2JCSA

Active site mutant of dnk from d. melanogaster with dttp bound
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
198
structure length
198
Chain Sequence
TKYAEGTQPFTVLIEGNIGSGKTTYLNHFEKYKNDICLLTDPVEKWRNVNGVNLLELMYKDPKKWAMPFQSYVTLTMLQSHTAPTNKKLKIMERSIFSARYCFVENMRRNGSLEQGMYNTLEEWYKFIEESIHVQADLIIYLRTSPEVAYERIRQRARSEESCVPLKYLQELHELHEDWLIHQRRPQSCKVLVLDADL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Functional Studies of Active-Site Mutants from Drosophila Melanogaster Deoxyribonucleoside Kinase. Investigations of the Putative Catalytic Glutamate- Arginine Pair and of Residues Responsible for Substrate Specificity.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transferase
molecule keywords DEOXYNUCLEOSIDE KINASE
total genus 75
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature ec 2.7.1.145: Deoxynucleoside kinase.
pdb deposition date 2007-01-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2jcsA00
721PA 4HLUC 4MKFA 4M1YA 1MO5A 4Z1MD 3IEVA 1D6JA 1XMJA 5E7MA 4C0BA 4CEIB 2RGDA 5FOSA 3ZVRA 3FMPB 1T8TA 2BBWA 3MAAC 4A0HA 3BB4A 3DMNA 2CE7A 5CB6A 1JEDA 2ZRNA 1HV8A 2Q3MA 1J8YF 4EKDA 4PR0A 4HB4A 1J70A 4QG7A 4YXWD 1FTSA 2AR7A 2W2VA 1N5IA 3QY0A 3GLIB 3PJRA 4TLCA 4PZZA 4IDNA 3SQWA 2D74A 3X1XA 3CRQA 1OH5A 3UK6A 2GTPA 3WMEA 1KI9A 2HEIA 3PEYA 3ZQ6A 2J0UA 4KFSA 1XEWX 2W00A 1XMVA 4AYWA 1XD9A 4ITRC 2W2XA 5KDLA 3B78A 4I99A 4LBZA 4WA7A 2J0UB 3GEIA 4N1AA 3CF2A 1UM8A 3SJBA 3TBKA 2RAPA 4G01B 4M1KA 3PCRB 5EP1A 2CCGA 5FPKA 1CULC 4NCJA 2DB3A 3ZS9A 3GLIE 4XTRA 2O8FB 1K5GA 4QJ4A 1CP2A 4LC0A 2AK2A 4PHTA 1TNDA 2HJVA 4CDGA 4RZ3A 3DO6A 1ZU5A 3K70C 2IYVA 3CR7A 3QXXA 4B75A 3IILA 2OLJA 3FKSD 1G3UA 1U8ZA 4RZXA 1RIFA 1VG1A 1HE1C 4QBGB 3TSZA 1RC8A 2BKUA 4AY2A 3EC1A 1HEIA 1R0WA 2JLWA 2VP6A 4TMKA 4A1FA 1IONA 2BDTA 3C4JA 3CX8A 2VTKA 2YHSA 2JEOA 3IO5A 1OH7A 3S1AB 5EE5B 2IL1A 1UAAA 1TUEA 1DAEA 5HE8A 2J5XA 3IHLA 4LYJA 2QI9C 2VSOA 4Q9KA 3A1WA 3WHKA 5D3MB 2IEYA 3FHCB 2IEZA 1R8QA 2J45A 3RS4A 2GETA 3A1UA 2P6RA 3P32A 4DWJA 2G1JA 4LK2A 1ESMA 1FL9A 1EFUA 1ZUHA 2H17A 4NH0A 1E69A 1P2TA 4GBMA 4O3MA 1UDWA 1Z83A 4LJ5A 1QHGA 2EU8A 1AKEA 2PJZA 1UFQA 2DWPA 