5SC 3FOQA 1Z90A 2CU2A 2VXLA 5FUHA 4FQWA 4AC3A 2D0JA 3SX8A 1FXOA 2Y4KA 2ZU8A 4Y9XA 1H5SD 3CKNA 4Y7TA 1GWVA 1YROB 2RJ5A 4Y7VA 2RITA 3Q4SA 1GWWA 4B5BA 3ZGGA 3I0FA 1WT0A 3SXAA 2WEEA 3IOIA 2E8BA 2AM5A 3E26A 1H5TA 1EYRA 1FR8A 4ASJA 1FWYA 2AGDA 2YQJA 1VH3A 4HO9A 1ZDFA 1HM8A 2RJ7A 2AM3A 1JYKA 4FRAA 4FCUA 1FRWA 4FREA 3GUEA 3D8VA 5DDVA 2GGOA 3OC9A 4KT7A 3T7NA 4GBPA 3V0LA 3RMVA 4KC1A 3PKQA 4O6NA 2AESA 3V0NA 4D11C 4Y62A 2JCKA 1ZI4A 3OAMA 3FWWA 4NAIA 3SPTA 2OEGA 2APCA 1R80A 4K6RA 1ZIZA 3V0QA 2OEFA 4KNRA 2ICYA 3RMWA 2AE7A 5C49A 3ST8A 1H7LA 4FRPA 4D48A 3DUVA 3CKOA 1H5RB 1H5SB 4FIXA 1G2VA 3PNNA 1IINA 1ZCTA 4EE5A 3CKQA 2Z86A 4BQHA 1WSZA 1K4VA 1HJLA 1XZ6A 4B2XA 4D0TA 1VPAA 3T7OA 4G3QA 2OI6A 1LL2A 4J18A 3IOHA 2X5SA 3CKVA 5DDTA 2P6WA 2V0JA 4HO0A 4ASYA 2V0KA 4ARWA 1YP2A 3USRA 2VSIA 5IDTA 4R7PA 1FG5N 1R7TA 2O1FA 4CJBA 1WT2A 3K8EA 1YP3A 3CU0A 1GQCA 2BO7A 2E3DA 4Y7FA 4B4MA 5EJZA 1ZJ0A 1ZJOA 3OH1A 3OH3A 4FRQA 5FYEA 1ZJ1A 2BO8A 1H5TB 5C47A 2FYAA 1H4EA 2WVLA 3EE5A 4JISA 3U2WA 1VGUA 2PGVA 2OI5A 5C1HA 2D7RA 1VICA 4KC2A 1W57A 2Z87A 5C4EA 1NWGB 1OMXA 1G95A 2RJ8A 2XMHA 4Y6UA 3E25A 1ZCVA 1QGSA 4ZDQA 1H7EA 1H7QA 2WAWA 3LW6A 5C1LA 1JVDA 2W0VA 1O7QA 3PKPA 1ZJPA 4IRPA 2QGIA 4LW6A 1O0RA 5J49A 4B4GA 1VGZA 3D98A 2YQHA 1LL3A 2A8UA 4HO3A 1H7HA 5D92A 1YP4A 2Y4LA 4FCEA 1HJJA 2JCJA 1IIMA 3JUKA 2OI7A 1R7XA 1NF5B 3KIAA 1ZI1A 1QGQA 1JV3A 2AM4A 2W0WA 4FRBA 4O6MA 1ZJ3A 1INJA 3JTJA 3ZF8A 4EEAA 3F1CA 3Q7UA 1R81A 1FOAA 5JQQA 3OH2A 3SXGA 3ZLLA 4M4KA 1H7FA 3K8DA 1G97A 5CQMX 1PZTA 1JV1A 2UX8A 2P72A 1NHEB 3I0KA 4NALA 2X60A 5HS2A 4EEMA 1O23B 1S4NA 5D91A 5C3DA 2ICXA 5FU8A 2YC5A 1ZI5A 4FRHA 5C4DA 3T7MA 1LZIA 2RIZA 3NGWA 1H7GA 2C0NA 4G87A 1W77A 1TW1A 4UEGA 1ZI3A 5FU0A 4HO6A 1V83A 3N9WA 2RJ9A 3I0EA 1H4CA 2RJ4A 1VZUA 2RIXA 2RJ0A 5C36A 2YCMA 3R2WA 1MP3A 4CJ8A 3U0YA 2I7BA 1G3LA 2FYBA 1NMMB 2J0AA 3V0OA 1VM8A 3I0LA 1ZHJA 5CMGX 5I1FA 1ON8A 3OKRA 2VK9A 2XMEA 5AJPA 5FV9A 4E1KA 4B2WA 1VZXA 1MP5A 2PGYA 5AJNA 2Y4MA 3USQA 1VH1A 3CKJA 5EIYA 2RJ6A 3I0IX 2VXMA 4NAKA 3SX3A 2X65A 1PZYB 5L6SA 1LL0A 3SXEA 4D0ZA 1OQMB 3OH4A 2FFUA 2PX7A 2RIYA 4CVHA 3JUJA 5C1GA 2VSHA 4NANA 1FO8A 1ZCUA 4FIYA 2QH5A 3SX5A 3U0XA 2WE9A 5CQOA 2VD4A 1SS9A 2YQCA 2O1HA 2MZBA 4MIXA 2VS3A 4FRLA 1ZDGA 1GX4A 2D7IA 3U2XA 4DDZA 4HG6A 1S4PA 3D5NA 1FXJA 2RJ1A 4ECMA 1FO9A 1LZJA 2I5EA 1I52A 5CMFX 2I5KA 5IDSA 4LW3A 5C4BA 2WVKA 1JVGA 3V0MA 1WVCA 4Y7UA 2BO6A 4DECA 3I0DA 1LVWA 1H3MA 2QKXA 5C4FA 4FROA 1ZCYA 1E5KA 5EJ1A 1MC3A 3IOJA 1H5RA 1NKHB 3I0JA 4FRDA 2XWLA 4AYJA 1R7YA 2WVMA 4M2BA 2NXVA 3V0PA 4G3SA 1EZIA 2P73A 1GA8A 2X5ZA 1WT1A 4KPXA 2YC3A 3SX7A 3I0GA 1H4DA 2JCOA 4C2SA 2J0BA 5C38A 4KC4A 2ZU7A 5C48A 2YQSA 1HM0A 1HV9A 3I0HA 1O7OA 2Y6PA 4JD0A 5CMIA 5FTSA 3O3PA 1R7UA 4HO2A 3QVBA 5C3BA 3V91A 4B3UA 1HM9A 4HOCA 3HL3A 4HO8A 4IRQA 1ON6A 1QG8A 3RSBA 4AAWA 3R3IA 1KWSA 1WT3A 2VS5A 4EEGA 5BXCA 4HCQA 4B4BA 3TZTA 5CQNX 2Y7AA 2FFVA 3U2VA 3OGZA 2V0LA 4D11A 2O1GA 3V8ZA 4Y63A 1INIA 5CQLX 1G0RA 2Q4JA 4KNXA 3ZLKA 5L6VA 4MNDA 2V0HA 1OMZA 4Y64A 2YESA 4Y6NA 1GX0A 1VGWA 3SXBA 1V82A 1G9RA 1S4OA 4L41C 4AYLA 3SXDA 3DK5A 4HO5A 4B42A 4EE3A 2ZU9A 1GQ9A 1VGTA 4KQLA 2VFZA 1G8OA 5IFYA 5FTVA 1VZTA 1QWJA 4XWIA 3POLA 4Y7GA 2FY7A 4P00A 1TW5A 1G1LA 4HO4A 2VS4A 3BRKX 4G3PA 5AJOA 3U2TA 5C4CA 1MP4A 4M2AA 2FYDB 1TVYA 1TZFA 2JCLA 2BO4A 2XWNA 4BMAA 3TQDA 3SXCA 1H7TA 2GGQA 3DJ4A 3V90A 3OH0A 1XHBA 1R7VA 4P02A 4Q7CA 4KXOA 2PA4A 4EVWA 2A8WA 1FGGA 3I0CA 5C3AA
