2JCLA

Crystal structure of alpha-1,3 galactosyltransferase (r365k) in the absence of ligands
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
277
structure length
277
Chain Sequence
KLKLSDWFNPFKRPEVVTMTKWKAPVVWEGTYNRAVLDNYYAKQKITVGLTVFAVGRYIEHYLEEFLTSANKHFMVGHPVIFYIMVDDVSRMPLIELGPLRSFKVFKIKPEKRWQDISMMRMKTIGEHIVAHIQHEVDFLFCMDVDQVFQDKFGVETLGESVAQLQAWWYKADPNDFTYERRKESAAYIPFGEGDFYYHAAIFGGTPTQVLNITQECFKGILKDKKNDIEAQWHDESHLNKYFLLNKPTKILSPEYCWDYHIGLPADIKLVKMSWQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords N-ACETYLLACTOSAMINIDE ALPHA-1,3-GALACTOSYLTRANSFERASE
publication title Conformational Changes Induced by Binding Udp-2F-Galactose to Alpha-1,3 Galactosyltransferase-Implications for Catalysis.
pubmed doi rcsb
source organism Bos taurus
molecule tags Transferase
total genus 101
structure length 277
sequence length 277
chains with identical sequence B
ec nomenclature ec 2.4.1.87: N-acetyllactosaminide 3-alpha-galactosyltransferase.
pdb deposition date 2006-12-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 2jclA00
1GQCA 1LZ0A 2RJ8A 2YQSA 4KPXA 1ZDFA 5AJPA 3Q4SA 3KIAA 4JISA 4KC2A 2AM4A 1MC3A 1LZIA 2YQHA 1H7TA 4HO8A 3SX8A 1ZJ0A 3K8DA 3I0HA 2D7IA 4EEAA 1QGQA 3ZGFA 4B2XA 4Y64A 3I0GA 1ZJ3A 2RJ1A 2VS4A 2AGDA 3ZGGA 1FWYA 1NHEB 2JCJA 3I0FA 4KQLA 5CMIA 5C3DA 4CJBA 3SXDA 5IDSA 4Y62A 1OMZA 1G3LA 5C4FA 1O0RA 1FGGA 1K4VA 2V0JA 4ARWA 1NWGB 2Y4JA 2E3DA 1R81A 2YESA 2ICYA 5C4DA 2WVLA 5CQLX 2XMHA 4IRPA 2VXMA 1OMXA 4DECA 4EVWA 1ON8A 4KRVA 3U2XA 2O1GA 4NANA 1FO8A 1H4EA 1YP4A 2AECA 1NF5B 1ZCVA 2O1FA 3I0JA 1ZCTA 4D11C 1FXOA 1WVCA 4HO9A 1NMMB 1XZ6A 5FTSA 4IRQA 5DDTA 3V0LA 1INIA 2QGIA 3V90A 5AJOA 1LZ7A 2VSIA 3RSBA 5CMGX 4LW6A 5HS2A 2VFZA 2P73A 2BO6A 4NAIA 3USRA 1G9RA 2OI7A 3U0XA 2FYBA 2WVMA 1HM8A 5JQQA 1V84A 4B4BA 3OH3A 3T7OA 2QKXA 4LW3A 2P72A 1PZYB 1FR8A 1HJJA 3V0NA 1ZI1A 3IOJA 4Y7FA 2GGQA 1W77A 1QG8A 2AH9A 2WE9A 3CKJA 3Q7UA 2YC5A 3JTJA 3NGWA 1G0RA 2GGOA 1ZIZA 1W57A 5I1FA 4FROA 4BMAA 4B42A 4DE7A 5CMJA 1H5SC 4Y7TA 2V0IA 1H5RB 2RITA 2V0HA 5CQOA 5FU8A 3DUVA 3SX3A 5C1HA 4P00A 1H5RA 4KC4A 2FFUA 1H7EA 1G97A 3BCVA 2O1HA 1YP2A 3T7NA 3CKNA 1VGWA 4HOCA 2FYCB 1EZIA 4EE5A 2DPWA 4Y9XA 5DDVA 2D0JA 3CU0A 4EEGA 1LZJA 2RJ4A 3PKQA 5C3AA 3SXBA 3BRKX 1FO9A 2MZBA 1TVYA 2RIZA 1H7QA 1JVGA 1GX0A 1R80A 1FGXA 5EJ1A 1PZTA 1R7YA 5AJNA 2PA4A 1JV1A 4G3QA 5CQPA 1G2VA 1IINA 4JD0A 3O3PA 1ZDGA 4EEMA 2CU2A 1G95A 2VS3A 1H3MA 2XWMA 3FWWA 4KNXA 2RJ0A 2FYDB 2Y6PA 3F1YA 1WSZA 1ZI5A 4HO6A 4L41C 2XWNA 3V91A 4ECMA 4B4GA 4EE3A 4FRDA 1VPAA 2V0LA 3JUKA 1H4CA 3SPTA 4ASYA 1V82A 4R7PA 2OI5A 3U2TA 4FCUA 3TQDA 1VZXA 5C36A 5CQNX 3RMVA 1KWSA 4NALA 2WVKA 1LL3A 5C49A 2JCOA 4HO3A 1G1LA 3LW6A 2JCKA 4KC1A 4FRBA 2X60A 4FRMA 1G93A 1HM9A 2VD4A 3CKQA 2I5KA 2PGYA 4HO5A 5C1GA 4KT7A 1VGZA 2RJ6A 4EE4A 3GUEA 2AM3A 4KPZA 3V0QA 2YC3A 1TW5A 1FR9A 4D48A 3DJ4A 5C1LA 3V0OA 3SXEA 1FG5N 1O7QA 2VS5A 1R7VA 5J49A 1FZWA 4KNRA 4DDZA 2OEGA 4NAKA 5FYEA 4HCQA 3SX7A 2E8BA 2AM5A 2YCMA 2YQJA 4UEGA 3V8YA 4Y6UA 2VSHA 4J18A 4B5BA 4YS8A 3U2VA 1YP3A 3I0KA 2Y7AA 3SX5A 2PX7A 2RIYA 4M2BA 1VZUA 2VXLA 4FRLA 3CGXA 4XWIA 5IFYA 1G8OA 1JV3A 1ON6A 5CQMX 3ST8A 1ZJ1A 1VGUA 1YROB 1R7XA 5C4BA 5C3BA 2Y4LA 2ZU9A 4EEOA 3V0MA 5FTVA 3POLA 1H4DA 3OH1A 2BO7A 4AC3A 4FQWA 1V83A 3F1CA 1Z90A 5C4CA 4CJCA 4AYJA 4D11A 4C2SA 1IIMA 4E1KA 1O23B 2ZU8A 2FFVA 1VM8A 5C47A 4CJ8A 3IOIA 1H7HA 3OGZA 2NXVA 1SS9A 4M4KA 1VICA 2WGZA 1VGTA 3SXGA 1H7GA 3V0PA 1H7LA 1HM0A 2P6WA 1R82A 5C8RA 4HG6A 4CVHA 2YQCA 4Y7VA 2X65A 5FV9A 5FUHA 3I0IX 2XMEA 3HL3A 4M28A 3E26A 3ZLLA 1JYLA 1WT0A 1H5SB 2W0VA 4K6RA 2FYAA 4Y63A 2V0KA 3ZLKA 