2JCSA

Active site mutant of dnk from d. melanogaster with dttp bound
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
198
structure length
198
Chain Sequence
b'TKYAEGTQPFTVLIEGNIGSGKTTYLNHFEKYKNDICLLTDPVEKWRNVNGVNLLELMYKDPKKWAMPFQSYVTLTMLQSHTAPTNKKLKIMERSIFSARYCFVENMRRNGSLEQGMYNTLEEWYKFIEESIHVQADLIIYLRTSPEVAYERIRQRARSEESCVPLKYLQELHELHEDWLIHQRRPQSCKVLVLDADL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DEOXYNUCLEOSIDE KINASE
publication title Functional Studies of Active-Site Mutants from Drosophila Melanogaster Deoxyribonucleoside Kinase. Investigations of the Putative Catalytic Glutamate- Arginine Pair and of Residues Responsible for Substrate Specificity.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transferase
total genus 75
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature ec 2.7.1.145: Deoxynucleoside kinase.
pdb deposition date 2007-01-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2jcsA00
1N6LA 1E4YA 3IILA 3EPJA 3L0SA 3QOFA 5JZVA 4AG5A 3K09C 2IBMA 2QP3A 1G8GA 2FV8A 1HYQA 5EP1A 3HU1A 4H9GA 4ERNA 2XNDD 3G82C 5EE5B 3LQQA 2J3EA 3B1ZA 1XFAA 1JB1A 2ZRHA 4YLGA 2V1XA 1N6RA 1N5IA 3CRRA 1T5LA 2Z0MA 5A4JA 5G41A 3T5GA 4CT4B 2FPLA 2WWWA 2CHQA 2F1IA 1E9CA 4JMPA 4B71A 2ZI7A 1EFRA 2AD1A 2PL3A 3AVXA 1QG4A 1D2EA 3QF4B 1CJKC 1E1QA 2QQ0A 4AKEA 4W9MC 5DI9A 3ADKA 1JXMA 1HTWA 1OKKD 2QT1A 5LBIA 4P4TA 5FOWA 1NBMA 3BH6A 4TMZA 2NMVA 4Q1AA 5KNDA 3CW2A 2QP9X 5FPSA 2XXAA 4FWTA 1Q1BA 1N6PA 4ESVA 2PT5A 1KSHA 4QRHA 4TMVA 4C0LA 5AUQA 3ZGXA 1G5RA 5GJVC 1IN7A 2W2VA 2YWFA 4V0NA 3SJAA 2QBYA 3RVBA 3KQNA 3TW8B 2CMKA 2YC4C 4EJSB 3P26A 1XEWY 2ZS9A 2ODEA 1XU4A 5D3QA 4A0RA 5JCPA 5C46F 2QM7A 3TE6A 2QAGA 4LOAA 4BRUA 5L3QB 1ESNA 4MUAA 2IWHA 3OIVA 3K1JA 1KDOA 5JEDA 4CEJA 1XEFA 3GLIE 5CLQA 4PHFA 3T12A 4LYAA 3UPUA 2X2EA 2IHYA 5KDOA 4POAA 4BEJA 2FWRA 1LVGA 3AH8A 1COWA 1JECA 3BH7A 1HT1E 5JWHA 2O8BA 4K8OA 4XSGA 1VCNA 4WW0A 4AKGA 3NG1A 5A0FA 4D4KA 4KAXA 1QDEA 3DM9B 3KKMA 3UWOA 1SKQA 2QPOA 4URWR 4C2TA 4DLTA 3GJ8A 1EESA 2QNRA 3BFVA 1ZCAA 4PPQA 4B44A 1LF5A 2GVDC 4M1TA 4TTPA 5FOUA 5HPYB 2ZJ5A 4LHWA 2WWIA 4HUQB 3U4QB 4C30A 3KJIA 2A5FA 3BK7A 3U44A 3FE2A 1OB5A 1G8YA 2AWNA 4D0GA 5FH9A 4KBGA 5AJYA 1R7RA 4LPKA 3ZD6A 3LVQE 2MSDB 4Q7MB 5HE9A 1ZNZA 2VQSA 3K0AB 3TUZC 4TTRA 4DSNA 1IM2A 821PA 2ZJ8A 2F55A 4B32A 3G0HA 3W34A 1TUEA 3CX8A 2R6DA 4MITA 1QHYA 2P5SA 5HZHA 5KTYA 3NXSA 3OZXA 4TN1A 3W6PA 1CR1A 4NU0A 1M74A 1SVIA 2K5UA 3KJGA 2DFKB 4IDHA 4UXJA 4G0NA 4Q21A 1TL7C 3FPAA 2IS6A 3SNHA 3CZQA 2H7VA 1XJ0A 2REOA 5CK5A 3WXMA 1AKEA 4RFVA 5CB8A 3QY0A 5TV2A 1E69A 4UJ5A 1G9XA 1T0JB 3IEUA 1ZNXA 3GFTA 3HR7A 3KXKA 4BRWA 1BO6A 3KFVA 4JSTA 1R8SA 2QTHA 4JL5A 3VQTA 5F2EA 2O0KA 3L82B 2VO1A 1WBDA 1HY3A 2F7SA 3AP2A 3GLHB 1S1MA 1U0LA 3FHOA 5EZ6B 3QXCA 1GKUB 2YYZA 4DZZA 2QMUA 3CH5A 2QGZA 2CVHA 5FBLB 1UKEA 1IY0A 421PA 4K46A 3J81k 3TK1A 3R8FA 2DY1A 2GJAA 5FPYA 1Q57A 5AWFC 2GA8A 2WHXA 2FU5C 1DELA 3U6BA 5JS7A 2I3BA 3ZJYA 1NJGA 3M0EA 1GL7A 2C03A 4IFEA 4URZR 4OI4A 3GLGE 3CONA 4Q1EA 1VHTA 3IPYA 3K8YA 2NO7A 5J4YA 2J45A 1NLZA 1QF9A 1YR6A 2R6CA 2WJGA 2WWGA 4WZ6A 3P4XA 1T3HA 1RC8A 1KYIA 1NMXA 3GEHA 1DAFA 1N0VC 5CDFE 4AK9A 3MRSA 1KMQA 1XRJA 2VSXA 1UPTA 3F0TA 3W5IA 4IHQA 1GRNA 3QNUA 4M22A 4Q48A 2A5DA 1TQ2A 3IGFA 4RZ2A 2J0QA 1GOTA 1NN0A 1Z3IX 1ZM9A 3V9PA 2ZEJA 2W0MA 1N5LA 2N46A 3CWZA 1UKYA 3C5CA 2O8CB 2NOAA 2WPDA 4ARZA 1GG2A 1T8TA 3EPHA 2IYXA 2A78A 4LV6A 5L3VA 2FOLA 4DB2A 1K6MA 4DDVA 1P61B 4HZUA 2ECKA 3P32A 2X2FA 1GFIA 4TLEA 3T1TA 4O2LA 3B9PA 4HAXA 1A2KC 2BHRA 1QHIA 1US8A 2CK3D 2PZEA 3LX8A 1KI8A 4RD6A 5DGXA 4AIIA 2J5XA 4B2PA 4QM6A 3EZ7A 1W47A 4I1UA 4H1VA 3THOA 1QVAA 2ODBA 1J8MF 2G88A 2OE2A 1YZLA 2VHJA 3O47A 4TQ9A 1VYUA 4PAQA 1TMKA 4QNRA 3LQRA 4AYWA 1FP7A 1RFLA 4TL8A 4Q01A 3QKRB 1E2NA 1SVSA 2Q9AA 3U3KA 3N2EA 4HLUC 1XD9A 3W3AA 4TQAA 3I1FA 4V0OA 2IC5A 2YOHA 2YOGA 3RSOA 3QEOA 5CJ2A 4XVUA 621PA 1Q21A 4LV5B 3Q8XB 3IPXA 5KPDA 4NZYA 1BKDR 4Q18A 2C98A 2GBLC 3B1VA 1E2GA 4PO8A 2XZPA 1FFHA 2FZLA 1FPMA 3CX7A 3ADBA 4ZCIA 3QJYA 3BXZA 3EX7C 1TTTA 2GWHA 1TPZA 4M1MA 221PA 3UG7A 4LBYA 3OIYA 4MGKR 4G5OA 2JGNA 4M1KA 2VP4A 2F43A 3E70C 4GPTA 2ZAOA 3Q7QA 4ILEA 1MKYA 4M21A 1NI3A 1OV4A 1G3MA 3GLFB 3KDSE 2WMOB 3WHKA 4RCZA 4JLBA 4BFXA 3RWOA 5HE8A 3CUEF 3AP1A 3UK6A 5CIQA 4Q7KA 4RZUA 4M9SA 3TR5A 3GD7A 2DFTA 1A7JA 4RCYA 1U9IA 4PPFA 2H8KA 1V5WA 3HU2A 5EXTA 1Z29A 1NBMD 4OJQA 4PHTA 2R6GA 4BLQA 5LD2B 4YDHB 2GF9A 4RVCA 1G7TA 4WIAA 5HR5A 1AZTA 2N1BA 4HLDA 4LK2A 5AUPB 2E9SA 2UZ3A 3FWYA 1ZNWA 4MRNA 4JLPA 1UKVY 3MCAA 4LY6A 4NP6A 4WA7A 5K8TA 4TYNA 3PVSA 4CGZA 5J5CA 2P67A 3B1YA 3WMEA 2ZI3A 3P1JA 3IIMA 2Z5FA 1NVWQ 3PEUA 4BLOA 4QJ3A 2IEYA 1Q0UA 1OH8A 5HCNA 2YOFA 2QE7A 3KTAA 2FN4A 4A8JB 1PZNA 4CW7A 1II9A 2IYLD 1UM8A 3PV0A 1YZGA 2JEOA 1DG3A 1PLKA 4HB0A 1ZM3A 4LI0A 1YZUA 1U8ZA 1XMJA 1AS2A 5IRCD 1FOEB 4QJ4A 1COWD 4RKEA 3LW8A 3A8TA 4HI0E 4RZXA 4B3FX 5FFMA 2JJ1A 3G5UA 4GOXA 4OBEA 2Q9CA 4FMCF 3RWMB 2CJWA 2HXSA 2EYQA 1KMHA 2V54A 3MFYA 3RRNA 2FZ4A 4YXWD 1DTSA 1JXOA 2NQ2C 1E2DA 5HKKD 4KI0A 2CLDX 3A6PC 1F2TB 2ZRFA 4LSGA 2B92A 4GMDA 1MO6A 3L0OA 3T34A 4OJKA 2EFEB 2J7PA 4JLAA 1G4AE 3LVRE 2YINC 2REXB 