2JCSA

Active site mutant of dnk from d. melanogaster with dttp bound
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
198
structure length
198
Chain Sequence
b'TKYAEGTQPFTVLIEGNIGSGKTTYLNHFEKYKNDICLLTDPVEKWRNVNGVNLLELMYKDPKKWAMPFQSYVTLTMLQSHTAPTNKKLKIMERSIFSARYCFVENMRRNGSLEQGMYNTLEEWYKFIEESIHVQADLIIYLRTSPEVAYERIRQRARSEESCVPLKYLQELHELHEDWLIHQRRPQSCKVLVLDADL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DEOXYNUCLEOSIDE KINASE
publication title Functional Studies of Active-Site Mutants from Drosophila Melanogaster Deoxyribonucleoside Kinase. Investigations of the Putative Catalytic Glutamate- Arginine Pair and of Residues Responsible for Substrate Specificity.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transferase
total genus 75
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature ec 2.7.1.145: Deoxynucleoside kinase.
pdb deposition date 2007-01-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2jcsA00
1JR3D 4POAA 1E96A 1E9SA 1XD2B 4JL8A 2BBWA 2A7QA 3QXJA 5EJEA 2VBCA 2YHSA 4BLOA 3F5FA 4ZI3A 4MA4A 3EC1A 4KBFA 4NCHA 4UXHA 5TARA 2RGEA 3REGA 4DUGD 5K8IA 1WB9A 1Z6AA 3K70B 1D2MA 1MRSA 2BEKA 1Y63A 2QORA 4QBFA 2J87A 2C8VA 1IOZA 3NIBA 5DI3A 4UKDA 1VYTA 2ZE6A 4C0JA 3RC8A 1QRAA 4FCVA 1HTWA 5AJWA 3K0FB 1XEWY 4LHYA 3LV8A 1F60A 2CLSA 3QENA 4M1SA 4ASUD 4JSTA 3SJZA 1E2MA 2ONJA 1TF2A 4D82A 4S2EA 1EWRA 4KV9A 1R7RA 1M34E 4OK6A 3DM5A 4TLDA 4XWKA 3UG7A 1ZINA 4KAXA 4B75A 2V8OA 3EW9A 5GJVC 1NSFA 4C7OB 1XTIA 4D0GA 2J0UA 1M7BA 2OLKA 3OIVA 4KODA 3K70C 3RWOA 3E5HA 2AFIE 1E9EA 3B9QA 1CR4A 1NRJB 2BCJQ 4TT3A 4B2IA 3CM0A 1UJ2A 1KSGA 4IOLA 2GDJA 3U4QB 3FMPB 1E4VA 3NEJA 2FPKA 1G4AE 3THXB 2GXAA 3D6TB 3CO5A 3EZ2A 3RS5A 2GEUA 1YVDA 4TMVA 3CRMA 1W4AA 1PJRA 5FPHA 4PHFA 2A5YB 4YLGA 4KLZA 1IN6A 1NL3A 3P20A 4AWXA 3SYNA 2Q9CA 3FHOA 4ZIRB 5DYIA 2XXAB 1KO7A 4PZYA 1VTKA 3QY0A 1XTKA 3K9GA 2HT1A 1KMHA 1AN0A 1KO4A 3A1VA 3OE7D 3SE0A 1BOFA 4NYIQ 3AVXA 1ZNXA 4QM6A 2DCUA 2VP4A 1TQ2A 1IHUA 3SYKA 1G64A 1XZPA 4B47A 5M04A 2P65A 2XB4A 4KLNA 2AKAB 3VFDA 5G40A 3SR0A 3AVYA 2GCPA 4B44A 2QPTA 1OXVA 3EXAA 1Z0JA 3MWYW 5DGXA 1K5DA 1KKMA 4Q7LA 4R2IA 5JBQA 2FEMA 1PLKA 3OHMA 5AJVB 1KK1A 3WHLA 3NC0C 4MUBA 1E0SA 1Z29A 1KI8A 3K09A 3RC3A 3X1YA 3GLFB 2JLXA 5KSOA 2ZUCA 3FHTA 2KWIA 1KAGA 3HPRA 4MYUA 4JKIA 1VG1A 4IRUB 4KCGA 5C4MA 3NHAA 1ZNZA 1U2RA 5BWMA 1XXHA 1NMXA 2FFBA 1YR6A 2C9OA 1GFIA 4DDVA 1LTQA 3W5IA 1N25A 2LWIA 4ACBA 2DWPA 4Q1AA 2PX3A 5C18A 3EWAA 3OIUA 4US1R 1DAFA 4GRAA 3KQHA 3UIEA 4OQFA 2IHBA 4OHXA 3U6BA 4LBWA 1TQ4A 1DAHA 1KO8A 1L4YA 2ZETA 4B35A 1QF9A 3U3MA 1JAIA 2IYQA 4LC0A 3LXRA 2BV3A 4CF7A 1FOEB 3ZVNA 4UNNA 3GFTA 2ZYTX 5CB6A 2MMCA 4DXAA 4XWOA 1C1YA 4GOKA 5DHFA 2F6RA 3GJ8A 3LAWA 3TW4A 1NMYA 3CF2A 1RJ9A 3JZMA 4YDSA 2KSQA 3A36A 4QFMA 1SKYE 3DMDA 4DSNA 1OXUA 4QBIA 5FI1B 1P3JA 4D81A 4XTRA 3OF5A 4LOAA 3CNLA 1ZD9A 3U6KA 4Q1EA 2NZJA 2QY9A 4I1OA 1CRQA 4PO1A 1HE1C 2G1JA 4HDQB 3GLIB 1UKZA 2GHIA 5KDLA 3LVQE 4P4UA 2C04A 2C96A 3LVRE 1GUAA 2HXYA 3T35A 5FTMA 2KE5A 1AS3A 3HJNA 4XJXA 2I3BA 4PAQA 5E7IA 1S1MA 2J5XA 3D7MA 3TQFA 2RGBA 4LJ4A 4V0ME 2ZJBA 4JLPA 3RDPA 2IHYA 3M1IA 5EXPA 4AY2A 1YRAA 1E2PA 1QHIA 4DDUA 5JECA 3SQWA 4NE2A 5FL7D 2DHRA 1FX0B 1BIFA 3WMGA 3K9NA 4W5HA 1EFHA 1EX6A 5CM9C 4Q4HA 2XZPA 3SI7A 3VU9B 3F3YA 5H70A 3WY9A 1ZC3A 4L9WA 3EIEA 4Y0AA 1YJ5A 3X1ZA 4AKGA 3EPKA 4MKHA 1SVSA 4G5QA 3U60B 2JJ8A 3FWYA 1ZM2A 4MRPA 3GD7A 1YR7A 4OI4A 3BB4A 4D4KA 2QROA 2PMKA 1I2DA 3KKOA 5FFMA 2DBYA 5L3VA 1OFHA 5JCPA 2AL7A 4NH0A 3T61A 3RRYA 2ZE7A 5EE5B 4F4CA 1HA3A 1HT2E 2TMKA 2QAGA 3K8YA 1ZIOA 3FFBA 4XSHA 1QVAA 3OEHA 2W2VA 2QSYA 4RFVA 4A0RA 1GITA 5GADl 1A1VA 3SJAA 4DZZA 4A2QA 1Z2CA 4JSYA 4Q18A 1WQ1R 3AH8A 3R9XA 1GZSA 4ZKEA 1F2TA 3PQCA 5B2ZA 8OHMA 2GBLC 1GDDA 1OFTA 1XMJA 2EW1A 3ZIAD 1VG9B 4ZDWA 4GNKA 2OBNA 1N6LA 5FOVA 3GLHB 3FMOB 3UK6A 3IEUA 1ZIPA 2QRNA 2YWFA 1XX6A 1N6PA 1U8ZA 1FW6A 4BLSA 1XEXB 1G3RA 4PHTA 2FU5C 3KB1A 5SZJA 4A0FA 3EX7C 3CR7A 1W46A 2V4ZA 3T12A 3CNNA 2GZHA 3AB3A 1U9IA 4MH0R 2DFTA 2G83A 5JEDA 4LWZA 1V43A 3CH4B 4HLUA 1COWD 2H7VA 4IEIA 5SZIA 4Q7JB 3ZGXA 4D4MA 3U5ZB 1OE0A 2VSFA 3ZS9A 2I1QA 4RJLA 4KSCA 3GJ0A 4TTPA 5IT5A 3FMFA 2RB4A 1TL7C 1EFRD 5SZHB 3QKRA 2KBEA 1TPZA 4PHGA 1GRRA 3VAAA 2ZAOA 3ZIAA 3RS7A 1F5NA 3AGQA 2B8TA 3SJCA 4BECA 2DFLA 2VA8A 1SGWA 3AP2A 2F55A 4I1UA 1QBKC 3FYHA 3MWJA 1Q1QA 1JR6A 3L8YA 2Q9BA 2ZR7A 4LI0A 5EZ5A 3HYTA 4JVNA 2ANBA 1XPRA 3P1JA 4FCWA 5L3RA 1Z47A 2J0QA 1H8ED 5KTYA 1T8TA 3BOSA 2QP9X 2WBLC 4TZ6A 1U0HC 3FKSD 4Q4AB 2CHQA 2D62A 2GVZC 4L15A 2C78A 4HAXA 5J4VA 1US8B 3GEIA 5EUMA 3A1UA 3FTQA 4TL6A 2X2FA 1MRNA 2AWNA 4RZ3A 5TB5A 1ZYUA 4KU4A 4UJ5A 3KQUA 1BMFD 2QI9C 1BH2A 2AD5A 4ARZA 1E79D 1N6KA 4O3MA 4A15A 4YQFA 1L8QA 4BASA 1DE0A 1AGPA 4LYHA 2D74A 4JMPA 1SXJA 3BRWD 2AWOA 4DT1B 3AKDA 1TEVA 3TR0A 4H1UA 3ICEA 4B3FX 2Z83A 5JCZA 2AD1A 1G5PA 4MYTA 1OJLA 1XXHE 2JIZA 4F93B 3T5DA 3ASZA 2WJYA 4LV5B 2UZ3A 1KNXA 3KJEA 2ZRKA 4PANA 5IDVA 5KOYA 1Z0FA 2CE7A 3I5YA 2WOJA 3EASA 3QKSB 1UEJA 1FUKA 1DO2A 1SHZA 3KJGA 5EE1A 4EPRA 2IC5A 1QVRA 4P31A 1CJKC 4B33A 4YMWA 1J70A 4JVSB 4LBZA 3KKPA 3I8XA 4QNRA 5DI3B 1X86B 1GP2A 4EQ6B 3CPHA 3QPVA 2P6RA 2O5VA 