3I0CA 2A8UA 2RJ5A 2JCLA 1OQMB 1WT1A 1XHBA 1H5SA 4G87A 1FXJA 1GWWA 4Y6NA 1H5SD 1HJLA 1TW1A 4FREA 1JYKA 3U2WA 4HO2A 3OC9A 1ZJ2A 1NKHB 3IOHA 3I0DA 4MYBA 2XWLA 2X5ZA 3EE5A 5C48A 3SXAA 1LL2A 3JUJA 3D5NA 3RMWA 2Z86A 3U2UA 3D8VA 3OH4A 3QVBA 1I52A 1O7OA 4D0ZA 3CKVA 5C4EA 3N9WA 4BQHA 3DK5A 4B3UA 1VH3A 3E25A 1FOAA 2I5EA 1VH1A 4G3PA 1INJA 1VZTA 5EJZA 1GWVA 4M2AA 4MNDA 3OH0A 2BO4A 2QH5A 2Y4MA 3R2WA 4FRAA 4G3SA 3OAMA 2ZU7A 4HO0A 4FCEA 1QGSA 2AESA 1S4NA 1ZI3A 1ZHJA 2OI6A 4B2WA 1R7UA 4FRQA 4FRPA 2APCA 4KXOA 5L6SA 2X5SA 1WT3A 3OKRA 1S4OA 3CKOA 1MP3A 4FRHA 1MP5A 4B4MA 1FRWA 1H5TB 3I0EA 3U0YA 5L6VA 2RJ7A 5C38A 1ZI4A 3PNNA 1W55A 4ZDQA 1H5TA 2RJ9A 3FOQA 4Y7UA 4P02A 2RIXA 1ZCUA 1MP4A 3Q80A 2Q4JA 2D7RA 1JVDA 3I0LA 1EYRA 1NQIB 1GX4A 1LL0A 1ZCYA 5CMFX 3SXCA 1GQ9A 2WAWA 2ICXA 1G23A 2PGVA 2A8WA 2Y4KA 4ASJA 1E5KA 3OH2A 3ZF8A 1QWJA 1LVWA 3TZTA 4D0TA 2W0WA 2I7BA 3V8ZA 5CMHA 3D98A 4AAWA 2Z87A 5FU0A 1R7TA 1ZJOA 5BXCA 5IDTA 2BO8A 5EIYA 3T7MA 3K8EA 3PKPA 1H7FA 4AYLA 1S4PA 1GA8A 2AE7A 1ZJPA 4Y7GA 1HV9A 3R3IA 4HO4A 1TZFA 2WEEA 2UX8A 4GBPA 2FY7A 3USQA 1WT2A 2OEFA
chains in the Genus database with same CATH superfamily
1GQCA 1LZ0A 2RJ8A 2YQSA 4KPXA 1ZDFA 5AJPA 3Q4SA 3KIAA 4JISA 4KC2A 2AM4A 1MC3A 1LZIA 2YQHA 1H7TA 4HO8A 3SX8A 1ZJ0A 3K8DA 3I0HA 2D7IA 4EEAA 1QGQA 3ZGFA 4B2XA 4Y64A 3I0GA 1ZJ3A 2RJ1A 2VS4A 2AGDA 3ZGGA 1FWYA 1NHEB 2JCJA 3I0FA 4KQLA 5CMIA 5C3DA 4CJBA 3SXDA 5IDSA 4Y62A 1OMZA 1G3LA 5C4FA 1O0RA 1FGGA 1K4VA 2V0JA 4FIXA 4ARWA 1NWGB 2Y4JA 2E3DA 1R81A 2YESA 2ICYA 5C4DA 2WVLA 5CQLX 2XMHA 4IRPA 2VXMA 1OMXA 4DECA 4EVWA 1ON8A 4KRVA 3U2XA 2O1GA 4NANA 1FO8A 1H4EA 1YP4A 2AECA 1NF5B 1ZCVA 2O1FA 3I0JA 1ZCTA 4D11C 1FXOA 1WVCA 4HO9A 1NMMB 1XZ6A 5FTSA 4IRQA 5DDTA 3V0LA 1INIA 2QGIA 3V90A 5AJOA 1LZ7A 2VSIA 3RSBA 5CMGX 4LW6A 2VK9A 5HS2A 2VFZA 2P73A 2BO6A 4NAIA 3USRA 1G9RA 2OI7A 3U0XA 2FYBA 2WVMA 1HM8A 5JQQA 1V84A 4B4BA 3OH3A 3T7OA 2QKXA 4LW3A 2P72A 1PZYB 1FR8A 1HJJA 3V0NA 1ZI1A 3IOJA 4Y7FA 2GGQA 4O6MA 1W77A 1QG8A 2AH9A 2WE9A 3CKJA 3Q7UA 2YC5A 3JTJA 3NGWA 1G0RA 2GGOA 2J0AA 4MIXA 1ZIZA 1W57A 5I1FA 4FROA 4BMAA 4B42A 4DE7A 5CMJA 1H5SC 4Y7TA 2V0IA 1H5RB 2RITA 2V0HA 5CQOA 5FU8A 3DUVA 3SX3A 5C1HA 4P00A 1H5RA 4KC4A 2FFUA 1H7EA 1G97A 3BCVA 2O1HA 1YP2A 3T7NA 3CKNA 1VGWA 4HOCA 2FYCB 1EZIA 4EE5A 2DPWA 4Y9XA 5DDVA 2D0JA 3CU0A 4EEGA 1LZJA 2RJ4A 3PKQA 5C3AA 3SXBA 3BRKX 1FO9A 2MZBA 1TVYA 2RIZA 1H7QA 1JVGA 1GX0A 1R80A 1FGXA 5EJ1A 1PZTA 1R7YA 5AJNA 2PA4A 1JV1A 4G3QA 5CQPA 1G2VA 1IINA 4JD0A 3O3PA 1ZDGA 4EEMA 2CU2A 1G95A 2VS3A 1H3MA 2XWMA 3FWWA 4KNXA 2RJ0A 2FYDB 2Y6PA 3F1YA 1WSZA 1ZI5A 4HO6A 4L41C 2XWNA 3V91A 4ECMA 4B4GA 4EE3A 4FRDA 1VPAA 2V0LA 3JUKA 1H4CA 3SPTA 4ASYA 1V82A 4R7PA 2OI5A 3U2TA 4FCUA 3TQDA 1VZXA 5C36A 5CQNX 3RMVA 1KWSA 4NALA 2WVKA 1LL3A 5C49A 2JCOA 4HO3A 1G1LA 3LW6A 2JCKA 4KC1A 4FRBA 2X60A 4FRMA 1G93A 1HM9A 2VD4A 3CKQA 2I5KA 2PGYA 4HO5A 5C1GA 4KT7A 1VGZA 2RJ6A 4EE4A 3GUEA 2AM3A 4KPZA 3V0QA 2YC3A 1TW5A 1FR9A 4D48A 3DJ4A 5C1LA 3V0OA 3SXEA 1FG5N 1O7QA 2VS5A 1R7VA 5J49A 1FZWA 4KNRA 4DDZA 2OEGA 4Q7CA 4NAKA 5FYEA 4HCQA 3SX7A 2E8BA 2AM5A 2YCMA 2YQJA 4UEGA 3V8YA 4Y6UA 2VSHA 4J18A 4B5BA 4YS8A 3U2VA 1YP3A 3I0KA 2Y7AA 3SX5A 2PX7A 2RIYA 4M2BA 1VZUA 2VXLA 4FRLA 3CGXA 4XWIA 5IFYA 1G8OA 1JV3A 1ON6A 5CQMX 3ST8A 1ZJ1A 1VGUA 1YROB 1R7XA 4O6NA 5C4BA 5C3BA 2Y4LA 2ZU9A 4EEOA 3V0MA 2C0NA 5FTVA 3POLA 1H4DA 3OH1A 2BO7A 4AC3A 4FQWA 1V83A 3F1CA 1Z90A 5C4CA 4CJCA 4AYJA 4D11A 4C2SA 1IIMA 4E1KA 1O23B 2ZU8A 2FFVA 1VM8A 5C47A 4CJ8A 3IOIA 1H7HA 3OGZA 2NXVA 1SS9A 4M4KA 1VICA 2WGZA 1VGTA 3SXGA 1H7GA 3V0PA 1H7LA 1HM0A 2P6WA 1R82A 5C8RA 4HG6A 4CVHA 2YQCA 4Y7VA 