chains in the Genus database with same CATH topology
2FYCB 4KRVA 1NQIB 1LZ7A 4EEOA 1FR9A 4CJCA 3U2UA 1R82A 1V84A 3F1YA 2Y4JA 5CMJA 4YS8A 4DE7A 1JYLA 5CQPA 5CMHA 1ZJ2A 4M28A 1G23A 1G93A 1FGXA 1LZ0A 4EE4A 2AH9A 2WGZA 2V0IA 3Q80A 3ZGFA 1H5SA 3CGXA 4MYBA 3BCVA 1FZWA 4FRMA 4KPZA 2AECA 5C8RA 1W55A 2DPWA 2XWMA 3V8YA 1H5SC 3FOQA 1Z90A 2CU2A 2VXLA 5FUHA 4FQWA 4AC3A 2D0JA 3SX8A 1FXOA 2Y4KA 2ZU8A 4Y9XA 1H5SD 3CKNA 4Y7TA 1GWVA 1YROB 2RJ5A 4Y7VA 2RITA 3Q4SA 1GWWA 4B5BA 3ZGGA 3I0FA 1WT0A 3SXAA 2WEEA 3IOIA 2E8BA 2AM5A 3E26A 1H5TA 1EYRA 1FR8A 4ASJA 1FWYA 2AGDA 2YQJA 1VH3A 4HO9A 1ZDFA 1HM8A 2RJ7A 2AM3A 1JYKA 4FRAA 4FCUA 1FRWA 4FREA 3GUEA 3D8VA 5DDVA 2GGOA 3OC9A 4KT7A 3T7NA 4GBPA 3V0LA 3RMVA 4KC1A 3PKQA 4O6NA 2AESA 3V0NA 4D11C 4Y62A 2JCKA 1ZI4A 3OAMA 3FWWA 4NAIA 3SPTA 2OEGA 2APCA 1R80A 4K6RA 1ZIZA 3V0QA 2OEFA 4KNRA 2ICYA 3RMWA 2AE7A 5C49A 3ST8A 1H7LA 4FRPA 4D48A 3DUVA 3CKOA 1H5RB 1H5SB 4FIXA 1G2VA 3PNNA 1IINA 1ZCTA 4EE5A 3CKQA 2Z86A 4BQHA 1WSZA 1K4VA 1HJLA 1XZ6A 4B2XA 4D0TA 1VPAA 3T7OA 4G3QA 2OI6A 1LL2A 4J18A 3IOHA 2X5SA 3CKVA 5DDTA 2P6WA 2V0JA 4HO0A 4ASYA 2V0KA 4ARWA 1YP2A 3USRA 2VSIA 5IDTA 4R7PA 1FG5N 1R7TA 2O1FA 4CJBA 1WT2A 3K8EA 1YP3A 3CU0A 1GQCA 2BO7A 2E3DA 4Y7FA 4B4MA 5EJZA 1ZJ0A 1ZJOA 3OH1A 3OH3A 4FRQA 5FYEA 1ZJ1A 2BO8A 1H5TB 5C47A 2FYAA 1H4EA 2WVLA 3EE5A 4JISA 3U2WA 1VGUA 2PGVA 2OI5A 5C1HA 2D7RA 1VICA 4KC2A 1W57A 2Z87A 5C4EA 1NWGB 1OMXA 1G95A 2RJ8A 2XMHA 4Y6UA 3E25A 1ZCVA 1QGSA 4ZDQA 1H7EA 1H7QA 2WAWA 3LW6A 5C1LA 1JVDA 2W0VA 1O7QA 3PKPA 1ZJPA 4IRPA 2QGIA 4LW6A 1O0RA 5J49A 4B4GA 1VGZA 3D98A 2YQHA 1LL3A 2A8UA 4HO3A 1H7HA 5D92A 1YP4A 2Y4LA 4FCEA 1HJJA 2JCJA 1IIMA 3JUKA 2OI7A 1R7XA 1NF5B 3KIAA 1ZI1A 1QGQA 1JV3A 2AM4A 2W0WA 4FRBA 4O6MA 1ZJ3A 1INJA 3JTJA 3ZF8A 4EEAA 3F1CA 3Q7UA 1R81A 1FOAA 5JQQA 3OH2A 3SXGA 3ZLLA 4M4KA 1H7FA 3K8DA 1G97A 5CQMX 1PZTA 1JV1A 2UX8A 2P72A 1NHEB 3I0KA 4NALA 2X60A 5HS2A 4EEMA 1O23B 1S4NA 5D91A 5C3DA 2ICXA 5FU8A 2YC5A 1ZI5A 4FRHA 5C4DA 3T7MA 1LZIA 2RIZA 3NGWA 1H7GA 2C0NA 4G87A 1W77A 1TW1A 4UEGA 1ZI3A 5FU0A 4HO6A 1V83A 3N9WA 2RJ9A 3I0EA 1H4CA 2RJ4A 1VZUA 2RIXA 2RJ0A 5C36A 2YCMA 3R2WA 1MP3A 4CJ8A 3U0YA 2I7BA 1G3LA 2FYBA 1NMMB 2J0AA 3V0OA 1VM8A 3I0LA 1ZHJA 5CMGX 5I1FA 1ON8A 3OKRA 2VK9A 2XMEA 5AJPA 5FV9A 4E1KA 4B2WA 1VZXA 1MP5A 2PGYA 5AJNA 2Y4MA 3USQA 1VH1A 3CKJA 5EIYA 2RJ6A 3I0IX 2VXMA 4NAKA 3SX3A 2X65A 1PZYB 5L6SA 1LL0A 3SXEA 4D0ZA 1OQMB 3OH4A 2FFUA 2PX7A 2RIYA 4CVHA 3JUJA 5C1GA 2VSHA 4NANA 1FO8A 1ZCUA 4FIYA 2QH5A 3SX5A 3U0XA 2WE9A 5CQOA 2VD4A 1SS9A 2YQCA 2O1HA 2MZBA 4MIXA 2VS3A 