1ZW6A 2F3TA 3HYRA 3L0PA 4GNKA 1KI1A 3TAUA 5SZKB 4A6PA 1XXHB 3A58B 4FXPA 5DE3A 1MOZA 4AG6A 2FSFA 3KQUA 2IL1A 1BIFA 4I99A 1GILA 1N0UA 1RJ9B 1YZTA 1RRCA 3VX4A 1G3UA 4EPYA 4I1SA 4U02A 2IS2A 3AVUA 2D74A 2G0TA 2G6BA 1AGPA 4NCKA 1ZYUA 4Q4AA 4CEIA 2G9NA 3R7WB 2VL7A 4KFSA 1G291 4ZI2A 1J8YF 4UKDA 3NIBA 4DLSA 3KKPA 3CO5A 1GAJA 3NKVA 2IYWA 4GP7A 3IHWA 4N3NA 2GVZC 1G64A 1E2PA 4NTZA 3TIFA 1NNEA 3X1ZA 2J7KA 2HCBA 2P6NA 5DHAA 2JATA 3KJHA 2ZE8A 3NBFA 2YJTD 1OXXK 4JKYA 4A2WA 1CJUC 3A4MA 4Q1DA 2FE4A 5FUWA 5AJVB 2PH1A 4CEHB 1Q3TA 1VECA 3CF6R 1ELOA 1OH5A 1VCIA 2IYRA 2NO6A 2CE2X 3B60A 4HDCA 2YZ2A 4IRUB 1TU4A 3AQ4A 4YMUA 1N6OA 5G53C 1OT3A 4A0GA 1SXJC 2WIBA 1AKYA 2AFHE 2FFBA 1KKLA 3IIJA 5K8UA 2R44A 1RYHA 1W4CA 3QKUA 2QMOA 5LB2A 3D6TB 2IWRA 4PPNA 4V0KA 2BMEA 2MSCB 2RHMA 2HF8A 1H8HA 3TSWA 2P6UA 2WWXA 4RD0A 4OQLA 2KWIA 4X8MA 5JECA 2ZRDA 3H86A 1DEKA 3FMPB 1XD2B 1F5NA 4LJAA 2BMFA 1Z28A 2W0SA 3PEWA 2GJ8A 5FPTA 3ZVLA 4DCNA 2CLSA 1G19A 4NCIA 1SVKA 1S3SA 2PX0A 3BAFA 1L2TA 4TT3A 4BZXA 3THYB 4OQMA 3GP8A 3VR4A 2QT0A 2V9PA 2HV8A 2Z4RA 3BGWA 1OJLA 1R10A 1AS3A 3IO5A 4JS0A 3QF4A 1XZPA 2RGXA 2WZQA 2HYIC 1W44A 1XBTA 2EW1A 3WHLA 1M2OB 3CM0A 1CS4C 2ANCA 3W6NA 4II7A 2H92A 3HJNA 2QRNA 2OESA 2OSBA 3RS0A 3MJRA 1G4UR 4TL6A 2F6RA 1SXJE 2WJJA 3NDPA 4JJZA 3B2EA 2ZU6A 4BLRA 2AK2A 4MRRA 1ZUNB 4QJ5A 5DIFA 2ZJBA 1E0KA 2PEZA 5JLJA 4EJSA 5J40A 1Z6TA 4IVPA 3W90A 1IAQA 4GFDA 4UNNA 3SN6A 2GAAA 3LLUA 4ZI3A 2ZE6A 1KI9A 1BH2A 5AK0A 5L3QA 1P62B 2F1RA 1YJ5A 3AVTA 4PZZA 3CX6A 5DYIA 3TRFA 3BD9A 3SQWA 2QU8A 1TUIA 2JDID 2JLQA 1YHNA 2JAQA 4NONA 2G1KA 1JR6A 3REGA 2IS1A 2CL7X 4BLPA 2IT1A 4D0LB 2QAGC 1SQ5A 4NYJQ 1Q1ZA 3ETLA 4JVNA 5LDDC 5P21A 5IHPA 1BMFD 2RKOA 1XTSA 2QY9A 2IA5A 1UBCA 5FPKA 4QC2A 1U0JA 3SI7A 2PZFA 3U4QA 1G5TA 4MKFA 3AP3A 4HB4A 4NYJR 1WBBA 3O8DA 3TW4A 1Z5ZA 3BIFA 5LPNA 3AVVA 2O0JA 3SHWA 2BBOA 2DWQA 2VP2A 3IUYA 3PJRA 1G17A 3K0AA 3UIEA 4O25A 2OAP1 4GI7A 5G40A 2ORWA 1ZU4A 3EPLA 1KTVA 4CYMA 1ONBA 2EFHB 1CXZA 4K81B 3CRMA 4V03A 4R98A 1E9RA 4A2PA 1EXMA 3P20A 1FZQA 5JWRA 2PBRA 2GZDA 2Q3MA 4IXNA 1KI7A 4QBHA 5CJPA 5FR2A 2FPMA 3FFAA 2VSFA 1DG1G 4FINA 4MKIA 3VR1A 1HV8A 3SJCA 2XZLA 3BERA 4Q5IA 5G3ZA 2J9RA 1XJQA 1OB2A 2O8DB 4I4LA 1Q3HA 1GL6A 2BKEA 2RGCA 3AKCA 1XP8A 4Q7JB 1W36D 1OIVA 2F9LA 3OEHA 1S3GA 4Z8YA 1G6OA 2W00A 2HJVA 2GCOB 3UXMA 2JJ1D 3AKYA 2J87A 2JLVA 4Q9JA 3GLHA 2ONKA 1KNQA 2BKUA 2DBYA 1ZD9A 1O3YA 1T9HA 1TEVA 4NPHA 1IQPA 2V6JA 2ZYVX 3RAPR 2G83A 1VCOA 2D62A 4V0LA 2V3CC 2BBTA 2G1JA 5FUYA 1WQ1R 2RGGA 1H8EA 2B21A 4XWOA 5BN5A 2J7PD 2ZRGA 3I32A 5FBRB 4GMXA 3SJBA 3GLGB 3CR7A 1E2EA 2VIIA 2IYSA 1OXVA 4C0JA 1E6CA 5KO2A 1GIAA 4FCTA 1P72A 3EARA 2VHTA 1N6KA 2OCAA 3FDIA 3ICQB 3B78A 1OF1A 2D2FA 4KLNA 1IJEA 5B58C 2WMNB 2GAOA 4RY2A 3N2IA 4ZPXA 5J4HA 1W7AA 3FHTA 1P2TA 1PUIA 4O0MA 1XCPA 2ZSFA 2PJZA 1E96A 4B33A 1Z6GA 3LA6A 4JLVA 1UBEA 2PX3A 5C18A 1YR7A 3IEVA 3R9IA 2UZIR 2YWHA 3TMKA 3EZ9A 3AF2A 2XTMA 5KDDA 1FQJA 2WKRA 3RS4A 2O8CA 4HAUA 4BPBA 2YV5A 1G1MA 1C1YA 1EFTA 4L4UA 1AS0A 2ZANA 2RGNA 2WICA 3QUSA 4Q03A 2CK3A 1D2MA 4OQNA 5FOVA 5KUTA 4KYUA 4YC7A 3CLVA 2QP4A 3K70B 1EFUA 1NY5A 2I1VB 1DO2A 4JYBA 1YE8A 3RYTC 4ZV4A 2OBNA 3FVQA 2QG6A 2ZS8A 4DSTA 2FGJA 5K8LA 3QXXA 4QHYA 5L3RA 4MKHA 3LV8A 1PUJA 2FSIA 4E5UA 2OAQ1 1G7CA 4JBXA 3OFND 1U0HC 4P0TA 4LC0A 1CR0A 2LKCA 1G7SA 3GJ4A 2JLUA 2GCPA 3QKRA 4LJ5A 4B6EA 1KOFA 2RAPA 2GEUA 4DRZA 4ZDJA 1AQUA 5IDVA 5KOYA 2OFWA 2ORVA 2VTKA 4QM7A 4CVNA 4PC6A 4M2LA 2C04A 4LJ9A 1H8HD 1BOFA 3I61A 1E3MA 3K0CA 2REBA 1GTVA 2CEAA 2VH5R 3JZAA 1JI0A 1XF9A 5FUVA 2AN9A 2XEXA 2FSGA 2L0XA 1IXRC 4JSYA 1A2BA 4F91B 2UVQA 4A1FA 1XMVA 3LXRA 1CRPA 1R4AA 1UDXA 2J0UB 3EIHA 1NKSA 4TT3D 4AY2A 2OFXA 2C8VA 1Q1QA 4A2QA 4OQFA 1XCMA 3TR0A 3EXAA 3CRQA 3GLFA 1MO4A 1ANKA 2WSMA 4JLKA 3ZQ6A 1Q12A 1LS1A 4JIMA 1VTKA 4OK3A 3W6OA 1NY6A 1UADA 4BWYA 3F8TA 2NZJA 2J0SA 4IJMA 4PANA 2XTNA 2JJ2A 3PUVA 2D7CA 4ZCMA 4C4PA 4NCHA 2GESA 3QE0A 3TVTA 1E9SA 2R2AA 4U00A 2R8RA 4M1OA 2FMXA 4FW9A 4GBMA 4DC9A 2WTUA 4FMCB 1E9EA 1M7GA 4TLBA 4IFBA 3EA0A 4G5GA 1ZINA 3B85A 2ZYTX 3QI2A 5KSPA 4M1WA 2GEDA 4FCWA 4LWZA 2QPTA 1T91A 2D4HA 4PQYA 4BUJA 1AJEA 2BM1A 3UATA 3H4MA 1IHUA 5AJXA 4RD3A 5EE9A 4EPRA 3ZLJA 1YQTA 2H57A 1XEXB 2V4ZA 3Q3JB 3X1WA 3SU8A 3T1QA 1GITA 5FTNA 1ZVQA 4JKIA 3ZVNA 2V7QA 1P75A 1PLLA 2BC9A 2ZI9A 4M9ZA 4F7WA 3CIOA 4YXWA 2RB4A 3B6EA 4ACBA 4MYTA 4ZO4A 4DLRA 1E2FA 3EWAA 2QAJA 4X8OA 3BB3A 1N3BA 3BH0A 4Q02A 5HKKA 1AM4D 1YRBA 1Z8FA 3RRMA 4GRAA 4Z54A 3LFUA 3LWNA 2ASEA 4U7DA 1VDZA 3EG5A 1TX4B 1WA5A 3EIEA 3QXSA 1W36C 2GKSA 1F2TA 4LUCA 4DEYA 2E1RA 4BEBA 2JLZA 1W2HA 2ZETA 4YMSA 1EWRA 4URYR 5TY0A 3TAHA 3AF0A 4WXRA 5BN3A 4F4JA 1G6HA 2OBMA 1UBGA 4TL7A 1XXHA 1P4SA 4FWIB 5BYKA 3CB4A 5B64A 2X19A 4MRPA 4IDOA 1KDPA 4N1AA 4LPSA 3FMOB 3JVVA 1XTQA 2DFNA 3I72A 1RJ9A 4JL8A 3ZYCA 4KXFB 1MT0A 4LC1A 1E1RD 5F3WB 4DCSA 4YMVA 2RHDA 1R0ZA 3R7WA 2ZJAA 3CKLA 1JQLB 4DCUA 3DZDA 2IYVA 3CPJB 3R9XA 4P3YA 1IY2A 1X8KA 4Q9IA 5BQ5A 5L3SB 2ZUCA 3ZS8A 3JZMA 3OEHD 1P73A 4JVLA 1WF3A 3SOPA 4B3CA 4IXMA 4IDNA 1XTJA 4HB3A 5H8WA 3FMFA 2OUKA 3BORA 1M1YE 4PO9A 2A7QA 3THWB 2BOVA 4ZDWA 1LW7A 4MA4A 2DWOA 2CCJA 2BJVA 4CEHA 1KO4A 5IF9A 4BLSA 2OLKA 1KK2A 