2X65A 5FV9A 5FUHA 2J0BA 3I0IX 2XMEA 3HL3A 5D91A 4M28A 3E26A 3ZLLA 1JYLA 1WT0A 1H5SB 2W0VA 4K6RA 2FYAA 4Y63A 2V0KA 3ZLKA 3I0CA 2A8UA 2RJ5A 2JCLA 1OQMB 1WT1A 1XHBA 1H5SA 4G87A 1FXJA 1GWWA 4Y6NA 1H5SD 1HJLA 1TW1A 4FREA 1JYKA 3U2WA 4HO2A 3OC9A 1ZJ2A 1NKHB 3IOHA 3I0DA 4MYBA 2XWLA 2X5ZA 3EE5A 5C48A 3SXAA 1LL2A 3JUJA 3D5NA 3RMWA 2Z86A 3U2UA 3D8VA 3OH4A 5D92A 3QVBA 1I52A 1O7OA 4D0ZA 3CKVA 5C4EA 3N9WA 4BQHA 3DK5A 4B3UA 1VH3A 4FIYA 3E25A 1FOAA 2I5EA 1VH1A 4G3PA 1INJA 1VZTA 5EJZA 1GWVA 4M2AA 4MNDA 3OH0A 2BO4A 2QH5A 2Y4MA 3R2WA 4FRAA 4G3SA 3OAMA 2ZU7A 4HO0A 4FCEA 1QGSA 2AESA 1S4NA 1ZI3A 1ZHJA 2OI6A 4B2WA 1R7UA 4FRQA 4FRPA 2APCA 4KXOA 5L6SA 2X5SA 1WT3A 3OKRA 1S4OA 3CKOA 1MP3A 4FRHA 1MP5A 4B4MA 1FRWA 1H5TB 3I0EA 3U0YA 5L6VA 2RJ7A 5C38A 1ZI4A 3PNNA 1W55A 4ZDQA 1H5TA 2RJ9A 3FOQA 4Y7UA 4P02A 2RIXA 1ZCUA 1MP4A 3Q80A 2Q4JA 2D7RA 1JVDA 3I0LA 1EYRA 1NQIB 1GX4A 1LL0A 1ZCYA 5CMFX 3SXCA 1GQ9A 2WAWA 2ICXA 1G23A 2PGVA 2A8WA 2Y4KA 4ASJA 1E5KA 3OH2A 3ZF8A 1QWJA 1LVWA 3TZTA 4D0TA 2W0WA 2I7BA 3V8ZA 5CMHA 3D98A 4AAWA 2Z87A 5FU0A 1R7TA 1ZJOA 5BXCA 5IDTA 2BO8A 5EIYA 3T7MA 3K8EA 3PKPA 1H7FA 4AYLA 1S4PA 1GA8A 2AE7A 1ZJPA 4Y7GA 1HV9A 3R3IA 4HO4A 1TZFA 2WEEA 2UX8A 4GBPA 2FY7A 3USQA 1WT2A 2OEFA
chains in the Genus database with same CATH topology
1GQCA 1LZ0A 2RJ8A 2YQSA 4KPXA 1ZDFA 5AJPA 3Q4SA 3KIAA 4JISA 4KC2A 2AM4A 1MC3A 1LZIA 2YQHA 1H7TA 4HO8A 3SX8A 1ZJ0A 3K8DA 3I0HA 2D7IA 4EEAA 1QGQA 3ZGFA 4B2XA 4Y64A 3I0GA 1ZJ3A 2RJ1A 2VS4A 2AGDA 3ZGGA 1FWYA 1NHEB 2JCJA 3I0FA 4KQLA 5CMIA 5C3DA 4CJBA 3SXDA 5IDSA 4Y62A 1OMZA 1G3LA 5C4FA 1O0RA 1FGGA 1K4VA 2V0JA 4FIXA 4ARWA 1NWGB 2Y4JA 2E3DA 1R81A 2YESA 2ICYA 5C4DA 2WVLA 5CQLX 2XMHA 4IRPA 2VXMA 1OMXA 4DECA 4EVWA 1ON8A 4KRVA 3U2XA 2O1GA 4NANA 1FO8A 1H4EA 1YP4A 2AECA 1NF5B 1ZCVA 2O1FA 3I0JA 1ZCTA 4D11C 1FXOA 1WVCA 4HO9A 1NMMB 1XZ6A 5FTSA 4IRQA 5DDTA 3V0LA 1INIA 2QGIA 3V90A 5AJOA 1LZ7A 2VSIA 3RSBA 5CMGX 4LW6A 2VK9A 5HS2A 2VFZA 2P73A 2BO6A 4NAIA 3USRA 1G9RA 2OI7A 3U0XA 2FYBA 2WVMA 1HM8A 5JQQA 1V84A 4B4BA 3OH3A 3T7OA 2QKXA 4LW3A 2P72A 1PZYB 1FR8A 1HJJA 3V0NA 1ZI1A 3IOJA 4Y7FA 2GGQA 4O6MA 1W77A 1QG8A 2AH9A 2WE9A 3CKJA 3Q7UA 2YC5A 3JTJA 3NGWA 1G0RA 2GGOA 2J0AA 4MIXA 1ZIZA 1W57A 5I1FA 4FROA 4BMAA 4B42A 4DE7A 5CMJA 1H5SC 4Y7TA 2V0IA 1H5RB 2RITA 2V0HA 5CQOA 5FU8A 3DUVA 3SX3A 5C1HA 4P00A 1H5RA 4KC4A 2FFUA 1H7EA 1G97A 3BCVA 2O1HA 1YP2A 3T7NA 3CKNA 1VGWA 4HOCA 2FYCB 1EZIA 4EE5A 2DPWA 4Y9XA 5DDVA 2D0JA 3CU0A 4EEGA 1LZJA 2RJ4A 3PKQA 5C3AA 3SXBA 3BRKX 1FO9A 2MZBA 1TVYA 2RIZA 1H7QA 1JVGA 1GX0A 1R80A 1FGXA 5EJ1A 1PZTA 1R7YA 5AJNA 2PA4A 1JV1A 4G3QA 5CQPA 1G2VA 1IINA 4JD0A 3O3PA 1ZDGA 4EEMA 2CU2A 1G95A 2VS3A 1H3MA 2XWMA 3FWWA 4KNXA 2RJ0A 2FYDB 2Y6PA 3F1YA 1WSZA 1ZI5A 4HO6A 4L41C 2XWNA 3V91A 4ECMA 4B4GA 4EE3A 4FRDA 1VPAA 2V0LA 3JUKA 1H4CA 3SPTA 4ASYA 1V82A 4R7PA 2OI5A 3U2TA 4FCUA 3TQDA 1VZXA 5C36A 5CQNX 3RMVA 1KWSA 4NALA 2WVKA 1LL3A 5C49A 2JCOA 4HO3A 1G1LA 3LW6A 2JCKA 4KC1A 4FRBA 2X60A 4FRMA 1G93A 1HM9A 2VD4A 3CKQA 2I5KA 2PGYA 4HO5A 5C1GA 4KT7A 1VGZA 2RJ6A 4EE4A 3GUEA 2AM3A 4KPZA 3V0QA 2YC3A 1TW5A 1FR9A 4D48A 3DJ4A 5C1LA 3V0OA 3SXEA 1FG5N 1O7QA 2VS5A 1R7VA 5J49A 1FZWA 4KNRA 4DDZA 2OEGA 4Q7CA 4NAKA 5FYEA 4HCQA 3SX7A 2E8BA 2AM5A 2YCMA 2YQJA 4UEGA 3V8YA 4Y6UA 2VSHA 4J18A 4B5BA 4YS8A 3U2VA 1YP3A 3I0KA 2Y7AA 3SX5A 2PX7A 2RIYA 4M2BA 1VZUA 2VXLA 4FRLA 3CGXA 4XWIA 5IFYA 1G8OA 1JV3A 1ON6A 5CQMX 3ST8A 1ZJ1A 1VGUA 1YROB 1R7XA 4O6NA 5C4BA 5C3BA 2Y4LA 2ZU9A 4EEOA 3V0MA 2C0NA 5FTVA 3POLA 1H4DA 3OH1A 2BO7A 4AC3A 4FQWA 1V83A 3F1CA 1Z90A 5C4CA 4CJCA 4AYJA 4D11A 4C2SA 1IIMA 4E1KA 1O23B 2ZU8A 2FFVA 1VM8A 5C47A 4CJ8A 3IOIA 