4FRLA 1ZDGA 1GX4A 2D7IA 3U2XA 4DDZA 4HG6A 1S4PA 3D5NA 1FXJA 2RJ1A 4ECMA 1FO9A 1LZJA 2I5EA 1I52A 5CMFX 2I5KA 5IDSA 4LW3A 5C4BA 2WVKA 1JVGA 3V0MA 1WVCA 4Y7UA 2BO6A 4DECA 3I0DA 1LVWA 1H3MA 2QKXA 5C4FA 4FROA 1ZCYA 1E5KA 5EJ1A 1MC3A 3IOJA 1H5RA 1NKHB 3I0JA 4FRDA 2XWLA 4AYJA 1R7YA 2WVMA 4M2BA 2NXVA 3V0PA 4G3SA 1EZIA 2P73A 1GA8A 2X5ZA 1WT1A 4KPXA 2YC3A 3SX7A 3I0GA 1H4DA 2JCOA 4C2SA 2J0BA 5C38A 4KC4A 2ZU7A 5C48A 2YQSA 1HM0A 1HV9A 3I0HA 1O7OA 2Y6PA 4JD0A 5CMIA 5FTSA 3O3PA 1R7UA 4HO2A 3QVBA 5C3BA 3V91A 4B3UA 1HM9A 4HOCA 3HL3A 4HO8A 4IRQA 1ON6A 1QG8A 3RSBA 4AAWA 3R3IA 1KWSA 1WT3A 2VS5A 4EEGA 5BXCA 4HCQA 4B4BA 3TZTA 5CQNX 2Y7AA 2FFVA 3U2VA 3OGZA 2V0LA 4D11A 2O1GA 3V8ZA 4Y63A 1INIA 5CQLX 1G0RA 2Q4JA 4KNXA 3ZLKA 5L6VA 4MNDA 2V0HA 1OMZA 4Y64A 2YESA 4Y6NA 1GX0A 1VGWA 3SXBA 1V82A 1G9RA 1S4OA 4L41C 4AYLA 3SXDA 3DK5A 4HO5A 4B42A 4EE3A 2ZU9A 1GQ9A 1VGTA 4KQLA 2VFZA 1G8OA 5IFYA 5FTVA 1VZTA 1QWJA 4XWIA 3POLA 4Y7GA 2FY7A 4P00A 1TW5A 1G1LA 4HO4A 2VS4A 3BRKX 4G3PA 5AJOA 3U2TA 5C4CA 1MP4A 4M2AA 2FYDB 1TVYA 1TZFA 2JCLA 2BO4A 2XWNA 4BMAA 3TQDA 3SXCA 1H7TA 2GGQA 3DJ4A 3V90A 3OH0A 1XHBA 1R7VA 4P02A 4Q7CA 4KXOA 2PA4A 4EVWA 2A8WA 1FGGA 3I0CA 5C3AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FYC B;  4KRV A;  1NQI B;  1LZ7 A;  4EEO A;  1FR9 A;  4CJC A;  3U2U A;  1R82 A;  1V84 A;  3F1Y A;  2Y4J A;  5CMJ A;  4YS8 A;  4DE7 A;  1JYL A;  5CQP A;  5CMH A;  1ZJ2 A;  4M28 A;  1G23 A;  1G93 A;  1FGX A;  1LZ0 A;  4EE4 A;  2AH9 A;  2WGZ A;  2V0I A;  3Q80 A;  3ZGF A;  1H5S A;  3CGX A;  4MYB A;  3BCV A;  1FZW A;  4FRM A;  4KPZ A;  2AEC A;  5C8R A;  1W55 A;  2DPW A;  2XWM A;  3V8Y A;  1H5S C;  3FOQ A;  1Z90 A;  2CU2 A;  2VXL A;  5FUH A;  4FQW A;  4AC3 A;  2D0J A;  3SX8 A;  1FXO A;  2Y4K A;  2ZU8 A;  4Y9X A;  1H5S D;  3CKN A;  4Y7T A;  1GWV A;  1YRO B;  2RJ5 A;  4Y7V A;  2RIT A;  3Q4S A;  1GWW A;  4B5B A;  3ZGG A;  3I0F A;  1WT0 A;  3SXA A;  2WEE A;  3IOI A;  2E8B A;  2AM5 A;  3E26 A;  1H5T A;  1EYR A;  1FR8 A;  4ASJ A;  1FWY A;  2AGD A;  2YQJ A;  1VH3 A;  4HO9 A;  1ZDF A;  1HM8 A;  2RJ7 A;  2AM3 A;  1JYK A;  4FRA A;  4FCU A;  1FRW A;  4FRE A;  3GUE A;  3D8V A;  5DDV A;  2GGO A;  3OC9 A;  4KT7 A;  3T7N A;  4GBP A;  3V0L A;  3RMV A;  4KC1 A;  3PKQ A;  2AES A;  3V0N A;  4D11 C;  4Y62 A;  2JCK A;  1ZI4 A;  3OAM A;  3FWW A;  4NAI A;  3SPT A;  2OEG A;  2APC A;  1R80 A;  4K6R A;  1ZIZ A;  3V0Q A;  2OEF A;  4KNR A;  2ICY A;  3RMW A;  2AE7 A;  5C49 A;  3ST8 A;  1H7L A;  4FRP A;  4D48 A;  3DUV A;  3CKO A;  1H5R B;  1H5S B;  1G2V A;  3PNN A;  1IIN A;  1ZCT A;  4EE5 A;  3CKQ A;  2Z86 A;  4BQH A;  1WSZ A;  1K4V A;  1HJL A;  1XZ6 A;  4B2X A;  4D0T A;  1VPA A;  3T7O A;  4G3Q A;  2OI6 A;  1LL2 A;  4J18 A;  3IOH A;  2X5S A;  3CKV A;  5DDT A;  2P6W A;  2V0J A;  4HO0 A;  4ASY A;  2V0K A;  4ARW A;  1YP2 A;  3USR A;  2VSI A;  5IDT A;  4R7P A;  1FG5 N;  1R7T A;  2O1F A;  4CJB A;  1WT2 A;  3K8E A;  1YP3 A;  3CU0 A;  1GQC A;  2BO7 A;  2E3D A;  4Y7F