4LCBA 1P9WA 3RLFA 3FMIA 4B76A 3S1AB 1H8ED 2MSEB 4EPXA 4QGAA 1GSIA 4KODA 4R71A 1XPOA 1KJYA 4O3MA 3OEEA 2H1LA 2OZEA 1JNYA 4NH0A 4C0AC 3CF2A 3WNBA 3H84A 3RC3A 4XD7D 4M0LA 2HLDA 4P32A 3K9NA 2CXXA 2A5GA 2C9CA 4FCVA 3QXJA 1QHHB 2B8WA 1RRFA 3EZ2A 3GFPA 4JLDA 1JR3A 3B1XA 521PA 4CDGA 2JIZA 1J99A 4E03A 2ZI6A 2DHRA 4QGFA 2IYZA 1NVXQ 1XD2A 3PENA 1BS1A 4LYHA 2KBFA 2NIPA 1EFHA 1F60A 3PUZA 5GVSA 4PAMA 3LLMA 2WOOA 2J0VA 2GTPA 1W1WA 4DUGD 3VX3A 1OXSC 4MUBA 2OCYC 2ZVPX 3THYA 3IO3A 3DZ8A 1G8PA 2A30A 3KZ1E 2ATVA 1P2UA 5FTJA 2EFDB 3AKDA 1Z6YA 3GJ3A 2KBEA 5GJWC 1UAAA 1R8QA 1D6JA 3BRWD 4QGGA 3R8CA 1G21E 2FFQA 4NDZA 3P4YA 2GJ9A 4QBGB 3KB1A 3DDCA 1RIFA 4HAZA 5TMPA 1RW4A 1SXJB 2XGJA 1OYWA 3FOZA 2NG1A 3B9QA 3T35A 2VHUA 2BBSA 3WMGA 3SZRA 3SYNA 1RRPA 3HDTA 3AM1A 1CR4A 1Z63A 1R6BX 3KX2A 2ZRCA 2A9KA 1KI6B 2Q9BA 2GK7A 2PMKA 3A1UA 4P4UA 5CB6A 3TKLA 1TU3A 5CIWA 721PA 4OHXA 3TBKA 3VNVA 3T5DA 1C4OA 2JA1A 1K8RA 3ZZUA 2P2LA 1DADA 4YQFA 1I4LD 2R62A 2ZI5A 1Z6XA 3HPRA 3HWSA 2Z43A 3ASZA 4P4SA 4IW3B 2JDIA 3U7EB 1QHNA 3RS5A 3ZZTA 5KHOC 2ZR0A 2ANBA 1DAHA 2WWYA 1NG9A 4S2EA 2KSQA 3KFXA 5EE0A 4EJSC 5EE1A 4WAUA 3LBHA 1DO0A 5HCIA 4EQ6A 2YKGA 3VR2A 3TSZA 3B7GA 1BMFA 3MWJA 3ZD7A 1E2IA 5GVRA 1QHGA 4E22A 4IDPA 1PLJA 2JLSA 3RDPA 1D2NA 1W46A 4KSCA 2O8EB 5EP4A 2NO1A 1E98A 1I4DD 1OFIA 5SZJA 4DDUA 3LD9A 3MUFA 3JVUA 1OIXA 3ECCA 3KKOA 3P27A 4B74A 1MABB 2JJ2D 4G5SA 2QGNA 1JJ7A 4DIDA 1E0SA 2CDNA 1GP2A 3MSXA 2EFCB 3SBDA 4Q4HB 4B75A 1CJTC 4EPVA 3AF1A 3A1TA 1L8QA 1R5OA 5FI0B 4F92B 1F6BA 3C16C 3E1SA 4GOJA 4M1SA 3HPQA 2PJRA 4OHWA 2AXNA 1FNMA 3FKSD 1NG1A 1BYUA 4L9WA 1M6NA 4B3DA 1CR2A 5FOXA 2IF2A 3CRVA 1Z08A 1JEDA 1XWIA 4DLWA 4F38A 2C95A 1NSTA 4KFUA 1IN4A 1ETUA 3MGCA 2NZ8A 2O8DA 2RGDA 2W6IA 4D82A 4KCGA 2QAGB 4NYMR 3MG9A 5H1YA 1EG7A 2IYUA 2ZUBA 4PSAA 4DJTA 4QHTA 4PXAA 1XTRA 4L15A 1U90A 3AVPA 2GCOA 2V7QD 4MGIR 1HE1C 4MQBA 4CEJB 2GNOA 1NLYA 3PITA 4DXAA 4ZDKA 5AJZA 5A5GA 2WJVA 2PEYA 1ZM2A 3R20A 4A0HA 1E9BA 2WV9A 1XNJA 3BE4A 3Q9LA 1DARA 2QZ4A 3DM5A 4PQRA 4D0NA 5DH9A 1YVDA 3WBKA 2A5YB 2HYDA 1XTIA 2YWGA 4Q19A 1NMZA 3A1VA 3AUXA 4DLVA 4EAQA 1D9XA 2CBZA 1CJVC 4JLJA 3QPWA 3QVVA 3T06B 2B6HA 2GK6A 1BYIA 1N25A 1T5IA 2ZQ5A 1W4AA 3CNLA 3NWJA 1R0YA 1ZP6A 1K5GA 1IXZA 3GCGA 1W49A 2QL6A 5EZ5A 4ON9A 1E0JA 1IONA 3WP1B 4CF7A 2EFGA 4AD8A 1CLUA 1WXQA 2V1UA 3PUXA 4OI1A 4KLZA 3ADDA 3VR6A 2WJIA 4LHYA 2XOKA 3IBYA 2CE7A 1QHSA 2AKYA 3NH6A 3BFKA 3QBVA 2HT6A 3LH5A 1J2JA 1NLFA 1OW3B 3FFBA 4MYUA 3NBXX 1W0KD 3I8SA 2W58A 4LV8B 5EXXA 3SDZA 3WNDA 3NHAA 2O52A 1TF7A 3GJXC 5FBQB 1VPLA 5CM9C 4JJKA 5EUQB 3OFNA 2FEOA 1QZXA 1RKBA 3PG5A 2IX3A 3QF7A 4UNRA 1NF3A 5FOTA 3AVYA 4OHZA 2RGNC 3OEED 2BJWA 3B5JA 3LDAA 5DI3B 1VG8A 4Q66C 2HLDD 1XX6A 4UJ3A 1CKEA 2VLIA 1KGDA 4FMDB 2DB3A 1JR3D 1JAHA 3T1VA 2JIZD 1OSNA 5GJBA 2GJKA 3EWSA 3A37A 4BASA 3HU3A 2JLRA 1AZSC 2P0EA 4OKSA 2G0NA 4AYTA 1E79A 1KSJA 1VYTA 5J4LA 4RD1A 1KIMA 4Q9HA 4NCNA 5J47A 2GF0A 3AEZA 2VEDA 3L0IB 3C41J 1S8FA 2C9OA 1OPXA 5EP3A 1E0AA 1NIPA 4HDOB 2AK3A 3BJIC 2J0UA 4MDEA 5B2ZA 3RS2A 2AKAB 3B1WA 3OAAA 3ZQJA 3K0CC 4Q1BA 1CF4A 1KI4A 3VMFA 2PCLA 3AV0B 1TF2A 2W2TA 4XH9B 1Z2CA 2ERXA 4WZAE 1T4GA 5DLQC 4D80A 2C96A 3CNNA 1KY3A 2FSHA 1ZMXA 4MRVA 1CIPA 1UFQA 4W5HA 1Q44A 4DDWA 4P31A 3QIAA 4YDSA 3ZH9B 3B82A 3U3MA 4Q9KA 3U3OA 3KL4A 4FD2A 4QXAA 2V8OA 3I62A 2H5EA 4HLUA 1E2QA 1GUAA 1ZM4A 3FKQA 5GJCA 4EPTA 2EYUA 4KSBA 1ZUHA 1MO3A 5E4FA 3KXLA 3K53A 2GXSA 2OEPA 4LDJA 4L16A 3R9WA 2QPAA 2AL7A 1NRJB 4TMXA 1RZ3A 5JCZA 5LD2C 1MV5A 3EZ6A 3SYKA 1ZD8A 3GLIB 1VKJA 1GWNA 1KO8A 3GPLA 2LCFA 1IN6A 4C0BA 1ZJ6A 1KHTA 1LFDB 4AKHA 4L5BA 3EA5A 2KJQA 1UDWA 3FYHA 5AUNB 2P3SA 4EFLA 1MRSA 2VRWA 5DO9A 2UKDA 5UKDA 3V00A 1U94A 4B47A 4KJZA 3GEEA 2FGKA 1IXSB 1XEXA 2R65A 4OHVA 1IBRA 4IEIA 3SBEA 2NGRA 5C1BA 1FTNA 2ZYWX 2PLFA 4RFSB 4C0KA 5JRZA 1DAMA 1DAIA 3NTUA 4LRWA 4NCJA 4HUQA 1WP9A 3PXGA 2IYQA 4I81A 2F43B 5BXQC 3VKGA 2IUSA 1RYFA 5FI1B 5FTLA 5CITA 2KB0A 4TLDA 4XJXA 4B48A 4TLCA 2FFHA 3QQ5A 5E7IA 4GT1A 1Z0IA 1ZC4A 2P65A 2VSOA 3SS8A 1Z0DA 1R5NA 1Z06A 3GLFE 3MLEA 4JLNA 2GZAA 2IHBA 2TMKA 3CPEA 1JPNA 1NBME 4NBSA 3I92A 2XB4A 2BDTA 4RD4A 1VMAA 1FUKA 2OXCA 4XTCS 1U99A 4GZLA 2QSZA 3KXIA 1N0WA 4LJ4A 1E1RA 1RRGA 3K9LA 3EIQA 3VU9B 1KJWA 2SHKA 2IXFA 4Q9LA 4PTLA 4PR0A 4XVRA 3I5XA 2O8FB 2QMEA 3UMRA 4AWXA 4C2UA 4GOKA 2F3RA 5E7JA 4AKIA 4B34A 2ZXUA 4I1OA 1FX0B 1X8LA 3E5HA 3KTAB 1EK0A 4A6XA 2Q6TA 2ZJOA 3D7MA 2W6ID 5C4GB 3U7GA 1OH7A 1FUUA 1P2SA 1NVVQ 4P33A 5L3SA 1AGRA 1DS6A 4XOIA 1OXUA 2OCBA 4US0R 3RSLA 1WDTA 2QEQA 1KO1A 2YWEA 5BWMA 3L8ZA 4PFSA 5JHGB 3ZDQA 2FX3A 1WE2A 4RZ3A 2ZUDA 2OM2A 2BIFA 1NVVR 3B8HA 3THWA 2OV2A 4DCTA 1UBFA 1NN5A 3MWYW 4DIEA 2BEKA 1G3RA 1D5CA 2CJWB 2HCJB 4V02A 4YMWA 3WBJA 2N42A 4GP6A 4A82A 4Q00A 3RNLA 3ADCA 1YZNA 3CZPA 3FHCB 2J59A 3BB4A 5FTKA 3S1AA 4GL2A 3KB2A 4XD7A 1CRQA 4JYCA 4DLXA 4MYCA 1E9FA 1ESMA 3GMTA 3EASA 3GJ7A 4TQUS 2AHOA 4E07A 3EZFA 4BZPA 1SVWA 1NP6A 2ZM5A 3DOEA 1NJFA 1SZPA 4FN5A 1QHHA 4LHXA 2VP6A 1TF5A 3OIUA 4CT5A 3OE7A 3U2QA 1YR8A 2BEJA 1JBKA 2B8TA 1FW6A 2XZOA 1X6VA 4HYYA 4LJYA 1Z0FA 2VA8A 2IS4A 2ZYUX 1XXHE 4DUGA 3H1TA 1CULC 5D3MB 4S35A 2IK8A 3PIRA 5IT5A 1HA3A 2JLXA 4L9SA 1U2RA 