1H7HA 3OGZA 2NXVA 1SS9A 4M4KA 1VICA 2WGZA 1VGTA 3SXGA 1H7GA 3V0PA 1H7LA 1HM0A 2P6WA 1R82A 5C8RA 4HG6A 4CVHA 2YQCA 4Y7VA 2X65A 5FV9A 5FUHA 2J0BA 3I0IX 2XMEA 3HL3A 5D91A 4M28A 3E26A 3ZLLA 1JYLA 1WT0A 1H5SB 2W0VA 4K6RA 2FYAA 4Y63A 2V0KA 3ZLKA 3I0CA 2A8UA 2RJ5A 2JCLA 1OQMB 1WT1A 1XHBA 1H5SA 4G87A 1FXJA 1GWWA 4Y6NA 1H5SD 1HJLA 1TW1A 4FREA 1JYKA 3U2WA 4HO2A 3OC9A 1ZJ2A 1NKHB 3IOHA 3I0DA 4MYBA 2XWLA 2X5ZA 3EE5A 5C48A 3SXAA 1LL2A 3JUJA 3D5NA 3RMWA 2Z86A 3U2UA 3D8VA 3OH4A 5D92A 3QVBA 1I52A 1O7OA 4D0ZA 3CKVA 5C4EA 3N9WA 4BQHA 3DK5A 4B3UA 1VH3A 4FIYA 3E25A 1FOAA 2I5EA 1VH1A 4G3PA 1INJA 1VZTA 5EJZA 1GWVA 4M2AA 4MNDA 3OH0A 2BO4A 2QH5A 2Y4MA 3R2WA 4FRAA 4G3SA 3OAMA 2ZU7A 4HO0A 4FCEA 1QGSA 2AESA 1S4NA 1ZI3A 1ZHJA 2OI6A 4B2WA 1R7UA 4FRQA 4FRPA 2APCA 4KXOA 5L6SA 2X5SA 1WT3A 3OKRA 1S4OA 3CKOA 1MP3A 4FRHA 1MP5A 4B4MA 1FRWA 1H5TB 3I0EA 3U0YA 5L6VA 2RJ7A 5C38A 1ZI4A 3PNNA 1W55A 4ZDQA 1H5TA 2RJ9A 3FOQA 4Y7UA 4P02A 2RIXA 1ZCUA 1MP4A 3Q80A 2Q4JA 2D7RA 1JVDA 3I0LA 1EYRA 1NQIB 1GX4A 1LL0A 1ZCYA 5CMFX 3SXCA 1GQ9A 2WAWA 2ICXA 1G23A 2PGVA 2A8WA 2Y4KA 4ASJA 1E5KA 3OH2A 3ZF8A 1QWJA 1LVWA 3TZTA 4D0TA 2W0WA 2I7BA 3V8ZA 5CMHA 3D98A 4AAWA 2Z87A 5FU0A 1R7TA 1ZJOA 5BXCA 5IDTA 2BO8A 5EIYA 3T7MA 3K8EA 3PKPA 1H7FA 4AYLA 1S4PA 1GA8A 2AE7A 1ZJPA 4Y7GA 1HV9A 3R3IA 4HO4A 1TZFA 2WEEA 2UX8A 4GBPA 2FY7A 3USQA 1WT2A 2OEFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GQC A;  1LZ0 A;  2RJ8 A;  2YQS A;  4KPX A;  1ZDF A;  5AJP A;  3Q4S A;  3KIA A;  4JIS A;  4KC2 A;  2AM4 A;  1MC3 A;  1LZI A;  2YQH A;  1H7T A;  4HO8 A;  3SX8 A;  1ZJ0 A;  3K8D A;  3I0H A;  2D7I A;  4EEA A;  1QGQ A;  3ZGF A;  4B2X A;  4Y64 A;  3I0G A;  1ZJ3 A;  2RJ1 A;  2VS4 A;  2AGD A;  3ZGG A;  1FWY A;  1NHE B;  2JCJ A;  3I0F A;  4KQL A;  5CMI A;  5C3D A;  4CJB A;  3SXD A;  5IDS A;  4Y62 A;  1OMZ A;  1G3L A;  5C4F A;  1O0R A;  1FGG A;  1K4V A;  2V0J A;  4ARW A;  1NWG B;  2Y4J A;  2E3D A;  1R81 A;  2YES A;  2ICY A;  5C4D A;  2WVL A;  5CQL X;  2XMH A;  4IRP A;  2VXM A;  1OMX A;  4DEC A;  4EVW A;  1ON8 A;  4KRV A;  3U2X A;  2O1G A;  4NAN A;  1FO8 A;  1H4E A;  1YP4 A;  2AEC A;  1NF5 B;  1ZCV A;  2O1F A;  3I0J A;  1ZCT A;  4D11 C;  1FXO A;  1WVC A;  4HO9 A;  1NMM B;  1XZ6 A;  5FTS A;  4IRQ A;  5DDT A;  3V0L A;  1INI A;  2QGI A;  3V90 A;  5AJO A;  1LZ7 A;  2VSI A;  3RSB A;  5CMG X;  4LW6 A;  5HS2 A;  2VFZ A;  2P73 A;  2BO6 A;  4NAI A;  3USR A;  1G9R A;  2OI7 A;  3U0X A;  2FYB A;  2WVM A;  1HM8 A;  5JQQ A;  1V84 A;  4B4B A;  3OH3 A;  3T7O A;  2QKX A;  4LW3 A;  2P72 A;  1PZY B;  1FR8 A;  1HJJ A;  3V0N A;  1ZI1 A;  3IOJ A;  4Y7F A;  2GGQ A;  1W77 A;  1QG8 A;  2AH9 A;  2WE9 A;  3CKJ A;  3Q7U A;  2YC5 A;  3JTJ A;  3NGW A;  1G0R A;  2GGO A;  1ZIZ A;  1W57 A;  5I1F A;  4FRO A;  4BMA A;  4B42 A;  4DE7 A;  5CMJ A;  1H5S C;  4Y7T A;  2V0I A;  1H5R B;  2RIT A;  2V0H A;  5CQO A;  5FU8 A;  3DUV A;  3SX3 A;  5C1H A;  4P00 A;  1H5R A;  4KC4 A;  2FFU A;  1H7E A;  1G97 A;  3BCV A;  2O1H A;  1YP2 A;  3T7N A;  3CKN A;  1VGW A;  4HOC A;  2FYC B;  1EZI A;  4EE5 A;  2DPW A;  4Y9X A;  5DDV A;  2D0J A;  3CU0 A;  4EEG A;  1LZJ A;  2RJ4 A;  3PKQ A;  5C3A A;  3SXB A;  3BRK X;  1FO9 A;  2MZB A;  1TVY A;  2RIZ A;  1H7Q A;  1JVG A;  1GX0 A;  1R80 A;  1FGX A;  5EJ1 A;  1PZT A;  1R7Y A;  5AJN A;  2PA4 A;  1JV1 A;  4G3Q A;  5CQP A;  1G2V A;  1IIN A;  4JD0 A;  3O3P A;  1ZDG A;  4EEM A;  2CU2 A;  1G95 A;  2VS3 A;  1H3M A;  2XWM A;  3FWW A;  4KNX A;  2RJ0 A;  2FYD B;  2Y6P A;  3F1Y A;  1WSZ A;  1ZI5 A;  4HO6 A;  4L41 C;  2XWN A;  3V91 A;  4ECM A;  4B4G A;  4EE3 A;  4FRD A;  1VPA A;  2V0L A;  3JUK