2JCSA

Active site mutant of dnk from d. melanogaster with dttp bound
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
198
structure length
198
Chain Sequence
TKYAEGTQPFTVLIEGNIGSGKTTYLNHFEKYKNDICLLTDPVEKWRNVNGVNLLELMYKDPKKWAMPFQSYVTLTMLQSHTAPTNKKLKIMERSIFSARYCFVENMRRNGSLEQGMYNTLEEWYKFIEESIHVQADLIIYLRTSPEVAYERIRQRARSEESCVPLKYLQELHELHEDWLIHQRRPQSCKVLVLDADL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DEOXYNUCLEOSIDE KINASE
publication title Functional Studies of Active-Site Mutants from Drosophila Melanogaster Deoxyribonucleoside Kinase. Investigations of the Putative Catalytic Glutamate- Arginine Pair and of Residues Responsible for Substrate Specificity.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transferase
total genus 75
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature ec 2.7.1.145: Deoxynucleoside kinase.
pdb deposition date 2007-01-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2jcsA00
4RD6A 1MO5A 4TQAA 3L8ZA 1OLOA 3W3AA 4Q18A 1W2HA 1LB1B 1XBTA 4BZPA 3KUCA 5EXPA 1XCMA 1SVIA 1KMHA 3H84A 1UEJA 4LJ9A 2FEOA 1G3IA 3L0PA 3TE6A 4HDCA 3P26A 1Z0AA 1IN4A 821PA 1AA9A 1Q1EA 1P2UA 5IT5A 3VR5A 1GFIA 2VO1A 3K0FB 3PUWA 2X77A 4RVCA 4ITRC 4TLEA 2ZSDA 1SHKA 4LHZA 1P4SA 4D0GA 2O52A 2ZYWX 4DKXA 1HA3A 2OESA 2FH5B 1KDPA 4HB3A 1LS1A 4AG6A 1G8HA 3RS7A 2LKCA 3BB1A 3RHFA 4TTRA 5F2EA 5EXSA 4NCHA 3WYGA 4RD4A 5JCPA 2QZ4A 1QF9A 3CH4B 2VP0A 4CEJB 2CL0X 4KVAA 3QUSA 4Q1DA 3CRQA 1GZSA 1FZQA 1Q3TA 2BBSA 1W46A 3QVUA 2AN9A 4RFVA 2NTYC 4B3FX 1CJVC 1XTIA 2ZREA 4WOPA 3EPLA 2PMDA 3REFA 1FFHA 4B34A 3PUVA 5B58C 3THWA 1S4QA 1JJ7A 2BBTA 1BS1A 1G7TA 5C2JB 5K8UA 2ONJA 1FQKA 3GLGE 1TQ6A 4IDPA 4AC9A 3W6OA 1BOFA 3IIKA 1CR0A 4P4UA 1E1QA 2RGNA 2XXAB 3A1UA 1DAKA 3LFUA 4DLYA 4P3YA 2QMOA 3Q5EA 4NKRA 2PT7A 4LYAA 2RHMA 4PO1A 2OEPA 4CRWB 3I3SR 1WRBA 5JWHA 4EJSB 5AUPB 1D6JA 1TQDA 3VNVA 4LJ5A 3QKRB 2ZJYA 2ZPTX 2K5UA 3SN6A 1BKDR 2HT6A 2BBWA 1DADA 3SHWA 4BE7B 2WSMA 1KI9A 2C8VA 4RFSA 5G53C 5BYJA 4ZV4A 4B3GA 3AVOA 1R5OA 1AGPA 5EP1A 2WZQA 4AIIA 4CDGA 1U0HC 3GEEA 4DLUA 1JR6A 4FCTA 2IT1A 3RABA 2WKPA 2XOKD 3W8RA 1ZINA 2BEKA 2BBOA 3NVAA 5DI3B 4GP7A 2WJHA 1US8A 3F0TA 1F3OA 2EWWA 5A4JA 4EUNA 1DEKA 1KNQA 2B92A 4XWOA 1DBSA 4Q21A 1H8HD 4B76A 5BN4A 5GJVC 2YWEA 4DSNA 1RE0A 1OW3B 2ZAOA 3X1DA 5KNCA 4Q7LA 4A6XA 1GL7A 4U5XA 3IO3A 1XTKA 2QP3A 3IPYA 5J4KA 2GJ9A 2H8KA 4Y0AA 1W0KD 3MD0A 1RIFA 2BVNA 5LD2C 1IXSB 1EG7A 3BORA 2V4ZA 2JIZD 5LDDC 3HU3A 2GXAA 3JVUA 4H1UA 3W3ZB 3IHLA 2QL6A 2ZAMA 1NMZA 1II8A 5EE5B 4B32A 3P32A 2WKRA 1KKMA 3LBHA 4PC1A 5G40A 4ARZA 4DLXA 4PR0A 1G18A 2C77A 4AYTA 4PO8A 5F98A 1G4UR 1PV4A 2GVZC 621PA 3TBKA 1ZMXA 4FMDF 2G83A 2R6GA 2XOKA 3B13B 3LBIA 5CDFE 2FEMA 2IYSA 3I8SA 3NHBA 4MRSA 3DZ8A 1KAOA 4AKEA 1SXJC 1CR1A 1QHNA 1RJ9A 1OHHA 3CRRA 5HTKA 2ZRMA 3F8TA 5FOWA 1ZVQA 4E07A 3KQNA 1X6VA 4C9BA 1N6PA 3NC1C 5CK5A 4FCWA 3C16C 4GRAA 2A5YB 2O5VA 4GPTA 1GM5A 2QE7D 2F3RA 3THYA 5EQTA 4F4IA 5JJKA 1ZU5A 2BKUA 1NN3A 4RY2A 2O8CA 1J8MF 4IOJA 2Z6VA 5CM9C 4IHQA 1NIJA 3ZQ6A 1W0KA 1BMFD 1LTQA 3B9PA 1ELOA 3BERA 4DT1B 1M7BA 1DAIA 2QU8A 4M1TA 3IKJA 1XMSA 1K5GA 1DVRA 2E87A 2ZRKA 2GEUA 2HYDA 2DY1A 3EPKA 4PFSA 2ZS9A 4P32A 4Z1MD 2G3YA 5FI1B 3LA6A 2FSGA 2CVHA 1ZM4A 4AKGA 1G16A 1MR3F 1N6OA 1ZP6A 5GVSA 2PT5A 2HDNB 3BFXA 4LHYA 3THXA 1EESA 4IXMA 2J41A 4TLBA 2PZGA 4AY2A 4NCJA 4AURA 5E3HA 1VIAA 3ZJYA 1PJRA 1N0UA 2GZDA 2O8FA 2GA8A 1J90A 4IJMA 1M6NA 5DIFA 2FWRA 3U3KA 5LD2B 1RPZA 3GLIA 2FA9A 4U7DA 4JVMA 1C1YA 4NDZA 3EA0A 1IHUA 2OSBA 3T61A 4XTRA 4EKDA 1OF1A 2PJZA 1EXMA 2NGRA 2QSYA 4KITB 2QE7A 3WY9A 1WQ1R 2RGCA 1OJLA 2AKYA 3NBFA 1E2IA 3T1OA 2GCOA 3T35A 3F5FA 1EFRA 5FPSA 6Q21A 4FCVA 1BMFA 5G41A 4KFUA 3K0AB 4M2LA 4XSHA 1P9RA 1YZNA 3FKSD 3ZVRA 4DVGA 1CRQA 3FHCB 1SXJB 2JJ1D 4MDEA 1EX6A 2FU5C 3ZIAA 4C4PA 1CIPA 4P31A 1AZSC 2QPAA 3BFVA 4B33A 3QQ5A 3CUEF 3QXXA 4QM6A 5DLQC 2R8RA 5EJEA 5J47A 2P3SA 4Z1MA 2AR7A 2CCKA 3TMKA 2ZU0C 2HV8A 2B8TA 3K0EA 2IYYA 3KZ1E 1IJEA 4E5UA 1Q21A 4IVPA 2AK2A 3QY0A 2YNMA 3A4LA 2FGKA 1R0XA 2GJKA 2IS1A 3UXMA 3BIFA 2ODBA 5FBRB 3BBPA 4ZDKA 3RSOA 4DRZA 3DKVA 5DHFA 3D6TB 1LF5A 3IQWA 4TMXA 5KSYA 4BLPA 1CJUC 4M0LA 4PAMA 1FW6A 1K8RA 5B30A 5F9HA 1D2EA 3NH9A 2CHVA 2CNWA 1GDDA 3P20A 2WWHA 3QBVA 4MYUA 1Y63A 4ZPXA 3RS4A 1N25A 1OV4A 4BFTA 3EX7C 4JL5A 2ZEJA 4LJ6A 4URVR 4OKSA 5DI9A 4B3CA 3QVVA 3R7WA 1OH5A 2AD1A 5DGXA 2JLZA 3RS2A 4PHHA 3BAFA 3UKDA 1M7GA 4Q7JB 4QXAA 5DO9A 3QENA 2NQ2C 1XFAA 4RKEA 3K70B 4S35A 4AK9A 2BMJA 2ZE5A 1KHTA 3LLUA 1NVUQ 1T5IA 3UK6A 5FPTA 3B6EA 3I5XA 3HPRA 1ESNA 4R2HA 4B6EA 2ZANA 4MYHA 3E70C 4N3NA 1MO6A 1TQ2A 2QRNA 2V9PA 4V0ME 1FP6A 5G3YA 1Q20A 1GUAA 2ZRJA 3FGNA 4US0R 2HEIA 2VEDA 4QFMA 1FX0A 1M74A 1R0YA 2BJVA 2W00A 3TNFA 1Z0DA 2YOGA 2QPOA 2C2HA 3BXZA 4Z51A 1Z29A 3C41J 3R9IA 3JVVA 4V0LA 1G6HA 2ZUCA 3REGA 3RS0A 3LBNA 1GSIA 1YZUA 3C5CA 1TUIA 2X1VA 3WBKA 2JJ8A 4BFXA 1DO2A 1AM4D 4D4JA 1BO6A 4IEIA 5L3SB 4DSOA 3QIAA 5CJ2A 4CIDA 3QKSA 4GFDA 3U44A 4B74A 4LHVA 3DEFA 2CBZA 4UKDA 2BCJQ 1KDOA 1M2OB 1ZRHA 4ON9A 2QORA 2YWGA 3EW9A 1UBEA 4DHEA 2BHRA 4Q00A 1ETUA 4LYFA 4LJYA 3HWSA 1OFTA 4URWR 3BWDD 5TMPA 3PEYA 1E2JA 1N6KA 4U00A 1E2DA 4LJ7A 1XXHB 