4OK5A 1P2VA 1SGWA 2ZR7A 3BFXA 4I1VA 3THXB 2J1LA 3AF4A 1FMLA 2XOKD 2HT1A 2W2XA 4Y0VA 5EXPA 2OG2A 4XSHA 3RANA 2QRZA 4A4DA 3U60B 4WZBE 4UNQA 1OYYA 2X1VA 1Z6AA 5KSZA 2LWIA 4PC3A 1IN8A 3GEIA 1DBSA 2FPKA 2ZRIA 3D8BA 3M1IA 4OL0A 3K70D 1SXJA 4IOKA 4QHSA 1X8JA 2Q0HA 2QN6A 2F1JA 4AI6A 3NEYA 5KNCA 2V55B 4BZQA 4DWJA 1Y3AA 3CBQA 1KSGA 4US2R 1EWQA 1KI6A 1M7BA 4UXHA 2Q3FA 1XZQA 3DMDA 4Z1MD 4EKDA 2Q3HA 1KAGA 4TL9A 4M4SA 3WYGA 3ZZ0A 2XJ9A 4NHOA 4A0FA 1NN3A 4BFVA 4V0MA 2F9MA 4JLMA 5SZIA 1PJRA 3X1XA 3A1SA 4JZKA 3WRYC 4QKQA 1JAIA 2WVJA 3WMFA 2R9VA 4IOJA 1XJCA 4M1YA 3AVOA 2GJSA 2VF7A 3Q72A 1ZAKA 3RRYA 2FA9A 3IQXA 1E79D 4LBZA 5BW8A 1CBUA 1F2UB 3TJZA 1Z0KA 3U3RA 3AF3A 1F3OA 1JR3E 4OI0A 2VP9A 4QL3A 4ZCLA 1E9AA 2IXEA 3QVUA 4TMWA 4XTRA 1IOZA 2XITA 4BFUA 4FMDF 3OAAD 4A9AA 1GL9B 2OO7A 3BC1A 3E2IA 1XEWX 3QSYA 5M04A 1NL3A 1VG9B 4AYXA 1FQKA 4MRSA 2ZRPA 1VG0B 2O8EA 2BV3A 5TARA 5LB4A 2Z4SA 1DAGA 1W4RA 1MR3F 1E99A 3PUWA 2DFLA 3SQXA 2WSSA 2DR3A 3TSOA 4CIDA 1MABA 1YRAA 3ZVRA 4KV9A 1Q1EA 2DPXA 3MJHA 3DMNA 1SVOA 2IUUA 4BFTA 3QEJA 4TMKA 2CHGA 3MMPA 4DLYA 2OILA 1YZKA 3NEJA 4Q4HA 3FKSA 1E94E 1I2DA 1U9IC 2O0HA 2ZRJA 4ASUD 5EJEA 1IJFA 2ZRLA 3LRPA 4A8JA 1N2CE 4HLQB 2WWFA 1AIPA 2QQEA 1VIAA 4BFWA 1SKYE 1GNPA 2RCNA 4NYIQ 2VHQA 2ZAMA 2GXAA 1Z22A 1KO5A 1S1CA 1S2MA 1O87A 3HP1A 1TEXA 5EXSA 2AX4A 2BMDA 4M9QA 5C2JB 2EQBA 4NYIR 2VP5A 3GQBA 3NBYC 3HR8A 3EAQA 4LGMA 4C3ZA 1ZRHA 3K0SA 4C7OB 1Z83A 1JEEA 1XDBA 1HEIA 2CVFA 1DE0A 1J7KA 3BB1A 3I3SR 3LO5A 4QG7A 1LTQA 4B2IA 2Y8EA 4LZZA 2PT7A 5JSZB 3A4LA 3QKTA 4LX0A 1AN0A 2ZRNA 3Q5DA 3WYAA 3ND8A 4O2RA 2VYFA 2YHSA 1OE0A 2EWWA 3ICEA 4B43A 1ZIOA 3NVAA 4HEJA 1T3SA 2NO0A 4Q4JB 1P9RA 2H17A 3QKSB 2LKDA 3KKNA 4GSYA 4D26A 1TNDA 2ZS7A 3T61A 1KI3A 2DCUA 4B3XA 5BN4A 1E9DA 1HQYE 2CCKA 2VBCA 3VKWA 3BOSA 3AGPA 2ZU0C 2QM8A 3U61B 4PC7A 2Z6VA 2P5TB 1DAEA 2HUPA 2ZR9A 2AFIE 2WAYA 1XPUA 5DN6A 4BECA 1II8B 1X1SA 1G7RA 1Q20A 2XSZA 3I5YA 3TLXA 1Z0JA 4URVR 5JMTA 2XB2A 2QUZA 2QTVB 1N5KA 4CZ2A 1W5TA 3TUIC 4PSKA 5EUMA 2HF9A 4JT2A 1S0UA 4D81A 3VKHA 4ACAA 3LXXA 1IY1A 5KPJA 1OHHA 4PX9A 2FFAA 1XB2A 1X3SA 1W48A 4JT4A 1NSFA 3PUYA 4DLZA 4US1R 1W0KA 2J41A 2GCNA 5JBQA 2C2HA 1I4TD 1L4UA 1DOAA 5FOSA 1Z0AA 2HJGA 2I4IA 2WJYA 4DHEA 2BWJA 4TSFA 2H16A 2CHVA 2RGBA 1JJVA 5JJKA 2BM0A 3REFA 2XTZA 4ESHA 5E3HA 2G77B 5E95A 5SZHB 1GNQA 1WRBA 2ZTSA 3GJ0A 2KI5A 4M53A 4U5XA 4BQSA 4CRWB 3EW9A 5FUXA 1S96A 4ZIRB 1G5PA 1VG1A 4HZIA 4TZ6A 1QG2A 2GXUA 3NDBB 3KQHA 2NO9A 2F1HA 6Q21A 1SHZA 5IK2D 3IQWA 2ODWA 5F98A 3K0EA 3N5CA 1XTKA 4KYIB 4TTQA 4BFZA 3BWDD 2CLCX 5DI3A 2HEIA 4QFMA 2Q21A 2C9YA 3QG1A 3O8CA 3K70C 2C78A 3CWQA 2XJ4A 1OIWA 1W0JD 1VYVA 5FL3A 3K0FB 2D7DA 3OE7D 5FL7D 1EFCA 3AB3A 2IF0A 3NC0C 4AC9A 3QPUA 4MGYR 3Q7PA 1ZBDA 2BMJA 2ZITA 2AWOA 4Y0AA 1A1VA 4LYFA 3TNFA 4XIGS 2RMKA 1HURA 2I1QA 2JCSA 2ZROA 4DEXA 2QMHA 2BCJQ 3D31A 4KFRA 3VHXA 3MWLA 4D2IA 3UMFA 1NIJA 1Z07A 1SHKA 3SYLA 1U8AA 5HZKA 3M6AA 1R5BA 3OESA 2WJHA 4WVFA 3T1OA 2OT3B 3QENA 2Z83A 5GADl 3EPKA 2W6JA 1GKIA 2PLRA 2B7BA 1R2QA 5FTMA 1N6NA 1Y63A 4AURA 5DHFA 5FBVB 3DL0A 1SXJD 2VPPA 2B7CA 4FIDA 4HSEA 3K09A 4OK6A 1UEJA 1LF0A 1P9NA 4KITB 1D8TA 1KNXA 2ZRBA 4Q47A 5FBWB 1P3JA 4DT1B 4WBSA 2BBWA 3ZVMA 4KVGA 3HYTA 1WB9A 1OFHA 3O8BA 4PZLA 4YMTA 2FEMA 3W8RA 5CM8B 4IVQA 2VHCA 4M9XA 5J4VA 4LYJA 2EU8A 1QBKC 3PEYA 3GLIA 1JQJC 2OBLA 3CH4B 2MMGA 4XVQA 4LJ8A 4LJ7A 1NN1A 1EX7A 3U7FB 1E2JA 3BS4A 4PHHA 3V4RA 4C0HA 2ATXA 3LNCA 1GRRA 1VIYA 3DKVA 5K8IA 5KSYA 1U98A 1GVNB 4G5RA 1M8PA 5TDHA 1XPRA 4JLOA 3RS3A 5JHHB 5AUOB 1C9KA 2OLJA 2NPIA 3GJ6A 4R2HA 2G3YA 1SVMA 2FJUA 4PSVA 4RFSA 5KYKA 4JBYA 2IYYA 2ONJA 4F4IA 1FL9A 2BCGY 1DAKA 2ZIAA 3DPUA 4PPGA 4RKFA 4ABYA 1GKYA 3EC2A 5J4KA 4KU4A 4WOPA 2MMCA 4G01B 1Z47A 3WNCA 3LY5A 3SR0A 3ZS9A 2GHIA 1EFRD 4PC2A 3SEAA 2WSSD 3QXHA 5KSOA 1E1QD 3MAAC 1L4YA 4IKEA 4X8LA 3VHLB 2XXAB 3C5HA 3VR3A 2P6RA 1TQ4A 1NKTA 3DEFA 1HUQA 1G8HA 2WWHA 1EX6A 4NMMA 4NYMQ 2ZJZA 4QGHA 3WYFA 2QBYB 2R6AA 1AA9A 3UWKA 3C4JA 1JALA 1VCMA 3IBGA 2V6IA 3VU9A 3W8NA 4B73A 5JI2E 2O8FA 3UMSA 4IOLA 2ZE7A 3Q85A 3TQCA 2WKPA 4A92A 1E2HA 4HB2A 4OQXA 3WY9A 2PZGA 4ZDIA 1A5TA 4IEEA 4QBIA 2A3RA 1FX0A 2DYKA 2GETA 4NL4H 5CYOA 1LV7A 3V4FA 4EFMA 4B3GA 2JJ8A 3T15A 1D9ZA 5JS8A 3KQLA 3H2YA 1KDRA 4LHZA 4PHGA 4W5JA 4BFYA 4EIWA 3KUDA 1V43A 2O8BB 1J90A 1QRAA 4UQOA 1CU1A 5JJLA 4BGDA 3CPHA 5JJIA 1WCV1 1Z2AA 2QI9C 2J46A 2OCPA 2KE5A 1S9HA 4EUNA 4A36A 2IUTA 2ODNA 2X8AA 4D4MA 1YZQA 1P60A 1N6HA 1AQYA 1UF9A 3LW7A 3GLGA 3Q5EA 2ZREA 1GM5A 1XMIA 3U44B 3IIKA 2O5VA 5DSZA 4MH0R 4QOSA 4LBWA 1U81A 4X8HA 3VTKA 3QBTA 2WBLC 3FGNA 1W2GA 3MD0A 4TLAA 3RC8A 4D4JA 4TMTA 4Q7LA 2QROA 3A36A 5DISB 5CDFA 5F9FA 2D06A 3GFOA 1H65A 1UJ2A 1T6NA 3PCRB 2HDNB 5AJWA 3ZIAA 2NPFA 4WXPA 3I4LA 1UKZA 2VF8A 1HQCA 4J0QA 3ND9A 5DN6D 4DB4A 3AUYA 3MWKA 4G3XA 1M7HA 2XSZD 4QBFA 3C8UA 3LX5A 1MRNA 3SC3A 3U7HB 2FG5A 3LBIA 3B13B 2XAUA 2ZRMA 2CNWA 3W5JA 4EPWA 2RGEA 3OF5A 5JEEA 4KHZA 5D3MA 4JBWA 1FTSA 4R7ZA 3PFIA 1LB1B 1E32A 1KK3A 4IVRA 3CF0A 4BFSA 2RGAA 1ZU5A 1OHHD 3THXA 1FNNA 3RABA 4PQFA 1TADA 4FI3C 4LHVA 4EDHA 1OLOA 4TSFD 1ZC3A 2GILA 2ZJYA 2ORIA 4G5QA 4ZKEA 5HTKA 2AR7A 2GZHA 2ZSBA 3EC1A 5B57C 3RRZA 4TYPA 5KU1A 