2JLWA 3Q85A 3PCRB 2IYWA 2VF8A 1AQYA 2O8EA 4QJ3A 5BYJA 4NTZA 2W0SA 5A5GA 4RD3A 4D25A 2AKYA 2WWXA 3BK7A 1E79A 2WWGA 2YVUA 4JIMA 2AHOA 1ETUA 5DLQC 1R0WA 1JJVA 3B13B 1NSTA 1EX7A 2IXEA 2JCSA 3DZ8A 3W8NA 4KITB 2FEOA 1JNYA 3HWSA 1N5JA 1R8SA 2QSZA 3A1TA 3CX6A 3K9LA 3P4XA 4QXAA 1GNQA 2ZR9A 4F92B 2CHVA 2RCNA 4RZXA 1P60A 2ZYVX 3Q72A 2R6DA 5A4JA 4G01B 4IDQA 2ZYWX 1XFAA 2F9MA 4BFUA 5E3HA 2CCGA 4WIAA 1QHYA 1K6MA 3CH5A 4BGDA 2YWHA 4HAYA 3R7WB 2XNDA 1RYFA 4JYCA 1X6VA 1ZD1A 4BQSA 4CW7A 4X8MA 4FWIB 3LNCA 1N0VC 5JS7A 4NHOA 2CBZA 5CYOA 5FUYA 3A4MA 3HDTA 2YYZA 1DTSA 2J7KA 1GKYA 2N42A 1MABB 4AI6A 1NN3A 3OFND 1IONA 2ZRJA 2ZR0A 2QU8A 2HYIC 2WV9A 2ECKA 2O8CA 1ZCAA 2FSHA 1QHHB 4MKFA 1E1RD 3UATA 4D4LA 4M4SA 4TMKA 3V4FA 4A8JA 1KMHB 2IA5A 3B8HA 2ZVQX 1II8A 1SULA 1DARA 4P4SA 4PC2A 3K53A 4DLZA 4C0SA 1G3IA 2FV8A 4LZZA 2CJWA 2HYDA 1S4QA 1NP6A 1SVMA 5KNDA 3PUZA 4MGIR 3EZ9A 3TGPA 1Q3HA 3KUDA 1E2IA 2NTYC 1PUIA 5KPDA 2Q3FA 1F48A 1ESNA 2VYFA 2QEQA 4OBEA 4NYJR 2EFEB 4M9SA 3TE6A 3GJ4A 3Q8XB 1XB2A 1Z0DA 4L5BA 4P0TA 5CIQA 4A6PA 4E5UA 1B23P 4PO9A 2F43B 2P67A 4IXMA 3C8UA 4IDNA 1KK2A 3AVQA 1U99A 1NG9A 3T15A 1MR3F 2YOFA 1XU4A 3WBJA 4IVQA 3CW2A 1CR2A 4PX9A 4B3BA 3IPYA 4B6FA 1Z22A 2IT1A 5FBLB 3TSZA 2OCBA 3I72A 1OYWA 4GMXA 4BLQA 2HF9A 1ZW6A 2XB2A 2X1VA 5FBRB 2B21A 1PUJA 2F7SA 4ZI2A 3VR3A 2JDID 1K5GA 1OW3B 2XTZA 1A2BA 2FE4A 1XD8A 2LKDA 5KHOC 1ZP6A 4Q21A 2JATA 3TVDA 1P2VA 4CEJB 4GZLA 4PFSA 2VH5R 1FP6A 2PT5A 2F1IA 4RZ2A 5J5CA 1UBCA 1UBEA 2X2EA 2QTFA 1LNZA 2XSZA 3K0AB 4M9XA 4PTLA 2CNWD 1Q21A 3TNFA 1DAGA 4S35A 5JWRA 3NBXX 5F3WB 5DN6D 4UXJA 3MJHA 4URZR 3HR8A 2BMFA 3LFUA 3BC1A 3HPQA 1UEIA 3I1FA 4KFSA 4OYHA 1H8HA 4BFWA 3UKDA 1OV4A 2RAPA 2VHTA 1TNDA 1RJ9B 4FMDF 1MV5A 2FDCA 3BWDD 2QZ4A 4TL7A 2EFGA 3UPUA 4NKRA 2C9CA 3ADCA 2GXSA 3A1SA 4NZYA 3NBZC 3T1TA 1ELOA 1EFCA 4RD6A 3ZH9B 5IHPA 1G291 2D2EA 2ZYUX 1S3SA 4MUAA 5KSPA 4PPNA 2OFWA 4XWAA 3KFVA 2OG2A 3GLGB 2CVFA 3ONWA 1W0KA 5G53C 3GPLA 2NMVA 1N5KA 4PQRA 3QQ5A 5JJIA 3EPLA 4PAOA 4Z1MA 2QN6A 4BFXA 2ZITA 3AV0B 2C2HA 2YC2C 4HLQB 4PPGA 5HKKA 4ZCLA 3HR7A 5JSZA 1JBKA 5DN6A 1YQTA 2R2AA 1G8FA 1JAHA 2R6GA 4LUCA 2JLYA 1P9RA 1ZNYA 2J0VA 3K0CC 3TAHA 4A36A 2JASA 4NMMA 3UANA 2ZRGA 3OZXA 1SXJE 3P4YA 4G0NA 4UNQA 2GZAA 2ODBA 3E1SA 3CBQA 1OSNA 2BCGY 2GK6A 2HJGA 3C5CA 1E32A 1LF5A 4N3NA 2BVNA 4ON9A 2IF0A 2ZRHA 4OI2A 3MG9A 4JBWA 1D8TA 4I99A 4Q01A 3AF4A 3IDQA 3NHBA 3AUXA 3JVVA 2H8KA 3AF3A 3T1VA 1KSJA 3CX8A 2Z0MA 3QI2A 3RS3A 4V0OA 3DDCA 1SQ5A 1KTVA 2D7CA 2VP0A 4AG5A 5LBIA 2IEZA 3W34A 1RIFA 1U0LA 2DB3A 1NJGA 3PIRA 2CK3D 3H84A 5EE0A 4LHXA 4KXFB 4RD1A 2IYZA 4EJSA 5TMPA 4OHWA 2ASEA 821PA 4YONB 1NBMA 1NKSA 2O8FB 5A0FA 5JWHA 1O3YA 1P6XA 1FQKA 4Z8XA 1WCV1 1XP8A 4I81A 3TR5A 4DKXA 4XSGA 3FB4A 5F2EA 2WAYA 4AYXA 4PSAA 4Q5IA 4W7SA 1DAIA 3GJXC 1Q1EA 2ORIA 2X8AA 1ONBA 4EFLA 3GCGA 5FR2A 1XMSA 3C14C 4KO8A 1QHNA 5EZ6B 4FWTA 3NG1A 4L8GA 4AYTA 1CRPA 4QL3A 5BQ5A 2OAQ1 4OI0A 1CBUA 2W2TA 4EPTA 2Z4RA 2BIFA 3U3OA 2IWRA 2ZM5A 4BFZA 4Q48A 3CF0A 1UPTA 4LX0A 5AJYA 3QXXA 3KJHA 1YZNA 2IWHA 4RFSB 1E69A 1R0YA 1CTQA 2QENA 3FVQA 2BOVA 1MT0A 2W6IA 4R71A 1I4DD 3KTAB 4BLRA 4C0HA 3KQNA 4QOSA 5C2JB 4HUQB 1X1SA 5JJLA 1BYUA 2C03A 5L3QB 4Q9LA 1D2EA 4CVNA 1G8PA 1E0JA 1NY6A 4TQAA 4NONA 4DLYA 4U5XA 1JEEA 1SZPA 1NIPA 4A6XA 3FMIA 5D3QA 1SVOA 4UQOA 1ZRHA 4OKSA 3TSWA 1BYIA 1XTQA 1FQJA 2VRWA 2V7QD 3RS4A 2PZFA 2WZQA 4ESVA 1CKEA 2FG5A 4CEIA 4DSTA 5FTKA 1CXZA 1XMIA 5AJZA 4DEYA 5FR1A 1YZGA 2ORVA 3MUFA 4HEJA 2BJWA 3RANA 4ARZB 2QM7A 3C16C 2MSDB 3OIWA 1CEEA 3W8RA 1TQDA 1KI6B 1VHTA 1JR3A 2D2FA 3Q7QA 4FCTA 1IXZA 4DEXA 1NF3A 4DCVA 3RABA 4ESHA 4RY2A 4BPBA 1JXOA 4L16A 3TBKA 3WYGA 4QGHA 2ZJAA 3OESA 5AJXA 4DUGA 1P62B 1AKYA 1P73A 1IXRC 2ZREA 5FOWA 5D3MB 4HSEA 1N2CE 3WYFA 4TQUS 4Q4JA 2NO1A 2RGNA 3L0SA 2ZRIA 1AIPA 2IYYA 5B58C 2O52A 3H86A 1U8YA 4LRWA 4M8NE 4ASUA 3NXSA 1Z06A 4YMVA 3O8CA 4HZUB 3EA0A 3PENA 4Q9KA 1UKYA 4F4IA 1NN5A 3U61B 3QVVA 3LWNA 2O8EB 1G21E 1FMLA 4B74A 5KO2A 1IY0A 4OQLA 1T3HA 2BM1A 3NBFA 3UMSA 3NEYA 1W2HA 4JVMA 3THWB 4E22A 2RGXA 4E07A 4ZCIA 2WIAA 2Q9AA 4K8OA 2PEZA 1Z0IA 3RS0A 4CEHA 5TY0A 1YU9A 1GRNA 2KB0A 1OF1A 3CLVA 3Q5DA 1JQLB 2ZJZA 3NH9A 2ZRNA 4OHYA 1LV7A 5EXXA 5FBWB 1P9NA 2NO9A 2EFDB 1DAKA 2ZRAA 1HEIA 3BIFA 3QXHA 5KNBA 4DCSA 1VYUA 1JEDA 2CHGA 2W6JD 2ZQ5A 1YKSA 4OHZA 3EARA 1F2UB 2CLDX 4R7ZA 1RC8A 1NLZA 2GVDC 4KBGA 4FMCF 1DOAA 4WBSA 4PSKA 2MSCB 1RKBA 2GF9A 1Q12A 4RD2A 3PITA 3SFZA 3OE7A 4E03A 1NY5A 4F7WA 2C5LA 3H4MA 1TU3A 1G17A 4WW0A 1OHHD 1X8KA 3Q9LA 2R8RA 1N6IA 1E2GA 2D4HA 1CJVC 2ZI4A 2H17A 2AXNA 2HF8A 1FL9A 2OESA 3EIHA 1P5ZB 2H16A 4C0AC 4QKQA 1HV8A 4B3GA 1AZSC 3ZD7A 2RKOA 2HLDD 1DPFA 2FWRA 3CRVA 4TLEA 221PA 2A30A 4ZO4A 4XVQA 2ZE5A 3I3SR 2GXUA 3VR4A 5LD2B 2GK7A 4NL4H 5E7JA 5KSYA 1RZ3A 1XBTA 2VHCA 2LCFA 4DLWA 3A4NA 1S1CA 4Y0VA 3IPXA 1RRCA 3ICQB 2IS2A 2R9VA 3E2IA 3KZ1E 1OH6A 4ILEA 1GIAA 3U2QA 2XGJA 5JZVA 2ZSBA 2CL6X 5J4YA 4QJ4A 2NO0A 4DC9A 1GWNA 4M1KA 5BN4A 2WICA 5H68A 1R8QA 4AURA 4IVPA 2XZOA 1TMKA 2GA8A 1KZ7B 3VR5A 5HTKA 3KDSE 4DRZA 5HPYB 5H1YA 1NBME 2HJVA 2QP4A 1E9FA 2ORWA 3L43A 2P3SA 4TTQA 2W58A 5LD2C 1Y3AA 4EAQA 2VIIA 4XTCS 4RKFA 5JHGB 1IXSB 1KY3A 3BBPA 3NBYC 4Q1CA 