A;  1H4C A;  3SPT A;  4ASY A;  1V82 A;  4R7P A;  2OI5 A;  3U2T A;  4FCU A;  3TQD A;  1VZX A;  5C36 A;  5CQN X;  3RMV A;  1KWS A;  4NAL A;  2WVK A;  1LL3 A;  5C49 A;  2JCO A;  4HO3 A;  1G1L A;  3LW6 A;  2JCK A;  4KC1 A;  4FRB A;  2X60 A;  4FRM A;  1G93 A;  1HM9 A;  2VD4 A;  3CKQ A;  2I5K A;  2PGY A;  4HO5 A;  5C1G A;  4KT7 A;  1VGZ A;  2RJ6 A;  4EE4 A;  3GUE A;  2AM3 A;  4KPZ A;  3V0Q A;  2YC3 A;  1TW5 A;  1FR9 A;  4D48 A;  3DJ4 A;  5C1L A;  3V0O A;  3SXE A;  1FG5 N;  1O7Q A;  2VS5 A;  1R7V A;  5J49 A;  1FZW A;  4KNR A;  4DDZ A;  2OEG A;  4NAK A;  5FYE A;  4HCQ A;  3SX7 A;  2E8B A;  2AM5 A;  2YCM A;  2YQJ A;  4UEG A;  3V8Y A;  4Y6U A;  2VSH A;  4J18 A;  4B5B A;  4YS8 A;  3U2V A;  1YP3 A;  3I0K A;  2Y7A A;  3SX5 A;  2PX7 A;  2RIY A;  4M2B A;  1VZU A;  2VXL A;  4FRL A;  3CGX A;  4XWI A;  5IFY A;  1G8O A;  1JV3 A;  1ON6 A;  5CQM X;  3ST8 A;  1ZJ1 A;  1VGU A;  1YRO B;  1R7X A;  5C4B A;  5C3B A;  2Y4L A;  2ZU9 A;  4EEO A;  3V0M A;  5FTV A;  3POL A;  1H4D A;  3OH1 A;  2BO7 A;  4AC3 A;  4FQW A;  1V83 A;  3F1C A;  1Z90 A;  5C4C A;  4CJC A;  4AYJ A;  4D11 A;  4C2S A;  1IIM A;  4E1K A;  1O23 B;  2ZU8 A;  2FFV A;  1VM8 A;  5C47 A;  4CJ8 A;  3IOI A;  1H7H A;  3OGZ A;  2NXV A;  1SS9 A;  4M4K A;  1VIC A;  2WGZ A;  1VGT A;  3SXG A;  1H7G A;  3V0P A;  1H7L A;  1HM0 A;  2P6W A;  1R82 A;  5C8R A;  4HG6 A;  4CVH A;  2YQC A;  4Y7V A;  2X65 A;  5FV9 A;  5FUH A;  3I0I X;  2XME A;  3HL3 A;  4M28 A;  3E26 A;  3ZLL A;  1JYL A;  1WT0 A;  1H5S B;  2W0V A;  4K6R A;  2FYA A;  4Y63 A;  2V0K A;  3ZLK A;  3I0C A;  2A8U A;  2RJ5 A;  2JCL A;  1OQM B;  1WT1 A;  1XHB A;  1H5S A;  4G87 A;  1FXJ A;  1GWW A;  4Y6N A;  1H5S D;  1HJL A;  1TW1 A;  4FRE A;  1JYK A;  3U2W A;  4HO2 A;  3OC9 A;  1ZJ2 A;  1NKH B;  3IOH A;  3I0D A;  4MYB A;  2XWL A;  2X5Z A;  3EE5 A;  5C48 A;  3SXA A;  1LL2 A;  3JUJ A;  3D5N A;  3RMW A;  2Z86 A;  3U2U A;  3D8V A;  3OH4 A;  3QVB A;  1I52 A;  1O7O A;  4D0Z A;  3CKV A;  5C4E A;  3N9W A;  4BQH A;  3DK5 A;  4B3U A;  1VH3 A;  3E25 A;  1FOA A;  2I5E A;  1VH1 A;  4G3P A;  1INJ A;  1VZT A;  5EJZ A;  1GWV A;  4M2A A;  4MND A;  3OH0 A;  2BO4 A;  2QH5 A;  2Y4M A;  3R2W A;  4FRA A;  4G3S A;  3OAM A;  2ZU7 A;  4HO0 A;  4FCE A;  1QGS A;  2AES A;  1S4N A;  1ZI3 A;  1ZHJ A;  2OI6 A;  4B2W A;  1R7U A;  4FRQ A;  4FRP A;  2APC A;  4KXO A;  5L6S A;  2X5S A;  1WT3 A;  3OKR A;  1S4O A;  3CKO A;  1MP3 A;  4FRH A;  1MP5 A;  4B4M A;  1FRW A;  1H5T B;  3I0E A;  3U0Y A;  5L6V A;  2RJ7 A;  5C38 A;  1ZI4 A;  3PNN A;  1W55 A;  4ZDQ A;  1H5T A;  2RJ9 A;  3FOQ A;  4Y7U A;  4P02 A;  2RIX A;  1ZCU A;  1MP4 A;  3Q80 A;  2Q4J A;  2D7R A;  1JVD A;  3I0L A;  1EYR A;  1NQI B;  1GX4 A;  1LL0 A;  1ZCY A;  5CMF X;  3SXC A;  1GQ9 A;  2WAW A;  2ICX A;  1G23 A;  2PGV A;  2A8W A;  2Y4K A;  4ASJ A;  1E5K A;  3OH2 A;  3ZF8 A;  1QWJ A;  1LVW A;  3TZT A;  4D0T A;  2W0W A;  2I7B A;  3V8Z A;  5CMH A;  3D98 A;  4AAW A;  2Z87 A;  5FU0 A;  1R7T A;  1ZJO A;  5BXC A;  5IDT A;  2BO8 A;  5EIY A;  3T7M A;  3K8E A;  3PKP A;  1H7F A;  4AYL A;  1S4P A;  1GA8 A;  2AE7 A;  1ZJP A;  4Y7G A;  1HV9 A;  3R3I A;  4HO4 A;  1TZF A;  2WEE A;  2UX8 A;  4GBP A;  2FY7 A;  3USQ A;  1WT2 A;  2OEF A; 
#chains in the Genus database with same CATH topology