2V6IA 3UG6A 3NDBB 1GVNB 2ZR0A 2C95A 4YMUA 1ZBDA 1E0JA 1T9HA 3U7EB 5JEEA 3ZS9A 2Z4RA 2JCSA 2IUUA 4R2IA 1KSJA 1OH8A 2PJRA 1IN8A 4Z8XA 1J70A 1ZJ6A 1T5LA 4MYCA 1OXXK 1COWD 1NP6A 1H65A 3K09A 4CW7A 3OIUA 3R20A 1AKYA 3W5JA 4BZQA 2JEOA 2YHSA 1DARA 2D7DA 4BLOA 4HEJA 3TUZC 1GWNA 4LX0A 1JALA 3B1VA 1T6NA 3GFOA 3B8HA 3KB2A 2JA1A 4BRWA 4BPBA 2IWRA 1FUUA 1OB2A 5E7JA 1B23P 2N42A 1JB1A 3QXCA 5L8VA 2UZ3A 3SJZA 1N3BA 4F93B 1VIYA 1KGDA 4C3ZA 4DJTA 3Q7PA 3UMFA 1G5PA 1XZPA 2C9CA 1A82A 2PEYA 4FWIB 4KBGA 4BASA 5EXTA 2Y8EA 3B85A 5KOYA 2R65A 4DEYA 4PPQA 4G5QA 1VKJA 5HPYB 2GXUA 4TQ9A 1NJFA 2X8AA 3E2IA 4PHTA 1YZQA 4G01B 2C9OA 1X3SA 2AFIE 2EFHB 1YZGA 2W2XA 1KO5A 1PUIA 1GNPA 1KI1A 3GLGB 1W0JD 2ZYVX 4Q1CA 2P6NA 4URUR 2QBYA 4KYUA 3T1QA 4BEJA 4D2IA 1E9CA 3PXGA 3QKUA 4W7SA 2GHIA 1XJCA 3VU9B 3H0KA 4LC1A 1GKIA 3KQHA 3EXAA 3JZMA 3SZRA 4GDFA 3RRZA 5DHAA 1KSHA 5C1BA 2BV3A 4OHWA 2KBFA 3L2OB 4PSKA 3HP1A 3CPEA 4QC2A 1TADA 2IF0A 4NPHA 4C7OB 4Q9HA 4OK5A 3LDAA 2RGDA 3OHMA 4JL8A 2ZIAA 4W5JA 1MV5A 3I62A 4TT3D 5BN3A 3OIYA 2P6RA 3CKLA 421PA 2GK6A 4A8JA 1IOZA 2JLSA 5J4VA 3WXMA 1G41A 1P7CA 1SZPA 4GMXA 1R5BA 5AK0A 3AGQA 4B2IA 2D06A 4F38A 1WDTA 2CE7A 1ZM3A 1W5TA 3SS8A 2FE4A 4DDWA 4ZCIA 3U5ZB 1JECA 1R4AA 2Q0HA 3RC3A 3ZD6A 3OEED 1ZIPA 3L0OA 2IHBA 3BGWA 3MJRA 2JAQA 1Z0IA 4DBLC 2WM9B 4U02A 1E2MA 4C2TA 2BMDA 4B73A 2W58A 5A0FA 1RFLA 2WVJA 4GSYA 4OHVA 3KUDA 1W0JA 3GQBA 5JI3E 5CYOA 2QROA 4KO8A 3B2EA 3WMFA 2F1RA 2IYLD 3B5JA 3MWLA 1FNNA 3SFZA 4BGDA 4M9XA 4JLKA 1U98A 3A4MA 2YWFA 4WXRA 3X1YA 4A92A 1S8FA 4GI7A 4JJKA 2VYFA 3NIBA 4EDHA 1QBKC 1U8AA 2AL7A 4B2PA 2IWHA 1MABB 2JLWA 5TVKA 4ZI2A 5FBVB 3L0SA 1L7VC 3LO5A 4TT3A 2D74A 4KBFA 4L9WA 1EX7A 4RZUA 5D3MA 2ZE6A 1U9IC 4ZDWA 1LY1A 5SZIA 3EWSA 4DZZA 4YXWD 4OQNA 4Q48A 3MRSA 5P21A 1UKZA 3PG5A 4Q9JA 1Z0JA 5L3QA 1R10A 2R6DA 1BYIA 2J7PA 4TYQA 4JIMA 1W2GA 5JWOA 4L16A 4KLZA 5HKKA 3U6KA 2KJQA 1R6BX 1VCMA 3OEEA 1NIPA 2LKDA 1Q1QA 5K8TA 1RRGA 2QENA 3C7KA 2J0UA 1D2MA 4KFRA 2GEVA 3OIWA 4LHXA 1HY3A 5CIWA 3TKLA 1EFCA 2WPDA 5FUXA 2IXEA 5DSZA 2ZI5A 2IK8A 1G8YA 2IBMA 3NBXX 2EFDB 1JQJC 4PZLA 2CHGA 2OLKA 3RWOA 1AQYA 4TYYA 4HZUB 4GP6A 4RCYA 2FMXA 2DCUA 2XX3A 3HU1A 4KSCA 1N6IA 3GJ6A 4NL4H 2F43A 4XD7D 3T1VA 2QMUA 2I3BA 2ZS7A 4EPRA 4LV6A 3V9PA 2VF8A 3I5YA 3SFVA 2WSSD 4JJZA 4JMPA 3LVQE 4MGZR 1KIMA 3A1TA 4LBYA 5CYPA 3KKNA 4QBIA 3KKQA 2F1IA 2JLVA 4JLOA 4TN1A 4LJAA 2WIAA 3P4XA 1XTSA 3Q72A 4QHTA 1DELA 2CCGA 1QHXA 5FR1A 3PJRA 3O47A 4YXWA 1YR9A 4QGAA 4Q4JB 3TR0A 1P60A 2RHDA 1T0HB 1DS6A 3QEOA 2GDJA 3QXJA 2OBLA 3SJCA 4Q66C 2VBCA 3C8UA 1NVWQ 1Y3AA 2BJWA 3CIOA 1XTJA 2MSEB 3EZ2A 4JVSB 4PZYA 2W0MA 2W6JA 3CZQA 4FMDB 4JBYA 3AF3A 2J46A 2P6UA 1JAIA 4QBHA 3SI7A 3TUIC 4B6FA 1ZUNB 2VP2A 1MRSA 4ZCLA 3ZZUA 1IXRC 3DHWC 4LOAA 3CRMA 5KNBA 1P75A 3VX4A 1E2PA 3A1SA 5KSOA 2ERYA 3E1SA 5E7MA 2IHYA 1YZLA 1N6HA 4HAUA 5LB4A 1VTKA 1W4RA 2AWNA 5BXQC 4MRPA 5HZKA 4OI1A 4A82A 2V54A 3ADKA 4PPNA 1KJYA 2I4IA 3W34A 1ZYUA 4Q4AA 1VG1A 1Z08A 4JVNA 4MKFA 4O2RA 3VTKA 1Z2CA 2PLFA 5KO2A 2DWQA 1M1YE 1MOZA 2Q21A 4X8LA 1S1MA 5SZHB 1SVSA 4BFVA 3KQKA 4KODA 3E5HA 2V1UA 3AKYA 2CVFA 1WA5A 2BMEA 4JS0A 3EZ6A 3WBJA 4F7WA 1YJ5A 2VHCA 5JSZA 1QHHB 4PQFA 2JLUA 1LS6A 1KNXA 3CONA 1U90A 2P0EA 3EC2A 5KTYA 3DOEA 4TMKA 4MRNA 1KDTA 3VKHA 3AB3A 3U3RA 2R6CA 2J3EA 1OKKD 1QHSA 2XTMA 4M1OA 1UBCA 2VH5R 2O0KA 1VHTA 4Z8YA 1II0A 4WAUA 3RRMA 3CO5A 1YZTA 5LB2A 2OAQ1 4Z54A 2ONKA 1W36C 2FPMA 1L2TA 4UXIA 1XEXB 4TL8A 1CR4A 5EP2A 4ASUD 4Q7MB 1KJZA 1Z0FA 5CB8A 1MO3A 1X8LA 5CLLA 3SJBA 2QQEA 1HH4A 2DFNA 4ZO4A 1NI3A 4AKHA 3SQWA 2RGGA 2O8BB 3UATA 1J99A 1UEIA 1TF2A 1EWRA 1N0VC 4QBGB 4OYHA 4RD2A 4D80A 2P5TB 1QZXA 2G1JA 1Z0KA 2Z5FA 2AD5A 4K8OA 3HJNA 3X1XA 4CEHB 4NZYA 2RGNC 4R98A 1E2KA 5DH9A 3BH7A 2Z4SA 3PUZA 2J9RA 4B3BA 1E9RA 2IL1A 4GOXA 5FL7D 2FOLA 1AS0A 1CJMA 2PL3A 4DB2A 4PPGA 4UQOA 3T1TA 2E9SA 2XSZA 5EE3A 3PUYA 5C4MA 4TLCA 2WTUA 2FGJA 2ZU6A 2VP9A 3D31A 3QF4B 1NN5A 4LSGA 5JFGA 5JLJA 2ZUBA 1YKSA 2KBEA 4GZMA 5FOXA 4B3XA 5JECA 1OKKA 5FI0B 2ZR9A 2FSFA 4JZKA 1G3QA 4EJSA 4LBWA 3T34A 2OUKA 3C15C 1G4AE 1LF0A 4L5BA 4LY6A 3CF6R 1XP8A 1TL7C 1GAJA 2HXSA 4KCGA 3VR4A 1N0WA 3MGCA 2CLSA 2X2FA 4ASUA 2QNRA 3MLEA 4CT5A 1XD9A 2G6BA 3NBZC 4D82A 1C4OA 1JNYA 5H1YA 4X8HA 5DI3A 2AHOA 1UFQA 1GTVA 1KKLA 4LGMA 3GLHA 5F3WB 3B82A 4MGKR 2BEJA 1S1CA 2CJWA 1WBDA 1J2JA 1G8GA 2VTKA 3PV0A 1E9SA 2FN4A 3QNUA 2IYXA 2ZSEA 5FOSA 4OQFA 4PZZA 4QHYA 4S2EA 3TVTA 4TZ6A 4TL6A 2OLJA 1W36B 2XB2A 2NO1A 2C98A 1S9HA 3NH6A 2DFLA 2F9MA 4Q1EA 5FL7A 2JATA 4KV9A 1E9AA 3AF0A 4PAOA 4E22A 1TEXA 4BFZA 2IA5A 4IFBA 3ND8A 1OHHD 1XPRA 1XTQA 3TQFA 1KYIA 3Q3JB 1G291 2Q3FA 2W2TA 1RZ3A 4NMMA 4M22A 5KDLA 4XWKA 3THWB 1YR7A 4BFYA 1HV8A 2EFGA 4HB2A 2N1BA 1KI2A 2QTFA 1KZGB 1Q44A 2G77B 5BW8A 3ZLJA 4W5HA 3RC8A 1YR8A 1NVXQ 2OE2A 1W7AA 3B1YA 1KK0A 2ANCA 2OILA 4HUQA 1OFIA 4XOIA 5CB6A 4K46A 4PC2A 3CNNA 2YWHA 4DCTA 2R62A 4LRWA 1FTNA 2V7QD 3DDCA 5EE1A 4RFSB 2NPIA 2CHQA 5FL3A 2WBLC 2RGBA 4ZKDA 4AKIA 1HEIA 1IY1A 3AKEA 3WRYC 2VSFA 3UANA 2XZPA 3K0SA 2P65A 4C0HA 3R9WA 3VHXA 1US8B 4DDUA 2OCBA 2WWXA 2R44A 1JR3E 2WV9A 4Y0VA 2OBNA 3O8CA 4PC3A 1UJ2A 3K9GA 2V3CC 1BIFA 1MRNA 4OK3A 3DVLA 2QAJA 3SC3A 4FI3C 