A;  4B4M A;  5EJZ A;  1ZJ0 A;  1ZJO A;  3OH1 A;  3OH3 A;  4FRQ A;  5FYE A;  1ZJ1 A;  2BO8 A;  1H5T B;  5C47 A;  2FYA A;  1H4E A;  2WVL A;  3EE5 A;  4JIS A;  3U2W A;  1VGU A;  2PGV A;  2OI5 A;  5C1H A;  2D7R A;  1VIC A;  4KC2 A;  1W57 A;  2Z87 A;  5C4E A;  1NWG B;  1OMX A;  1G95 A;  2RJ8 A;  2XMH A;  4Y6U A;  3E25 A;  1ZCV A;  1QGS A;  4ZDQ A;  1H7E A;  1H7Q A;  2WAW A;  3LW6 A;  5C1L A;  1JVD A;  2W0V A;  1O7Q A;  3PKP A;  1ZJP A;  4IRP A;  2QGI A;  4LW6 A;  1O0R A;  5J49 A;  4B4G A;  1VGZ A;  3D98 A;  2YQH A;  1LL3 A;  2A8U A;  4HO3 A;  1H7H A;  1YP4 A;  2Y4L A;  4FCE A;  1HJJ A;  2JCJ A;  1IIM A;  3JUK A;  2OI7 A;  1R7X A;  1NF5 B;  3KIA A;  1ZI1 A;  1QGQ A;  1JV3 A;  2AM4 A;  2W0W A;  4FRB A;  1ZJ3 A;  1INJ A;  3JTJ A;  3ZF8 A;  4EEA A;  3F1C A;  3Q7U A;  1R81 A;  1FOA A;  5JQQ A;  3OH2 A;  3SXG A;  3ZLL A;  4M4K A;  1H7F A;  3K8D A;  1G97 A;  5CQM X;  1PZT A;  1JV1 A;  2UX8 A;  2P72 A;  1NHE B;  3I0K A;  4NAL A;  2X60 A;  5HS2 A;  4EEM A;  1O23 B;  1S4N A;  5C3D A;  2ICX A;  5FU8 A;  2YC5 A;  1ZI5 A;  4FRH A;  5C4D A;  3T7M A;  1LZI A;  2RIZ A;  3NGW A;  1H7G A;  4G87 A;  1W77 A;  1TW1 A;  4UEG A;  1ZI3 A;  5FU0 A;  4HO6 A;  1V83 A;  3N9W A;  2RJ9 A;  3I0E A;  1H4C A;  2RJ4 A;  1VZU A;  2RIX A;  2RJ0 A;  5C36 A;  2YCM A;  3R2W A;  1MP3 A;  4CJ8 A;  3U0Y A;  2I7B A;  1G3L A;  2FYB A;  1NMM B;  3V0O A;  1VM8 A;  3I0L A;  1ZHJ A;  5CMG X;  5I1F A;  1ON8 A;  3OKR A;  2XME A;  5AJP A;  5FV9 A;  4E1K A;  4B2W A;  1VZX A;  1MP5 A;  2PGY A;  5AJN A;  2Y4M A;  3USQ A;  1VH1 A;  3CKJ A;  5EIY A;  2RJ6 A;  3I0I X;  2VXM A;  4NAK A;  3SX3 A;  2X65 A;  1PZY B;  5L6S A;  1LL0 A;  3SXE A;  4D0Z A;  1OQM B;  3OH4 A;  2FFU A;  2PX7 A;  2RIY A;  4CVH A;  3JUJ A;  5C1G A;  2VSH A;  4NAN A;  1FO8 A;  1ZCU A;  2QH5 A;  3SX5 A;  3U0X A;  2WE9 A;  5CQO A;  2VD4 A;  1SS9 A;  2YQC A;  2O1H A;  2MZB A;  2VS3 A;  4FRL A;  1ZDG A;  1GX4 A;  2D7I A;  3U2X A;  4DDZ A;  4HG6 A;  1S4P A;  3D5N A;  1FXJ A;  2RJ1 A;  4ECM A;  1FO9 A;  1LZJ A;  2I5E A;  1I52 A;  5CMF X;  2I5K A;  5IDS A;  4LW3 A;  5C4B A;  2WVK A;  1JVG A;  3V0M A;  1WVC A;  4Y7U A;  2BO6 A;  4DEC A;  3I0D A;  1LVW A;  1H3M A;  2QKX A;  5C4F A;  4FRO A;  1ZCY A;  1E5K A;  5EJ1 A;  1MC3 A;  3IOJ A;  1H5R A;  1NKH B;  3I0J A;  4FRD A;  2XWL A;  4AYJ A;  1R7Y A;  2WVM A;  4M2B A;  2NXV A;  3V0P A;  4G3S A;  1EZI A;  2P73 A;  1GA8 A;  2X5Z A;  1WT1 A;  4KPX A;  2YC3 A;  3SX7 A;  3I0G A;  1H4D A;  2JCO A;  4C2S A;  5C38 A;  4KC4 A;  2ZU7 A;  5C48 A;  2YQS A;  1HM0 A;  1HV9 A;  3I0H A;  1O7O A;  2Y6P A;  4JD0 A;  5CMI A;  5FTS A;  3O3P A;  1R7U A;  4HO2 A;  3QVB A;  5C3B A;  3V91 A;  4B3U A;  1HM9 A;  4HOC A;  3HL3 A;  4HO8 A;  4IRQ A;  1ON6 A;  1QG8 A;  3RSB A;  4AAW A;  3R3I A;  1KWS A;  1WT3 A;  2VS5 A;  4EEG A;  5BXC A;  4HCQ A;  4B4B A;  3TZT A;  5CQN X;  2Y7A A;  2FFV A;  3U2V A;  3OGZ A;  2V0L A;  4D11 A;  2O1G A;  3V8Z A;  4Y63 A;  1INI A;  5CQL X;  