 1GQC A;  1LZ0 A;  2RJ8 A;  2YQS A;  4KPX A;  1ZDF A;  5AJP A;  3Q4S A;  3KIA A;  4JIS A;  4KC2 A;  2AM4 A;  1MC3 A;  1LZI A;  2YQH A;  1H7T A;  4HO8 A;  3SX8 A;  1ZJ0 A;  3K8D A;  3I0H A;  2D7I A;  4EEA A;  1QGQ A;  3ZGF A;  4B2X A;  4Y64 A;  3I0G A;  1ZJ3 A;  2RJ1 A;  2VS4 A;  2AGD A;  3ZGG A;  1FWY A;  1NHE B;  2JCJ A;  3I0F A;  4KQL A;  5CMI A;  5C3D A;  4CJB A;  3SXD A;  5IDS A;  4Y62 A;  1OMZ A;  1G3L A;  5C4F A;  1O0R A;  1FGG A;  1K4V A;  2V0J A;  4FIX A;  4ARW A;  1NWG B;  2Y4J A;  2E3D A;  1R81 A;  2YES A;  2ICY A;  5C4D A;  2WVL A;  5CQL X;  2XMH A;  4IRP A;  2VXM A;  1OMX A;  4DEC A;  4EVW A;  1ON8 A;  4KRV A;  3U2X A;  2O1G A;  4NAN A;  1FO8 A;  1H4E A;  1YP4 A;  2AEC A;  1NF5 B;  1ZCV A;  2O1F A;  3I0J A;  1ZCT A;  4D11 C;  1FXO A;  1WVC A;  4HO9 A;  1NMM B;  1XZ6 A;  5FTS A;  4IRQ A;  5DDT A;  3V0L A;  1INI A;  2QGI A;  3V90 A;  5AJO A;  1LZ7 A;  2VSI A;  3RSB A;  5CMG X;  4LW6 A;  2VK9 A;  5HS2 A;  2VFZ A;  2P73 A;  2BO6 A;  4NAI A;  3USR A;  1G9R A;  2OI7 A;  3U0X A;  2FYB A;  2WVM A;  1HM8 A;  5JQQ A;  1V84 A;  4B4B A;  3OH3 A;  3T7O A;  2QKX A;  4LW3 A;  2P72 A;  1PZY B;  1FR8 A;  1HJJ A;  3V0N A;  1ZI1 A;  3IOJ A;  4Y7F A;  2GGQ A;  4O6M A;  1W77 A;  1QG8 A;  2AH9 A;  2WE9 A;  3CKJ A;  3Q7U A;  2YC5 A;  3JTJ A;  3NGW A;  1G0R A;  2GGO A;  2J0A A;  4MIX A;  1ZIZ A;  1W57 A;  5I1F A;  4FRO A;  4BMA A;  4B42 A;  4DE7 A;  5CMJ A;  1H5S C;  4Y7T A;  2V0I A;  1H5R B;  2RIT A;  2V0H A;  5CQO A;  5FU8 A;  3DUV A;  3SX3 A;  5C1H A;  4P00 A;  1H5R A;  4KC4 A;  2FFU A;  1H7E A;  1G97 A;  3BCV A;  2O1H A;  1YP2 A;  3T7N A;  3CKN A;  1VGW A;  4HOC A;  2FYC B;  1EZI A;  4EE5 A;  2DPW A;  4Y9X A;  5DDV A;  2D0J A;  3CU0 A;  4EEG A;  1LZJ A;  2RJ4 A;  3PKQ A;  5C3A A;  3SXB A;  3BRK X;  1FO9 A;  2MZB A;  1TVY A;  2RIZ A;  1H7Q A;  1JVG A;  1GX0 A;  1R80 A;  1FGX A;  5EJ1 A;  1PZT A;  1R7Y A;  5AJN A;  2PA4 A;  1JV1 A;  4G3Q A;  5CQP A;  1G2V A;  1IIN A;  4JD0 A;  3O3P A;  1ZDG A;  4EEM A;  2CU2 A;  1G95 A;  2VS3 A;  1H3M A;  2XWM A;  3FWW A;  4KNX A;  2RJ0 A;  2FYD B;  2Y6P A;  3F1Y A;  1WSZ A;  1ZI5 A;  4HO6 A;  4L41 C;  2XWN A;  3V91 A;  4ECM A;  4B4G A;  4EE3 A;  4FRD A;  1VPA A;  2V0L A;  3JUK A;  1H4C A;  3SPT A;  4ASY A;  1V82 A;  4R7P A;  2OI5 A;  3U2T A;  4FCU A;  3TQD A;  1VZX A;  5C36 A;  5CQN X;  3RMV A;  1KWS A;  4NAL A;  2WVK A;  1LL3 A;  5C49 A;  2JCO A;  4HO3 A;  1G1L A;  3LW6 A;  2JCK A;  4KC1 A;  4FRB A;  2X60 A;  4FRM A;  1G93 A;  1HM9 A;  2VD4 A;  3CKQ A;  2I5K A;  2PGY A;  4HO5 A;  5C1G A;  4KT7 A;  1VGZ A;  2RJ6 A;  4EE4 A;  3GUE A;  2AM3 A;  4KPZ A;  3V0Q A;  2YC3 A;  1TW5 A;  1FR9 A;  4D48 A;  3DJ4 A;  5C1L A;  3V0O A;  3SXE A;  1FG5 N;  1O7Q A;  2VS5 A;  1R7V A;  5J49 A;  1FZW A;  4KNR A;  4DDZ A;  2OEG A;  4Q7C A;  4NAK A;  5FYE A;  4HCQ A;  3SX7 A;  2E8B A;  2AM5 A;  2YCM A;  2YQJ A;  4UEG A;  3V8Y A;  4Y6U A;  2VSH A;  4J18 A;  4B5B A;  4YS8 A;  3U2V A;  1YP3 A;  3I0K A;  2Y7A A;  3SX5 A;  2PX7 A;  2RIY A;  4M2B A;  1VZU A;  2VXL A;  4FRL A;  3CGX A;  4XWI A;  5IFY A;  1G8O A;  1JV3 A;  1ON6 A;  5CQM X;  3ST8 A;  1ZJ1 A;  1VGU A;  1YRO B;  1R7X A;  4O6N A;  5C4B A;  5C3B A;  2Y4L A;  2ZU9 A;  4EEO A;  3V0M A;  2C0N A;  5FTV A;  3POL A;  1H4D A;  3OH1 A;  2BO7 A;  4AC3 A;  4FQW A;  1V83 A;  3F1C A;  1Z90 A;  5C4C A;  4CJC A;  4AYJ A;  4D11 A;  4C2S A;  1IIM A;  4E1K A;  1O23 B;  2ZU8 A;  2FFV A;  1VM8 A;  5C47 A;  4CJ8 A;  3IOI A;  1H7H A;  3OGZ A;  2NXV A;  1SS9 A;  4M4K A;  1VIC A;  2WGZ A;  1VGT A;  3SXG A;  1H7G A;  3V0P A;  1H7L A;  1HM0 A;  2P6W A;  1R82 A;  5C8R A;  4HG6 A;  4CVH A;  2YQC A;  4Y7V A;  2X65 A;  5FV9 A;  5FUH A;  2J0B A;  3I0I X;  2XME A;  3HL3 A;  5D91 A;  4M28 A;  3E26 A;  3ZLL A;  1JYL A;  1WT0 A;  1H5S B;  2W0V A;  4K6R A;  2FYA A;  4Y63 A;  2V0K A;  3ZLK A;  3I0C A;  2A8U A;  2RJ5 A;  2JCL A;  1OQM B;  1WT1 A;  1XHB A;  1H5S A;  4G87 