4JLMA 4O0MA 1OIVA 1RYHA 3B60A 4JT4A 5FUWA 1QHIA 2ORWA 2GETA 5J5CA 1E2QA 3O8RA 4B48A 4EPWA 3VHLB 3KDSE 2EFEB 3VR1A 1G8FA 2KE5A 3WP1B 1HYQA 5CLQA 4UJ3A 1EFRD 3IQXA 1IONA 2WAYA 4A0GA 2CLDX 2J7KA 2JLXA 1P62B 1GNQA 3FMFA 3OE7D 1CXZA 2F9LA 3ZIAD 1IN6A 3BOSA 2O8EA 3U61B 4IOLA 2V7QA 2JASA 3CX7A 5K8LA 1UDWA 2QUZA 4DSUA 1E1RA 2Q3MA 1SVWA 1W4AA 3HDTA 1UDXA 2DPXA 4NBSA 4ZCMA 1S0UA 4EFMA 1U0JA 5E7IA 1BYUA 1NY5A 2HF8A 3A37A 3KB1A 1UM8A 3U4QA 4KYIB 4OJQA 4A9AA 3ASYA 1UBGA 4KAXA 1SVKA 5FUYA 1YR6A 4BUJA 4M1KA 1P61B 4N0EA 4D25A 4Q4HA 3THYB 3RWMB 1M8PA 2ORIA 1VG8A 2CNWD 2WIBA 5FFMA 521PA 4XVUA 2ANBA 1XRJA 5BN5A 4LC0A 3I1FA 3K70D 2ZRHA 2ECKA 4OI4A 4BRUA 4JYBA 2ZE7A 4G5OA 3TSOA 1KI6A 3H86A 3LH5A 3P4YA 2TMKA 2ZROA 3P1JA 4WVFA 3OAAA 3U3OA 1SKYE 3KXKA 4Q1BA 2J0SA 5GADl 4DEXA 2H17A 2YJTD 1A7JA 1G1MA 3LNCA 3OE7A 4EFLA 5AUOB 1E98A 2WJIA 3FPAA 5HE8A 1RRPA 1ZUHA 1YQTA 3THXB 1SULA 1XDBA 2EVWX 3BH0A 4NU0A 4D4LA 1R7RA 2Z0MA 5KPJA 2R6AA 2P67A 2WOOA 4B3DA 2LWIA 3GJ3A 4OQLA 2X19A 4RZXA 4TL7A 5E95A 3CNOA 4Q1AA 5FR2A 2O8FB 2C78A 2PH1A 4EPVA 1X86B 4YONB 4RZ2A 3AM1A 3GFTA 3UPUA 4LUCA 3ZD7A 2O8DA 3NG1A 2ZTSA 1ODFA 3KTAA 2Q9AA 3DM5A 5FTKA 3RAPR 4LHWA 3FMOB 4Q03A 2E1RA 4GNKA 1XZQA 2DFTA 5J4HA 4UNSA 1CULC 1P3JA 1II9A 2HF9A 4A4DA 4CVNA 5JRJA 2GCOB 4HZIA 1CBUA 1IBRA 3SJAA 3DM9B 3DZDA 3AV0B 1QDEA 1PZNA 4OI0A 1LV7A 3DL0A 3X2SA 2A3RA 1ZUIA 2PZEA 2ZRBA 3DOFA 3UWOA 2QEQA 2QG6A 3GP8A 3N70A 3KJHA 2GTPA 1A2BA 3SEAA 4IOKA 1DG1G 5A5GA 1L4YA 2ODWA 2IS6A 4IDHA 2ZSAA 1P73A 2HT1A 1PLJA 4GT1A 4E03A 4V02A 1JEDA 3UIEA 4IVRA 4Q01A 2AK3A 3QPUA 3CM0A 3RDPA 4R7ZA 1XEFA 2HCBA 3A1WA 3EA5A 3O8DA 4UXJA 4YMWA 1V43A 4AG5A 4DWJA 4EQ6A 4TZ0A 3NKVA 4JLJA 1E0AA 3U7FB 2IYQA 1WE2A 2FZ4A 4OHXA 1IY0A 1JXOA 1RVDA 4YQFA 2FFHA 2ZJZA 5L3SA 5BYKA 2BCGY 4N0DA 4PSVA 4FWTA 1HURA 4KFSA 1G7SA 2FX3A 4I1OA 2GJSA 3DKPA 2D62A 1XEWY 4V03A 2ZRFA 3TIFA 4B75A 3NTUA 1XCPA 1CU1A 1ZD1A 2GNOA 1X8JA 5FPKA 3GJ8A 3TVDA 3KQUA 1KI3A 3Q7QA 2N46A 1VG0B 3VKGA 2ZI4A 1NBMD 3WYAA 1FTSA 1T3HA 3FFBA 4M21A 4NYMR 1XXHA 3B1XA 2ORVA 1S96A 2VIIA 1NG1A 1O87A 2PCJA 3MG9A 1CF4A 2VA8A 3K09C 4GMDA 2D2EA 3GLFA 1VG9B 3LX5A 5G3ZA 3VR2A 3ZGXA 4F92B 3RVBA 4BFUA 4MGYR 1YRAA 5AWFC 2V1XA 4DLTA 4TSFA 3KL4A 3UMSA 4YDSA 4DDVA 2Z43A 4DCSA 4L4UA 5M04A 1G19A 2ZUDA 3CH5A 2H16A 1NMYA 2Z83A 4DCNA 4C0BA 5CJPA 2J0QA 4ZIRB 5K8IA 2BWJA 2Q6TA 2VRWA 2EQBA 1FNMA 1N6LA 1HQYE 1XD2A 2H5EA 2IYRA 3C5HA 3LW8A 4BLSA 1DAEA 4LPSA 4AI6A 4RZ3A 3A36A 3K0CA 2REXB 3QJYA 3ETLA 4NYJR 1G3MA 2GAAA 1PVOA 2VF7A 1E2GA 1Z6TA 3V4FA 3U44B 1NBMA 2JJ2A 3GFPA 4JT2A 3D3QA 3ICEA 2EFCB 3GMTA 3IILA 4LJ8A 1WCV1 4WZAE 4BQSA 1K6MA 3OEHD 3UMRA 5EP3A 3VAAA 1OE0A 4URYR 1JBKA 3U60B 1IXZA 1S9DA 2G88A 2XGJA 5AR1A 4HB0A 1I4LD 3GLHE 2D7CA 3QE0A 3VU9A 4C0SA 3AH8A 1AIPA 3IHWA 2QMHA 4TMWA 1OSNA 1IQPA 4HB4A 4G1UC 3FHTA 5LPNA 4A8JC 2C04A 3TQCA 1OFHA 1F2TA 1E0KA 2A5JA 2GCPA 4NYIQ 4UJ5A 3WNDA 2QRZA 2D3WA 3EAQA 1BH2A 5EP4A 1IN7A 4DC9A 1VCNA 4PAQA 3CLVA 2X2EA 2OXRA 4I1UA 2H7VA 1KAGA 5H70A 4FMBB 3LQRA 2VLIA 4OHYA 4ESVA 2FFQA 1CLUA 2GAOA 5TV2A 3ONWA 4OBEA 4ABYA 2GBLC 2VHUA 4BLTA 2UZIR 4UNRA 4IDOA 1KI8A 1KO7A 1G21E 2RGAA 4B43A 4DCVA 1NKTA 3Q8XB 1DO0A 1SKQA 1MKYA 1UKVY 1IAQA 2OG2A 1P2TA 3K53A 3QXSA 5AJXA 1F2UA 4DLRA 3V00A 5FTNA 3OEHA 1VYUA 2XTNA 1UADA 1ZC4A 4EAQA 3QG1A 4ZDJA 4I1SA 1G3RA 1XMJA 3WMEA 3ADCA 1YU9A 2J7PD 4EIWA 4HDOB 2DBYA 2ERXA 2R9VA 2AFHE 1ZNYA 1AS2A 5HKKD 4NCKA 1SHZA 4I81A 5CM8B 4F4JA 2ZRCA 5KSPA 3C14C 3TLXA 3CBQA 1R8SA 2IYWA 2VL7A 2PLRA 2QBYB 4R71A 121PA 2J45A 4NH0A 2WWWA 4FW9A 1GKYA 4B44A 4MYTA 4KSBA 3GJ4A 2WPDD 3A4NA 2WAXA 1UBFA 4CEIB 3IIJA 4JBXA 3BK7A 4HSEA 1G5RA 3IO5A 4BLQA 1A4RA 4M4SA 2EU8A 5JI2E 1JPNA 3H2YA 4M53A 3TAUA 2QP4A 2I1VB 1R8QA 3H4MA 2FNAA 2XTZA 3VX3A 1XF9A 1SVLA 1X8KA 1E4YA 1XD8A 3ZZ0A 3GPLA 3SYNA 2O0HA 4HLQB 1KOFA 3I61A 3H1TA 1U2RA 4W9MC 3PEUA 3IBYA 4A8JB 2YC4C 3AGPA 4PPFA 4RCZA 4WA7A 4WZ6A 2ZSBA 4J0QA 4H9GA 4CF7A 4IFEA 1TUEA 2WWIA 2ZRNA 1WXQA 4HLDA 2ZJ2A 2A5DA 3MFYA 4NCIA 1UAAA 1Z07A 1TPZA 2MSDB 4E09A 1XB2A 2QAGA 5FBLB 1P2VA 1JXMA 5JRZA 4URZR 2EYUA 1J7KA 3QPVA 1V5WA 3IGFA 1EFUA 1T4GA 1Z6GA 3KXIA 2HYIC 5JBQA 1H8ED 2W6JD 2YC2C 4TYPA 2HXYA 2QY9A 3MJHA 4MH0R 4TTQA 1E94E 3L8YA 1VMAA 2ZJBA 2P5SA 2YVUA 4IDQA 5AJZA 3GJ5A 3PR1A 3WP0A 4F91B 4RKFA 3B1WA 2UVQA 3CWQA 3GEHA 3SYKA 5FTJA 1GP2A 3GLIE 4D0LB 2F7SA 4C0JA 1FQJA 3I73A 3SQXA 4JVLA 2QMEA 4IXNA 5FPYA 4KHZA 4NE2A 5EXXA 5EUMA 4CYMA 1FMLA 3EPJA 2A30A 1TU4A 2QI9C 2YV5A 2IXGA 1GRQA 1NLFA 2IYVA 5GJWC 4LZZA 3G0HA 1MT0A 2J5XA 5D3MB 3KFXA 2XNDD 4C0AC 4RJLA 1DPFA 4UNPA 4EPXA 4X8MA 2WWYA 1W5SA 1RC8A 2GJAA 4D0NA 1Q57A 5L3QB 2IW3A 2O0JA 4JSYA 3BD9A 3ADBA 1HT1E 2H1LA 4KJZA 4PSAA 1T3LA 3ECCA 3T15A 3LLMA 3G5UA 3G82C 1E79D 1YRBA 2OCPA 3HYRA 3X1ZA 1E0SA 3SHFA 2GZAA 2RH5A 3W9YA 4LK2A 2J0UB 2QGNA 1H8EA 2XJ4A 1GIAA 4KVGA 5EE9A 3WHKA 1NSTA 2WHXA 3B7GA 2REBA 3RLFA 4K81B 1OB5A 4QG7A 4QGGA 3CR7A 1GL9B 5IK2D 1SKYB 3BC1A 4W5WA 4MKIA 3T06B 5B2ZA 5JHGB 5HZHA 5SZJA 4FXPA 3GD7A 1Q12A 4URXR 1JPJA 1E2EA 2QA5A 3A8TA 5E4FA 3AKCA 5BQ5A 5UKDA 1TTTA 1Z6YA 1QHHA 3I32A 4I1VA 1E32A 1KI7A 2RMKA 4IEEA 2GILA 5KUTA 2B7BA 2IF2A 2GZHA 4OHZA 4MQBA 3GEIA 