3IIKA 5DNYB 1UM8A 1GTVA 1E2QA 1R0ZA 4P3YA 4LSGA 4JT2A 3TAUA 3I8SA 1SVWA 3B5JA 4M2LA 1T91A 2FOLA 4V0NA 3RRZA 3ZJYA 5KNCA 3PJRA 3L0IB 5E95A 4GPTA 1Z0KA 2QGZA 4GP6A 3T1QA 4XOIA 3K0SA 5P21A 2BBOA 2B92A 4ZDJA 1ZU5A 2GCOA 1HH4A 2GJ9A 4JLNA 4RD0A 4TMWA 5TV2A 5ELXA 3EPHA 3K1JA 3UWKA 2W0MA 3S1AB 2BWJA 4GT1A 4WZBE 1ZAKA 4LPSA 3B78A 1T3SA 2BMDA 4MKGA 4IXNA 1C9KA 2NO6A 4R98A 5EP2A 4Q7MB 1EFUA 1YHNA 3R8CA 4C0KA 2QBYB 3A4LA 1IN4A 1GILA 1ZUIA 3HYRA 1QHXA 1P2SA 5AK0A 2VP2A 4ZPXA 1I4LD 3CIOA 3DOFA 1B0UA 4URWR 3U44A 1G7SA 3QBTA 4G3XA 5TVKA 4DLTA 2C98A 3CRQA 4PZLA 4B34A 2GAOA 5FL7A 1GNPA 3B2EA 1G41A 2I1VB 4MDEA 2Q3HA 1GM5A 3O8RA 5JWOA 3QF4A 3AVTA 4NU0A 4AG6A 2ZRPA 3F0TA 4EPWA 4US2R 4C2UA 1J2JA 4HAWA 5KYKA 4X8HA 5GJWC 3VKWA 1DG1G 1SHKA 4Q9IA 3EC2A 2QQEA 2VPPA 4OI1A 4TL9A 1I2MA 2QQ0A 4C0BA 1IY1A 2W00A 3H1TA 2ANCA 1G4UR 2FNAA 3THYA 3V00A 2Q0HA 3PVSA 1VCMA 2CEAA 3KFXA 2PJRA 3AF1A 4D80A 2ODWA 4Q02A 1JR3E 1KY2A 5BW8A 2V6JA 4C0LA 1OFIA 3D8BA 2ZRFA 3W9YA 1W2GA 1AGRA 3LD9A 5B30A 3TK1A 3TKLA 1G6HA 4AKEA 4GSYA 2RGDA 4TYYA 2FPLA 5BN3A 2DFKB 5DH9A 3K70D 4MGKR 2WKQA 5FI0B 5LB2A 2O8BA 3EZFA 1Z07A 2YOGA 1TUIA 3LW8A 2ZXUA 1OT3A 1SKYB 1E2JA 3BFKA 3MSXA 2FF7A 4D0NA 1G18A 1M2OB 4YXWD 1NMZA 2WWFA 2YWEA 2NOAA 3ZVRA 3ND9A 4O0MA 1CLUA 3BH0A 2CL0X 1OXXK 2NQ2C 3NKVA 1Z28A 2P5TB 4QGGA 3OAAD 4RZUA 3U3JA 4DDWA 4TYNA 1VYVA 3MWLA 5G3YA 2CCKA 2GJKA 3SBEA 3BJIC 3T5GA 3MD0A 1G8HA 1IN8A 4UNPA 2LKCA 2O0HA 1HURA 1NVVQ 1FNNA 2DPXA 1OXSC 1COWA 1JXMA 1EXMA 1XD2A 2PJZA 2R44A 3HU1A 1XZQA 2EYQA 4YDHB 1XTSA 3GFPA 2O8DA 4IFEA 1IN7A 2A9KA 3RLFA 4N0EA 3VR1A 1G1MA 2IXFA 3MLEA 5GVRA 3NC1C 1EFRA 2IYTA 1P9WA 4KJZA 3GJ5A 3KX2A 3IBGA 1P7CA 4HZIA 5JLJA 1Z6YA 3I61A 3QUSA 3P26A 3K0FA 1S9HA 4BEBA 3GEEA 2OV2A 5C1BA 1WXQA 2ZANA 5JI3E 2C95A 2MMGA 2ZJOA 3R9WA 4B76A 2CE2X 3PFIA 2D7DA 3SNHA 4GI7A 1E2NA 4M53A 3RHFA 3WP1B 3BFVA 4D2IA 1LB1B 2HT6A 2NGRA 2VO1A 2GCNA 5DI9A 1H8EA 3WMEA 1OXTA 4CDGA 3LLUA 4O25A 2A5JA 1KAOA 1KSHA 2VSXA 3C41J 4QGFA 3GP8A 1M1YE 3FKSA 3ZZ0A 1Q1ZA 4URYR 3ZVMA 3BXZA 1LFDB 1AS2A 5CJ2A 4V03A 4QHSA 3K0EA 1YZQA 3U4QA 1WRBA 4MRNA 3GMTA 5AUQA 2ATVA 1BMFA 1UKVY 4PZZA 3THXA 2ZRBA 1L2TA 3DPUA 2ZS9A 3U3RA 4NDZA 4KSBA 1G3UA 2NPIA 3RRMA 3VQTA 3AGPA 3KXIA 3WBKA 3O47A 3PG5A 2G9NA 1DELA 3VHLB 2NO7A 2ZI9A 4JJKA 3FFAA 4ZIRA 4U00A 2XXAA 4IJMA 2FFQA 1NJFA 3PEUA 2J0UB 2YKGA 3BGWA 1V5WA 4M1WA 1Z8FA 3LBHA 4TMZA 2BC9A 5E7MA 2AR7A 5J40A 2J41A 1CJTC 2EVWX 3U3KA 5CJPA 1AKEA 1TUEA 1MO4A 3O8DA 4JLBA 1M8PA 2KJQA 5FTLA 4OQNA 1E2FA 3AKYA 1EESA 3HP1A 1E9CA 3LBIA 1A82A 4MYCA 4YC7A 2XZLA 2R62A 2B7BA 2FSFA 4HLDA 5JHHB 2F3RA 4HLCA 2YINC 4B48A 3QG5A 1U8AA 2IBMA 2HXSA 4FMDB 2ZAMA 4KHZA 1Q57A 2QTHA 5J4HA 4CGZA 2XNSA 4JS0A 1KI9A 4MQBA 4Q03A 5F9FA 5FPYA 4PQFA 1GL6A 1SVKA 4BZXA 3FE2A 5DO9A 1D5CA 3A58B 2ZE8A 1T3LA 3QPUA 4EFNA 2ZS7A 5KU1A 5EP3A 4BZQA 1ZM7A 3GLFA 1W7AA 1NVWQ 2NZ8A 3BERA 4BEJA 521PA 3BD9A 4JL5A 2G0NA 3SN6A 4V0KA 5CITA 1W0JD 3EPJA 3CZPA 4GFDA 3KKMA 2QMUA 2Z4SA 4QC2A 2ZRCA 4W9MC 5LDDC 2EWWA 4TL8A 2ZI6A 1S0UA 1OYYA 2J46A 2FPMA 1HQCA 1E9BA 2ZJ8A 3B1VA 4GP7A 1NN0A 4FN5A 2PX0A 5FBVB 1RW4A 1Z3IX 4WA7A 4FIDA 1R10A 3WXMA 1CF4A 1WDTA 3C4JA 2EFCB 2ZI7A 4FW9A 1OFUX 4DVGA 4DB2A 4NCJA 4TYQA 1JALA 1TTTA 2XTMA 3OFNA 1MO6A 4A2PA 3N70A 4HB0A 3R8FA 1OIXA 3LQRA 3AKEA 2OFXA 1MOZA 5SZKB 1WF3A 1E1RA 4AYWA 2IS1A 1AM4D 1VMAA 4FINA 1LF0A 2CVHA 3QSYA 1XXHB 1KI3A 2WM9B 3IKJA 3B1WA 1R5NA 4URXR 3KB2A 1DBSA 1X3SA 4PC1A 4XVUA 5JI2E 2WKRA 4GBMA 2ODEA 3TMKA 3B9PA 2AK3A 2Q3MA 3Q7PA 2EQBA 3SDZA 4A0HA 4FMBB 1NVXQ 1CS4C 4LJ5A 1VHLA 4OJQA 2IYVA 1W36B 4HYYA 5KDOA 3AVWA 3WRXC 1FP7A 3BORA 3M6AA 1NLYA 1FZQA 2G3YA 2PL3A 1GRQA 2XOKD 3GLIA 1R6BX 1JECA 2QNRA 3SU8A 2IUUA 5CB8A 3DEFA 1NI3A 3ZYCA 1KJWA 3P32A 2XTNA 1XMVA 1A2KC 3K09C 3EIQA 2Z6VA 4TYWA 1S9DA 3CR8A 2WIBA 4P4TA 3WNDA 3QBVA 4HAVA 4W5JA 2PT7A 1Q3TA 4B3XA 4N0DA 1FPMA 1XTRA 3W3AA 2P0EA 2RHDA 2O0JA 2RHMA 3QVUA 3BE4A 4LDJA 2ZS8A 4WXRA 5DE3A 3VX3A 3X1WA 4K81B 721PA 4U02A 1FX0A 1KO1A 2ODNA 2VSOA 4II7A 4LV6A 4BE7B 2B7CA 1CP2A 1RPZA 2ZI3A 2JDIA 2WJIA 4TLBA 3ZZTA 3VU9A 4HB2A 4DJTA 3C5HA 1W36C 4D4JA 2GBLA 1YRBA 3L0PA 4XD7D 1JB1A 2HDNB 2WSMA 1XPOA 4G5GA 1YE8A 1R5BA 4URUR 4LJ7A 2J3EA 2ZRDA 1P61B 2R6FA 3FDIA 3B1XA 3U7EB 3LX8A 3KQKA 2QPAA 3ZQJA 1RRGA 2J0SA 2GJSA 2PCJA 1AJEA 2A3RA 4WAUA 3ZS8A 2WAXA 2XX3A 5UKDA 1KHTA 2DWOA 2CNWA 2ZSFA 3A8TA 4EUNA 1J99A 5J47A 1PLLA 1OPXA 3AUYA 5FOSA 2AXPA 4DLXA 1ZMXA 2HCBA 2QMHA 1P75A 4AIIA 1NG1A 2GZDA 1G7CA 2IF2A 2KBFA 2UZIR 3OEED 4Q4HB 3VKHA 1RFLA 2D06A 2R6AA 5CM8B 3NVAA 3GEHA 3PR1A 4LHVA 1OKKD 1BKDR 4MDFA 2CCJA 4ZV4A 3AEZA 1M6NA 3L2OB 5AUNB 4F4JA 2OLJA 2YV5A 3KUCA 1E1QD 2XJ9A 2WJVA 4NCNA 4CYMA 1OH5A 5AUOB 1XCMA 1IM2A 1Q22A 3GLHA 3KXKA 5EP4A 2BJVA 1ZNWA 4G1UC 2PH1A 1A5TA 2EFHB 3BFXA 5HE8A 3K9HA 2WJHA 1XEXA 3PUVA 2EYUA 2QAGB 2REBA 4DLUA 4TQ9A 3QIAA 4UNSA 3PUYA 3T06B 3AP3A 2F9LA 1VIYA 3CF6R 3DOEA 2QA5A 1A4RA 1AK2A 1G7RA 3B85A 4J0QA 4I1SA 3PEVA 4Q1BA 3QF7A 1F2TB 3AVUA 1VKJA 4KFUA 4JBXA 1DS6A 4A9AA 2C9YA 2V1XA 1S96A 1UKEA 3WNCA 2QUZA 5CK5A 3OEEA 2AK2A 2H92A 2Q21A 3WMFA 4XIGS 5AWFC 1GKUB 3WHKA 2IS4A 1BS1A 2OCYC 1X8LA 4HAUA 4LYAA 1SVLA 621PA 