1G0R A;  2Q4J A;  4KNX A;  3ZLK A;  5L6V A;  4MND A;  2V0H A;  1OMZ A;  4Y64 A;  2YES A;  4Y6N A;  1GX0 A;  1VGW A;  3SXB A;  1V82 A;  1G9R A;  1S4O A;  4L41 C;  4AYL A;  3SXD A;  3DK5 A;  4HO5 A;  4B42 A;  4EE3 A;  2ZU9 A;  1GQ9 A;  1VGT A;  4KQL A;  2VFZ A;  1G8O A;  5IFY A;  5FTV A;  1VZT A;  1QWJ A;  4XWI A;  3POL A;  4Y7G A;  2FY7 A;  4P00 A;  1TW5 A;  1G1L A;  4HO4 A;  2VS4 A;  3BRK X;  4G3P A;  5AJO A;  3U2T A;  5C4C A;  1MP4 A;  4M2A A;  2FYD B;  1TVY A;  1TZF A;  2JCL A;  2BO4 A;  2XWN A;  4BMA A;  3TQD A;  3SXC A;  1H7T A;  2GGQ A;  3DJ4 A;  3V90 A;  3OH0 A;  1XHB A;  1R7V A;  4P02 A;  4KXO A;  2PA4 A;  4EVW A;  2A8W A;  1FGG A;  3I0C A;  5C3A A; 
#chains in the Genus database with same CATH topology
 2FYC B;  4KRV A;  1NQI B;  1LZ7 A;  4EEO A;  1FR9 A;  4CJC A;  3U2U A;  1R82 A;  1V84 A;  3F1Y A;  2Y4J A;  5CMJ A;  4YS8 A;  4DE7 A;  1JYL A;  5CQP A;  5CMH A;  1ZJ2 A;  4M28 A;  1G23 A;  1G93 A;  1FGX A;  1LZ0 A;  4EE4 A;  2AH9 A;  2WGZ A;  2V0I A;  3Q80 A;  3ZGF A;  1H5S A;  3CGX A;  4MYB A;  3BCV A;  1FZW A;  4FRM A;  4KPZ A;  2AEC A;  5C8R A;  1W55 A;  2DPW A;  2XWM A;  3V8Y A;  1H5S C;  3FOQ A;  1Z90 A;  2CU2 A;  2VXL A;  5FUH A;  4FQW A;  4AC3 A;  2D0J A;  3SX8 A;  1FXO A;  2Y4K A;  2ZU8 A;  4Y9X A;  1H5S D;  3CKN A;  4Y7T A;  1GWV A;  1YRO B;  2RJ5 A;  4Y7V A;  2RIT A;  3Q4S A;  1GWW A;  4B5B A;  3ZGG A;  3I0F A;  1WT0 A;  3SXA A;  2WEE A;  3IOI A;  2E8B A;  2AM5 A;  3E26 A;  1H5T A;  1EYR A;  1FR8 A;  4ASJ A;  1FWY A;  2AGD A;  2YQJ A;  1VH3 A;  4HO9 A;  1ZDF A;  1HM8 A;  2RJ7 A;  2AM3 A;  1JYK A;  4FRA A;  4FCU A;  1FRW A;  4FRE A;  3GUE A;  3D8V A;  5DDV A;  2GGO A;  3OC9 A;  4KT7 A;  3T7N A;  4GBP A;  3V0L A;  3RMV A;  4KC1 A;  3PKQ A;  4O6N A;  2AES A;  3V0N A;  4D11 C;  4Y62 A;  2JCK A;  1ZI4 A;  3OAM A;  3FWW A;  4NAI A;  3SPT A;  2OEG A;  2APC A;  1R80 A;  4K6R A;  1ZIZ A;  3V0Q A;  2OEF A;  4KNR A;  2ICY A;  3RMW A;  2AE7 A;  5C49 A;  3ST8 A;  1H7L A;  4FRP A;  4D48 A;  3DUV A;  3CKO A;  1H5R B;  1H5S B;  4FIX A;  1G2V A;  3PNN A;  1IIN A;  1ZCT A;  4EE5 A;  3CKQ A;  2Z86 A;  4BQH A;  1WSZ A;  1K4V A;  1HJL A;  1XZ6 A;  4B2X A;  4D0T A;  1VPA A;  3T7O A;  4G3Q A;  2OI6 A;  1LL2 A;  4J18 A;  3IOH A;  2X5S A;  3CKV A;  5DDT A;  2P6W A;  2V0J A;  4HO0 A;  4ASY A;  2V0K A;  4ARW A;  1YP2 A;  3USR A;  2VSI A;  5IDT A;  4R7P A;  1FG5 N;  1R7T A;  2O1F A;  4CJB A;  1WT2 A;  3K8E A;  1YP3 A;  3CU0 A;  1GQC A;  2BO7 A;  2E3D A;  4Y7F A;  4B4M A;  5EJZ A;  1ZJ0 A;  1ZJO A;  3OH1 A;  3OH3 A;  4FRQ A;  5FYE A;  1ZJ1 A;  2BO8 A;  1H5T B;  5C47 A;  2FYA A;  1H4E A;  2WVL A;  3EE5 A;  4JIS A;  3U2W A;  1VGU A;  2PGV A;  2OI5 A;  5C1H A;  2D7R A;  1VIC A;  4KC2 A;  1W57 A;  2Z87 A;  5C4E A;  1NWG B;  1OMX A;  1G95 A;  2RJ8 A;  2XMH A;  4Y6U A;  3E25 A;  1ZCV A;  1QGS A;  4ZDQ A;  1H7E A;  1H7Q A;  2WAW A;  3LW6 A;  5C1L A;  1JVD A;  2W0V A;  1O7Q A;  3PKP A;  1ZJP A;  4IRP A;  2QGI