5H8WA 1ZC3A 3NXSA 1CP2A 1FUKA 1XTRA 2NO0A 2C96A 2EWVA 3SBDA 5DNYB 1AQUA 1P5ZB 3AQ4A 5AUQA 1GKUB 4EFNA 2DHRA 4OQXA 1N6NA 2XNDA 4FINA 2C03A 4HAWA 4BECA 1T0JB 1WBBA 4LYHA 2QGZA 3W90A 1ZD9A 1XPUA 3GJ7A 4A6PA 4ACBA 4NYMQ 1OT3A 3FE2A 4JKYA 2PX0A 3BE4A 3ICQB 1XEXA 2XSZD 4D26A 3S1AA 3ZVLA 3FKQA 3RRNA 1HT2E 3EIEA 1VHLA 4C0KA 1XU4A 4XVRA 1E79A 5C4GB 1D9ZA 1A2KC 1RKBA 2RGXA 1Z2AA 2QPTA 1WP9A 3L82B 4OQMA 1UKEA 1NN0A 3UG7A 4Q7KA 1AS3A 5FOUA 5IK2A 3CRW1 4JLAA 4CEHA 3K0FA 4V0MA 3K9LA 4A2WA 3AVTA 1G8PA 1RW4A 2QTVB 5L3VA 3ZVMA 2ZJOA 3QSYA 1FMJA 4EJSC 2FDCA 1OXVA 1KK2A 3KX2A 1KY3A 1TNDA 4HLUA 4JLVA 1X1RA 3TK1A 2SHKA 4CEJA 2W83A 4WIAA 3SE0A 5GJBA 2ZRGA 3QI2A 4NYJQ 3W5IA 5JSZB 1NG9A 1G64A 2IYTA 3OFND 1B0UA 1Q1BA 1JI0A 5JMTA 1R5NA 2R2AA 2ZI6A 3RS5A 3SBEA 2BIFA 1ESMA 3AKDA 2CE2X 3CNLA 2PEZA 2ZRAA 3T5DA 2A5FA 4I4LA 5IDVA 4DLSA 3LVRE 3Q85A 3M6AA 4QKQA 3GLFE 4KXFB 1TU3A 1XCGB 3THOA 4AWXA 4HAXA 4P4SB 2XXAA 1ZCAA 2QTHA 4NP6A 1E4VA 3LV8A 4C2UA 4QOSA 3AF1A 4PC6A 3SR0A 1I4TD 2G1KA 3DMNA 2FPLA 4MITA 4DXAA 1ZM2A 3QKRA 5HR5A 1YHNA 2WWGA 5BWMA 4A36A 2IYZA 5HE9A 1U8ZA 5TB5A 1OXUA 1N5IA 3QXHA 1DAHA 1P72A 5DYGA 5B64A 1KMHB 4DB4A 5FBWB 3AVVA 4FN5A 4JBWA 2ZYUX 1GILA 2VP6A 2YOHA 3NEJA 1N2CE 1OH6A 2FPKA 3M4YA 5DN6D 1ZCBA 2MMGA 8OHMA 3ND9A 1W4CA 4MKHA 1NBME 3OFNA 1GRNA 4QGFA 5JS7A 4KFTA 4QNRA 3FVQA 4RSGA 1G7RA 3PQCA 4N1AA 2ZE8A 3RYTC 2XEXA 4Q47A 3BB4A 4YDHB 4BFWA 4M9SA 2ATVA 4CGZA 4RD3A 3VR3A 2DFKB 4DIDA 4MUBA 2BKEA 2BC9A 4QJ5A 4TWZA 4NONA 2ZI7A 1GITA 2OO7A 3QOFA 1F60A 4DDTA 5AJWA 2JDID 4DUGD 4IRUB 4L15A 4Q9IA 2KB0A 2ZITA 1NN1A 2BMFA 2HCJB 3AEZA 1D9XA 3J81k 3MUFA 5FOVA 4US2R 2NZJA 1QRAA 1W47A 3PVSA 3IUYA 2IEYA 1OPXA 2QN6A 3BJIC 3GLHB 2P2LA 3C4JA 2V8OA 2H92A 4NCNA 2WICA 2CJWB 5TDHA 1IJFA 5JJLA 5CIQA 5TXGA 3TR5A 4GOKA 4LI0A 1FL9A 1T8UA 3WYFA 4CT4B 4WBSA 4ILEA 1G17A 1TEVA 2ZI9A 3GJXC 2CDNA 2OT3B 1E1RD 3FTQA 2VSOA 4JSTA 2FSIA 5DN6A 2XAUA 3SU8A 3X1WA 3ZDQA 4OK6A 4MDFA 1EFHA 1Z28A 3KKOA 3RSLA 3PEVA 2OXCA 2ZSFA 1XJ0A 3R9XA 3NDPA 3EARA 2FZLA 4NYIR 3I72A 4A15A 4QRHA 2CL6X 1UF9A 4QNMA 3LY5A 1A5TA 4DT1A 1U99A 1N5KA 4HAVA 4HI0E 5JS8A 3OIVA 2GWHA 4Q1FA 2NG1A 3LRPA 4QGHA 2IX3A 2G0TA 1IM2A 1SXJD 2NO6A 1Q22A 1P9NA 1M7HA 4TYWA 3TW4A 4WW0A 2OCYC 5FPHA 2BDTA 2JDIA 4HUQB 3VFDA 4DUGA 3OAAD 2FG5A 4PHFA 1I2DA 2B6HA 3R8CA 1N6RA 1T91A 3VKWA 4Q19A 1E99A 5L3RA 1FP7A 1ZNWA 4LWZA 1II8B 1OFUX 4NTZA 4ARZB 5KDDA 3P27A 1ZNZA 3HR7A 1D2NA 1O3YA 4MRVA 2JLYA 1DE0A 1W4BA 1H8HA 1N5JA 1QG2A 2OM2A 4G0NA 5EE0A 4JLNA 2ODEA 1ZAKA 3HYTA 3M1IA 4M9QA 3CF2A 5JEDA 4FMCF 1ZM7A 3BRWD 2C99A 3CB4A 2AXNA 1W49A 4FIDA 4NHOA 5D3QA 1R2QA 5FTMA 1M34E 2W6ID 3FMIA 1RJ9B 4B35A 3LX8A 3PUXA 4X8OA 3B1ZA 4GBMA 4V0OA 2WWFA 5JJIA 2JIZA 4P0TA 1Z83A 2XITA 5FTLA 4JLBA 2RCNA 3K0AA 2ZRIA 3SOPA 3KKMA 4ACAA 4KLNA 2CXXA 1E96A 1AKEA 3U2QA 1TAGA 1SXJA 4LCBA 1DOAA 1E9EA 3TRFA 5ANRB 2O8CB 3AP3A 1DTSA 4Q9KA 2HLDD 4V0KA 4YMTA 3OESA 2KSQA 3PENA 3KFVA 4C0LA 1E9DA 2FV8A 4D4KA 1QVAA 1T8TA 4QM7A 4OJKA 1KSFX 4XVQA 3EC1A 3EPHA 1WF3A 4HLCA 1P6XA 2O8EB 1TQ4A 1T3SA 5KU1A 2CL7X 5KNDA 3TAHA 1Z47A 2RB4A 1I2MA 1HE8B 3RNLA 2REOA 2PMKA 2HUPA 1E2NA 1NVVQ 2NMVA 1XMIA 3K70C 2ZVQX 1JQLB 4YMVA 3CW2A 2VHQA 2A5GA 2OZEA 1JAHA 4MA4A 4OL0A 2QT1A 3DO6A 3T12A 3U4QB 2J87A 1YVDA 2WJGA 4TQUS 3QBTA 2JLQA 2V6JA 4LBVA 1LVGA 3AVUA 3VR6A 3M0EA 3PEWA 5IF9A 3GLIB 1OH7A 2W6IA 4Q4HB 1R0ZA 1S3GA 1TMKA 2IYUA 3ZZTA 1CTQA 2ODNA 3SDZA 4LJ4A 2HJGA 5IRCD 1QG4A 2QP9X 5CK4A 2NIPA 3V4RA 2AKAB 2VHJA 1E2LA 1Z63A 1NL3A 1CJKC 3CZPA 4RD0A 1NKSA 1KI6B 1QHGA 3FHOA 3AF2A 3MSXA 2CLCX 2AX4A 3FB4A 3NEYA 2HLDA 3W6PA 2OAP1 2DYKA 2ZVPX 3B78A 4XIGS 1S3SA 2KWIA 2F6RA 4M1YA 3U3MA 2VHTA 3CPHA 2ZXUA 3AP2A 2YKGA 2WMNB 1XX6A 3ZQJA 4XSGA 2B21A 4UNQA 1EK0A 4EPYA 1CS4C 1TF7A 3EIQA 3GJ0A 2C9YA 1G7CA 2DR3A 2VSXA 1NRJB 1E9BA 1XNJA 1XEWX 2WJJA 3KJIA 2XZOA 4TSFD 4TYNA 3LD9A 1OYYA 1G20E 2O8DB 4TTPA 2VP4A 4PHGA 3TH5A 3R8FA 5IHPA 3SYLA 3KTAB 2J0VA 3A1VA 3EZFA 4A0HA 4GL2A 1AK2A 3CWZA 3CPJB 4A1FA 5KYKA 1DAMA 2ZJ5A 3N5CA 1P9WA 3FKSA 1GNRA 1RRFA 4G3XA 4Q5IA 5HCIA 2R6FA 2I1QA 1E9FA 1NJGA 1SVMA 2JJ1A 3I92A 5C18A 4QBFA 3F3YA 4IOMA 2FFAA 3O8BA 3T5GA 1ZNXA 2YOFA 1RYFA 1U81A 5AUNB 2AXPA 3R7WB 4B2LA 2JJ2D 4O3MA 3Q5DA 2EW1A 2ZI3A 3MWYW 4ZKEA 2A2ZA 3AF4A 3ADDA 2ATXA 2XNSA 1K5DA 2ZR7A 3BFKA 1IY2A 2NO9A 3K0CC 3KXLA 1HTWA 4QL3A 4ZIRA 1CJTC 2IUTA 3A6PC 3ASZA 2GVDC 4EQ6B 3EZ9A 4FD2A 1W1WA 2H57A 5KSZA 2A78A 4MKGA 4AYXA 1E2FA 2QSZA 4LV8B 2XJ9A 3PITA 1A1VA 1GOTA 1OYWA 1CKEA 2MMCA 1FX0B 3RRYA 3WMGA 1AZTA 1RRCA 3AVXA 2XZLA 3AVPA 2ZM5A 1PLKA 1I4DD 2A7QA 4QJ3A 3QEJA 3LXXA 3U7HB 2D4HA 1JEEA 1EFTA 3KJEA 5KHOC 3N2IA 4A0FA 4PQYA 4UNNA 3FDIA 1G6OA 3CX6A 1D8TA 1GL6A 3GCGA 3LAWA 3TSZA 3Q9LA 4WZBE 2ASEA 1W44A 2PCLA 1Z06A 3EIHA 1JJVA 2BOVA 1G5TA 3QKSB 2ZQ5A 2ZRPA 3TW8B 3IEUA 4ZDIA 3U6BA 2EYQA 4BEBA 4D81A 1KK1A 1ZM9A 3GLFB 3GLGA 1NLZA 1HE1C 2QM8A 4TMZA 4C0QC 3IEVA 4HATA 5FOTA 1P2SA 4Q02A 3U3JA 1C9KA 2B8WA 4JKIA 1MH1A 1E2HA 4EPTA 4DSTA 4A0RA 2ZRDA 2CK3D 3FWYA 3K9HA 1DG3A 1GG2A 1E69A 1OXTA 4TL9A 2GEDA 4M1SA 2WKQA 4UXHA 4C7OA 3OZXA 3KKPA 1Q3HA 4OI2A 1LFDB 1JR3D 1PUJA 2AWOA 2GXQA 3K8YA 4HAZA 1XD2B 3A58B 3I8XA 2PX3A 