A;  1FXJ A;  1GWW A;  4Y6N A;  1H5S D;  1HJL A;  1TW1 A;  4FRE A;  1JYK A;  3U2W A;  4HO2 A;  3OC9 A;  1ZJ2 A;  1NKH B;  3IOH A;  3I0D A;  4MYB A;  2XWL A;  2X5Z A;  3EE5 A;  5C48 A;  3SXA A;  1LL2 A;  3JUJ A;  3D5N A;  3RMW A;  2Z86 A;  3U2U A;  3D8V A;  3OH4 A;  5D92 A;  3QVB A;  1I52 A;  1O7O A;  4D0Z A;  3CKV A;  5C4E A;  3N9W A;  4BQH A;  3DK5 A;  4B3U A;  1VH3 A;  4FIY A;  3E25 A;  1FOA A;  2I5E A;  1VH1 A;  4G3P A;  1INJ A;  1VZT A;  5EJZ A;  1GWV A;  4M2A A;  4MND A;  3OH0 A;  2BO4 A;  2QH5 A;  2Y4M A;  3R2W A;  4FRA A;  4G3S A;  3OAM A;  2ZU7 A;  4HO0 A;  4FCE A;  1QGS A;  2AES A;  1S4N A;  1ZI3 A;  1ZHJ A;  2OI6 A;  4B2W A;  1R7U A;  4FRQ A;  4FRP A;  2APC A;  4KXO A;  5L6S A;  2X5S A;  1WT3 A;  3OKR A;  1S4O A;  3CKO A;  1MP3 A;  4FRH A;  1MP5 A;  4B4M A;  1FRW A;  1H5T B;  3I0E A;  3U0Y A;  5L6V A;  2RJ7 A;  5C38 A;  1ZI4 A;  3PNN A;  1W55 A;  4ZDQ A;  1H5T A;  2RJ9 A;  3FOQ A;  4Y7U A;  4P02 A;  2RIX A;  1ZCU A;  1MP4 A;  3Q80 A;  2Q4J A;  2D7R A;  1JVD A;  3I0L A;  1EYR A;  1NQI B;  1GX4 A;  1LL0 A;  1ZCY A;  5CMF X;  3SXC A;  1GQ9 A;  2WAW A;  2ICX A;  1G23 A;  2PGV A;  2A8W A;  2Y4K A;  4ASJ A;  1E5K A;  3OH2 A;  3ZF8 A;  1QWJ A;  1LVW A;  3TZT A;  4D0T A;  2W0W A;  2I7B A;  3V8Z A;  5CMH A;  3D98 A;  4AAW A;  2Z87 A;  5FU0 A;  1R7T A;  1ZJO A;  5BXC A;  5IDT A;  2BO8 A;  5EIY A;  3T7M A;  3K8E A;  3PKP A;  1H7F A;  4AYL A;  1S4P A;  1GA8 A;  2AE7 A;  1ZJP A;  4Y7G A;  1HV9 A;  3R3I A;  4HO4 A;  1TZF A;  2WEE A;  2UX8 A;  4GBP A;  2FY7 A;  3USQ A;  1WT2 A;  2OEF A; 
#chains in the Genus database with same CATH homology
 1GQC A;  1LZ0 A;  2RJ8 A;  2YQS A;  4KPX A;  1ZDF A;  5AJP A;  3Q4S A;  3KIA A;  4JIS A;  4KC2 A;  2AM4 A;  1MC3 A;  1LZI A;  2YQH A;  1H7T A;  4HO8 A;  3SX8 A;  1ZJ0 A;  3K8D A;  3I0H A;  2D7I A;  4EEA A;  1QGQ A;  3ZGF A;  4B2X A;  4Y64 A;  3I0G A;  1ZJ3 A;  2RJ1 A;  2VS4 A;  2AGD A;  3ZGG A;  1FWY A;  1NHE B;  2JCJ A;  3I0F A;  4KQL A;  5CMI A;  5C3D A;  4CJB A;  3SXD A;  5IDS A;  4Y62 A;  1OMZ A;  1G3L A;  5C4F A;  1O0R A;  1FGG A;  1K4V A;  2V0J A;  4FIX A;  4ARW A;  1NWG B;  2Y4J A;  2E3D A;  1R81 A;  2YES A;  2ICY A;  5C4D A;  2WVL A;  5CQL X;  2XMH A;  4IRP A;  2VXM A;  1OMX A;  4DEC A;  4EVW A;  1ON8 A;  4KRV A;  3U2X A;  2O1G A;  4NAN A;  1FO8 A;  1H4E A;  1YP4 A;  2AEC A;  1NF5 B;  1ZCV A;  2O1F A;  3I0J A;  1ZCT A;  4D11 C;  1FXO A;  1WVC A;  4HO9 A;  1NMM B;  1XZ6 A;  5FTS A;  4IRQ A;  5DDT A;  3V0L A;  1INI A;  2QGI A;  3V90 A;  5AJO A;  1LZ7 A;  2VSI A;  3RSB A;  5CMG X;  4LW6 A;  2VK9 A;  5HS2 A;  2VFZ A;  2P73 A;  2BO6 A;  4NAI A;  3USR A;  1G9R A;  2OI7 A;  3U0X A;  2FYB A;  2WVM A;  1HM8 A;  5JQQ A;  1V84 A;  4B4B A;  3OH3 A;  3T7O A;  2QKX A;  4LW3 A;  2P72 A;  1PZY B;  1FR8 A;  1HJJ A;  3V0N A;  1ZI1 A;  3IOJ A;  4Y7F A;  2GGQ A;  4O6M A;  1W77 A;  1QG8 A;  2AH9 A;  2WE9 A;  3CKJ A;  3Q7U A;  2YC5 A;  3JTJ A;  3NGW A;  1G0R A;  2GGO A;  2J0A A;  4MIX A;  1ZIZ A;  1W57 A;  5I1F A;  4FRO A;  4BMA A;  4B42 A;  4DE7 A;  5CMJ A;  1H5S C;  4Y7T A;  2V0I A;  1H5R B;  2RIT A;  2V0H A;  5CQO A;  5FU8 A;  3DUV A;  3SX3 A;  5C1H A;  4P00 A;  1H5R A;  4KC4 A;  2FFU A;  1H7E A;  1G97 A;  3BCV A;  2O1H A;  1YP2 A;  3T7N A;  3CKN A;  1VGW A;  4HOC A;  2FYC B;  1EZI A;  4EE5 A;  2DPW A;  4Y9X A;  5DDV A;  2D0J A;  3CU0 A;  4EEG A;  1LZJ A;  2RJ4 A;  3PKQ A;  5C3A A;  3SXB A;  3BRK X;  1FO9 A;  2MZB A;  1TVY A;  2RIZ A;  1H7Q A;  1JVG A;  1GX0 A;  1R80 A;  1FGX A;  5EJ1 A;  1PZT A;  1R7Y A;  5AJN A;  2PA4 A;  1JV1 A;  4G3Q A;  5CQP A;  1G2V