A;  4LW6 A;  1O0R A;  5J49 A;  4B4G A;  1VGZ A;  3D98 A;  2YQH A;  1LL3 A;  2A8U A;  4HO3 A;  1H7H A;  5D92 A;  1YP4 A;  2Y4L A;  4FCE A;  1HJJ A;  2JCJ A;  1IIM A;  3JUK A;  2OI7 A;  1R7X A;  1NF5 B;  3KIA A;  1ZI1 A;  1QGQ A;  1JV3 A;  2AM4 A;  2W0W A;  4FRB A;  4O6M A;  1ZJ3 A;  1INJ A;  3JTJ A;  3ZF8 A;  4EEA A;  3F1C A;  3Q7U A;  1R81 A;  1FOA A;  5JQQ A;  3OH2 A;  3SXG A;  3ZLL A;  4M4K A;  1H7F A;  3K8D A;  1G97 A;  5CQM X;  1PZT A;  1JV1 A;  2UX8 A;  2P72 A;  1NHE B;  3I0K A;  4NAL A;  2X60 A;  5HS2 A;  4EEM A;  1O23 B;  1S4N A;  5D91 A;  5C3D A;  2ICX A;  5FU8 A;  2YC5 A;  1ZI5 A;  4FRH A;  5C4D A;  3T7M A;  1LZI A;  2RIZ A;  3NGW A;  1H7G A;  2C0N A;  4G87 A;  1W77 A;  1TW1 A;  4UEG A;  1ZI3 A;  5FU0 A;  4HO6 A;  1V83 A;  3N9W A;  2RJ9 A;  3I0E A;  1H4C A;  2RJ4 A;  1VZU A;  2RIX A;  2RJ0 A;  5C36 A;  2YCM A;  3R2W A;  1MP3 A;  4CJ8 A;  3U0Y A;  2I7B A;  1G3L A;  2FYB A;  1NMM B;  2J0A A;  3V0O A;  1VM8 A;  3I0L A;  1ZHJ A;  5CMG X;  5I1F A;  1ON8 A;  3OKR A;  2VK9 A;  2XME A;  5AJP A;  5FV9 A;  4E1K A;  4B2W A;  1VZX A;  1MP5 A;  2PGY A;  5AJN A;  2Y4M A;  3USQ A;  1VH1 A;  3CKJ A;  5EIY A;  2RJ6 A;  3I0I X;  2VXM A;  4NAK A;  3SX3 A;  2X65 A;  1PZY B;  5L6S A;  1LL0 A;  3SXE A;  4D0Z A;  1OQM B;  3OH4 A;  2FFU A;  2PX7 A;  2RIY A;  4CVH A;  3JUJ A;  5C1G A;  2VSH A;  4NAN A;  1FO8 A;  1ZCU A;  4FIY A;  2QH5 A;  3SX5 A;  3U0X A;  2WE9 A;  5CQO A;  2VD4 A;  1SS9 A;  2YQC A;  2O1H A;  2MZB A;  4MIX A;  2VS3 A;  4FRL A;  1ZDG A;  1GX4 A;  2D7I A;  3U2X A;  4DDZ A;  4HG6 A;  1S4P A;  3D5N A;  1FXJ A;  2RJ1 A;  4ECM A;  1FO9 A;  1LZJ A;  2I5E A;  1I52 A;  5CMF X;  2I5K A;  5IDS A;  4LW3 A;  5C4B A;  2WVK A;  1JVG A;  3V0M A;  1WVC A;  4Y7U A;  2BO6 A;  4DEC A;  3I0D A;  1LVW A;  1H3M A;  2QKX A;  5C4F A;  4FRO A;  1ZCY A;  1E5K A;  5EJ1 A;  1MC3 A;  3IOJ A;  1H5R A;  1NKH B;  3I0J A;  4FRD A;  2XWL A;  4AYJ A;  1R7Y A;  2WVM A;  4M2B A;  2NXV A;  3V0P A;  4G3S A;  1EZI A;  2P73 A;  1GA8 A;  2X5Z A;  1WT1 A;  4KPX A;  2YC3 A;  3SX7 A;  3I0G A;  1H4D A;  2JCO A;  4C2S A;  2J0B A;  5C38 A;  4KC4 A;  2ZU7 A;  5C48 A;  2YQS A;  1HM0 A;  1HV9 A;  3I0H A;  1O7O A;  2Y6P A;  4JD0 A;  5CMI A;  5FTS A;  3O3P A;  1R7U A;  4HO2 A;  3QVB A;  5C3B A;  3V91 A;  4B3U A;  1HM9 A;  4HOC A;  3HL3 A;  4HO8 A;  4IRQ A;  1ON6 A;  1QG8 A;  3RSB A;  4AAW A;  3R3I A;  1KWS A;  1WT3 A;  2VS5 A;  4EEG A;  5BXC A;  4HCQ A;  4B4B A;  3TZT A;  5CQN X;  2Y7A A;  2FFV A;  3U2V A;  3OGZ A;  2V0L A;  4D11 A;  2O1G A;  3V8Z A;  4Y63 A;  1INI A;  5CQL X;  1G0R A;  2Q4J A;  4KNX A;  3ZLK A;  5L6V A;  4MND A;  2V0H A;  1OMZ A;  4Y64 A;  2YES A;  4Y6N A;  1GX0 A;  1VGW A;  3SXB A;  1V82 A;  1G9R A;  1S4O A;  4L41 C;  4AYL A;  3SXD A;  3DK5 A;  4HO5 A;  4B42 A;  4EE3 A;  2ZU9 A;  1GQ9 A;  1VGT A;  4KQL A;  2VFZ A;  1G8O A;  5IFY A;  5FTV A;  1VZT A;  1QWJ A;  4XWI A;  3POL A;  4Y7G A;  2FY7 A;  4P00 A;  1TW5 A;  1G1L A;  4HO4 A;  2VS4 A;  3BRK X;  4G3P A;  5AJO A;  3U2T A;  5C4C A;  1MP4 A;  4M2A A;  2FYD B;  1TVY A;  1TZF A;  2JCL A;  2BO4 A;  2XWN A;  4BMA A;  3TQD A;  3SXC A;  1H7T A;  2GGQ A;  3DJ4 A;  3V90 A;  3OH0 A;  1XHB A;  1R7V A;  4P02 A;  4Q7C A;  4KXO A;  2PA4 A;  4EVW A;  2A8W A;  1FGG A;  3I0C A;  5C3A A; 