1FOEB 1KDRA 1R0WA 2GCNA 5FH9A 4F4CA 3ZVNA 3AVQA 2FSHA 4R9UC 5JWRA 3FMPB 4ERNA 2LCFA 4G5RA 1EGAA 4HUTA 5JZVA 2F1JA 2OHFA 3JZAA 1KO4A 2GXSA 3IDQA 2GF0A 3UWKA 2ZS8A 1TX4B 3VQTA 4TMVA 4L8GA 4G5GA 4BZXA 2UKDA 4LYJA 3L0IB 1SVOA 1KO1A 3DMDA 3FYHA 4CZ2A 2RKOA 4CEIA 4B71A 2GKSA 1Z6XA 2NZ8A 1FPMA 5FUVA 3MWKA 1CRPA 1KTVA 4L9SA 2QM7A 4HYYA 5J4LA 1COWA 2DWPA 3EG5A 4MRRA 1KMQA 1OIXA 1F2TB 1L4UA 1Z8FA 1F5NA 2FF7A 4H1VA 1LNZA 1ZD8A 2CK3A 1G3UA 3MCAA 4POAA 2QAGC 1N5LA 3CF0A 2OBMA 3WRXC 4O25A 4DLVA 4ESHA 3TJZA 1MABA 4O2LA 4II7A 2IEZA 4LDJA 5DE3A 4PTLA 5CDFA 1ONBA 1JR3A 2ZYTX 1DAGA 4LBZA 3N2EA 5DYIA 3U7GA 5H68A 2JGNA 1SGWA 3BB3A 3MWJA 4AD8A 3FOZA 1X1SA 2H18A 1VPLA 2C5LA 3PFIA 1WMSA 1HUQA 3NBYC 4JLPA 1KO8A 2G0NA 1L8QA 1F2UB 1Q0UA 1KI4A 1S2MA 1KK3A 1UPTA 2GBLA 3NC0C 5EZ6B 1YE8A 5B57C 1XPOA 3SNHA 2PBRA 5TY0A 5KPDA 2Q9BA 4LPKA 4WXPA 4JYCA 2J1LA 4PXAA 3HR8A 3IPXA 2IS2A 2F3TA 2XB4A 3LXRA 4HZUA 3ZYCA 3QF7A 3FFAA 1VCOA 2J59A 3AP1A 5KDOA 4DIEA 2CMKA 1UKYA 1OXSC 1AJEA 2RGEA 4B47A 2W2VA 4BWYA 1VDZA 5ELXA 2RAPA 1Z22A 1NMXA 3TGPA 3I4LA 1XMVA 4I99A 4DLZA 4M8NE 2GK7A 4M9ZA 1EWQA 5TARA 1U0LA 5LBIA 5J4YA 4Q4JA 1SXJE 2ZJ8A 3W6NA 4RD1A 1ZU4A 2QT0A 1U8YA 4IW3B 2F1HA 2IXFA 2YYZA 3RS3A 1OIWA 1QVRA 4DCUA 1AN0A 3TSWA 3CR8A 2VPPA 1F6BA 2NO7A 1NSFA 1Z3IX 3ZH9B 3VMFA 2DWOA 4MGIR 2QAGB 2ZETA 3KQLA 3MAAC 1W48A 3EASA 1F48A 1XJQA 5GJCA 2BM1A 5JCZA 5F9FA 3WHLA 3NWJA 2OCAA 1YZKA 2KI5A 2JLRA 2IUSA 2Q3HA 5DISB 1U9IA 4ZI3A 2YINC 221PA 1QHYA 2L0XA 4YC7A 1MO4A 1ZW6A 1VCIA 4IKEA 4LV5B 3HPQA 2F55A 2FJUA 2NPFA 1CR2A 2OFOA 1G9XA 4TLAA 3WNCA 721PA 2VP5A 2WJYA 3ZS8A 4DLWA 2IC5A 1WB9A 1SQ5A 3TUJC 1VYVA 5EZ5A 2WMOB 2ZJAA 2F43B 3W8NA 1KJWA 4BLRA 4A2PA 3HU2A 4PANA 4GOJA 5JHHB 1NVVR 4JLDA 4Q4LA 1Q1ZA 3BH6A 3NHAA 4QHSA 1D5CA 3D8BA 2DB3A 2CEAA 5J40A 1U94A 1Z6AA 3PIRA 1NLYA 3VNUA 5GVRA 3AVWA 4PX9A 3CX8A 2GRJA 4MUAA 4TMTA 3D7MA 4YMSA 2QQ0A 3EZ7A 4A2QA 1ZIOA 4KU4A 1NNEA 4M1WA 2OFWA 3LW7A 4D6PA 1KSGA 3WNBA 4P33A 4HLUC 3RANA 1NF3A 4PO9A 3B9QA 1HQCA 2PZFA 2OV2A 4JL6A 2OFXA 4XD7A 3K1JA 3KJGA 3PCRB 1TF5A 4FMCB 5AJYA 2CCJA 2ZRLA 2W0SA 1KZ7B 2BM0A 1E6CA 2WSSA 4G5SA 2O8BA 3MMPA 1E3MA 2GESA 3K9NA 1Z5ZA 4KI0A 2GJ8A 2B7CA 1LW7A 4HAYA 4XH9B 3L43A 3LWNA 4AYWA 4QJ4A 4GZLA 4YLGA 5SZKB 4D4MA 4HDQB 4US1R 4C30A 5EUQB 4BFSA 2MSCB 3LQQA 4Q4AB 1CEEA 1XWIA 1DAFA 2Q9CA 3OF5A 4P4TA 2FFBA 4XTCS 5C46F 1W36D 5HCNA 3EWAA 2V55B 4IDNA 1VECA 1GRRA 2WJVA 5AJVB 3QKTA 5FBQB 2VQSA 1ANKA 3IBGA 2G9NA 2HJVA 3AUYA 4Q9LA 3CRVA 2WOJA 2D2FA 3QF4A 4M1MA 1VYTA 4P4SA 4IVQA 4TLDA 4V0NA 3QG5A 5CITA 1NY6A 2IS4A 4PQRA 2YZ2A 2GF9A 1IN5A 1XXHE 3S1AB 1J8YF 3AVYA 1PLLA 1AGRA 4PC7A 1KY2A 3IIMA 3DPUA 1E1QD 3AUXA 3QPWA 4XWAA 4XJXA 2NOAA 2A9KA 3BS4A
chains in the Genus database with same CATH superfamily
1QCYA 4RD6A 3EEFA 3RSZA 2YS7A 3W3AA 5G02A 4F6RA 4G56A 1HM5A 1LB1B 3RG2A 4NMWA 4BZPA 2VJNA 5EXPA 3RVMA 3I58A 3O75A 4JELA 1SVIA 1KMHA 4MUNA 1UEJA 1RI4A 3RHZA 3L0PA 3IR5A 2JJMA 2RH4A 3Q9NA 4K87A 4KUGA 1T4BA 3LZDA 4ZEWA 4CDRA 1AA9A 5IT5A 3VJLA 1R5JA 4IGEA 2VO1A 3I05A 3W2EA 3T7DA 1WPGA 4XX0B 4O33A 1P4SA 2O52A 1XNGA 1HA3A 4X9XA 4HB3A 1SBIA 1C3XA 3DKKA 1V4NA 4O5AA 1PD1A 1RKUA 4AG6A 2LKCA 4UTVA 3BB1A 1GA1A 1L5SA 3IT0A 5DDIP 5EXSA 3HM9A 5REQA 1W8DA 1JPVA 1A2OA 5JCPA 2X5XA 2QZ4A 3SZOA 1QF9A 3VKFA 1SPXA 4CEJB 2CL0X 1USWA 1U8EA 3QUSA 1K6EA 3CT4A 2FSUA 1GZSA 5D01A 5H3CA 5K8JB 1GO2A 1W93A 5E8RA 5BP7A 1JIIA 2HU5A 1BJKA 1XTIA 3TEJA 2J9GA 1BKYA 1FFHA 3PUVA 1COZA 1Q0SA 2WQ7A 5DP1A 2C3YA 1S4QA 2Q2QA 4QEKA 4KQHA 3RK1A 1XZNA 2W4QA 3A27A 3A1NA 5K8UA 2BTQA 3CZCA 2G4LA 4Y6OA 1FQKA 2GTIA 1TQ6A 3INTA 3OLWA 3ZNOA 3GLGE 5KNLA 1DC4A 4UW9A 3P52A 3KSZO 1Q0QA 3A1UA 3FTDA 3LFUA 4KXUA 4AJJA 2PA0A 3T5BA 2O06A 4HEA1 3I3SR 4Q9AA 1TJ3A 2PWBA 1KS9A 4ND8B 1CDEA 4K9NA 1NQWA 1KC1A 1NQUA 2H2DA 1S2GA 4LJ5A 4M0MA 3VNVA 4U5QA 2K5UA 2E37A 3IB3A 2HT6A 4O29A 3PHHA 2VAWA 3EY9A 1UXGA 3LMKA 4RFSA 5E9JA 5BYJA 1J5EB 4B3GA 3AVOA 1AGPA 1S89A 1ZHFA 1U3UA 2RAUA 5K2OA 5JNSA 1U0HC 1LBEA 4UUAA 1PBTA 4TSKA 4F0JA 1JR6A 2AB0A 3FNIA 4XM1A 3NVAA 4G26A 3VVLA 5DI3B 4GP7A 3ETNA 2WJHA 4G89A 1ZSNA 3Q8LA 1Z5OA 1MEOA 2BI4A 3ZI4A 1GNTA 1PR5A 4E6PA 1FFDA 3Q3VA 2BR5A 2IY8A 1PV2A 4I46A 1T3GA 4Q21A 3KHTA 3JQQA 2R751 2PZKA 2XQJA 4N49A 5GJVC 3UXYA 1X1CA 4BP8A 4DSNA 2IDMA 1GRVA 5JADA 5K5EA 3UA3A 2GFQA 2POCA 2JGEA 1XTKA 3NNNA 3WADA 1H2YA 2QP3A 3D6UA 2V6MA 3NANA 3R2JA 4DZTA 3VUFA 4RQBA 4IX9A 4Y0AA 5E9WA 3WL5A 4TS9A 4E94A 4CGYA 1RIFA 3PHIA 5LD2C 4TWAA 3MTIA 1IXSB 3BORA 1LDGA 2V4ZA 3HZZA 1K06A 5JC1A 3D3JA 3GLVA 1WSWA 4H1UA 4AJKA 3TDNA 4BNDB 4UM8B 4O63O 3PNPA 3SC2A 2GLXA 5ALHA 3HCWA 3ZQ4A 1R3UA 2ENWA 2HBQA 3P32A 3IE2A 4EUKA 5G40A 1ZICA 5JO0A 2JGIA 1PTJC 3JQBC 1G18A 3FCUB 1FA9A 1RXEA 1PV4A 3ULKA 1JAZA 1N2EA 3GG9A 1NRXA 5IUJC 4Y9SA 2PD4A 1ODTC 3HA2A 3LBIA 2FEMA 3RGWS 4G0ZA 4EG0A 3IL2A 1QFJA 2DUMA 4ENUA 2ZSJA 3OT5A 2ZATA 1OHHA 3RS8A 4E07A 3F8TA 5FOWA 1ZVQA 3OLVA 3FMVA 3SZMA 3BMOB 3C3CA 4B4DA 5FUBA 4CETA 4CN8A 2I7TA 3C16C 2A5YB 3EXIA 3VPCA 3RYCA 3FPSA 4GPTA 4IKPA 3AHHA 4LRUA 1ZVMA 1KRXA 3W1EA 3R9XB 4B4WA 1JQEA 5JCOA 1P5FA 1J8MF 3C98A 3FRJA 3O0DA 3KZXA 3OQVA 4L22A 5CA1B 4GBGA 3TPZA 2AZXA 2GX6A 