3CZQA 4LYFA 4Q7KA 4NP6A 4RCZA 1E1QA 2XJ4A 3THYB 4DLSA 2VP9A 2QAGC 1EFTA 1G19A 1T5LA 4JYBA 5AR1A 3RRNA 1IBRA 1E4YA 1G20E 1T9HA 4US0R 5EXTA 2X19A 1MKYA 4LK2A 4QM7A 5KPJA 1J90A 1AQUA 1M74A 1OLOA 1W4BA 3AVVA 2IL1A 3W6OA 4YMUA 1TQ6A 3JZAA 2VLIA 1X8JA 4V02A 2FX3A 2IEYA 4WXPA 1CU1A 3LDAA 2JGNA 4Z8YA 2GWHA 4Q4AA 4BFVA 2OEPA 3VMFA 1LW7A 4URVR 3QKRB 3CX7A 1VECA 2ZRMA 3VTKA 1G16A 2ZSDA 2IUTA 1VCNA 2CK3A 3REFA 2GRJA 4DIDA 3ETLA 2G88A 4CT4B 1W5SA 4LYJA 4P32A 2IXGA 2ZUDA 3VR2A 2N1BA 4KVGA 1ZCBA 2VP5A 5KUTA 1G5TA 4HUTA 1EK0A 1N6HA 1R2QA 4C3ZA 1WBDA 1U9IC 3GLFE 1QHSA 4X8LA 3DZDA 3IEVA 3IIMA 4DT1A 4HLUC 1T4GA 1OIVA 2QMOA 4BUJA 2QT0A 5EUQB 1I4TD 3MAAC 4B73A 2QL6A 4KFRA 1JPNA 3GQBA 4LV8B 3LQQA 1CJUC 4MRVA 2BM0A 3V4RA 1XEWX 5G3ZA 2GJAA 3UMFA 2IUSA 5CDFE 3L8ZA 1KKLA 1RRPA 3VNVA 2SHKA 1E9DA 4TT3D 4FMCB 3MGCA 4RKEA 3W90A 3TUIC 3LX5A 3G0HA 2O8DB 2OCPA 3QKSA 2ZIAA 4QHTA 4CIDA 4JKYA 1XJQA 4Q66C 5TXGA 2GAAA 5JS8A 2H5EA 4JLOA 1JQJC 1PLJA 3DO6A 1A7JA 1E2HA 4LBVA 4C30A 3AQ4A 2FGKA 2REOA 4EQ6A 1R4AA 1SXJB 2FSGA 3SC3A 1NN1A 1XTJA 5FPKA 3FHCB 5K8LA 1XF9A 2J59A 1DEKA 3QOFA 1XRJA 1KDOA 1MO5A 3SHWA 3VNUA 3WRYC 5CIWA 4XVRA 3CB4A 5E4FA 2QE7D 3SQXA 2IW3A 4PC7A 1P4SA 2Z5FA 3TLXA 5JRJA 5IF9A 5FL3A 1NLFA 4IDPA 1J7KA 2OXCA 2BDTA 4JJZA 1QG2A 1Z63A 4LJ9A 4B2LA 4LC1A 2J45A 3CONA 5FTNA 1J8MF 1N3BA 2V7QA 4B2PA 3GLIE 4NCIA 1KO5A 3RYTC 4LJ8A 4BFTA 4TLCA 3R7WA 1IY2A 1ZBDA 3A1WA 3GJ3A 5FUWA 1SXJC 4IDHA 3ZDQA 1HQYE 2VHUA 4MRSA 2FZ4A 1HYQA 2ONKA 2AN9A 3QEOA 4EPXA 1FTNA 3N2IA 2WWWA 5JRZA 3V9PA 1E2KA 1UDWA 5G41A 4AD8A 4KYIB 2C99A 1AA9A 2PZGA 1MABA 3VX4A 3Q3JB 1GKIA 4OJKA 4ZDKA 3GJ6A 1KOFA 2KI5A 3B6EA 3EAQA 1QHHA 3DL0A 1G3MA 5L8VA 2QE7A 2BBSA 3PEYA 4JLJA 1P72A 2GF0A 2XITA 5J4LA 3SOPA 4EPYA 2GXQA 1Z6GA 3I92A 4LHWA 4R9UC 5BYKA 1Z83A 1ZM4A 2Q6TA 1UF9A 2YC4C 4HDCA 1W36D 3MMPA 3HU2A 2ZSEA 1OH7A 3CNOA 2OBMA 3WP0A 3B7GA 2IYLD 4LPKA 2CL7X 1ODFA 3F8TA 4QBGB 1N6RA 2J9RA 4ITRC 1KK3A 1N6OA 2F43A 4WZAE 3SEAA 4ABYA 421PA 1ZUHA 2O8CB 2OAP1 1D2NA 1GL7A 4Z51A 1Q20A 4A8JB 1D6JA 2WSSD 1II8B 4P4SB 3ZQ6A 1KI1A 4OQMA 3A37A 4HI0E 3IIJA 3PV0A 5K8UA 3AM1A 5FUXA 2CJWB 1E2DA 1U94A 3KL4A 2FN4A 4D26A 2ZU6A 1PVOA 2A5FA 3GLHE 3L82B 4G5OA 5FTJA 3ADBA 3KQLA 4KFTA 4IOKA 2ZPTX 1N0UA 1KNQA 4CT5A 3I73A 4CEJA 1NIJA 3LY5A 1BO6A 2W6JA 2JJ2D 4DLRA 3PEWA 2YNMA 2OUKA 4QHYA 2FGJA 2GKSA 4RD4A 3I5XA 4FI3C 1N5LA 3K0AA 1E6CA 3TJZA 3WNBA 2V3CC 1GVNB 3ADKA 3TUJC 3GJ7A 4JLMA 2R6CA 4RCYA 5FOXA 1HE8B 1D9XA 4A8JC 4BLTA 1DAMA 2ZVPX 4DCTA 3FKQA 4TYPA 3D3QA 2PEYA 3LXXA 1OHHA 4O2RA 4Q9HA 1NVVR 3NDPA 4IDOA 4O2LA 2WWYA 4EKDA 1IQPA 3ND8A 2GEDA 2Y8EA 3A6PC 3IO5A 3E70C 2WSSA 2F1RA 2I4IA 4CRWB 3U7GA 3MCAA 5BXQC 3SYLA 3DHWC 2QP3A 1W1WA 3MJRA 5HCIA 2HLDA 4Q47A 3K0CA 1YR8A 4HB4A 1XJCA 1Z5ZA 2DWQA 2N46A 2OFOA 4LBYA 2BBTA 3RSLA 4IW3B 3QNUA 1XJ0A 3GLGA 4MRRA 5EE3A 1VDZA 4ZCMA 2DFNA 4LJAA 1DO0A 2JJ2A 4LGMA 3OEHD 3MFYA 1KIMA 1VPLA 1ZD8A 2P2LA 4NCKA 5CLLA 4Q9JA 3Q5EA 3AF0A 5KDDA 1U90A 4M9QA 3THOA 2DYKA 4XH9B 4CZ2A 1XWIA 1T0HB 2ZJ5A 3SFVA 3AF2A 5C4GB 4L9SA 1ZUNB 4KYUA 4RVCA 2D3WA 4LHZA 3FOZA 4KVAA 2P5SA 1WBBA 2OCAA 4C0QC 2WTUA 3N2EA 4GOJA 4F38A 2CMKA 4DBLC 1TADA 3UMRA 4DDTA 2IX3A 1Z08A 2BMJA 4OK5A 1D9ZA 3WYAA 1EGAA 4AKHA 2JA1A 1XDBA 4JVLA 3EG5A 3R20A 5LB4A 2WJJA 4BWYA 2GILA 5BN5A 5DIFA 5CLQA 2HCJB 3EZ6A 4BLPA 5IK2D 5JSZB 1NVUQ 3AVPA 3IGFA 3BB1A 3B82A 2W2XA 3DKPA 1K8RA 2PCLA 1XCPA 2QPOA 1WP9A 3QXCA 5JJKA 1XPUA 4HAZA 2GNOA 1E94E 2AFHE 2QMEA 3DKVA 2QGNA 4M22A 4BRWA 1HUQA 3X1DA 4OL0A 1G9XA 1OIWA 1T6NA 2F1JA 2CXXA 3LA6A 4PAMA 3W6NA 3TIFA 5C46F 4UNRA 2VF7A 2IK8A 1G3QA 5FPTA 2O8FA 1FUUA 2PBRA 1G5RA 1AZTA 2RGAA 1CR0A 1YZTA 5L3SA 5EE9A 2PLRA 2WWIA 4QRHA 4DLVA 1MO3A 3I4LA 3RS2A 2OT3B 1DVRA 2IYSA 2ZUBA 1UBGA 1U98A 4K46A 3LW7A 4I1VA 4QJ5A 1XCGB 5IK2A 2WPDD 4OHVA 1VG8A 1IN5A 1UFQA 4N1AA 1EG7A 3KXLA 4OK3A 1QHGA 4EJSB 2QAJA 1KDRA 3EZ7A 2GEVA 2B8WA 2QM8A 4YMSA 2UKDA 2REXB 4WOPA 5F9HA 1G8YA 3UXMA 3D31A 1SXJD 1OB5A 4RFSA 1X1RA 2K5UA 4TMXA 2HV8A 5J4KA 4L4UA 3IBYA 3KTAA 2GETA 2EU8A 4GL2A 2RH5A 2W83A 2YZ2A 4WVFA 4HUQA 4PR0A 2XAUA 5B64A 2VL7A 1W5TA 5L3QA 4E09A 2JIZD 1ZJ6A 1II9A 4EIWA 2OXRA 4B3CA 2IYUA 2V6IA 2ZJ2A 3TRFA 3MRSA 4D0LB 3NTUA 2J7PD 3CWZA 2NG1A 2IYRA 3ASYA 3SJBA 4JZKA 1YR9A 2H1LA 2ZU0C 4EFMA 5HR5A 1G8GA 5FBQB 2E87A 4C2TA 4ZDIA 5HZHA 5JEEA 5CK4A 4PPFA 4EJSC 4MYHA 4YXWA 2WPDA 2FFHA 4IEEA 4H9GA 2OM2A 4HATA 4W5WA 1CULC 4PPQA 4Q1FA 2G6BA 3OAAA 1C4OA 3H2YA 5DSZA 1L4UA 1RYHA 2BKUA 2JEOA 2OHFA 4B3DA 2V54A 3GFOA 1M7GA 1QDEA 5HE9A 5K8TA 1KI6A 2OO7A 4C7OA 5TDHA 2VTKA 1XD9A 1E0KA 4LJ6A 2ZEJA 3SS8A 3BH7A 4F91B 4PHHA 1LY1A 2PMDA 4QNMA 2F1HA 2Z43A 5D3MA 2BMEA 2J7PA 5EQTA 4CEIB 3LRPA 3OIYA 4QG7A 2XNDD 3PUXA 2ERXA 4TN1A 1DAEA 3KJIA 2JAQA 1ZU4A 3M0EA 1LS1A 4RSGA 1Q1BA 4GOXA 2A5GA 4A2WA 1E3MA 1TF5A 1KI2A 4BFYA 3C15C 3H0KA 4NYMR 5CYPA 4DCNA 4TZ0A 1JI0A 4HZUA 4GMDA 2IYXA 2F3TA 3B1ZA 2DY1A 1N6NA 2RMKA 1SKQA 1W49A 4JL6A 1HY3A 1PZNA 4NPHA 4R2HA 2ZROA 4TMTA 2GTPA 2YJTD 1FFHA 5FOUA 3CRRA 4M1OA 2VP6A 3LBNA 1P2TA 3LO5A 3J81k 3THWA 2JLVA 2BHRA 1G6OA 3T34A 2WVJA 3T1OA 2ZSAA 4Q4JB 1GSIA 3O8BA 2JLSA 4ACAA 2A78A 4H1VA 1Z2AA 5HZKA 1UDXA 3PXGA 4DSUA 2H57A 