3GLHE 1CJMA 4DVGA 4OHYA 2WKQA 4EFNA 1T0HB 3K9HA 4Z1MA 1E2LA 2D3WA 2PMDA 3SFZA 1RPZA 2IXGA 2ZRAA 1A4RA 5JRJA 3L2OB 4URXR 5F9HA 4ZKDA 5BYJA 3WRXC 1KO7A 4URUR 1X1RA 3AVQA 4E09A 3F5FA 3K9GA 1G3IA 1S4QA 3PQCA 3L43A 1KY2A 1KZGB 1OFUX 1M34E 3CR8A 2WIAA 2XNSA 4L8GA 1I2MA 4MYHA 4UNPA 4DSUA 2C5LA 2IYTA 3FTQA 4HLCA 4JVSB 2XNDA 4KBFA 5C4MA 1E2KA 2XX3A 4NKRA 3TQFA 1F2UA 1JPJA 1SVLA 1ZNYA 4H1UA 5H68A 4B35A 4DCVA 3DO6A 5AR1A 1CEEA 1SULA 1GDDA 2A2ZA 4KFTA 3C14C 4HAVA 4XWKA 5ANRB 2DWPA 2OFOA 3D3QA 3NBZC 1R0XA 1W5SA 1VHLA 1TQDA 4JVMA 5L8VA 4W7SA 4ARZB 5CK4A 5TB5A 4C0SA 2AD5A 5FR1A 3CNOA 4G1UC 2W6JD 3SJZA 1GZSA 3UKDA 3VAAA 3KJEA 2WPDD 4HZUB 2X77A 3X2SA 1Q22A 1OKKA 3GJ5A 1US8B 4PC1A 4HDQB 4ASUA 4OI2A 1XCGB 1S9DA 3I8XA 4M8NE 1KKMA 4RJLA 3TH5A 1F48A 4A15A 2GBLA 1NVUQ 2QTFA 4RSGA 5DNYB 1MH1A 2CCGA 3AGQA 4DSOA 4JL6A 1E4VA 1SKYB 2OHFA 2WAXA 3AVWA 1LNZA 2WOJA 2HXYA 3X1DA 3TVDA 1OH6A 1RE0A 4PO1A 4D4LA 5TXGA 1P5ZB 1OFTA 1LS6A 4YONB 4TYQA 3SHFA 1YR9A 2GRJA 2ZRKA 2ZJ2A 4F4CA 4V0ME 1T8UA 5E7MA 2ERYA 4A8JC 2VP0A 4P4SB 4RD2A 3QPVA 5JI3E 4C7OA 1HH4A 4PZYA 3SFVA 1G18A 3N70A 3A4NA 5B30A 1KJZA 1U8YA 1ZIPA 3NH9A 4FMBB 5TVKA 1NMYA 1HT2E 3U3JA 3L8YA 5JFGA 5JSZA 3O8RA 2GXQA 4UXIA 4EQ6B 4Z51A 3UG6A 3KKQA 3AKEA 1A82A 1G41A 1XMSA 4LBVA 1QVRA 2GDJA 1YKSA 3LBNA 2EWVA 3H0KA 4Q4JA 4Q1CA 3U5ZB 1PVOA 3QKSA 1G20E 2D2EA 1N5JA 3W3ZB 4IDQA 2EVWX 3QG5A 3DHWC 2IEZA 3KQKA 1ZCBA 4TWZA 4UNSA 2JASA 2R6FA 2E87A 2YC2C 3OHMA 5DYGA 2ZSDA 3IDQA 3VR5A 2CL0X 3C7KA 2YVUA 2C77A 4HATA 2H18A 5EQTA 4PAOA 4MKGA 4DLUA 1YU9A 1ODFA 1P6XA 2QENA 121PA 1II8A 3NC1C 4W5WA 5JWOA 4XWAA 4TZ0A 3FB4A 3NHBA 2QORA 2JLWA 3IHLA 1RVDA 2FF7A 2W83A 1OXTA 1R0WA 2QE7D 1HE8B 1TAGA 3I73A 8OHMA 2RH5A 1CTQA 2YNMA 1GRQA 4B6FA 3M4YA 2ZSAA 5G3YA 2BVNA 1W36B 4TYWA 3TUJC 3BBPA 4HAYA 3DVLA 3ONWA 2AXPA 4D6PA 4MDFA 1KAOA 1KSFX 3X1YA 2NTYC 5KNBA 3DKPA 4Z8XA 5EP2A 2C99A 1KMHB 1KK1A 2ZE5A 1UEIA 1XD8A 2QA5A 1B0UA 2ZVQX 3DOFA 3W9YA 4B3BA 5IK2A 3CRW1 4ZIRA 1KK0A 1WMSA 1K5DA 5H70A 3WP0A 3RS7A 1X86B 1L7VC 1B23P 4Q1FA 5FPHA 5KDLA 1FP6A 4LJ6A 4MGZR 1W0JA 4C9BA 4NE2A 4GDFA 5ELXA 5FL7A 2CL6X 4BE7B 4DKXA 3ZIAD 2ZI4A 1N6IA 4Q4LA 3K0FA 3SE0A 4R2IA 2FNAA 3ASYA 5CYPA 1QHXA 1P7CA 4KVAA 2CNWD 2OXRA 1ZM7A 4GZMA 3U6KA 4C0QC 4TYYA 3LAWA 4IOMA 1DPFA 4D25A 3VNUA 1T3LA 4Q4AB 4CEIB 2FDCA 5CLLA 2QSYA 2PCJA 3UANA 1ZUIA 1GNRA 3F3YA 2A5JA 1G16A 1MO5A 3VFDA 1FMJA 1IN5A 1TQ6A 2FH5B 4R9UC 4DDTA 1EGAA 1AK2A 2JLYA 2GEVA 4N0EA 1CP2A 4F93B 4KO8A 1LY1A 4OYHA 2ZPTX 1E2MA 4HAWA 1PV4A 3RHFA 3TGPA 3C15C 3IKJA 2IW3A 1II0A 2WM9B 1ZD1A 3PEVA 4QNMA 3A1WA 5EE3A 4BLTA 4B2LA 1KZ7B 4N0DA 1G3QA 1DVRA 4DT1A 1KI2A 1G8FA 3KUCA 1J70A 3OIWA 3PR1A 4HUTA 1W4BA 4ITRC 2ZSEA 4DBLC 1KDTA
chains in the Genus database with same CATH superfamily
1E4YA 4MARA 4DABA 3MS4A 4YO7A 2NUTA 3ANYB 4IJ6A 4KRYA 4JI6B 4AG5A 3K09C 2BLLA 1GFSA 4L2IB 1T5DX 1G8GA 2XUZA 3V2GA 2Q8NA 1AUOA 3N3AC 3COJA 2A7XA 4A23A 2KLBA 2MYUA 1PYOA 2NM0A 4YRCA 2FVYA 1CFJA 3TZLA 3OTGA 5JSKA 3LUAA 2VYVD 3FOWA 3O7MA 4QPJC 1IH8A 4R2XA 1JB1A 4WPGA 3LCUA 4R6XA 3WADA 2BR5A 1N5IA 1RHRA 4JOBA 3GRYA 3KS9A 1DRJA 3V33A 1E9CA 2Q8QA 3E61A 3M4NA 2AD1A 3KD2A 3KUKA 5GINE 4KRFA 2XGSA 4Z3DA 1NNUA 3G0IA 1CJKC 1E1QA 1RXEA 4OHRA 4QLAA 5DI9A 5ALGA 1OMOA 4TUYB 3SGLA 4ZGBA 3DXYA 1JXMA 2CV1A 3LC7O 3UV7A 1OKKD 5JT1A 1U28C 2I3AA 4QAJA 4G5HA 1W8DA 4F5ZA 4DBVO 3I2YX 5IULC 2CMHA 1X80A 2YN4A 3U4MA 1PSZA 2QP9X 4X1YB 4AF7A 3OX3A 4WZZA 2A0WA 4BMZA 3K4QA 1Q1BA 3P45A 4ZVOA 3JQ8A 4G0YA 1USVA 4XWGA 4B46A 3BE8A 3ZGXA 1G5RA 1GU0A 3EGEA 5HM8A 1IWOA 4ZEMA 4UHKA 5KTOA 3RVBA 1FFSA 3TW8B 1GLVA 3WSVA 4BWGA 4F8JA 2VT6A 1GQ2A 1WO8A 2VOJA 1XEWY 3FAKA 2ETVA 3P26A 3M9LA 3BQMB 2ZBQA 4A0RA 5ILOA 3HCWA 3N58A 3TLKA 1QH9A 5C46F 2QM7A 3TE6A 1EM8B 4OMUA 1A77A 1IDOA 2J3KA 4RIFA 4BGUA 2IOFA 4MUAA 3D4LA 3OIVA 3FOCA 2J9ZB 3GLIE 1KP3A 4FM9A 5CLQA 4PHFA 2W6ZA 3I0ZA 3CURA 5KDOA 7MDHA 4LZPA 1IPEA 3G9TA 2FWRA 4AZTA 3WGYA 1IU9A 1COWA 2XT0A 2V45A 4FYHA 4K8OA 5BW4A 3ELDA 1CD5A 1QDEA 4KAXA 3AEUB 4BUZA 1H5UA 1SKQA 4URWR 3PB3A 3H3XA 2B1RA 5CCBA 3IIIA 3DQQA 3NTRA 1ZCAA 5A7FA 4M1TA 5FOUA 3AHEA 3X43A 4BKMA 3DEZA 2VAVA 2XMPA 1DRWA 3DC2A 1PS9A 3LDGA 4DV6B 3QOWA 3EXHB 2Q4RA 4BATA 1W76A 1T5BA 3BK7A 3L3BA 4LQCA 4O4JB 3FE2A 4HBGA 3RVNA 1G8YA 3WDSA 4F6CA 3RAEC 3U44A 1IZYA 2AYXA 5FH9A 4KBGA 1I33A 4IM7A 1NPTO 4JR0A 4P2BA 5D1HA 4GKJB 2ZJFA 2O2EA 2OGZA 3PNBA 1R7RA 3UV3A 3FHJA 3KLPX 3U1BA 1BDMA 5HE9A 1IUKA 1QE0A 3K0AB 3BF8A 4S1PA 3KQOA 4DSNA 1W59A 4LGYA 4QDUA 3MT8A 3CEHA 3D7LA 3P8ZA 5HYVA 2QLTA 1QNFA 4UBJA 3A3YA 4I46A 3GVPA 2F55A 1TUEA 1X0XA 3G0HA 1T4BA 1KH3A 4HH3C 1UBOS 3MWFA 4IUYA 1TZKA 3IB3A 4JLWA 5EMMA 3OZXA 3ZQ4A 1EFAA 1R64A 2V59A 1CR1A 4MR7B 1NKVA 1SVIA 2K5UA 3KJGA 2JGMA 4H7HA 4Y30A 1Q7RA 1TL7C 2R7NA 5AI5A 3AIKA 1KOLA 3ZOKA 1MX1A 3DV9A 3MGGA 1Z18A 2HC9A 2REOA 4UBLA 5CK5A 2YNMD 1DIAA 1L4FA 1N5DA 1OWLA 2TS1A 4RFVA 5G1OA 1RXIA 3VKVA 5CB8A 2O54A 3Q7TA 4WADA 1NQXA 1EX1A 3PFNA 1U6IA 2RI6A 1R8SA 4JL5A 5IXSA 1OXBB 5DOVA 3HRHA 3GARA 4YCBA 2A4KA 3LYHA 2VO1A 1K5HA 1HY3A 4MR9A 5JAIA 1YOBA 5TQVA 3ICPA 4BJ1A 3CZ4A 4YJHB 2D0DA 5EZ6B 3QXCA 4PX5A 1YRLA 1RM0A 1SXGA 1DXOA 2YYZA 4HQKA 