4CV0A 5B7NA 2ZUWA 2ADFA 2H08A 1MV8A 1ELOA 3BERA 4DT1B 5FORA 3ITEA 5JBNA 3I9JA 3ZD8A 4K88A 1I7PA 5EEGA 3QVGA 3AJ9A 1YU6A 2IPAB 1K5GA 4IAOA 3GFRA 5CCDA 1XTPA 2Y92A 3DFFA 4DC0A 1RR6A 2A88A 2GEUA 3KR9A 4YH1A 1SU6A 4E08A 2AUMA 3PRYA 1S2LA 4B7ZA 2ZS9A 3BT7A 2KHZA 1FK8A 1Y1SA 1TFRA 3VZPA 2G3YA 3NRCA 5FI1B 3RYHB 2YMLA 4NMHA 3GUHA 5GVSA 2JIRA 1L8AA 2A9FA 2L42A 3BFXA 4UBLA 3I0MA 3T6KA 2AJ8A 1WO8A 2J41A 4PGHA 1PZHA 2QLTA 3DQQA 3DMPA 5DHTA 1EI9A 4NNJA 3T0GA 4F71A 3TRDA 1U8TA 1WPRA 4AURA 3S99A 1VIAA 1CK4A 2GZDA 1N0UA 2NT4A 4UVEA 3S6JA 1U28A 2HDWA 2OMKA 3JAWA 4GC9A 1JAYA 4IJMA 2C5EA 3U3KA 2FWRA 1QB7A 5I9MA 4WX2B 1NU6A 5LD2B 3CCBA 1RPZA 3E9EA 2Y67A 5IF3A 4JVMA 2NTEA 1JXQA 3J81A 3ND7A 3G7UA 1O96A 2EKPA 1KEZA 1IHUA 3T61A 1YQWA 2X7JA 5BQPA 4EKDA 1OF1A 4JASB 4JOCA 1HR0B 2QSYA 2NGRA 2Z3VA 1E8MA 2ZB8A 1EVIA 3HMQA 3M3PA 3PYLA 3SLKA 2Q2OA 1J21A 2V3WA 3VO9A 5FV4A 2IIVA 3AINA 2AKYA 3NBFA 1KP9A 2ZJ3A 4TVSA 2Z58A 4ZU3A 5MFPA 2BMVA 3T35A 2AKEA 1EFRA 5DX1A 3JAKA 4CM8B 2X40A 5JBIA 3JSXA 2J6CA 5K6AC 3L8MA 2QM3A 3GXOA 3UAZA 3K31A 1BMFA 1UJ6A 3INRA 3IBFA 4KFUA 4O4LA 4PICA 5G41A 1AMNA 1P9RA 1RBZA 4JB3A 4FLMA 5TGZA 4S1VA 4DVGA 3FHCB 4L1KA 2JJ1D 1JKXA 1GGEA 5H82A 1ZHOA 1EX6A 2RJOA 3M4ZA 4MDEA 3AUTA 4IH4A 1CIPA 5AOBA 1K7YA 3AESB 4I14A 1TYAE 3BFVA 3IE0A 3JRWA 3OQPA 4QM6A 1TJ5A 1YDHA 3DZKA 4Y1GA 3QZUA 4Z1MA 3KEFA 3R0XA 3TWOA 4HYTA 2E49A 1FU7A 4AUNA 2CLIB 1UPFA 2NXNA 3HBLA 2HV8A 1K08A 1Z39A 4IVNA 4U0KA 1UOQA 3KZ1E 4RLQA 1QIFA 2JI7A 1E77A 3PGVA 1Q21A 2CXRA 3RSHA 5LQCA 3WGIA 3QY0A 3N75A 2FGKA 2GJKA 1WUYA 3D7LA 3TOZA 3PFHA 4I1PA 1UDRA 2EKBA 2JFHA 3EBLA 4S12A 1UFOA 2X8JB 3H6HA 2KQUA 3STHA 1LF5A 2GLTA 1EP2B 1CJUC 4BLPA 4BMVA 5LQNA 5DEOA 5JTTA 4QRIA 1D2EA 3NH9A 3TL2A 1AKRA 1L0BA 3P20A 1AXGA 6LDHA 1C30A 2GM3A 1KQPA 2C1EA 2XNKA 3Q8MA 3EX7C 4C6HA 5JFOA 3WKCA 3GHYA 2Z57A 2VTEA 4URVR 2P30A 1T6BY 5HQJA 3ROGA 1G63A 4YO7A 1GYRA 3T3HA 3QVVA 4IV8A 1XQ9A 3E3NA 3QWFA 2WIGA 4WEQA 3R7WA 4UZFA 3TQOA 1G0NA 1I6LA 3D2LA 3Q0TA 4W9NC 3RS2A 2QVLA 1MIOB 1Z7EA 3P0HA 4PHHA 3BAFA 3A1FA 3QU2A 3SKXA 3IV7A 1M7GA 2BDUA 3PR3A 4Q7JB 3UKDA 2NQ2C 2C9BA 4KW7A 4LQCA 4RKEA 1RJWA 1QZUA 2ATIA 4F4UA 3SX4A 1Y6QA 2P4SA 2ZE5A 4ZICA 1ZN7A 1FE8A 1Z35A 2ZSHA 2B8EA 1T5IA 4MV0A 4XX1A 2EGGA 2F1KA 4REQB 5FPTA 1O5TA 4Z4IA 2O2CA 4JQYA 3UJ7A 4EHKA 3AO0B 4MYHA 2ZJ1A 1I3KA 1UXIA 4JUDX 5B2FA 1W88B 5G3YA 1ZK1A 1QG0A 1V1JA 4ZCQA 4KWCA 1GUAA 2BFEB 4WN3A 1H69A 4URFA 4US0R 4JODA 2VEDA 2ARKA 1W2WB 2XHEA 2W00A 4LTNA 2BJVA 3PQ6A 4LN1A 1Z0DA 1OZGA 2PM8A 1AXRA 3IQDB 1L1FA 4Z51A 1ABFA 3MMZA 2J5KA 5KTKA 4I1RA 1QKJA 1YSCA 2O7VA 3REGA 3MW8A 4P38A 3VOBA 3GH3A 1GTMA 3UXHA 4WY5A 5DBGA 3IA2A 1RFGE 2X1VA 3MLBA 4EW6A 3PNLA 1A88A 3MUEA 3IOMA 4WASA 1AM4D 3LY9A 3W0LB 4IEIA 5L3SB 3MTEA 4DSOA 3M5PA 1BFKA 3QIAA 1C50A 1NRWA 1FYEA 2GUWA 2HFJA 2JIDA 3H7IA 1VL0A 2BR3A 3TW8A 4B74A 4E51A 4UKDA 2CBZA 4M0UA 4EF4A 2I3ZA 1KDOA 3A3KA 2BKLA 4IZHA 1SIOA 2YWGA 3BCRA 5B3AA 4JYMA 2DRIA 5G0WA 3TQTA 3FETA 5DBIA 1UBEA 5EC8A 5K1ZA 3MTAA 1LBHA 1UOOA 1SRRA 3OY7A 4MQLA 1FS5A 3BXEA 4NBRA 2O2HA 2PVCA 3D3WA 3LX4A 4FZRA 3BWDD 1JEQB 5TMPA 1E2JA 1N6KA 4MUGA 1PK7A 4U00A 5GAJA 3E1GA 1ZX1A 2V6IA 4UU8A 2FUEA 4HX2A 4AKSA 1ZBDA 1E0JA 3U7EB 5JEEA 2R7KA 2WYVA 4U0JA 3E22B 4BB5A 4XEUA 2JGDB 2XAAA 3DV0B 3OPYA 4YREA 1UBKS 4A1OA 2RE8A 4AJ2A 1U0FA 1O5OA 3A05A 4GUDA 4F06A 1IVYA 4D7AA 2WE7A 5DNCA 4ZC1A 4MYCA 3ZWQA 5JY1A 3G0OA 4J4TA 2SKDA 4FE3A 4IHJA 2RIPA 4YRJA 1UBJS 2QRVA 3K09A 1E1CA 1S2IA 1SH7A 3DUFA 3G9QA 2WDZA 5ESWA 1AKYA 4DPMA 1UT8A 5KJCA 2D3TA 1TYDE 4BLOA 4HEJA 1JALA 1RACA 4XQCA 3KB2A 2G80A 4MI3A 2BAGA 1LVHA 4BRWA 3GBVA 2DR0A 5DTRA 5E7JA 4MV8A 3DAOA 3S2GA 5EHZA 4O8CA 5L8VA 1JFFB 3SJZA 1M2GA 1U0GA 3WA7A 4KQEA 5FKJA 4C3ZA 2C9CA 1XZPA 3WLPA 3DOJA 2FRXA 3LUFA 4DIKA 3GPCA 5KOYA 4GP9A 1PKXA 2R65A 2CNNA 4BC1A 3GMSA 1U0BB 4TQ9A 2X8AA 1X87A 1WZIA 3D8UA 4V39A 5DWDA 1DUVG 1TQ8A 3HWRA 1YZQA 3K9QO 3HVUA 4EY8A 4G01B 3RBAA 1ZH0A 1VBNA 4AZ0B 3UXEA 4XUEA 1PUIA 1YO6A 1KMIY 2BFCA 3BK2A 4IZIA 1VLQA 1SBQA 3GLGB 4R8MA 4JXKA 2ZGVA 3T1QA 3SQNA 5KTMA 5SYMA 2DE0X 3PXGA 3HADA 3N0WA 1XJCA 1L6IA 3H0KA 1GKIA 3T54A 3KQHA 1XG5A 2FY8A 2VYNA 2BFWA 3BXHA 3AY0A 2X13A 1VKRA 2ACWA 2PD3A 1NC3A 2W6ZA 3CZ9A 3PNMA 5AKJA 1TFUA 5C1BA 3S8EA 3KQVA 2PYDA 1TTQB 1QV9A 3H7AA 4PRLA 4ZWNA 2BEWA 5JCJA 2GAJA 4PSKA 5KSWB 4QC2A 1X19A 1ZWLA 2IF0A 3IUSA 4FFLA 4NPHA 4WXYB 3WSVA 3Q0EA 1Z88A 4Q9HA 4OK5A 1MG5A 4I5EA 4F4FA 4W5NA 1XMXA 1SQGA 4EP1A 3I62A 3ETCA 2EKDA 4F3RA 4TYMA 3JRNA 4M0DA 1F0KA 4FB4A 1DDGA 3CKLA 4I8IA 5F51A 3EUWA 2MYNA 3NHKA 4Q3LA 1NUAA 2W2PA 1G41A 1P7CA 2QTMA 4XFDA 4RS4A 1YBHA 2AIRA 3IOYA 3JALA 4DLBA 5B55A 4F38A 5BMVA 1AHNA 2BELA 4G65A 4HSGA 5HK9A 1W5TA 3AC0A 1BSVA 3RFXA 1I14A 4R69A 1WXHA 1RU3A 1F6DA 3MJRA 3EH2A 5DK4A 4E70A 1KU0A 2JAQA 2W2KA 2ODAA 4ETNA 4J2HA 3PI6A 4C2TA 2CVQA 1CG6A 1P1FA 4HFRA 5A0FA 3PYXA 4GSYA 1B0ZA 5LA6B 3RVSA 3VPXA 1WQ4A 2GQ0A 4KK4A 3TBHA 4NU6A 1I4WA 5TGTA 4HZGA 2I67A 5LQKA 4RTKA 2G5PA 3ZK9A 3G79A 2QXUA 2IYLD 3B1KA 3N76A 4IFIA 5DNUA 2XWBF 4O4LF 1EK6A 3N87A 3A9VA 4QOHA 1T2VA 1A50B 2CLEB 2W8BA 3C5WP 3HKBA 4M9XA 3SFZA 4JLKA 5JSUA 1O97C 4LNAA 4X1YA 3A4MA 5BSKA 3DFUA 4KR0A 