#chains in the Genus database with same CATH homology
 2FYC B;  4KRV A;  1NQI B;  1LZ7 A;  4EEO A;  1FR9 A;  4CJC A;  3U2U A;  1R82 A;  1V84 A;  3F1Y A;  2Y4J A;  5CMJ A;  4YS8 A;  4DE7 A;  1JYL A;  5CQP A;  5CMH A;  1ZJ2 A;  4M28 A;  1G23 A;  1G93 A;  1FGX A;  1LZ0 A;  4EE4 A;  2AH9 A;  2WGZ A;  2V0I A;  3Q80 A;  3ZGF A;  1H5S A;  3CGX A;  4MYB A;  3BCV A;  1FZW A;  4FRM A;  4KPZ A;  2AEC A;  5C8R A;  1W55 A;  2DPW A;  2XWM A;  3V8Y A;  1H5S C;  3FOQ A;  1Z90 A;  2CU2 A;  2VXL A;  5FUH A;  4FQW A;  4AC3 A;  2D0J A;  3SX8 A;  1FXO A;  2Y4K A;  2ZU8 A;  4Y9X A;  1H5S D;  3CKN A;  4Y7T A;  1GWV A;  1YRO B;  2RJ5 A;  4Y7V A;  2RIT A;  3Q4S A;  1GWW A;  4B5B A;  3ZGG A;  3I0F A;  1WT0 A;  3SXA A;  2WEE A;  3IOI A;  2E8B A;  2AM5 A;  3E26 A;  1H5T A;  1EYR A;  1FR8 A;  4ASJ A;  1FWY A;  2AGD A;  2YQJ A;  1VH3 A;  4HO9 A;  1ZDF A;  1HM8 A;  2RJ7 A;  2AM3 A;  1JYK A;  4FRA A;  4FCU A;  1FRW A;  4FRE A;  3GUE A;  3D8V A;  5DDV A;  2GGO A;  3OC9 A;  4KT7 A;  3T7N A;  4GBP A;  3V0L A;  3RMV A;  4KC1 A;  3PKQ A;  4O6N A;  2AES A;  3V0N A;  4D11 C;  4Y62 A;  2JCK A;  1ZI4 A;  3OAM A;  3FWW A;  4NAI A;  3SPT A;  2OEG A;  2APC A;  1R80 A;  4K6R A;  1ZIZ A;  3V0Q A;  2OEF A;  4KNR A;  2ICY A;  3RMW A;  2AE7 A;  5C49 A;  3ST8 A;  1H7L A;  4FRP A;  4D48 A;  3DUV A;  3CKO A;  1H5R B;  1H5S B;  4FIX A;  1G2V A;  3PNN A;  1IIN A;  1ZCT A;  4EE5 A;  3CKQ A;  2Z86 A;  4BQH A;  1WSZ A;  1K4V A;  1HJL A;  1XZ6 A;  4B2X A;  4D0T A;  1VPA A;  3T7O A;  4G3Q A;  2OI6 A;  1LL2 A;  4J18 A;  3IOH A;  2X5S A;  3CKV A;  5DDT A;  2P6W A;  2V0J A;  4HO0 A;  4ASY A;  2V0K A;  4ARW A;  1YP2 A;  3USR A;  2VSI A;  5IDT A;  4R7P A;  1FG5 N;  1R7T A;  2O1F A;  4CJB A;  1WT2 A;  3K8E A;  1YP3 A;  3CU0 A;  1GQC A;  2BO7 A;  2E3D A;  4Y7F A;  4B4M A;  5EJZ A;  1ZJ0 A;  1ZJO A;  3OH1 A;  3OH3 A;  4FRQ A;  5FYE A;  1ZJ1 A;  2BO8 A;  1H5T B;  5C47 A;  2FYA A;  1H4E A;  2WVL A;  3EE5 A;  4JIS A;  3U2W A;  1VGU A;  2PGV A;  2OI5 A;  5C1H A;  2D7R A;  1VIC A;  4KC2 A;  1W57 A;  2Z87 A;  5C4E A;  1NWG B;  1OMX A;  1G95 A;  2RJ8 A;  2XMH A;  4Y6U A;  3E25 A;  1ZCV A;  1QGS A;  4ZDQ A;  1H7E A;  1H7Q A;  2WAW A;  3LW6 A;  5C1L A;  1JVD A;  2W0V A;  1O7Q A;  3PKP A;  1ZJP A;  4IRP A;  2QGI A;  4LW6 A;  1O0R A;  5J49 A;  4B4G A;  1VGZ A;  3D98 A;  2YQH A;  1LL3 A;  2A8U A;  4HO3 A;  1H7H A;  5D92 A;  1YP4 A;  2Y4L A;  4FCE A;  1HJJ A;  2JCJ A;  1IIM A;  3JUK A;  2OI7 A;  1R7X A;  1NF5 B;  3KIA A;  1ZI1 A;  1QGQ A;  1JV3 A;  2AM4 A;  2W0W A;  4FRB A;  4O6M A;  1ZJ3 A;  1INJ A;  3JTJ A;  3ZF8 A;  4EEA A;  3F1C A;  3Q7U A;  1R81 A;  1FOA A;  