A;  1IIN A;  4JD0 A;  3O3P A;  1ZDG A;  4EEM A;  2CU2 A;  1G95 A;  2VS3 A;  1H3M A;  2XWM A;  3FWW A;  4KNX A;  2RJ0 A;  2FYD B;  2Y6P A;  3F1Y A;  1WSZ A;  1ZI5 A;  4HO6 A;  4L41 C;  2XWN A;  3V91 A;  4ECM A;  4B4G A;  4EE3 A;  4FRD A;  1VPA A;  2V0L A;  3JUK A;  1H4C A;  3SPT A;  4ASY A;  1V82 A;  4R7P A;  2OI5 A;  3U2T A;  4FCU A;  3TQD A;  1VZX A;  5C36 A;  5CQN X;  3RMV A;  1KWS A;  4NAL A;  2WVK A;  1LL3 A;  5C49 A;  2JCO A;  4HO3 A;  1G1L A;  3LW6 A;  2JCK A;  4KC1 A;  4FRB A;  2X60 A;  4FRM A;  1G93 A;  1HM9 A;  2VD4 A;  3CKQ A;  2I5K A;  2PGY A;  4HO5 A;  5C1G A;  4KT7 A;  1VGZ A;  2RJ6 A;  4EE4 A;  3GUE A;  2AM3 A;  4KPZ A;  3V0Q A;  2YC3 A;  1TW5 A;  1FR9 A;  4D48 A;  3DJ4 A;  5C1L A;  3V0O A;  3SXE A;  1FG5 N;  1O7Q A;  2VS5 A;  1R7V A;  5J49 A;  1FZW A;  4KNR A;  4DDZ A;  2OEG A;  4Q7C A;  4NAK A;  5FYE A;  4HCQ A;  3SX7 A;  2E8B A;  2AM5 A;  2YCM A;  2YQJ A;  4UEG A;  3V8Y A;  4Y6U A;  2VSH A;  4J18 A;  4B5B A;  4YS8 A;  3U2V A;  1YP3 A;  3I0K A;  2Y7A A;  3SX5 A;  2PX7 A;  2RIY A;  4M2B A;  1VZU A;  2VXL A;  4FRL A;  3CGX A;  4XWI A;  5IFY A;  1G8O A;  1JV3 A;  1ON6 A;  5CQM X;  3ST8 A;  1ZJ1 A;  1VGU A;  1YRO B;  1R7X A;  4O6N A;  5C4B A;  5C3B A;  2Y4L A;  2ZU9 A;  4EEO A;  3V0M A;  2C0N A;  5FTV A;  3POL A;  1H4D A;  3OH1 A;  2BO7 A;  4AC3 A;  4FQW A;  1V83 A;  3F1C A;  1Z90 A;  5C4C A;  4CJC A;  4AYJ A;  4D11 A;  4C2S A;  1IIM A;  4E1K A;  1O23 B;  2ZU8 A;  2FFV A;  1VM8 A;  5C47 A;  4CJ8 A;  3IOI A;  1H7H A;  3OGZ A;  2NXV A;  1SS9 A;  4M4K A;  1VIC A;  2WGZ A;  1VGT A;  3SXG A;  1H7G A;  3V0P A;  1H7L A;  1HM0 A;  2P6W A;  1R82 A;  5C8R A;  4HG6 A;  4CVH A;  2YQC A;  4Y7V A;  2X65 A;  5FV9 A;  5FUH A;  2J0B A;  3I0I X;  2XME A;  3HL3 A;  5D91 A;  4M28 A;  3E26 A;  3ZLL A;  1JYL A;  1WT0 A;  1H5S B;  2W0V A;  4K6R A;  2FYA A;  4Y63 A;  2V0K A;  3ZLK A;  3I0C A;  2A8U A;  2RJ5 A;  2JCL A;  1OQM B;  1WT1 A;  1XHB A;  1H5S A;  4G87 A;  1FXJ A;  1GWW A;  4Y6N A;  1H5S D;  1HJL A;  1TW1 A;  4FRE A;  1JYK A;  3U2W A;  4HO2 A;  3OC9 A;  1ZJ2 A;  1NKH B;  3IOH A;  3I0D A;  4MYB A;  2XWL A;  2X5Z A;  3EE5 A;  5C48 A;  3SXA A;  1LL2 A;  3JUJ A;  3D5N A;  3RMW A;  2Z86 A;  3U2U A;  3D8V A;  3OH4 A;  5D92 A;  3QVB A;  1I52 A;  1O7O A;  4D0Z A;  3CKV A;  5C4E A;  3N9W A;  4BQH A;  3DK5 A;  4B3U A;  1VH3 A;  4FIY A;  3E25 A;  1FOA A;  2I5E A;  1VH1 A;  4G3P A;  1INJ A;  1VZT A;  5EJZ A;  1GWV A;  4M2A A;  4MND A;  3OH0 A;  2BO4 A;  2QH5 A;  2Y4M A;  3R2W A;  4FRA A;  4G3S A;  3OAM A;  2ZU7 A;  4HO0 A;  4FCE A;  1QGS A;  2AES A;  1S4N A;  1ZI3 A;  1ZHJ A;  2OI6 A;  4B2W A;  1R7U A;  4FRQ A;  4FRP A;  2APC A;  4KXO A;  5L6S A;  2X5S A;  1WT3 A;  3OKR A;  1S4O A;  3CKO A;  1MP3 A;  4FRH A;  1MP5 A;  4B4M A;  1FRW A;  1H5T B;  3I0E A;  3U0Y A;  5L6V A;  2RJ7 A;  5C38 A;  1ZI4 A;  3PNN A;  1W55 A;  4ZDQ A;  1H5T A;  2RJ9 A;  3FOQ A;  4Y7U A;  4P02 A;  2RIX A;  1ZCU A;  1MP4 A;  3Q80 A;  2Q4J A;  2D7R A;  1JVD A;  3I0L A;  1EYR A;  1NQI B;  1GX4 A;  1LL0 A;  1ZCY A;  5CMF X;  3SXC A;  1GQ9 A;  2WAW A;  2ICX A;  1G23 A;  2PGV A;  2A8W A;  2Y4K A;  4ASJ A;  1E5K A;  3OH2 A;  3ZF8 A;  1QWJ A;  1LVW A;  3TZT A;  4D0T A;  2W0W A;  2I7B A;  3V8Z A;  5CMH A;  3D98 A;  4AAW A;  2Z87 A;  5FU0 A;  1R7T A;  1ZJO A;  5BXC A;  5IDT A;  2BO8 A;  5EIY A;  3T7M A;  3K8E A;  3PKP A;  1H7F A;  4AYL A;  1S4P A;  1GA8 A;  2AE7 A;  1ZJP A;  4Y7G A;  1HV9 A;  3R3I A;  4HO4 A;  1TZF A;  2WEE A;  2UX8 A;  4GBP A;  2FY7 A;  3USQ A;  1WT2 A;  2OEF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...