4PC6A 4M9ZA 1OB2A 3GLGE 1KI4A 1CJMA 1KJZA 1GOTA 1RRFA 1UADA 3QPWA 1ZVQA 3CPEA 5JFGA 4TTRA 3BB3A 4LCBA 3M4YA 3ZLJA 1TF7A 1F2UA 2GJ8A 2ZTSA 3AVOA 4G5RA 5FOTA 4QBHA 1O87A 1T0JB 4AKIA 3IO3A 4CEHB 4QGAA 3KKNA 5CDFA 1H65A 1QG4A 1SVIA 2RGCA 2ZJYA 3EA5A 5GVSA 3VKGA 3RSOA 2RGNC 1E2LA 5DISB 1W4CA 5LPNA 4M1YA 3R9IA 1Q0UA 1LS6A 2A5DA 4M0LA 3DM9B 2G77B 2OSBA 2WMNB 1W48A 4EPVA 3HU3A 3SZRA 4JLKA 4BZPA 1M7HA 3X2SA 3TW8B 4JBYA 5EP1A 4B43A 3AP1A 4D6PA 1VCIA 6Q21A 2FA9A 1VG0B 2XEXA 2XSZD 3G82C 2MSEB 3N5CA 1Z0AA 3P27A 3U7HB 1YZUA 2R65A 2X77A 1VCOA 1IJFA 1JJ7A 4ERNA 2B6HA 3TVTA 3I32A 3EWSA 1HT1E 3NDBB 1WE2A 1H8HD 1F3OA 3QG1A 2NPFA 4IOJA 2FH5B 1W0JA 5F98A 4DCUA 1R0XA 2FSIA 3CKLA 1TX4B 4NBSA 3IUYA 4G5SA 4DB4A 2WWHA 1GG2A 1KGDA 3UWOA 4Q19A 3RWMB 2FFAA 1ZC4A 2JLQA 3QXSA 4V0LA 4A82A 3W3ZB 4MGZR 1ANKA 1Z6TA 3QEJA 2QTVB 1TAGA 5DYGA 1CIPA 2AX4A 2GESA 2VQSA 4B6EA 1N5IA 3IHWA 2O0KA 3NWJA 3TH5A 4IOMA 4Q1DA 5EXSA 5AUPB 3IHLA 1W0KD 4IFBA 2FZLA 1ZM9A 1KJYA 5FPSA 4P33A 1OH8A 2A2ZA 2QRZA 1KDTA 1R5OA 1DG3A 4B71A 4Q00A 1KK0A 4Z1MD 2C77A 2FMXA 2H18A 4JLAA 2OZEA 3W5JA 4A92A 1FMJA 2ZRLA 1KDPA 2DR3A 3CPJB 3DVLA 5HKKD 4GDFA 1RE0A 4JLVA 3VR6A 4FD2A 4AK9A 3QJYA 3SHFA 1E9RA 2RGGA 4JLDA 3ZZUA 4NYMQ 1WMSA 2VHJA 3FGNA 4B32A 1GL9B 3S1AA 5GJBA 2L0XA 1S8FA 1JPJA 4I4LA 1KZGB 1S3GA 2OBLA 2XOKA 1ZM3A 3U7FB 1VIAA 3ECCA 2ERYA 2QG6A 5H8WA 3RAPR 2QBYA 4A0GA 4PXAA 4TSFD 1RVDA 5FH9A 4A4DA 4LJYA 4PC3A 4TLAA 1YZKA 4WZ6A 1UBFA 4LY6A 1Z6XA 2HEIA 4AC9A 2E9SA 3X1XA 3RVBA 1TU4A 2P6NA 2QT1A 3QKUA 4IKEA 5B57C 5IRCD 3QE0A 5JMTA 2OE2A 2FJUA 3C7KA 3G5UA 4IVRA 4DSOA 2GCOB 4A1FA 2UVQA 4HB3A 3I62A 1GAJA 3KKQA 2V55B 3IQXA 5KSZA 3B1YA 1II0A 2CLCX 2P6UA 1FTSA 1P2UA 4PQYA 4XD7A 1WA5A 3PUWA 1MH1A 2JLZA 1E99A 3RNLA 4M1MA 1U81A 1NBMD 1TEXA 1IJEA 4FXPA 2BKEA 1E2EA 1GNRA 3CUEF 3IILA 4UXIA 4BRUA 3U44B 2NIPA 4MGYR 4TWZA 4X8OA 3TUZC 2PLFA 3SBDA 1NKTA 3ADDA 4IHQA 4TSFA 2JLRA 2BEJA 4PO8A 1S2MA 2G0TA 2WJGA 2E1RA 3QF4B 121PA 4GZMA 4UJ3A 2JJ1D 2V9PA 3B60A 3CWQA 3AKCA 5GJCA 5HCNA 1E0AA 1AS0A 5DHAA 1G7TA 1OKKA 1YZLA 4MITA 4NYIR 3VHXA 3IQWA 4EDHA 1KYIA 2V1UA 4C4PA 4NYJQ 1ESMA 4DHEA 3LLMA 4C9BA 3MWKA 3LH5A 2ZI5A 4OQXA 4MKIA 1CR1A 2W6ID 3TSOA 1NNEA 2IS6A 1LVGA 1DADA 1E9AA 2HUPA 3JVUA 2J1LA 4JT4A 4PSVA 2VHQA 1E98A 3NH6A 4KI0A 1N0WA 4Z54A 2WMOB 1KI7A 4V0MA 3BS4A 3QKTA 5L3SB 2O8BB 4U7DA 2PZEA 5FUVA 2YWGA 1PV4A 3L0OA 1KSFX 1US8A 2OILA 1L7VC 3ZD6A 2WKPA 1XEFA 2VEDA 2WHXA 1EWQA 3ZVLA 3BAFA 4DWJA 1W47A 2G1KA 2ATXA 5ANRB 2JJ1A 4BFSA 3CRW1 1XNJA 4HDOB 1IAQA 3FPAA 1T8UA 4Q4LA 1UAAA 1U0JA 4YMTA 1KMQA 1QZXA 4DIEA 2CDNA 4M1TA 1W4RA 3TQCA 1J8YF 3BH6A 4M21A 2YOHA 2EWVA 2JLUA 1F6BA 3DMNA 3UG6A 2WOOA 1Q44A 1W44A 1T5IA 3W6PA 1FNMA 4ZKDA
chains in the Genus database with same CATH superfamily
4FGLA 2R47A 4GF5A 4PS1A 4TKUA 5D1NA 4POAA 1E96A 5PGMA 4JL8A 4AS2A 3HXKA 3WK5A 5T41A 2HSGA 2PKYX 2VBCA 2B30A 2B20A 2BW0A 4GLFA 1HYHA 2IEIA 2CNKA 3FX2A 4MUHA 4N5DA 5KWEA 4QPNA 3SD7A 1LI7A 4ZK6A 3G2IA 2RGEA 2P9CA 1KYXA 4KO2S 3TTYA 4KXWA 1WB9A 1DJNA 4JUFA 3TEMA 4BB5A 1Z2OX 1MRSA 2BEKA 4QBFA 4C3UA 3I58A 3OA2A 3X1KA 3PT9A 3WLHA 2E21A 2YWCA 1IOZA 4OXIA 2FMUA 2XBUA 3NPMA 4R31A 1W75A 1QIMA 1TGVA 2OV6A 2NN3C 2ZE6A 3JVDA 4UKDA 4P7GA 4C0JA 2JAOA 2BTOA 1HTWA 3RC8A 2QM3A 5AJWA 2FEPA 5EIBC 3K0FB 1NZJA 1UBJS 4OYLA 2CDBA 2YXLA 1WPRA 3LV8A 3MJFA 3ZNNA 1E5QA 3ZY4A 1X14A 2G9QA 3FI9A 1E2MA 3OKPA 4HGNA 1X8XA 1XJ5A 1Y9JA 4BVBA 4C4YA 3UUGA 2C57A 3WGUA 3FPKA 4UHDA 5CGQB 4OK6A 1FDWA 4EECA 5JCJD 1QF6A 4EFKA 3A9UA 3AERB 3V1LA 4AU1A 2OQ2A 4EHDA 1GZ7A 3ANXA 2HR1A 4YMHA 2VPXA 3B36A 4C7OB 3LT1A 3Q9UA 1IBSA 2J0UA 4D0GA 4IMRA 1T35A 1NUUA 2Q0QA 2GM5A 1YC2A 2Q07A 3DMTC 3E5HA 3ICCA 2AFIE 1E9EA 2EP7A 4P08A 3GLSA 1CR4A 2BCJQ 4TM8A 4TT3A 1I7SB 2OCLA 3U3ZA 3UICA 3NBMA 3WTCA 1KSGA 1Y48E 4IOLA 5DMXA 2VSYA 3FMPB 5FO1A 1VLLA 3E2PA 3W8FA 2ZUSA 1XK7A 5BMVB 4TV9F 1YU6A 2DM6A 4TSKA 3CZ9A 2Y6VA 2OKCA 2I67A 4JDPA 3L8DA 5HFAA 1FFCA 2V4UA 3LOUA 4KIGA 2GEUA 3QKWA 3RS5A 1O94D 1IWOA 2O23A 4NI5A 2WC1A 3EXG2 1P7PA 1EX9A 3FGZA 4MW0A 4CR7A 5KNBD 2A5YB 2H2WA 3DBRA 3CVJA 4YLGA 2J4CA 5A4AA 3LLCA 3P20A 1WHSB 4ZIRB 3LCUA 5DYIA 5HRAA 1K0FA 2XDWA 4PZYA 5JCXA 3I2GA 1G20B 1XTKA 3K9GA 1KMHA 3EWIA 3OE7D 3SE0A 4FX2A 1I13A 3BHMA 4NYIQ 4ABTA 3EDQA 5EPEA 1X7XB 2PGJA 3TMYA 3PR2B 4QM6A 1IZ7A 2DCUA 3ACDA 3LE8A 2VP4A 4G25A 2UXBB 1BGVA 2PD6A 4OM7A 5COQA 4B47A 1AOXA 1SWVA 4WK0B 3WWCA 1DDGA 5M04A 3LPDA 2AKAB 4PRLA 2Q41A 2X7XA 2C0PA 2GCPA 3ITNA 4DA4A 2X8LA 3BYZA 3OUTA 4X91A 5TQVA 4LF4B 2FEMA 2PX5A 4KP7A 2AJCA 4HY3A 1L4FA 3FRJA 5AH0A 1E0SA 1GFWA 1Z29A 3BHJA 5CT9A 1GGVA 1V11A 5CA0A 3RC3A 2ZB2A 2Y1XA 4QPJC 3MCUA 3NGMA 2ZUCA 3PNMA 2KWIA 5FB3A 3TXYA 3V32A 3ZU2A 5LYJF 1E5VA 4C29A 3NETA 4EX7A 1I3LA 4JKIA 3WJ1A 1NUAA 4IRUB 2F62A 2GN9A 3B53X 3BDAA 1U4NA 4JY7A 4NV0A 5CPBA 5BWMA 1YR6A 3PE6A 1N25A 1EVKA 5CX1B 3HXPA 3UOWA 1UPAA 1O6CA 4Q1AA 4WESA 5KOHB 4KAJA 3MB8A 3H2HA 4NEGA 1LQTA 5F73A 1SCAA 4OQFA 2IHBA 2BE9A 1DCTA 3FPCA 2XUQA 2C9ZA 3FWZA 3D1VA 3WISA 1DAHA 1KO8A 2VI5A 4B35A 1ZLXA 4EG4A 3U3MA 2GH1A 5ALLA 3ZDEA 4HRVA 2BV3A 2X3YA 3IP8A 1VE6A 4CF7A 3ZVNA 2RBGA 1A9YA 1YVUA 2ZYTX 5CB6A 2MMCA 1PJAA 5ELLA 