5JQQ A;  3OH2 A;  3SXG A;  3ZLL A;  4M4K A;  1H7F A;  3K8D A;  1G97 A;  5CQM X;  1PZT A;  1JV1 A;  2UX8 A;  2P72 A;  1NHE B;  3I0K A;  4NAL A;  2X60 A;  5HS2 A;  4EEM A;  1O23 B;  1S4N A;  5D91 A;  5C3D A;  2ICX A;  5FU8 A;  2YC5 A;  1ZI5 A;  4FRH A;  5C4D A;  3T7M A;  1LZI A;  2RIZ A;  3NGW A;  1H7G A;  2C0N A;  4G87 A;  1W77 A;  1TW1 A;  4UEG A;  1ZI3 A;  5FU0 A;  4HO6 A;  1V83 A;  3N9W A;  2RJ9 A;  3I0E A;  1H4C A;  2RJ4 A;  1VZU A;  2RIX A;  2RJ0 A;  5C36 A;  2YCM A;  3R2W A;  1MP3 A;  4CJ8 A;  3U0Y A;  2I7B A;  1G3L A;  2FYB A;  1NMM B;  2J0A A;  3V0O A;  1VM8 A;  3I0L A;  1ZHJ A;  5CMG X;  5I1F A;  1ON8 A;  3OKR A;  2VK9 A;  2XME A;  5AJP A;  5FV9 A;  4E1K A;  4B2W A;  1VZX A;  1MP5 A;  2PGY A;  5AJN A;  2Y4M A;  3USQ A;  1VH1 A;  3CKJ A;  5EIY A;  2RJ6 A;  3I0I X;  2VXM A;  4NAK A;  3SX3 A;  2X65 A;  1PZY B;  5L6S A;  1LL0 A;  3SXE A;  4D0Z A;  1OQM B;  3OH4 A;  2FFU A;  2PX7 A;  2RIY A;  4CVH A;  3JUJ A;  5C1G A;  2VSH A;  4NAN A;  1FO8 A;  1ZCU A;  4FIY A;  2QH5 A;  3SX5 A;  3U0X A;  2WE9 A;  5CQO A;  2VD4 A;  1SS9 A;  2YQC A;  2O1H A;  2MZB A;  4MIX A;  2VS3 A;  4FRL A;  1ZDG A;  1GX4 A;  2D7I A;  3U2X A;  4DDZ A;  4HG6 A;  1S4P A;  3D5N A;  1FXJ A;  2RJ1 A;  4ECM A;  1FO9 A;  1LZJ A;  2I5E A;  1I52 A;  5CMF X;  2I5K A;  5IDS A;  4LW3 A;  5C4B A;  2WVK A;  1JVG A;  3V0M A;  1WVC A;  4Y7U A;  2BO6 A;  4DEC A;  3I0D A;  1LVW A;  1H3M A;  2QKX A;  5C4F A;  4FRO A;  1ZCY A;  1E5K A;  5EJ1 A;  1MC3 A;  3IOJ A;  1H5R A;  1NKH B;  3I0J A;  4FRD A;  2XWL A;  4AYJ A;  1R7Y A;  2WVM A;  4M2B A;  2NXV A;  3V0P A;  4G3S A;  1EZI A;  2P73 A;  1GA8 A;  2X5Z A;  1WT1 A;  4KPX A;  2YC3 A;  3SX7 A;  3I0G A;  1H4D A;  2JCO A;  4C2S A;  2J0B A;  5C38 A;  4KC4 A;  2ZU7 A;  5C48 A;  2YQS A;  1HM0 A;  1HV9 A;  3I0H A;  1O7O A;  2Y6P A;  4JD0 A;  5CMI A;  5FTS A;  3O3P A;  1R7U A;  4HO2 A;  3QVB A;  5C3B A;  3V91 A;  4B3U A;  1HM9 A;  4HOC A;  3HL3 A;  4HO8 A;  4IRQ A;  1ON6 A;  1QG8 A;  3RSB A;  4AAW A;  3R3I A;  1KWS A;  1WT3 A;  2VS5 A;  4EEG A;  5BXC A;  4HCQ A;  4B4B A;  3TZT A;  5CQN X;  2Y7A A;  2FFV A;  3U2V A;  3OGZ A;  2V0L A;  4D11 A;  2O1G A;  3V8Z A;  4Y63 A;  1INI A;  5CQL X;  1G0R A;  2Q4J A;  4KNX A;  3ZLK A;  5L6V A;  4MND A;  2V0H A;  1OMZ A;  4Y64 A;  2YES A;  4Y6N A;  1GX0 A;  1VGW A;  3SXB A;  1V82 A;  1G9R A;  1S4O A;  4L41 C;  4AYL A;  3SXD A;  3DK5 A;  4HO5 A;  4B42 A;  4EE3 A;  2ZU9 A;  1GQ9 A;  1VGT A;  4KQL A;  2VFZ A;  1G8O A;  5IFY A;  5FTV A;  1VZT A;  1QWJ A;  4XWI A;  3POL A;  4Y7G A;  2FY7 A;  4P00 A;  1TW5 A;  1G1L A;  4HO4 A;  2VS4 A;  3BRK X;  4G3P A;  5AJO A;  3U2T A;  5C4C A;  1MP4 A;  4M2A A;  2FYD B;  1TVY A;  1TZF A;  2JCL A;  2BO4 A;  2XWN A;  4BMA A;  3TQD A;  3SXC A;  1H7T A;  2GGQ A;  3DJ4 A;  3V90 A;  3OH0 A;  1XHB A;  1R7V A;  4P02 A;  4Q7C A;  4KXO A;  2PA4 A;  4EVW A;  2A8W A;  1FGG A;  3I0C A;  5C3A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...