3CEJA 1B4DA 4DZZA 1XDSA 2WJAA 2XUAA 1WNFA 3UJDA 1QS0A 3UAGA 2CVHA 5FBLB 1UKEA 3EXFB 3TEMA 421PA 1H0KA 3EXEA 4H1TA 4B6PA 3SJUA 3J81k 3EVFA 3ENZA 1ND6A 1RXUA 1GT91 1UOQA 2VNKA 3Q4GA 5BN5B 5JQWA 5FPYA 1X9HA 2JK0A 3GIDA 2GA8A 3HGTA 1I30A 2GNAA 1IUPA 4N82A 3JQBA 5ETJA 3U6BA 5CHEA 2O19A 2WNIA 3OT1B 2GLXA 1OX4A 4RVUA 3BWCA 1GL7A 3GLGE 2VDJA 4WE3A 2PO7A 3EZXA 3SE7A 4FFOA 1LH0A 3K8YA 3N87A 1PKXA 4BRSA 4L0DA 2NYVA 1A72A 3HJGA 1RC8A 2YUIA 3G1UA 3FVTA 3HA7A 3A7EA 4PTYA 1GTMA 3OZ7A 5CDFE 3EH2A 4AK9A 1KPIA 3QU7A 1UPTA 2Y1FA 1FNDA 3F8WA 2VH1A 1AY0A 4HQRA 4P7KA 3IGFA 3D81A 3SBXA 3RS8A 4S04A 2H4WA 1FLVA 3IB6A 2SKDA 4LS3A 3V9PA 2ZEJA 5JH7A 1X3LA 3HDJA 2N46A 3K2QA 3C5CA 3WTCA 3HKEB 4GS5A 4RE5A 1ICIA 5J1TB 3I4CA 1T8TA 3ZV5A 3PHCA 2UZAA 4LV6A 5EWJB 2FOLA 1W29A 1K6MA 4UVEA 1RAFA 3WWYA 4DB2A 4JT8A 1P61B 4L02A 2X2FA 1GFIA 5AW4A 3KQQA 1D4AA 1ZGAA 4HAXA 3OHPA 4KWIA 3FMGA 1VFNA 4RPGA 4YP1A 5EJ6A 5DGXA 1QHIA 2CK3D 3LI2A 3LX8A 3A6GA 4MUKA 2OPHA 4B2PA 4QUKA 2CLKB 1W47A 4P7FA 2GBCA 4H1VA 3RIXA 4FHCA 3THOA 3NIFB 1C7EA 1J8MF 2VDOB 1YZLA 3H3JA 1XN1A 1L4MA 2R68A 4MMYB 1AX9A 4TQ9A 4YP6A 5K99A 1TMKA 3T0GA 3LQRA 9GPBA 3ZWOA 1ZUWA 4TL8A 3QKRB 4KPUB 1SVSA 3N2EA 3X1KA 2C7QA 2QLNA 1XD9A 2YICA 4TQAA 4X7RA 3UW1A 2QN7A 1P45A 3V48A 3LQYA 3AW8A 5CJ2A 2JEZA 4UPVA 3M4JA 3VKFA 1AKVA 1YZHA 2H63A 1U31A 3IPXA 5KPDA 2JHCA 2C98A 2GBLC 1SOAA 3DMTA 3GZTB 2YQ4A 3KB8A 3MFQA 4LQDA 3COZA 1A8SA 1NVEA 3CX7A 3UCEA 3EX7C 2GWHA 2C1EA 3MTEA 4D9IA 2F64A 3OJEA 3R75A 3KE8A 1CZNA 2FPPA 4LBYA 1EM6A 3ZKWB 1TO1E 1NUUA 1NSYA 2E0IA 4G5OA 4JI5B 4AJIA 3HLKA 2VP4A 4PXYA 1ZPDA 4C76A 5JXHA 2HHLA 3Q7QA 3R7LA 1J2YA 1NI3A 4M21A 3WKCA 4ZYZA 2H1IA 1ORTA 4CM9D 1O08A 3WHKA 1B6RA 1SWVA 4JLBA 5CVEA 3RWOA 1K4MA 4JH0A 3AP1A 3RVQA 5K0GA 4P54A 5CIQA 1XQWA 3FR8A 3HL0A 4RZUA 4IV0A 1DIHA 2CZGA 3G5TA 3O6VA 4RCYA 1U9IA 5FP0A 1M2KA 1Z29A 2FPRA 4OJQA 4PHTA 3W4KA 3PJFA 1X1EA 4YDHB 1OLSA 4RXMA 2FG7C 1P8JA 4LG1A 5HR5A 4LK2A 4HLDA 5AUPB 1EXVA 1YUMA 2UZ3A 4AAYA 1MO2A 3LK6A 1Z37A 3LDUA 3N2GB 4JLPA 4NP6A 1J8DA 4WA7A 4F04A 1TW3A 4Q05A 2RAFA 3LPNA 5K8TA 3ETHA 4IHJA 2MSWA 4EGQA 4FEGA 2Z5FA 1MW9X 3IQGX 4ENQA 3UK1A 3O83A 4MVWA 2HJHA 1OH8A 1ABFA 5HCNA 1TVKB 8GPBA 4LDZA 3A9UA 5CRIA 4CLXA 4IGFA 2J30A 1T36A 3N0RA 4KN9S 1PZNA 4NX2A 5FHQA 3GHHA 3VO2A 1UM8A 2CHFA 3PNVA 2HHCA 1FBTA 3LO8A 1M2EA 1U2DC 1RQLA 2XH8A 3Q7EA 4JUBA 1XZDA 4EW1A 2JEOA 1JL3A 2IZ5A 1FU4A 3KLMX 3F4BA 2C2ZA 1YZUA 3QX7A 1U8ZA 4ZQEA 3U5TA 2XZDA 3WDKA 1IVNA 1SQGA 5CLJA 1AS2A 2NUAB 5CA1A 1FOEB 7ADHA 4QJ4A 3LW8A 3LT1A 2UYOA 4YP9A 4ND3A 3A8TA 5FWDA 1WWKA 3LSYA 3HJRA 3S4YA 4RZXA 4CLRA 4X54A 1TZCA 3G5UA 1DJNA 3SLKA 4FMCF 2Z5VA 3FTFA 1U1GA 5DNDA 2GZ2A 3Q0IA 5BQXA 2NZWA 1ZHHA 3KTOA 2FZ4A 2IP4A 2YNMC 1Y3FE 1NYLA 2OB2A 1HLFA 4J0KA 3UOWA 5MGNA 4OLJA 1ZJJA 1XOIA 5A02A 4KI0A 2Z09A 3A6PC 2ZRFA 4LSGA 3VUEA 4GMDA 4QUIA 1ISMA 1QANA 3LX6A 3MSCA 4D3SA 1NBAA 3L0DA 3DZGA 4LOIA 4WOKA 4B84A 2REXB 1ZW6A 4RGBA 2CV0A 3L0PA 3OEWA 1KI1A 3TAUA 4A6PA 3NGMA 3H5AA 1P4RA 1XXHB 5TQ0B 2R84A 5DE3A 4E30A 2C00A 2FSFA 5BN4B 4EO7A 2O7RA 4BKOA 3L02A 2ZT8A 1QRSA 4L5CA 3DVQX 4I9GA 3VYTB 4A8PA 2H48A 2XE4A 1G3UA 1RBQA 3I28A 4EPYA 1WLYA 2RB5A 2JEYA 2PL1A 1GD1O 2QUIA 3G68A 1WP4A 4BWVA 2GQ0A 4COOA 5C51B 5F64A 3H9GA 1AGPA 1E60A 1K06A 1UBJS 1ZYUA 2E7ZA 2XDAA 4KQHA 4Q4AA 4BO7A 5BQFA 1LBQA 3TL3A 3U56A 3BXOA 2ODQA 4G4SO 4PV7A 1XZIA 4Y6RA 4ZI2A 3I2IA 4P08A 4JA0A 3CO5A 1UM9B 1UINA 1PQUA 3QLVA 5CCXA 1TJPB 1QGUA 4BQQA 2GVZC 1G64A 4GPIB 4NTZA 2XY4A 3BRSA 4GU5A 3P0HA 2PYIA 1AGNA 2P6NA 2I2DA 1X9IA 2RBKA 2JCBA 1LW6E 4EZIA 5LQCA 3AERB 1Y8QB 2YJTD 3GDFA 3I9NA 3PGJA 1QO0D 4EHAA 3A4MA 5H9WA 2PSFA 4S12A 1ORIA 2FE4A 4RNCA 3OTQA 4S3MA 5FUWA 2PH1A 3T5BA 1VIDA 1EE9A 1Q3TA 4OEHA 4PE5B 1ELOA 4HTFA 4MNTA 4CEHB 5B1EA 3OWHA 5B6PA 3AQ4A 1WXFA 3K32A 3BKXA 4RSHA 1ZGZA 4N12A 2C4MA 1SXJC 1Z0ZA 3ZIUA 3GJYA 2ZUUA 3UWMA 2VTDA 1BDJA 3G5AA 5K8UA 4HFMA 2QT9A 1YNSA 4C6TA 1VL0A 3QKUA 1ISJA 2DFVA 3D4OA 3ZWQA 4IJUA 1EINA 2YW9A 1A8UA 5LB2A 3KSAC 2RHMA 2MSCB 3ANSA 4IXTA 5FJIA 3IE1A 1HXHA 4QGBA 4RD0A 5DWVA 3TKYA 2KWIA 1XFDA 3C24A 4EVQA 4YI5A 4ZCPA 1LWNA 2YYYA 2QM3A 3AUFA 3I9KA 4HWTA 2VNHA 1G4HA 1W8IA 1AKRA 5EJIA 1MZVA 3Q3EA 5FPTA 1YMQA 4RWZA 4G97A 5F33A 1GZ7A 1YB2A 1HT3A 4G5XA 1QOQB 4EENA 2VSQA 2Q4BA 1FYVA 1S3SA 3R4VA 4ENWA 3VPXA 1USKA 4TS4A 4I66A 3VJRA 1WB4A 1Y6FA 1T9GR 3TJRA 3IO5A 3KAPA 5G0TA 1T24A 3OQPA 4CUZA 1XZPA 2RGXA 2VQDA 2J3LA 2W2KB 3BCRA 1JDBC 1PS8A 1CS4C 2JH9A 4PLPA 1C0IA 2PGOA 2FMHA 2W8ZA 2PYDA 1G4UR 3C6XA 4YV7A 2EHDA 3G13A 1Z4QA 4ZYLA 2GM9A 4Z9BA 2F6RA 2H1FA 1SXJE 1KRHA 1OZ0A 2VDPB 5DM2A 4AWBA 1FRQA 3K9WA 4E46A 2C9MA 2B7LA 1GTJ1 2EBFX 1A95A 1WJGA 2MU1A 1QNLA 4RABA 2FE1A 3O4RA 2YY7A 5FQNA 4WN9B 3UAZA 5HTOA 4LY0A 4JK3A 3VOSA 1F6WA 3A1CA 4QJ5A 4YAKA 3GA5A 2CHEA 2NUPB 3UJ6A 1CS0B 1X7XB 4GZ5A 4I55F 5CW2A 1EWTA 3DP7A 5JLJA 3HJFA 3OM8A 4CMCA 3W3AD 3JQGB 5BT9A 3SN6A 5KWEA 3I83A 3LLUA 1DCMA 3W5AA 3ROXA 2LPMA 1JHRA 1P39A 1R6AA 3I05A 1L7NA 1SBZA 4WXMA 1F6DA 3H9CA 4CQLA 2GRAA 2F1RA 3OZVA 4UVGA 1ITZA 1PW7A 3N1UA 1DCKA 1P7ZA 3TRFA 3W1VA 1F9AA 3BD9A 4IIEA 3N6VA 1MX3A 3ZY5A 4DNFA 3SQWA 3QH4A 2JLQA 1Y5RA 2ZXEA 3N2KB 4NONA 1VL6A 