3QMPA 4GOKA 1FRQA 1NWCA 4WFJA 3OQVA 2P2DA 4MB6A 3PE3A 3CJTA 4DQ0A 4X65B 4MWZA 5KNCD 2CUNA 1CFJA 3QMVA 1L1EA 2KSQA 3DB1A 3KR2A 1WD5A 2KHZA 2N9UA 4EHHA 4JHXA 2ZAIA 1DKPA 1THTA 1K98A 1OXUA 3K96A 4R5HA 2B4RO 1HDOA 5FI1B 2P1RA 4DJDC 2X2PA 2HREA 4KE6A 2Y1FA 3UBMA 1ZD9A 3M6WA 3K4QA 5KWJA 1VBMA 2Q5HA 2QY9A 3LQ4A 4J7UA 3LUGA 2QRMA 3V6LA 2CMDA 1HE1C 4PO1A 2G1JA 4R1QA 4U8HA 3GAAA 1ZMOA 3GLIB 1T4MA 5IJXA 1PZEA 3UM9A 4P4UA 1KP9A 2C04A 5ALZA 3JY6A 3LX6A 1I5EA 4NZMA 3Q6MA 3GO4A 4P7FA 3LFTA 3QZUA 4Z1OA 4V0ME 3OLWA 2ZJBA 4ZVVA 4JLPA 3TIIA 3L0DA 1QP8A 4O4JF 3QLEA 4AY2A 4MZDA 1E2PA 1QHIA 4RIIA 4DDUA 5JECA 4QPCA 1SXHA 2VFAA 4NE2A 3NHSA 3NJRA 3ADOA 4KXNA 3ZZNA 2EQ5A 1B14A 4TOIA 1R6DA 2X8BA 1Q0LA 3K9NA 1FNBA 2A14A 1DG9A 2DTEA 2QX4A 3DLTA 3IUMA 4Q4HA 5T3YA 4RMJA 5HWSA 4RF4A 1YFLA 4EF4A 4L9WA 1R3UA 4GKJB 2RD2A 3B38A 3A10A 3P2YA 1BJTA 4U9UA 3EPKA 1PDWA 4DMGA 1YDWA 1VE7A 2PA3A 4MRPA 2JGAA 4OI4A 4OP1A 4D4KA 1EEXB 2PMKA 3N2GA 4BN0A 1KOJA 1M75A 4AROA 3CH6A 2BGIA 3FPJA 3GGDA 1QCDA 3E7PA 4M83A 2QJWA 2AL7A 5G02A 3U16A 4WT7A 1TU0A 2FPOA 3T3MB 3ITEA 4I5DA 5C8XA 4I4TA 1D09A 1S2NA 3D4PA 2QAGA 4MW7A 3FFBA 3SHOA 3DNFA 2IEAA 4HCJA 1HZZC 5DCLA 5JVDF 4A0RA 4IGIA 1J8QA 4UVGA 1MFPA 3NWPA 2QXYA 1JLHA 2GYYA 2EC5A 3B6ZA 3BMXA 3NBKA 1RAAA 1Z2CA 4BC1A 4E3ZA 4MAMA 4TSRA 1ZOLA 4R7TA 4E2YA 4Q18A 2A4KA 3ABSB 1J97A 2RDMA 3OU6A 1GZSA 3ACCA 5JNTA 5B2ZA 2D1YA 1TJ5A 1GDDA 1OFTA 2VXYA 3ZIAD 3EAGA 4J03A 8ABPA 1EFLA 4GNKA 2OBNA 3UK6A 5C35A 1RYYA 5ALMA 4I6GA 3OQJA 2QRNA 1CF2O 2YXNA 3JWEA 4UCQA 4B4VA 8LDHA 2Y4OA 1U8ZA 4F3KA 4CWAA 3A9CA 4UMVA 4Y6SA 4O5OA 4BNNA 4TV9A 5DX0A 1ECFA 3TLMA 1G3RA 3MJEA 1P8JA 2R8PA 5SZJA 4PYQA 4A0FA 3JQBC 5CFLA 5LFAA 4Z3DA 1PL8A 3G68A 2V4ZA 3IP1A 3GMIA 5B6PA 1T0PA 2FG7C 2Q5FA 3QNMA 5T5QA 1OUMA 3CNNA 1WXDA 4BPRA 2A9VA 3R23A 2AZXA 2DFDA 3FTEA 4MH0R 2VYNA 4PS0A 3LC1O 3CH4B 5LL6P 1DL5A 1QTNA 3AR6A 3IEKA 3KEQA 1XN1A 4GXTA 4HHEA 5L95A 3ZGXA 4M0CA 4I55B 4RACA 4HNAA 4YJ3B 2C5BA 2EAUA 3DS8A 3ET4A 4KSCA 1VE1A 3VSAA 3KVOA 4BMCA 4IQGA 1LTKA 3B6MA 5JAUA 5SZHB 3QKRA 1K8ZB 3ZIUA 1TPZA 5GOTA 4PHGA 1NXQA 2Y77A 2ZAOA 1QYWA 1F5NA 3AWIA 1AHNA 3JATA 1XYYA 5J5VA 3RS7A 3SJCA 3TJMA 4TUYB 3RYFA 2FJPA 3DAPA 2YFQA 4I1UA 4PSCA 1XIVA 1HL3A 4OUKX 5DWVA 3L8YA 2UU9B 2ZR7A 4LI0A 5DOVA 3HYTA 2QVGA 2XUDA 1DKOA 3L1IA 5ARDA 1JLLA 3G7UA 2G25A 2XI4A 3OD5A 4KV7A 5L3RA 1PUXA 4J3FA 1KOGA 1KYWA 3NJ8A 4N76A 3CSSA 3LXMA 5A0TA 3N53A 2WBLC 1IL0A 4WKCA 3D7NA 5G0TA 1WKBA 3T0IA 1RE1A 3GIWA 4HPWA 4RESA 4RVUA 3ZTWA 5KOJB 2CHQA 3A6HA 3GRRA 1O2DA 4L15A 4AMGA 3LA8A 5K4AA 3C1TA 4G2NA 2W2MA 3TQHA 4AO7A 2G63A 3WI7A 3ZWCA 4XWWA 5C32A 3CC8A 3ZOZA 1MRNA 1CQIB 3PK0A 2XF2A 5C37A 1GAXA 2CLIB 1ONPA 2E2WA 1B73A 2OZLB 4N82A 4ZQBA 4G8BA 4IIBA 2DTXA 3OH8A 2ZJ4A 5TEVA 1GTZA 1ORIA 4A15A 1E2BA 1XROA 1RHJA 2NQ8A 4AJJA 5HFJA 1JKMA 4H4CA 1SXJA 3V4SA 5DULA 3KRTA 1TM1E 3KAPA 1N8NA 4NFLA 4QA9A 3C3PA 3R5JA 3NCTA 1G5PA 2H1OA 2BCEA 3WLMA 1VXOA 2HU5A 4FZVA 3JQQA 4JCOA 2VSQA 4L50A 4PYMA 1EUZA 2XGGA 4ZCRA 2XB9A 1NLMA 3C6BA 3OIFA 4LV5B 1SC4A 1Y42X 4M37A 4NQRA 5BRJA 4P7KA 3UPDA 2Q6KA 4BJ3A 1JFRA 1P1JA 2RIRA 2CE7A 3GPBA 3V9AA 4FSHA 5IBCA 4H7JA 1FUKA 2V0NA 3KTOA 1DO2A 1KS2A 4JD5A 4EPRA 1UDBA 1YQXA 3DYBA 4OH1A 2IC5A 4D57A 1XDWA 4P31A 2JBHA 3WQRA 1Z2PX 3I8XA 3KKPA 4QNRA 5DI3B 1H2FA 4M7RA 3CUWA 1A9TA 3FBWA 1A98A 4QJ3A 2V3WA 3O9VA 2PFSA 5HM6A 4G41A 3A7DA 4RD3A 4F5DA 3W5CA 3DV0B 1P8AA 1S89A 1XAGA 3O91A 3BK7A 4QUKA 2WWGA 5BOVA 3N6XA 3IAS6 1IUNA 2EX4A 1NSTA 5IUJC 1EX7A 4GR4A 3DTNA 3DZ8A 1J25A 4U7HA 2XWBF 4KITB 2O8NA 1JHDA 4I50A 1E3IA 2NAPA 5K6TA 1MXHA 2OGSA 4X90A 2PY6A 4ZJYA 1ZJYA 3IV9A 4F92B 3L6UA 4CM9A 4QE3A 2RHHA 2ACVA 3KOWA 2M6KA 1P60A 1B7GO 1WS6A 3K2IA 2R6DA 5A4JA 4IDQA 4BLUA 1SUWA 3HKBA 5CB4F 5MN4A 3EEIA 1XFAA 4BCDA 2Q3CA 1SK8A 2CCGA 4MJLA 4WIAA 1KPIA 2GLUA 3CH5A 4KEAA 4HAYA 2Q1WA 4R51A 1UZMA 4BGDA 5CAEA 4YHHB 1RYFA 4JQYA 1ZD1A 2J32A 3HFSA 4X8MA 5E2AA 5I5GA 4YAJA 4Y2RA 1N0VC 4K26A 1P29A 5JS7A 4RDCA 5CYOA 4Q05A 4KNWA 3HDTA 3U4HA 2N42A 2PR2A 4NFHA 4XEUA 3DMYA 1AVTA 3F73A 3OFND 4GI2A 1IONA 2ZR0A 2ZDQA 1H2HA 4IJ5A 1DB3A 2O8CA 3VI3B 1ZCAA 2FSHA 1K7SN 4GYYA 3T52A 4DR7B 1D3AA 1YJAA 1YJXA 4TMKA 4J3NA 4UEWA 3S27A 5LIPA 1E3EA 2BP7A 4CL8A 4RM3A 3B8HA 1OXKB 3ZI0A 4HDRB 1M8FA 4P4SA 2GS9A 3RJ9A 3WYCA 3K53A 4BMYA 3STYA 3KAQA 4DLZA 2HCTA 4EM6A 3NHRA 3N9IA 4LZZA 4GR5A 1Y3FE 3ANTA 4PZUA 3SQNA 3TB6A 3V4VB 4ZT5A 1JFVA 1JUDA 4M0EA 3EZ9A 1Q3HA 3KUDA 4QFBA 2PMEA 1PUIA 5HYVA 3RFCA 4J6FA 1SBCA 2DKFA 3A6ZA 3N2KA 2XMBA 4NYJR 1YBMA 3EY4A 1T43A 2HOQA 1RKUA 4MHOA 1E6KA 3RVOA 4BCBA 3AI3A 3OD1A 4MKXA 3C8UA 2JJMA 1M34A 1JHUA 5M29A 4FDUA 3AVQA 4W99A 4Z4CA 1NAHA 3GUHA 3O8QA 3OCUA 1XU4A 4PVDA 2CJPA 2IH4A 3MQ4A 1CR2A 4PX9A 4B3BA 3IPYA 5DSTA 1Z22A 4PG4A 1UC4B 3TSZA 2OCBA 2F90A 3FG9A 5TQ0B 1OYWA 2G5GX 3FDZA 4WXMA 3OFJA 4G5XA 1ZW6A 4M8SA 2YASA 5JARA 1J7JA 4WCDA 1PUJA 3SSMA 2YJ4A 1ND6A 1RABA 1K5GA 4UQLA 1HBJA 5AKJA 4Z0NA 1A2BA 1DINA 2FE4A 1ZZGA 2GZSA 1ZP6A 1QVWA 4Q21A 3TQTA 3UY4A 3IKTA 4N7BA 3H6HA 1RYNA 1GQYA 1N2CA 1WZUA 1M0WA 3DFZA 1UC9A 3DEJA 4GZLA 3UWMA 1FP6A 1HXHA 2OMEA 2PT5A 2J09A 4RZ2A 5J5CA 4DQXA 1YI1A 3R0VA 4L72A 4RWZA 4OSPA 5HDBB 3ZBQA 