1F8YA 4TTIA 2CDRA 1Y8RA 1T1SA 2ZUSA 1KOJA 4A92A 4BV2A 4DAEA 3K6SA 1AF7A 1IM5A 1U6KA 1Z38A 1U8AA 3KB8A 4KAFA 1AB6A 2IWHA 1MABB 3HE3A 4J76A 4YJ3A 5B6PA 3EBPA 4GQAA 2J31A 5TVKA 3PTZA 2IZ7A 5BR4A 5A4IS 4MS4A 1N2IA 1TUBB 3KSUA 4TT3A 5JJCA 4EW3A 2WM8A 5KHLB 9MHTA 4YDQA 3NQ41 3PDCA 5D51S 2FJPA 3O4IA 5IM4A 3ELBA 3GOHA 4DJ5X 2CVZA 3HCDA 2OBBA 1UPUA 4BAUA 6AT1A 1R10A 2HCFA 1TAQA 4LOLA 1BX3A 1PGOA 2R6DA 3PQEA 5ALUA 1BYIA 1V4VA 4OV6B 2J7PA 2O3SA 2AJLI 4QICA 4JIMA 5ERXA 3EZXA 4L16A 5TMBA 5CLHA 4L78A 4ENWA 2F64A 2H4JA 1R6BX 4PYKA 4R01A 1DC5A 2YH2A 2IZ0A 1U7DA 4NZZA 3VU0A 1Y1LA 2QENA 4EKGA 2HSZA 2IYFA 2RHGB 4UCWA 5CIWA 4LHXA 4A27A 2Y99A 3OZIA 4CMEC 3LUJA 1RYYA 2A1IA 1O95A 3T7SA 3URKA 1IZ0A 1GZ5A 1YE5A 3OJXA 2PPVA 5ALIA 5J2UB 2R7AA 3NBXX 2RC5A 3K4HA 1YBVA 3SICE 4MR9A 4R9VA 1K89A 4GP6A 4BGIA 4DF3A 2ID8A 3T1VA 2XX3A 3HU1A 2XUJA 4XD7D 5KQPA 5IU6A 4UBIA 4FEEA 4PWYA 2VDQB 4M0PA 3OZWA 2WU0A 3SNKA 1DFHA 2XYHA 2ODPA 3K1ZA 3TLCA 4Y9RA 1O4VA 1PL7A 4FE4A 3CVWA 1A0OA 1QK5A 3A1TA 4H17A 5J43A 3E81A 5CYPA 5ARCA 1ZSVA 4QBIA 3USCS 2F1IA 2JLVA 4MQ5A 4A6DA 4AL4A 2XE8A 3KV1A 4LJAA 2WIAA 3P4XA 4IJKA 4TYNA 3I0NA 5FR1A 2FF5A 2XMQA 3RLIA 4O5OA 4BV3A 4X94A 1P60A 3SHQA 3QEOA 3SQOA 3HN6A 3R09A 5CFMA 3SJCA 4AS1A 3GN2A 3FF4A 3C8UA 2HUNA 4AJLA 1CPYA 5KJ6A 4JFAA 1Y3AA 3CIOA 2XBMA 2R79A 2WR8A 4H35A 5IM5A 5K9ZA 1OX4A 5E6SB 1QF7A 3O1IC 2J46A 5FLYA 1JAIA 2C7BA 2ILVA 1YI0A 4B4OA 1MRSA 2PX5A 3OSUA 3DHWC 4OP3A 1V16B 4ZCLA 3ZZUA 2J0EA 1FFWA 2YXEA 1ULUA 5KNBA 3CY6A 3OC0A 2ERYA 3E1SA 4JEHA 5LYJF 1FLNA 2IHYA 1YZLA 5LB4A 2VTBA 1EJ6A 1T25A 4P86A 1W4RA 2O3JA 3HS3A 5BXQC 4HOYA 3K8QA 1FP2A 2FZGA 3E2PA 3MCZA 1PWZA 2O0MA 2I4IA 1USUA 1ZYUA 4Q4AA 4EG6A 3C3DA 1ILEA 4B87A 1SHLA 2DPLA 3DNPA 4Z2AA 1EHIA 2VKTA 3JRXA 2UYHA 5H83A 1E92A 2VWPA 4O2RA 2PLFA 2AI3A 1CDDA 1CT9A 1TD1A 2DWQA 5LQRA 1XPOA 1P2GA 4M0EA 4G5YA 1KYYA 3KQKA 4KODA 2V1UA 3AKYA 1WA5A 4PBSA 3LFHA 3Q3EA 4TV9A 3L7AA 2Y0PA 4YT8A 4MV6A 1RLOA 4Q4CA 4GX0A 4LNUB 1KNXA 4ZP1A 3S29A 1L4MA 2YFQA 3KOZA 4EW1A 3KOUA 4QDJA 2P0YA 2P0EA 3VZDA 4AP6A 4CG2A 1PFGA 1EGVB 4EVQA 4UAGA 1A5SB 4PBTA 4Z9XA 1RLUA 3FJ1A 3U3RA 2EV9A 2R6CA 1EP9A 2PGOA 1N3YA 2HU8A 1MO2A 1UBCA 4IHJF 4Y2UA 4BDSA 1VHTA 3R4VA 1QYWA 4HUJA 3RRMA 1Q83A 4F4HA 5EZSA 3A1EA 2IH4A 1GSAA 1YZTA 2MYUA 4JSRA 4Z54A 2VDWB 1W36C 4CIVA 1A27A 2FQQA 1L2TA 2PRKA 2VNKA 2H7XA 1UBHS 1WW3A 2WM3A 1Q11A 3DFMA 1K4KA 1Z9BA 3VZRA 3WL8A 5A1JA 1F51E 5EP2A 5AW0A 5HZMA 1IUKA 1KJZA 3KCNA 4Q7MB 4XX0A 5SV2A 3WDLA 1MO3A 1X8LA 2A9JA 2J5RA 1O6CA 4ZOLB 2XDQA 1J07A 2LIPA 2QXTA 2PMFA 3CSDA 5EJMA 2FN8A 2DFNA 1M5TA 1VPTA 1RWNA 2PUTA 5AP9A 5EPUA 4EJ0A 5KCZA 3LPCA 2RGGA 1BQEA 2O8BB 1QC5A 4ISCA 4QFDA 1EWRA 4Y2VA 4X60A 4B0PA 4OYHA 4CMGA 1M33A 5JSYA 1ZMBA 2QW0X 1EU1A 2RHOA 3HJNA 4CEHB 3AHGA 2RGNC 1KEEB 4R98A 1E2KA 4TXNA 3LYUA 3PRJA 1NVEA 4P8RA 2XMCA 1DJQA 5HCUA 2HR1A 1P1RA 1NQVA 1LPMA 2AZMA 3UAGA 2WD8A 2FPSA 3JTEA 5CGQB 4JD5A 3ZW7A 2YDXA 2E9SA 4I55A 5EE3A 5C4MA 3ENNA 4IGAA 2WTUA 3OTWA 3KHUA 5I7UA 4ZAZA 4N18A 2I34A 1BXRB 3D31A 3FCEA 4R8SA 3T1HB 4N12A 1W85B 4UTZA 2ZUBA 3O26A 1YKSA 4PN7A 4JX9A 3I2KA 3ST7A 5FI0B 2R84A 4LHEA 2ZR9A 5HJ7A 2VNJA 2HA2A 6REQA 1W1UA 3AF6A 3W2HA 4NQZA 5HIAA 1I3NA 3ZLTA 4NENB 2QQFA 4L5BA 3V7YA 5LL6P 2FPOA 2ZBQA 3I09A 1XP8A 4H0NA 3OCUA 4OSPA 4M8IA 1QQ5A 2I7XA 1GTRA 3RV3A 1KOGA 2PX8A 1PW7A 2G9VA 3V8RA 1JNYA 3PPYA 4WZAA 1JG6A 4DQXA 1PJCA 3LO8A 3S5UA 2VQ6A 1QYCA 3I1JA 2KYRA 3A9WA 5H1YA 5L51A 4X8HA 5DI3A 3ZE8A 4ZJUA 5BMVF 2AHOA 3FTEA 3E9NA 3UJAA 5IKMA 2IHUA 4LGMA 1X74A 4RMJA 2G9ZA 4MGKR 3GGJA 2DULA 5JQWA 1RS0A 3HA5A 4K9LA 4NHEA 1LK7A 3FWHA 2CJWA 4ZOBA 5CB0A 1J2JA 2IUEA 5FTKA 4S2EA 3TVTA 3WHIA 4TZ6A 3AONB 4TL6A 2PUJA 2D2IA 1LDYA 4J16A 3ZLBA 3EEBA 5H81A 1S9HA 3RTBA 3ZHZA 2XB2A 4OHRA 4PZ9A 3CVJA 1YH3A 2I4NA 2ZIGA 3VR6H 1YKGA 2PAFA 4KV9A 1W25A 1E9AA 3AF0A 4FOOA 1FYVA 4PAOA 4X7PA 4E22A 1SHTX 2Z6QA 1QLJA 1YD7A 4ARIA 3EGIA 3U4HA 3TOXA 1QM5A 1U8FO 1XPRA 1U2EA 2C88A 3R3XA 2X6QA 1RZ3A 2YX1A 4MZDA 1YR7A 3GY0A 4L0MA 4BNDA 5I7WA 4YRAA 1A69A 5IWCA 1NI4B 2GCEA 3SYMA 1KI2A 2WSBA 3ZWOA 1ZA2A 2N3ZA 2P2DA 1VJCA 3DJYA 4MINA 2D13A 4YJ3F 2EEPA 3TLEA 3OT1B 1QX4A 1KEVA 3C3YA 4GHWA 1Y0BA 4Q9NA 3H18A 1N2GA 4HN2A 4LDRA 3AHJA 3K0BA 1DUIA 2SKCA 1Y6ZA 2BGMA 3KDPA 1OFIA 3LLSA 3NYRA 1NBIA 4PC2A 4OQPA 5CB6A 2YWHA 1YJCA 3NDIA 2K87A 3WJAA 5KYTA 3SSNA 4YAJA 3SXUB 4KR6A 1KP3A 2JIQA 3T7JA 3SC6A 2NPIA 4GE0A 5BRJA 3HNOA 1F4LA 3BMOA 3EXFA 3N2GA 2ZP1A 2HLPA 5B3KA 5KC9A 2QTCA 1HEIA 3DE1X 2IHVA 3JD4A 4IX1A 2ORYA 4AKIA 3L1VA 3L7JA 4IWYA 1GDTA 2XZPA 2GFIA 3AY7A 5DBEX 2EARA 3MWDB 4NESA 2O07A 3UV3A 3B3GA 4BVFA 2Y3IA 3BXGA 3PPVA 3R9WA 1SZJG 3RS9A 2OCBA 4E2WA 5B1YA 1P1HA 1RLTA 3D1JA 5BVGB 2WWXA 3S2ZA 5CCBA 5CA1A 1KYTA 4Y0VA 4Q3NA 1ZD3A 4JUFA 3JSAA 2WE8A 2F3UA 3OP1A 2AG1A 1MRNA 3DVLA 5ER6A 2CSXA 4QO7A 5CBPB 2PUBA 1ZY2A 4JLMA 1MTZA 1ZISA 1LZLA 2I0FA 2O57A 4V3BA 5KKNB 3DNMA 5JAMA 4M8SA 2CMFA 5EJ2A 1OZHA 1XTVA 4ZZ1A 1MAAA 3MS2A 1PGJA 4Y6QA 3O8RA 1ZMOA 3C4QA 3NBKA 3VHLB 4B48A 3C7TA 1Z82A 5DGTA 1G8FA 2NW6A 2GBGA 1HYQA 2QX7A 3IP6A 3PF8A 4UJ3A 5CLQA 2PBZA 2CZCA 4ZOCA 4AN0A 2P3LA 4A0GA 2AQIA 2ZJ6A 4G86A 3TNLA 2EOAA 4GXTA 4O3FA 