4XWYA 3U26A 2HRZA 4ZO6A 3REGA 2IS1A 2CL7X 1Y6GA 5E0OA 2PZMA 2IT1A 4RMGA 3RTDA 1P2FA 2EW2A 2HFKA 1WU7A 3E9NA 2QAGC 5IJZA 4F4UA 3B3QA 4MWOA 5IHPA 3IR7A 5LDDC 1XTSA 1EFPA 2QY9A 1UBCA 5FPKA 3A26A 1JGTA 3U4QA 1J00A 1SC9A 4IDFA 2II6A 1SK8A 1TM1E 3PS9A 4ATNA 1G42A 4OIMA 2ZSHA 2V5AA 3D6UA 1W30A 4FJ2A 4BJHB 1LNQA 2H1SA 3R7NA 2AFIB 2O6HA 1ODLA 4UE6A 2BBOA 4HMQA 4W9NC 4O25A 4D1YA 1DBQA 3RTCA 1F8FA 2ORWA 3NXKA 3E03A 2V7XA 4GX5A 2G04A 3H4IA 2QSJA 2VTBB 3IHKA 4PBTA 1UPCA 2FHSA 5L3ZA 2UXBB 5F7OA 2AMFA 3KJXA 3CRMA 5PGMA 5H3CA 4V03A 3RKUA 4HXFB 1E9RA 1WSBA 1PF7E 1ZD2P 3P20A 4LZJA 5ERXA 5I5GA 2WM2A 4RV9A 5JQGF 5FWAA 4U7GA 1FFXB 2FPMA 1FBNA 3FFAA 5FBHA 5FD8A 5FR2A 5GOZA 3IMEA 2IW1A 4MKIA 4B2YA 3G6KA 5ICMA 3TDMA 3BERA 4Q5IA 5G3ZA 3HVRA 1J06A 1VRWA 4I4LA 4AS1A 2MIIA 1CIJA 2ZJ0A 4Q7JB 4W7HA 4RIHA 2WG1A 1S3GA 3WI7A 2FR0A 2W00A 4J0IA 2WKSA 2XKAA 3LKZA 6AT1A 3DH0A 2ZIWB 4U7HA 2V74B 3CZ9A 3ED1A 2BLNA 2QTWB 1G8JA 1P0FA 2UUPA 1AK9A 3GLHA 4FFVA 2ONKA 4MUHA 4EARA 3PK0A 1MIOB 2HWXA 2DBYA 3DZKA 3U4GA 5HF9A 3T41A 1UKBA 2A9JA 1K8QA 2ZYVX 3FYDA 4GVLA 5EYPB 3QELA 1YVRA 1VCOA 2D62A 4HRYA 4V0LA 3PUHA 5IBRA 2BBTA 5TPZA 4I3HA 4WK0B 3UGQA 1P19A 2V3CC 1DV2A 3DQPA 4GDMA 4A8HA 4BIMA 1H8EA 2B21A 1KJ8A 4CG2A 3RVRA 2L18A 2VLBA 2XE7A 4WKOA 4GKVA 2J7PD 2ZRGA 5FBRB 4R1UA 1DX4A 2FZVA 2QD1A 2RJ3A 2IH2A 3REQB 2W5UA 3UHFA 5JJ5A 3MHTA 3NDIA 4ZJZA 5AOAA 3P2YA 5EJGA 2WIGA 5CP8A 4C0JA 4ND2A 4ECEA 4Q16A 1FVXA 4FCTA 3ZWCA 5H80A 1P72A 4G26A 3JRNA 2X2PA 1N2SA 2IXBA 4RHFA 3C6KA 4O4LA 1KVQA 4KLNA 3SM9A 5B58C 5AVQA 3O92A 3PQ6A 3SIRA 5J4HA 3DD5A 3DE6X 1W7AA 4MVJD 1VJTA 3RU3A 1RI1A 1K66A 4NNPA 1V11B 5DGDA 1T3TA 2FP4A 1RMYA 1HKHA 5J58A 3FW1A 2UVDA 3L7YA 2PJZA 4RDCA 3K1AA 1Z6GA 4Y2YA 3FBTA 1PWXA 3R3SA 4OAOA 1E58A 1QGAA 1CFZA 1YQGA 3SZGA 5C18A 2AZTA 1LDMA 3O4JA 3W8FA 3LG2A 1U2EA 3QGMA 3QNMA 1UBUS 2KYRA 4J0FA 3RS4A 3X2EA 1H2FA 1E4EA 1MQ9A 2VJAA 3STUA 5KX5A 1EFTA 4LJKA 4CCWA 3AIMA 3IAS6 2Z2XA 4D3XA 2WICA 3C7AA 3L49A 2GBPA 2CK3A 2YASA 4OQNA 5FOVA 5LQUA 3L18A 1TYDE 2BE7A 3K7EA 3K8OE 2XYPA 2I1VB 3LT5A 3MJSA 1NJ6A 1PGNA 4PLWA 2RH4A 2QG6A 2ZS8A 4ZO7A 1P7YA 3QXXA 5L3RA 1XRSB 3IT3A 1JU4A 3CN7A 1TK2A 1W9HA 3WLSA 1ZMRA 1EQ2A 1MX9A 1O5IA 3KQYA 2QRVB 3WGUA 3RU9A 4YUXA 2OAQ1 2XV1A 1LRKA 3PVZA 6ABPA 3OFND 5CFNA 4CR7A 4FYKA 2ZYRA 2LKCA 4NS1A 4WCFB 1XHLA 4UUQA 3GJ4A 4M3NA 3KYIB 3MBIA 4I50B 5C8DA 4ZDJA 1KOFA 4H08A 3W2FA 1ECPA 1AQUA 3R0QA 5IDVA 1ZR4A 1ZVVA 1N3IA 4X0EA 1PGOA 4CVNA 2Y1GA 5EERA 1N7GA 1C41A 3NC4A 4YASA 2JFWA 2NQ8A 5A1JA 1U1DA 3E58A 3K0CA 4QA9A 1JE1A 1E7SA 1GTVA 2OMKA 4BO9A 1D0SA 1UXIA 3JZAA 2WUVA 1BGWA 2OV1A 5DSTA 4YAGA 2PLWA 4M9RA 1RHKA 1GYPA 2FSGA 3PXXA 2L0XA 3BIXA 3GP5A 1OXKB 1UJ6A 3HY4A 4JCCA 4CQMD 1IXRC 3DAHA 4JSYA 4BO3A 4F91B 3V6MA 4EKEA 3WLOA 1IOVA 3D7RA 1FRZA 1XDUA 3LXRA 4BP3A 1R4AA 5K3BA 3EIHA 1WEKA 5JANA 4BXOB 3FUUA 2R0QC 4GPEA 2YVAA 5BSRA 3PT5A 2QRKA 3IT0A 4CMBA 3OOJA 4ARCA 3GF4A 1NV8A 1ZAYA 3GLFA 3DDUA 4R1SA 3NVMB 4R7TA 3ZQ6A 4O33A 3H1GA 2GEJA 3LSTA 3W6OA 1VTKA 4OK3A 1DRUA 1NY6A 1UADA 2ZATA 2Z8YA 4IZIA 2HIMA 2VHZA 2Y6VA 3D7NA 2FCRA 5CEEA 2J0SA 4MUMA 2ZR8A 3DJYA 4BQOA 3LIPA 4S1VA 1JQDA 1U7UA 2QD3A 1Z82A 3QEKA 4YECA 1WPRA 2PU5A 2V65A 4KUHA 3TTVA 2IHNA 5E6SB 1TKRA 2P1DA 2Q45A 5CLIA 1GQOA 1L5WA 3RUHA 3S40A 2J5KA 4KQGA 5DTIA 4GXRA 4V3BA 4C4PA 4GPBA 3QE0A 2YV4A 1X15A 3A6KA 3PTLA 4Q3CA 3H4TA 2R8RA 4P3XA 3A6DA 2HIHA 3H2BA 5JNSA 5G0VA 4GBMA 3SXPA 1X7GA 1E9EA 1SCDA 2PQMA 1NUHA 4IFBA 5A05A 4RVHA 1RXSA 1P1RA 3AJRA 3RIHA 2VJYA 3QI2A 1DT5A 2XTAA 3M4XA 4JR1A 5KSPA 1XN4A 1QUEA 2WF8A 4R5MA 2GFQA 3BN3A 2QN8A 4LWZA 2G7ZA 2QPTA 4XQCA 5GOTA 1PT5A 1AJEA 1NBHA 5EG5A 3UATA 1SZCA 2BM8A 3H4MA 2R5NA 1IHUA 3SK0A 1C0KA 3GAAA 3ME5A 4IH4A 3GGCA 5JYEA 2NYAA 4EPRA 2FW9A 4RAOA 4LSZA 4XE5A 4L9RA 3ZCVA 1C1HA 5FTNA 3RIYA 4F5EA 4MKRA 4JKIA 3MJVA 4EG1A 3I53A 2BC9A 1P29A 4F7WA 2P78A 2Q1WA 1IK4A 1YB7A 4FB5A 1I6KA 2YWRA 1UDBA 5BV7A 4MYTA 4ZO4A 1ZOSA 3HXKA 5EFZA 3ZNPA 3N2NA 3OKPA 4YTEA 4DLRA 5J43A 1N3BA 3PZBA 3BH0A 4Q02A 2A9OA 1VBMA 5A03A 2XTJA 2ASEA 4KLCA 4LHEA 4PG7A 4BZWA 3FUCA 2OHIA 3EDCA 4LUCA 1FX1A 2BEVA 4KG7A 3PFCA 1CUHA 4OO3A 4UASA 2IHZA 1U02A 1UC9A 1EWRA 1FUEA 2XQJA 3KG2A 1HT0A 1TIKA 3Q9NA 1K6EA 3AF0A 3S68A 3EW7A 1RAIA 4AXXA 1DP4A 4HWKA 4OQYA 2XBMA 1SO8A 1KDVA 3V32A 1UBGA 4CE6A 4JROA 1M2WA 2B9EA 3PRYA 1YDWA 4NNOA 2G07A 2X19A 5CB4B 4N1AA 2AQIA 2A1UB 3JVVA 1NX6A 3HYNA 3I72A 1RJ9A 4UTOA 4XRGA 6YASA 5JUWA 1KEWA 1KQGA 4KFCA 3EZLA 1UWLA 1MT0A 4HZGA 4DAOA 1HOXA 2MSLA 2PUHA 4V0QA 4X3CA 2Z8YM 3ETGA 4JDUA 5F3WB 2GHTA 2QZJA 3M5WA 2RHDA 3GVCA 2Z57A 5JZBA 3R7WA 3AJ9A 3ZXUB 3MTDA 4G85A 3DZDA 3EEFA 4WY5A 4P3YA 1IY2A 2VA9A 2OHJA 2X58A 3V7FA 5IUJC 4G0OA 3DCNA 3K9CA 3O91A 3FOBA 3ZS8A 4Y1FA 5KYTA 5C5DA 3WE7A 3DUFB 3JQQA 1WF3A 1A8QA 1L5LA 2NXJA 1VMKA 2I3ZA 4IXMA 1IQRA 1LPNA 4J29A 1AZWA 1EDDA 1AT1A 1Y42X 4B6QA 5DM70 2FEKA 3F2IA 3QBDA 3DSRA 1VB5A 3FVRA 4LKOA 4L75A 4R2LA 4WLVA 4WGGA 1GA1A 1LW7A 2JFYA 2DWOA 5E4YA 1T6YA 4ZDWA 2BGMA 2BJVA 2BP7B 4ZQCB 1TECE 2OLKA 4LRUA 3TRHA 4ZJUA 4V3CA 2AFHB 4YJGA 2HWWA 1XCOA 4RORA 3QA3E 3VI3B 1SBNE 1GSIA 1W35A 2PWAA 4JDPA 1MEOA 3EQ2A 3UUGA 5BR7A 3NASA 4O3MA 2XMSA 