4RPHA 2HNBA 4R1PA 2QXTA 3DMGA 4PTLA 3BQ9A 2CNWD 3EVTA 3UV7A 1GAEO 3OIGA 3NBXX 4HUJA 4RXUA 2Y6UA 3ISTA 3ICOA 4EYEA 1G21A 2GBPA 2OWDA 1UEIA 2I76A 1UINA 1UP6A 4IFTA 2RAPA 3UW1A 1CSEE 4CR8A 1R6UA 3H8JA 2AQ8A 3R5FA 1MV5A 5H3CA 2C5AA 3BWXA 3BWDD 3FSGA 3T54A 2IZ7A 1I3NA 1KIFA 2QVXX 4X00A 4H59A 1LEHA 4NKRA 2D5CA 1U5AA 2C9CA 5AP9A 2C3MA 3A1SA 3W5DA 1KMMA 1C3XA 1LU9A 3AUSA 3PFGA 4Y2XA 3QVKA 5IHPA 1P6QA 1T25A 3EZYA 1D2AA 2D2EA 2ZYUX 1IC6A 1J9ZA 1S3SA 2YNMC 4MUAA 1HE4A 4EHAA 2OFWA 2BI7A 1Q7RA 2OG2A 4JC4A 4RKQA 3TNJA 1KVQA 3GLGB 3FW1A 5D8DA 1OR8A 4RA6A 1FLNA 3F9RA 1Q0HA 3EGXB 4GLJA 2UZ1B 1VLMA 1R3DA 3LSTA 4K9SA 4MB0A 5HGXA 1FJXA 1RRVA 3EPLA 1R4MA 4LVNA 5C5CA 5JFTA 3DLBA 2XTJA 3FI0A 3E2MA 5IBPA 3AV0B 4BFXA 1B42A 5IDQA 2C2HA 3SX0A 1YZYA 4MP6A 3HB9A 5DM0A 3PF9A 3H0EA 4LF6B 1PJQA 2DSNA 1C9NA 2DQYA 3EBLA 3CZ4A 2YZKA 2XRZA 1UK9A 5DN6A 1G8FA 3WWPA 2QUJA 4LUCA 4C06A 1HOTA 1P9RA 4MW1A 3V4PB 1MV8A 1XAHA 1KMCA 1B26A 1ZNYA 2J0VA 1Y8QB 1V26A 3TAHA 2EL9A 1I1QB 2OTCA 4C2BA 2HDWA 1ZG3A 3QEMA 4GEGA 5CDHA 1GPYA 1MQ9A 3NV7A 3I1IA 3EZGA 2GZAA 4RY0A 3OQBA 1WKVA 2IPXA 2NXWA 2G28A 1PV1A 1JKFA 4WJKB 4DLLA 2HPZA 3CE6A 4ND4A 4YAGA 3ZLBA 3OM0A 1YZ3A 2V96A 3ZDAA 4BNUA 1ZA2A 2FMHA 2QS9A 4B7XA 2HJGA 3ISJA 3IESA 3IUEA 1E32A 1EFPB 1LF5A 1QFXA 1O5OA 2IF0A 3L8GA 4UC0A 4ZRDA 4ZVKA 3VO2A 4OI2A 5ES4B 2BEVB 2EDCA 3HB5X 1XZAA 3FCXA 2EKZA 1YSCA 2YTZA 4Q01A 4DYVA 3GAFA 4YV0A 1QLJA 2FVXA 3KPVA 3M82A 2TMDA 2C8LA 4ZCPA 1A8PA 1LDYA 5JPDA 3NTXA 3HFGA 3AF3A 3T1VA 2H48A 3QI2A 4OD0A 2PKQO 1ZK3A 2OO5A 4V0OA 2XWPA 3DDCA 5HUQA 4XCQA 2BKLA 3EZNA 4NZOA 4F8YA 1V16B 5IMBA 5A2QA 5CB4A 2DB3A 2V59A 2JIOA 2CK3D 4JXJA 3STUA 5AKZA 4GUDA 4RD1A 2IYZA 4EJSA 4FFVA 5KNCH 4JB8A 2BFOA 3VR2D 3NTVA 3GFFA 4H1HA 3VTAA 2DETA 1NBMA 1TJ4A 2O8FB 1TUGA 2LP4Y 4XGIA 5HZMA 1O3YA 1FQKA 3KV1A 1WCV1 4QUHA 3VNAA 3H87A 4GPBA 2GVNA 4PCAA 4CV2A 4EFLA 5KJ1A 3H16A 5L9AA 1PYOA 1JWAB 1ZL2A 1VRCA 2EJCA 3C14C 4XDYA 5E1BA 1Q92A 2PGDA 2Z3ZA 4UUBA 5G4KB 4AJPA 5FWNA 1QHNA 1VLVA 1K2VN 3PPYA 4L8GA 4J9UE 2GPAA 1QVZA 3SR3A 5LZ2A 3HNOA 1F7VA 4OI0A 2H7CA 2YICA 2FUG1 3D5QA 2IWRA 3AOGA 5J58A 3E9YA 2XA1A 1Z2NX 2EEZA 5AJYA 1XP5A 2XDYA 2X8WA 3AEQA 1WM1A 3PDJA 4S1WA 2R84A 5GMOA 1O96B 2W4QA 1AGYA 4ZAZA 4RFSB 4YDRA 2IWHA 4ND6A 5AKIA 2QD5A 2BOVA 1MT0A 2ZWVA 3IMGA 3KTAB 4LFCB 4BLRA 2ONYA 1DXYA 1U8CB 3H5AA 4TWIA 1GSAA 2XWSA 4Y1EA 1IZ8A 3ZWVA 2BSAA 1MDBA 2C2KA 1D2EA 2PXAA 3IALA 1G8PA 4FIZA 5DM1A 1E0JA 1YDMA 1YL7A 3VVBA 5BWCA 4KQEA 1T4CB 3M5DA 3P97A 1MVLA 4CN8A 1TTPB 2H63A 4KXVA 4RK1A 2BGRA 3VPHA 4CTNA 2I1LA 3OI7A 1V8DA 2R8ZA 5ICGA 1SVOA 1DKQA 1KQPA 4G23A 3DKIA 1FQJA 2VRWA 3RU2A 4GIBA 2V7QD 3RS4A 2O1XA 2PZFA 3K8OE 2V7XA 1RWBA 2JCVA 1A96A 3M9WA 3PFCA 2ISSD 2WJAA 5AJZA 3MAGA 2RKWA 3C85A 3N59A 4XZ3A 3GH3A 1PSWA 2G09A 1TCAA 4EKIA 2H1CA 3OMLA 4HEJA 4KI7A 4C1BA 4LZWA 3MLBA 3RANA 3ABZA 3QELB 4EY4A 4ALIA 4OPMA 4RENA 3JYLA 4MR7A 2P3QA 4Q9NA 5JCOA 3T94A 2D13A 2J9FA 5K2MA 1VHTA 1KI6B 4DCCA 2HFJA 4DEXA 1IXZA 1QZUA 4KRXA 5ALVA 5HNKA 3BILA 2Q7OE 2FEWB 1ESZA 4C89A 1WXXA 4F3TA 3WYGA 2G9VA 3EQZA 1KYQA 3M6FA 4K9KA 1QWOA 1P62B 1XWWA 1P73A 2V98A 1YJBA 1ZXXA 5FOWA 5F7JA 1JTVA 2AJLI 4XM2A 3WYFA 2UDPA 1PL0A 3CTMA 4Q4JA 4UU8A 3VSDA 1SHTX 1PHRA 2YHIB 3L7LA 3L0SA 4UMEA 3IMEA 2O1SA 3BE5A 4OLHA 3IERA 3M3HA 2XY4A 2B1IA 3T0FA 3RYCA 4C4SA 4LRWA 1DQZA 2A1TS 4M8NE 5DBGA 3NXSA 4K9QA 3IC5A 3OWOA 2QLJA 3DD1A 4HZUB 2PO7A 3EA0A 4WN9A 1CVIA 4I9UA 3U61B 1B0PA 3QHQA 1FDIA 2O8EB 5JSQA 1UJBA 5JCJA 4OQLA 1T3HA 2BM1A 2X0KA 3NBFA 1EVIA 1FDSA 3ESZA 4JYZA 3NEYA 1W2HA 2FMIA 1QP7A 4HDKA 1Z2EA 4YCNA 1C14A 4ILKA 1QYXA 1ZI8A 1OBCA 2HA0A 2PS1A 2WVGA 1KAMA 4V0RA 2B0JA 3UEOA 3DO5A 13PKA 2OQRA 1YU9A 4UM8B 3MXTA 5E6RB 5FQOA 4JJ7A 2VXOA 3Q5DA 2SKDA 3K5HA 3ONEA 1C0PA 2HM7A 3R7NA 4HYTA 4F6CA 4NJMB 3K6SB 1XZMA 3QX8A 1M2EA 2PQ0A 3BIJA 1NFQA 2GPYA 3C1OA 4BQRA 5I4CA 5EXXA 5FBWB 4CKCB 4H0FA 3TZBA 2I2XB 2WFLB 4K6CA 3GUCA 1N2EA 1DBVO 1DAKA 4GX5A 1O94A 3MMNA 3WK8A 5DN9A 5KNBA 3OOEA 1WZNA 3ZDBA 1VYUA 2CHGA 4LGYA 1H4TA 2ZQ5A 2JCXA 3IUQA 3U1VA 1HDXA 3IB6A 2DJ5A 1F2UB 5T8KA 4WEOA 1OX6A 2G5TA 4NBKA 3I2YX 3H11A 1DOAA 1E1DA 1SC1A 4OQPA 2GF9A 4EMUA 3JQ9C 5YASA 5E6UA 2TRSB 3OE7A 1NY5A 2C5LA 1KWKA 1IIRA 3IPRA 2DP4E 4ZANA 4OXKA 2AW5A 4F4HA 1IHDA 1N6IA 2AE1A 2XCQA 4HGQA 4MS3A 4FCCA 5AJTA 1OLXB 4EEZA 5HJ7A 1ODJA 2W42A 2OESA 2G80A 1EZZA 3EIHA 5IC5A 2EZUA 3U4GA 4C0AC 5DGTA 4OHPA 5DTEA 1C1XB 1QJCA 1HV8A 4B3GA 4IYRA 2RKOA 2I4RA 1U1IA 2XB8A 3G85A 4IUYA 4ZOCA 1AB5A 1DPFA 4YROA 4BN4A 4R83A 4RJJA 3U09A 4IUDS 1PS0A 3L4KA 1ULHA 3I3SR 1NW4A 5HBGA 4KUEA 3W4KA 1R00A 5LD2B 2QTVA 2F4VB 4ZZ0A 1Z0ZA 4J6EA 4ENPA 2PUWA 3UHPA 4YIKA 4IM7A 3SIPA 5KSYA 3FCYA 5IABA 2Q5CA 1XBTA 2CMFA 3OSZA 4LZJA 4WERA 3A4NA 4QT0A 3GPIA 2ZUUA 4QAQA 4Y0VA 4JI8B 1RRCA 4H7HA 4J0HA 4UTOA 2R9VA 5L3ZA 4EB6A 3L01A 1GIAA 5TR9A 4Q12A 4YP5A 3U2QA 4D4GA 4PG7A 2AC2A 1R66A 2ZSBA 4YCAA 4MV6A 4R9VA 2CL6X 2MU1A 2A8YA 4IIEA 2CW5A 1GWNA 2IQ5A 3CLRC 4M1KA 3VC7A 2R00A 4IDEA 5BN4A 1R8QA 1M6WA 4Q9AA 1Y4AE 1KZ7B 1GVHA 2GSDA 5HPYB 3RG8A 5LQAA 2NZVG 1OU4A 3TJRA 5HA5A 2HJVA 1ODKA 2QP4A 4TV8A 3EEFA 2ORWA 3FPHA 4XX1A 1M0EA 2W58A 4CL3A 5LD2C 5DTIA 2F55A 