2QV0A 2JLXA 4FFNA 4XI9A 4DM7A 3D8SA 3IEPA 1T9BA 2EP8A 2ZJ0A 5LQSA 3PLRA 3BOSA 1B7GO 1ZPDA 3RODA 1Q0ZA 1Y3CE 5K8LA 2Z56A 4A8HA 1UDWA 2WYOA 4RK7A 3T5CA 4L4SA 1IQRA 4X61A 4UHJA 2QUZA 2R8EA 4S1TA 1TCBA 2VBIA 4HTFA 5EHNA 2R68A 3HDTA 4M49A 4JV5B 1PHPA 4B17A 4ZCMA 1U0JA 1YR3A 1U8XX 1ZXBA 5E7IA 5F5NA 3ZWVA 2P9BA 1BYUA 3KLBA 4CLOA 5KU7A 3SEFA 4JGIA 3A37A 2YNMD 3KTFA 4YP1A 1QPZA 4NXMB 2Z8XA 2MU1A 4Z9YA 4LE2A 1DEHA 3GGDA 3EEIA 4WV3A 2CV2A 2X3YA 3O3NB 1K98A 4BMSA 4PYRA 3W78A 1CIJA 4PIVA 1U04A 4FHEA 1EFLA 1RM0A 2ORIA 3DLCA 3L06A 4MP8A 1UKBA 2WIBA 4LXHA 2AZ4A 3VTFA 3G0DA 1XRJA 3T9DA 1KL7A 2YNMC 2JKYA 1F9AA 1FUEA 4XGIA 4OFXA 1UC8A 3NDJA 4Y6GB 4GMKA 4JYBA 3RKSA 2APJA 3IQEA 4W82A 2HHHB 2ZROA 4GEKA 4NAHA 3NFRA 3OAAA 4BB9A 4X6UA 3QE9Y 1WNFA 3C5EA 5GADl 5F35A 4NAUA 1MUUA 1NE7A 2YJTD 1A7JA 2ZBGA 3ZWAA 1HO3A 1B6GA 3GI1A 3OE7A 3HXQA 3W5AA 5AUOB 2PANA 3GEDA 3MTBA 3GAZA 3VGJA 5CXSA 4EGQA 1P7ZA 2JHGA 1RRPA 3X1JA 1YQTA 3GT0A 1NLMA 2X7XA 2CNOA 1PYDA 5AW4A 4D8UA 4LFBB 4RKQA 1LBIA 1U3CA 3OHSX 4WEOA 1TEZA 3PNBA 2VXOA 4XCQA 2LWIA 1A04A 3A2LA 3BRWA 3GJ3A 3LIPA 1L9KA 2AS0A 1IE3A 2KX7A 4RZXA 3ANTA 3AZOA 5DMXA 4P3PA 4BRZA 2VLBA 4YONB 5K3SA 3GFTA 4WRRA 1FPQA 3NR2A 4GAEA 3ZIUA 3I6YA 5AJHA 1WUKS 4WESB 5JE8A 1P0IA 3G3EA 4XXHA 4URHA 4X6LA 2NAPA 1D5WA 4MUFA 3DZCA 1JIJA 1MA0A 1RIIA 1H94A 3OZ7A 4QQNA 2FW6A 3QLJA 2NO4A 3HTXA 4TXHA 4Y7CA 3FAZA 1II9A 3BRQA 3LDHA 3PDUA 5D1HA 5JD6A 4FOTA 4CVNA 4QTZA 4HWPA 1SCNE 1NNSA 1O57A 2IOQA 1CBUA 1IBRA 1G4HA 1L5FA 1E5DA 3SJAA 1T1JA 1QRRA 4LRQA 1U2ZA 4NFYA 1XZIA 1WVMA 1NVAA 1VL2A 4OI0A 4PQGA 3DL0A 1PWXA 1DKNA 4REQA 2A3RA 4QD3A 5TX7A 4ER3A 4B3MB 1VI2A 2EIHA 1OZ0A 1E58A 3N3AC 2QEQA 3N70A 5ALPA 3K0KA 3G9ZA 3ZCTA 5CT9A 3SEAA 5T57A 4CIBA 1MB2A 1W88A 2F3QA 3MMXA 4I55F 4IDHA 2IS6A 1SOUA 2YVLA 2BFEA 1DBPA 4UHHA 2CN1A 3D2CA 4GT1A 3MTGA 1RXIA 4FC6A 2XVMA 3V4LA 2V0NA 4G07A 1ADYA 3QOXA 5GGXA 3RDPA 4F5EA 1DB3A 3R3VA 1NYTA 2OZKA 4RHCA 5IDQA 3DBIA 3EA5A 1XWFA 3FLAA 4AG5A 2OG1A 1QTNA 2HL6A 2I6QA 2OL4A 2Z2KA 3NKVA 4P80A 1U3VA 2J3MA 4G0MA 5LJIA 2OO3A 1BWSA 2CD9A 4QATA 4MLCA 4OUDA 1E0AA 1NE2A 5ALVA 3EZLA 3U7FB 5HQ3B 5HR5A 1HETA 3GJQA 3MCTA 1RVDA 3CH6A 5E3IA 5TPZD 3T3GA 4INAA 5BYKA 2PL9A 5L3SA 3FA2A 4EVIA 2OCDA 1ZL2A 2IZOA 2GOYA 3NYWA 1G7SA 2FE1A 5EJ6A 3AETB 2FX3A 2P79A 4GQIA 2GJSA 2PUVA 3DKPA 2D62A 3DBLB 4AUEA 4CCAA 1XEWY 4OFZA 2Q3BA 3RFCA 3LZ6A 4LW8A 1XCPA 1CU1A 4BVKA 1YS2X 4YCCA 3OZCA 4J9VA 5FPKA 1N5OX 3OX3A 3VKGA 2ZR8A 1T3HA 4QXPA 4M8LA 3UHPA 3EFBA 1ZUD1 2E0IA 1DKPA 3GXBA 2O59A 2ORVA 5A7GA 3AL2A 1S96A 2PL1A 3ZGNA 4KO4S 1VIVA 3MG9A 2C8JA 2VA8A 3GG2A 3BPSA 3E22A 3QLVC 5KX5A 2K7FA 4RH1A 2JGDA 3GLFA 2YN0A 1VG9B 5BRNA 2H1HA 1E5XA 2YWJA 3M1LA 5G3ZA 1CIVA 1RHJA 1G5IA 4PRKA 3VR2A 3ZGXA 4F92B 3DYIA 1SCUB 5L45A 5TLSA 4I3HA 3TZHA 1YRAA 3K05A 4M38A 2JFXA 4WK6A 5IDXA 4Q05A 3UMSA 1QYIA 4WKGA 1I5RA 2I76A 1A9OA 3C1OA 3E23A 3V9AA 2E4AA 3PXUA 3SD7A 1NTOA 4L4UA 3P2OA 6GPBA 1G19A 5M04A 3CTMA 4FN4A 1ORHA 1QH1A 1BMTA 5GOTA 2POQX 3QK7A 3G1UA 4MI6A 3AHIA 3BJRA 2Q6TA 3O90A 4JZYA 1X7XB 2P91A 3OLYA 1C0PA 4LZAA 1Q1NA 3ENKA 5DYYA 1YDWA 1HG0A 1KU6A 4F46A 1XVIA 4FYYA 3UFXA 5ALMA 3FPLA 4JA0A 3A6JA 3EVZA 5CJJA 2YMPA 4P5PA 1ZCJA 2ZTVA 4AI6A 3A36A 1SXPA 3ADPA 5NLLA 4AO6A 3E35A 3F5QA 2YS6A 3WRVA 4E2YA 1CB0A 2VF7A 1V7ZA 3V4FA 3U44B 3DL2A 3F96A 4GVPA 4HMOA 4UUOA 1AKQA 2GYYA 4JT2A 4L73A 2EFCB 2HK9A 3GMTA 2FX5A 4KQ1A 3LECA 4CJXA 1N4AA 4OM8A 3VAAA 1K3FA 4Y1RB 4URYR 3DKRA 1K7SN 4HH4A 1SU7A 2I6GA 1P39A 4WY2A 1ISMA 1KBOA 2IJGX 4MCAA 1TA9A 3V1KA 2WILA 3WIEA 4TKUA 1Z62A 4C0SA 3PPXA 1AIPA 5I51A 1EBUA 3IHWA 2VDPB 3GLRA 3R7LA 5H0IA 2Q3CA 1G98A 2NZVG 3I4CA 2WUFA 1T4CA 3WHPA 1P5RA 2AG0A 3S55A 4HVLA 4P7BA 4U2GA 1OFHA 2DHCA 3TQCA 1F2TA 3QW4B 4RUKA 4NX2A 1XC7A 4ZHSA 4NYIQ 4CODB 2ZOSA 1P6UA 2QRZA 1TCAA 2QJOA 4N8EA 3EAQA 5EP4A 5JAQA 5KVSA 1NR1A 4IO0A 5K6RA 3U37A 1C7QA 3PFWO 3NM5A 3CLVA 4PAQA 3RJ9A 3D4NA 4YUVA 3NIDB 4HWRA 3C3AA 1FY2A 1HMYA 4LZJA 2WEKA 1HOTA 2JFFA 1FFXB 2IEAA 3HLYA 3KCQA 3LQRA 1CLUA 1V45E 2IDZA 5TV2A 4DGQA 5B3JA 3NAQA 4WKBA 5ETJA 2GBLC 2VHUA 4ABYA 2IODA 3LDGA 1LZKA 2XUKA 3WLFA 4UNRA 4C14A 1KI8A 2ZKIA 5KWEA 3IP7A 4MUMA 2J07A 4DCVA 1NKTA 1BJTA 1FJHA 1DO0A 2OG2A 2NVUB 3SQLA 1P2TA 3OY2A 1F2UA 4DLRA 2XYRA 3AWIA 3H1AA 3K2EA 5IZ4A 2W4MA 5LA6A 3STTA 3GFQA 1VYUA 1UADA 5HUJA 1FQOA 3EOAI 1BE6A 5DWVA 1X1DA 1Y3HA 4I1SA 5I8PA 3IUMA 2XQFA 2PA3A 3JPWA 3WMEA 1YU9A 3BEDA 7ADHA 5KQLA 1HEUA 3KR0A 5HF9A 3UUGA 1ST3A 1M2VA 1HDZA 3BMNB 3B6KA 5CM8B 4K5QA 3C14C 2ODTX 1THZA 1QOZA 1ZN8A 3KOWA 4RJIA 3IVCA 3KL2A 3ZI0A 2J45A 3F8SA 3FOWA 1T15A 4RJJA 1IUPA 1EBFA 2ZUEA 2QTRA 1XKTA 4ZAFA 4B44A 1CQPA 2G5GX 3A4NA 2GM4A 2V7TA 4DOMA 4Z0PA 4KOEC 1J8FA 4G0VA 3GA5A 1TYZA 2EU8A 5K4HA 3DOHA 1E6MA 5IBRA 1R8QA 2UV8A 2FNAA 3H4MA 2EGHA 4W7HA 3BE8A 1SVLA 5J5AA 2QN3A 4ZU6X 3IUPA 4OHPA 1TC2A 3H5AA 1Z45A 2VG8A 1W8IA 4HWKA 1EIWA 3D0QA 2O0HA 4ZVOA 4NY1A 4B6RA 2VZ9A 2JW5A 1IZ9A 2W11A 4ZOEA 5BN3B 1KFJB 4DQ0A 4Z53A 4W9MC 2QGFA 1JIQA 5GGYA 5CFLA 3TD6A 3IBYA 1STOA 1WUIS 4DREA 1U2DA 4WA7A 4ZO7A 1FTGA 1PVDA 3H5NA 1EQAA 3O92A 4J0QA 5FEMA 5BWOA 4KH1A 2ZJ2A 3NUZA 1M34A 1CY4A 2FHPA 4HJXA 1TPZA 2MSDB 3VU1A 3FUXA