5YASA 4G0QA 3OEEA 2H1LA 4R1NA 3DE5X 3CF2A 2IHJA 1PFVA 1Y3DE 4FT2A 4QU8A 3DF9A 3G49A 3JYLA 1VIMA 3OCXA 4M0LA 1N75A 1A9RA 3K9NA 1T1IA 3GCZA 1KE1A 4FOTA 2QK4A 3ZK8A 4EG3A 4RTNA 2WZBA 4OBXA 5AVWA 1QHHB 3GFPA 4YMIA 4JLDA 2A1TS 5CVTA 3W05A 4CDGA 4D45A 4ISBA 1YL7A 3FLBA 4OJYA 3TRKA 4FKMA 2ZI6A 4E03A 3LCVB 3PEEA 4M7OA 3GNQA 4EB6A 2BD0A 1BS1A 3MOIA 1T2VA 2PNFA 4MO9A 3CCCA 1SUCA 4GVPA 1EFHA 1F60A 3B3JA 1D2AA 3O8OB 1VBFA 4KXLA 5HILA 4B82A 5GVSA 3H2JA 4YRRA 3K1ZA 1JEOA 4FU0A 4RWEA 1W1WA 3IQFA 2FUEA 3GB9A 3VX3A 4BCBA 1WUIS 3CG0A 3G8AA 3THYA 3LC1O 1G8PA 2J4CA 1VJGA 2ATVA 1BKYA 3CNEA 4O6VA 2O2ZA 5B6IA 1SBYA 5I45A 3HKCB 2Y1OA 3I4FA 4EI9A 1UAAA 5IDQA 4GR9A 1PW5A 3HB4X 1M2OA 3FSRA 1BD4A 2X5JO 4YRZA 3P4YA 2GJ9A 3E4CA 4EYEA 3DDCA 2FR8A 4OP2A 1RDFA 4HAZA 1EUQA 2JG3A 4N65A 2C88A 4IR7A 2YXPX 1E5QA 3T35A 2BBSA 2Q2VA 2OQ2A 3Q11A 4DY4A 4WXHA 2DT5A 2ZPAA 5JG7A 3AM1A 4CODB 3NDRA 4TKVA 4Q93A 1KI6B 4JU9A 2GK7A 4KDEA 2G09A 2PMKA 3A1UA 1ZUNA 5LDHA 2FZEA 4QOJA 4RADA 3TKLA 721PA 3QTBA 5K05A 2G1UA 1H1DA 9LDBA 4J7AA 3RVLA 3TBKA 4X1IA 4I4NA 4UHDA 1C3JA 1M66A 4HDRA 5HF5A 3RF6A 3G59A 3ZE8A 4YQFA 1I4LD 1KVSA 2NV2B 3RGGA 2DPYA 2QVZX 2C07A 4LXUA 3HPRA 1MA0A 4HDKA 3ML1A 3HBMA 5IF3A 3EG9B 5L6LB 4W1PA 1LDBA 3TZBA 5HIMA 1NW7A 2ZUFA 2HR1A 1I2BA 5CVCA 3PFKA 4M86A 4RU1A 4S2EA 1QIGA 2KSQA 3KEQA 5DRYA 5EE1A 4WAUA 5HCIA 4LJSA 3M5CA 1MC5A 3AT1A 3B7GA 3OZWA 1QIHA 3VYWA 1E7MA 5KYWA 3HBNA 3VAZA 2F8TA 3ZR4B 3J7AC 4UOEA 2LTAA 2JLSA 6REQB 1A9PA 1D2NA 1W46A 1FP2A 1G20B 1PGQA 1UXKA 4U6NA 4LFBB 4LOLA 4PIVA 4U63A 1OFIA 4LF9B 3RTBA 3LD9A 5SY6A 4J90A 1OIXA 3OPMA 3KKOA 1C3EA 3VDQA 4BGIA 1VLVA 3HUDA 1UAGA 2CJFA 3K6KA 3Q2KA 4DIDA 5FRDA 1DUIA 1CQWA 1E6UA 3FRJA 3KOMA 4JY7A 5JIBA 3ENVA 1CERA 4IP0A 2ZWAA 4YRTA 1L8QA 4QE3A 2YY6A 5FI0B 4F92B 4RUKA 4MGHA 2EG5A 2B1JA 1DO8A 4MI6A 5HQ3A 3G89A 1THGA 1ZGGA 3W3AH 4BMDA 2PJRA 3NT5A 2AXNA 2C54A 3M6VA 2QWXA 1OVGA 2BFWA 3CUYA 2QMZA 1NG1A 5COAA 5ARCA 3DNMA 4MUFA 2QDKA 4A5SA 4EJFA 3F96A 3LIIA 4GXQA 3ABRB 4YO8A 3SWWA 4Y2JA 1IDN1 1XZHA 3DYVA 5BNWA 2JI8A 2BUAA 1E1DA 3NHZA 1C3OB 4MOWA 1CUAA 1IULA 2F8MA 2HRQA 3L8EA 1JEDA 2R00C 1NSTA 4J6EA 4KFUA 1IN4A 2HFJA 3C1TA 3DULA 3MGCA 3QPAA 4M36A 4WOJA 5JAQA 1OLUB 2JKVA 2W6IA 3OU7A 4D82A 1V5FA 2CHUA 4KCGA 5H1YA 1JW9B 3GQBB 3PHHA 4PSAA 1K08A 5GGYA 3NBUA 5ECGC 4F9EA 5LM3A 1JHDA 4P58A 5DWQA 3V8BA 1JG7A 3WJ1A 1C7RA 4MGIR 1BN7A 4PYLA 2V9ZA 4DXAA 1E8DA 4GKAA 4M1EA 1DJMA 3L84A 3DYBA 1EK2A 4FP9A 1JKXA 2FJ0A 3A3OA 4A0HA 4JXXA 1XNJA 2DFDA 3Q9LA 4FE3A 1C4XA 1NUPA 5KKAA 3VZBA 3ZPXA 3H3FA 2Z3WA 5ALOA 1Q0TA 1EBBA 3KELA 1EFLA 1NNLA 1GZ3A 5AMXA 1ZONA 2ID4A 1YA6A 1GGVA 4R0VA 1A9ZA 4Z7JA 3Q8LA 4WNYA 2R1VB 4IIJF 4ZRDA 4JUIA 3ITKA 5GONA 1CRWG 1NMZA 2AEFA 3F1KA 2YDYA 4ZQBA 1A9QA 4QEKA 3L0ZA 5D6NA 4DLVA 3DS8A 2CBZA 3PUJA 1PJ2A 3SM3A 1YUNA 3I42A 2JFXA 1BYIA 5LOVB 3OCUA 1IN1A 3DAPA 1BDBA 1E3DA 2P3OA 4CIWA 4KBYA 1E5DA 5DNWA 2EQAA 3CNLA 2MYNA 3ITDA 3NWJA 4KWHA 1G8MA 3ZNNA 3GCGA 1W49A 2QL6A 3K30A 1XTUA 1EGMB 3PFWO 3WP1B 3JYOA 1KBOA 1P33A 4O4IB 4MV5A 2G4VA 2Z04A 2Z5GA 4OI1A 2CLMB 2FP3A 2ODAA 5D86A 6CHYA 4AZ0A 4KLZA 4BNDB 4JAVC 1EUYA 2C2KA 2BW0A 3I6MA 2KPOA 3MOGA 4LHYA 5AVKA 1XK7A 3ZH2A 3KQVA 3GUCA 2AKYA 4ZHQB 1VJ1A 2OBXA 4N3BA 3M1LA 1QCCA 1YB5A 2JBWA 3VYSB 4OOEA 2WFZA 1J23A 1J2JA 1NLFA 1JMVA 2REQB 3FFBA 3IQIX 4LISA 4ZT2A 4C2BA 5GY7A 3ZDAA 4EKYA 4TN5A 3UH1A 3OKAA 3T3DA 2W58A 3SDZA 1B0AA 1SCNE 3Q10A 2JGDB 4W99A 3H97A 3I0NA 3RUAA 5HKAA 5FBQB 3VGPA 5EEHA 4FK8A 4HUJA 2P77A 4BRZA 3S2GA 2QU7A 1MW8X 1VKNA 2C0QA 3OFNA 2Z1NA 1IZ0A 3MMNA 2EIXA 1WR8A 1FP1D 1Q0LA 3OD1A 4FFBB 4GL4A 4LYDA 4NAVA 2BJHA 3AJAA 4GM4A 5M29A 4KR9A 4UNRA 5B3LA 3FBWA 4ICIA 4MVJG 1BXZA 1K7CA 2J9FB 3M5PA 3AVYA 5KJ1A 4W7IA 4EHHA 2GD6A 1BXKA 4KPGA 4O2AB 3SAJA 3WL8A 3ZEAA 3MLBA 1QB8A 1LQUA 2OR3A 2HLDD 4HX9A 1BCSA 4Y6SA 4KOEC 4AY5A 4DR5B 2B37A 1XX6A 4K3UA 1VLHA 4RSMA 1Z62A 3L07A 4OQZA 4UJ3A 3ZG6A 4BX0A 2G4CA 5TGZA 1JAHA 2EKLA 2H51A 4MVJH 4NE9A 3RF7A 2JIZD 1ZK2A 3JQFC 2G17A 4D81A 4YAUA 4CQMA 5CUQA 3EVNA 4BL5A 2UV8A 1TO6A 4KR3A 5GJBA 3JASB 1MQSA 3EWSA 4RHTA 2JCVA 3A37A 3TLGB 1Q7CA 1AZSC 1IHXA 1V7QA 2G0NA 2P0EA 2QXUA 1RJWA 3LT2A 3EMKA 4Q9HA 4BPRA 3QUBA 5AXDA 1Y1QA 3L0IB 3U31A 5CFZA 2BSQA 2BSAA 1S8FA 4K9OA 5EP3A 5C80A 1NIPA 3G6WA 3GOHA 5CA0A 1X1DA 3MTJA 3RS2A 4TUYA 2C5FA 3V1YA 4ZOQI 4E4TA 4LXIA 1CF4A 5EWLB 4EZBA 2NVBA 1MENA 2R3SA 4ZCQA 1NPYA 2PMBA 4J6FA 3I2JA 1TF2A 2DLNA 1DCTA 3PA6A 1MGPA 2C4WA 1Z2CA 2XLBA 2HA7A 2IOHA 3GV0A 3SXJA 4N9WA 1VKZA 4ZT3A 1TD9A 3GRVA 1KY3A 2FSHA 2JIDA 2W2LD 4EY3A 1ZMXA 4MRVA 2CMFA 4NZPA 1XKXA 3USES 1Q44A 4MLPA 1N1DA 4PAWA 5KREA 1AQJA 1NX9A 3IESA 2OXTA 5HHTA 4J0DA 3U3MA 2Y2UA 4NZMA 3AL0C 3ZGZA 3U3OA 5CX4A 4F5YA 4UBKA 3VBCA 4AT1A 3SVZA 1U2ZA 1ZM4A 2LRHA 5GJCA 1J7JA 1P6QA 4LE0A 3UXHA 5CH5A 1J0CA 4BP8A 4M76B 1V1RA 1RHUA 3R44A 3OUUA 1QQBA 1TAUA 3RREA 1FDRA 1ZWKA 4LDJA 3OSZA 4FYPA 4XLTA 5AKGA 1H6AA 5HRAA 4AJ1A 2LIVA 4FHZA 1ZD5A 1VKJA 1GWNA 1KO8A 1XTZA 4JC8A 5EHIA 2OVFA 4J1TC 3F98A 1KHTA 2PJDA 4QIHA 1NQWA 1D6MA 2IZ6A 3FYHA 2O8DB 5AUNB 2P3SA 3ZNOA 4EFLA 1JUDA 4EWLA 5DO9A 3H4VA 4I6EA 4FCCA 2UKDA 3V00A 4Y8VA 1MQ8B 3ET4A 4M55A 1REQA 1I7PA 4RTPA