4XRRA 4OGLA 3VU1A 3WLKX 2BHSA 3UA4A 4A8TA 3W5SA 1UBOS 2J8ZA 4AF8A 1YOVA 2AG1A 3NBYC 3WB1A 5KNDH 4XWGA 2C97A 3W0LB 5DNYB 4UVHA 1LDNA 4YVFA 4YQEA 3P0JA 3IVRA 1HM5A 1ENOA 2EJUA 4LSGA 3TAUA 2H08A 3PC6A 4M2LA 1PI3A 1N3IA 1KQOA 3UK1A 5KNCA 3L0IB 4J9VA 1VHDA 4GPTA 1J5XA 4B40A 1Z0KA 3QWBA 1MB2A 1WTCA 3WNVA 3PD7A 1CR6A 4RHFA 2PLWA 4CKWB 2BBOA 1C7QA 1J2EA 4ZDJA 3DF7A 1HH4A 4JLNA 1QANA 1YNOA 3JWJA 2K6GA 1V1MB 3EVEA 4IH4A 4LPSA 3IIEA 1VJ5A 2JI9A 3HM9A 3SZLA 1QZZA 3U56A 3RBXA 4DLPA 5CLFA 1C9KA 1EFUA 3AFHA 2BDUA 1EVZA 4P5DA 4O3FA 3B6JA 4J29A 3OZ7A 1F0NA 1GILA 4JGIA 4OA5A 5FWDA 4C7KA 2AJ8A 1Z5UA 4L4YA 3O31A 4ZJPA 1FZTA 4EUSA 2QN1A 3PNYA 2YQ4A 1G7SA 2C00A 1FDUA 2EBUA 3QBTA 3GRKA 2GYVA 2C98A 4WXEA 1QP4A 1EVJA 1GNPA 1SCDA 3HVKA 1XK6A 2QM0A 3QVOA 1Z4MA 5DLEA 4AUKA 4MDEA 1RKVA 3O8RA 4WV3A 3F6EX 3FCAA 3O9ZA 4JI3B 4GC5A 5HW0A 5C31A 1I80A 4US2R 2H4XA 2R8XA 1L4HA 4HAWA 1D8AA 1ACMA 3FIJA 3RR2A 2HMWA 2NUAA 2QJFA 3FYUC 4UUAA 2CYAA 2G9UA 2SCUA 3PKJA 2Q6VA 2QYHA 3RK4A 2FNAA 1NZFA 1ZESA 3V00A 2GQ0A 3OT4A 1PQ4A 1JQBA 4LVOA 4D80A 2NVWA 2B2CA 3G1UA 4LFAB 1JR3E 1KY2A 2WU3A 1NNUA 2PGLA 3A2KA 3HZZA 4QPDA 2FDXA 4FD3A 4M8IA 1H9CA 1W2GA 3RV3A 2ASVA 4L8WB 5EZQA 4XQGA 3VZDA 4GSYA 5KJ6A 2RGDA 4HTFB 5EEHA 1TUBB 2OORC 3ENVA 5TX7A 3CUSA 1DBRA 2Q4EA 5HIAA 3P7MA 5I8ZA 1SB8A 1UMBB 3LWZA 1QRDA 1TOAA 3GLKA 4PN3A 4HNSA 3UB2A 1Z07A 1S02A 2R7MA 1PTKA 1TUIA 2DAPA 3GLQA 1OT3A 1I3MA 1PR2A 4XUCA 1TM4E 2VTVA 5H82A 4Z9BA 2FETA 4QEDA 4YT2A 4BOYA 3V1NA 1M2OB 1P4RA 3RC1A 2ROQA 4Y9SA 1PFKA 3K5WA 1NE2A 2YUIA 3OKFA 5KYUB 4B8YA 4DR5B 5C52B 5TIIA 4YV2A 4TKLA 4AB1A 1BWSA 3GT4A 4O0MA 2WP8J 1CLUA 5KQGA 2C92A 2CL0X 1NKVA 2C84A 3ORRA 1OXXK 4QGGA 1Z28A 1IDN1 7GPBA 3EQ8A 4DANA 4TYNA 1SCIA 1SHUX 4TXHA 3PWKA 1VYVA 3I5AA 5LP6B 1CFZA 2YRXA 4OFZA 4OKNA 1WSDA 5AOVA 3SBEA 1EAYA 2H1RA 2IHTA 3KS9A 3MD0A 4M0PA 1IN8A 2LKCA 2R48A 1CRWG 4PFQA 3ZXSA 4QOHA 4F3RA 4KPYA 3L05A 4KXQA 2PTHA 3HU1A 4F4DA 2PJZA 3FA2A 3GL9A 1XZQA 4PFKA 1XTSA 1SKBA 2ZYRA 1PS8A 4K9MA 5CVDA 2WMYA 2YUTA 3WL5A 3Q40A 4DV1B 5EQFA 2A9KA 1BU8A 5GOZA 1DJOA 3RLFA 2ZJ1A 3P8ZA 4IXDA 4ZALA 2PBFA 3I9OA 4N0EA 5HOEA 2AJBA 4LZPA 2J48A 3MS7A 4Q37A 2XDQB 5GVRA 1LJUA 5C8YF 4YUYA 5K0CA 3ZNOA 3QV1A 5FLYA 3U80A 4H08A 1ZSVA 4UHEA 3UO8B 3IBGA 3AV3A 1YUNA 3I61A 3QUSA 4DLBA 3AG5A 1CUIA 2VUSA 2ZT8A 3P26A 4KH0A 4QUBA 3GEEA 3AESA 5EZYB 6NULA 3ISVA 2ZANA 1OILA 2C95A 2MMGA 1OD6A 2BGNA 4IIJA 3W5UA 1GAQA 5LP6C 5JAQA 3V7FA 4TVKA 4KR2A 2GBIA 3OP4A 3R9WA 4KQMA 3RHFA 1E2NA 3AQIA 3R41A 1E7QA 4KX5A 1LB1B 2HT6A 2NGRA 3MBKA 2GCNA 3LTEA 1N2ZA 1QGOA 4JC0A 1VHQA 5LBUA 3TKYA 1C9YA 2FKNA 4F6RB 1SD2A 1NM5C 2NU8B 3LLUA 2A5JA 1QYRA 4BHTA 4B84A 2E48A 2PUAA 1PR3A 2VSXA 1UJMA 2G71A 3C41J 4BB0A 1K27A 1BGWA 1Q1ZA 3GJSA 2UYQA 3DH0A 3ZZ0A 4J8PA 2C3UA 3DZCA 3C3YA 1LFDB 1AS2A 5CJ2A 1A5AB 4QHSA 1J2YA 4V3CA 2HMYB 4EX6A 1QX3A 3U4QA 4C20A 2YFHA 2R25B 1O97D 4UZSA 4XLTA 2D00A 1BE0A 1K7XB 1RI2A 3JZDA 1L2TA 4IS3A 4Y2JA 3TRKA 1AKQA 1C4KA 4KSBA 5EOVA 2X5NA 1NQVA 4BMXA 5FFNA 4Y2PA 3PG5A 2G9NA 3SFTA 1H3EA 2NO7A 2BFMA 1U0OC 2PQ2A 2ZI9A 1ORRA 3KSMA 5ALWA 3NOQA 4UBNA 3OCWA 3D8HA 3W2HA 2J3DA 5FLXA 4QEKA 1W5FA 3UV6A 5A3VA 1RYZA 2VZEA 1NJFA 4A10A 2QHXA 3JWIA 2J0UB 3L7DA 5E9QA 1V5WA 1IXYA 3LBHA 2BC9A 2WUVA 1GV0A 5E3JA 2O0LA 2EVWX 1L5OA 1VL0A 3MJSA 3S68A 3O4VA 1MO4A 2KJQA 4FEEA 4FFWA 3ZEIA 3ZR4B 1XNQB 3F7OA 3AKYA 3FZNA 1EESA 3HP1A 3MUNA 4XQEA 5KWIA 4RF2A 4B4UA 2Z2KA 2ZIUB 4WI1A 3WGNA 1A82A 1KY4A 4AWAA 6REQA 5K4HA 2AGVA 2Q8PA 2XMPA 3ASUA 3FCOA 4LISA 4CQNA 5H7XA 1XRQA 1KYZA 4ND2A 4B48A 2CBGA 4OY3A 3DBRB 2P2GA 1LLDA 2GPBA 1I24A 1C4XA 1N9GA 3SLKA 3SS7X 1Q57A 3DDUA 4MQBA 3EK2A 4MVJD 2IXBA 1KAQA 2NXCA 4HX5A 4DCOA 5FPYA 1BWPA 2DWUA 3GLTA 2FP3A 3HKEA 3NTQA 4PQFA 4S1VA 3G2NA 3KAKA 5DO9A 1D5CA 4C4TA 3PUHA 4EFNA 2ZS7A 5KU1A 5IM5A 4BZQA 3KOZA 5CCBA 3DT9A 3TTUA 2I2CA 4PCUA 3HRIA 3HFJA 1TIBA 4CCAA 1TC1A 1NX9A 1USIA 2C4NA 4DPKA 1ODTC 3CV3A 1BE1A 2DSTA 3HR4A 5CITA 2F2TA 3S7TA 1L3IA 3DZKA 3S2YA 4L57A 5ERXA 1NW9B 4W9MC 1X7ZA 4H3SA 2IZ6A 5LDDC 1HFJA 2Q6IA 2ZI6A 4Y2HA 2BFFA 1GNLA 2FPMA 2IIPA 4E94A 5FAKA 1E9BA 5JYDA 1MPTA 1NN0A 4LY3A 2PX0A 4DYDA 3LM8A 4WA7A 4B87A 3SC4A 3Q3GE 1WDTA 5BORA 2EFCB 3DR3A 4ZV7A 4FW9A 1CNEA 1OFUX 1SVUA 3L0YA 1C8BA 4TYQA 4X1IA 4DVGA 3N86A 5EKSA 1V11B 3LY9A 5CA0B 3OFNA 1PD0A 4A2PA 3N70A 3R8FA 4KLRA 5NULA 3ZC3A 1TJNA 2QW1A 3GVHA 4RK5A 1AM4D 2O9JA 1QF7A 1UKAA 3U7JA 2IDZA 4HS9A 2YMPA 2QZSA 1KI3A 5D5QA 2CLHB 1KZ1A 4L08A 5C1DA 2I62A 1X3SA 3MUEA 4D8WA 4WESB 4AZVA 3ESBA 2WKRA 4GBMA 5AQEA 4LCEA 2I5PO 4F1KA 2Q3MA 1MD9A 3DLIA 3NT5A 4M3NA 1AV7A 1CS4C 3B51X 1VHLA 2R79A 1BJRE 4J1QA 3TTVA 4BNTA 1W36B 3ORQA 3ECAA 3UN1A 3AVWA 3WL7A 1FP7A 1ZOPA 3NHJA 1PT8A 2DQKA 2OG1A 2J3LA 2X15A 1KQFA 4ND8B 3IOCA 3IMCA 1Z7YA 1OYOA 1KJWA 1MAAA 1ND5A 2YMLA 3BXOA 2Z6VA 1S9DA 4DV5B 3D8SA 3QBVA 3AR3A 4HAVA 3RVNA 4B3XA 1IQUA 3DDSA 1UPBA 3KD3A 3IQEA 1EJ2A 1NV9A 2G76A 3S70A 2P5YA 3QUQA 2N0SA 3UOAB 3H1GA 1E5XA 3OQMA 4UUNA 3RIXA 2O0JA 2E49A 1QNLA 3BE4A 3AHEA 2ZS8A 3KYBA 1JLSA 3MIIA 3NORA 5CCEA 4W5QA 2YRWA 4E6EA 721PA 4D9BA 1E62A 1NPYA 1FX0A 1GSHA 2X6QA 3T5BA 2J67A 3NP7A 1ISGA 2WJIA 4J94A 4JROA 4H2DA 3ZZTA 1BVRA