3CUEF 3GJ4A 4RVCA 5HKKD 4GRAA 1Z2AA 1RKBA 4Y0AA 1DADA 2R62A 3WBJA 3U6KA 1Z3IX 5FPTA 2X2FA 2FZLA 3B2EA 1JR6A 2VSXA 4V0KA 4C0SA 3NBZC 1UBGA 1Z22A 5L3SB 4QGHA 3VKGA 2Z43A 1R2QA 3ADDA 2JJ2A 1FOEB 3KQKA 1G7SA 4U00A 5JRJA 3VR5A 4UJ3A 1Z6YA 3KKMA 1F6BA 4FW9A 5IDVA 2ZR9A 5LB2A 2ZM5A 4Z8YA 2IS4A 1XPOA 1XP8A 1T6NA 4LJ4A 4KYIB 4RSGA 1KHTA 2O5VA 2GBLA 4PHHA 4FMCF 4MDFA 1CJTC 1US8B 1Z0JA 4LJYA 2JDID 1YZKA 2QA5A 1ZNYA 3K0AA 3L8ZA 5CITA 5G41A 1YHNA 4M2LA 4B74A 1WBBA 3RRMA 3I5XA 1VDZA 3BE4A 4A0GA 1FW6A 4XJXA 1Q3HA 1L4UA 4LI0A 1GITA 3MMPA 1KK1A 3R9XA 3I8XA 1U2RA 1R10A 4UXIA 1AQUA 1II0A 1YRAA 1TEVA 3BGWA 3VAAA 4GL2A 1JQJC 1NF3A 2C77A 3K0SA 3CF6R 4V0OA 3V00A 4YONB 3THXB 4M21A 4DCNA 3TUIC 2GCOA 1LS6A 1P3JA 5DN6D 2FFAA 1Z08A 2W6JD 1P60A 3A37A 3AVQA 1E0AA 4BEBA 1GVNB 2RKOA 4OQLA 2PJRA 1WQ1R 4XD7D 4Q48A 3EPJA 3BB3A 1KI4A 4E22A 2WICA 3B82A 3X1YA 4DDVA 1A4RA 2JGNA 3ECCA 4WXPA 2ZI9A 3AKCA 2OESA 3LXRA 3U3MA 3V4FA 1UKYA 1P9WA 4OL0A 2O8EA 3OAAA 1T3SA 1E2IA 2OG2A 2ZU0C 1AK2A 1FUKA 1G5RA 2E87A 2RGXA 4E07A 4JL8A 1ZJ6A 2CL0X 4DIEA 3QVUA 3H1TA 3SHFA 4ACBA 3K53A 2PT7A 2C78A 1XJ0A 1EFTA 1R8SA 2H92A 2ORVA 2RGNC 1KOFA 3FGNA 1XZQA 4LWZA 4NBSA 5EP2A 2ZJ5A 4DLRA 4IRUB 2Q9BA 1YR9A 3M1IA 1A5TA 1IY2A 2ASEA 1JEEA 3CPJB 3C5HA 3D31A 4JLOA 2FFBA 4BLRA 2PMDA 5C46F 3KXLA 4KV9A 2UVQA 1Z0KA 1W46A 4V02A 1H8HD 1QHYA 2GZHA 4BRWA 3VKWA 1PLLA 1W1WA 2BMJA 2OZEA 4RD3A 5JRZA 1XJQA 4PAMA 2FFHA 3GLHA 3W5JA 2ZRPA 1N5JA 3X1ZA 4X8LA 2F9LA 1GNPA 3CPHA 1SXJC 1IN7A 1LF0A 5EXPA 1E2PA 3G5UA 2YINC 1JR3E 1HT2E 2O8DB 3OFNA 2WJIA 5FPSA 1LNZA 4TL7A 5G53C 4JT4A 1OT3A 3VQTA 2FEMA 1KGDA 5D3MA 3VR6A 1NKTA 5SZJA 3W8RA 1KY3A 3MWYW 1VMAA 2OBLA 4GI7A 4TLBA 4X8HA 2AWNA 1NVUQ 1JQLB 3H86A 4XTCS 1WDTA 2ZSDA 3EZ7A 1XD8A 4Q7MB 4HLQB 3LX8A 3LWNA 1OH8A 4B6FA 3F3YA 2AKYA 4ZKEA 2EFCB 2ZI3A 1OKKA 2ZIAA 4JKYA 1YZNA 3QPVA 3QOFA 4KCGA 4YMUA 2ERYA 3IBGA 1JR3D 2OBMA 4LJ7A 3H84A 1P9RA 3PQCA 1UBEA 2LWIA 4CT5A 2K5UA 1JJ7A 1KDOA 2ZJYA 1W36B 4GDFA 1OYWA 4DT1B 4D26A 4HDOB 3HYTA 4GOXA 4QGAA 4ACAA 2QAGB 4Z54A 1D2MA 1XD2A 1L2TA 2GEVA 1EWQA 1G4UR 4BFZA 4BEJA 3HP1A 3RANA 2NPIA 1TL7C 1EG7A 1TAGA 5TVKA 1WBDA 4AYXA 2YV5A 3T34A 2CVHA 4RFSB 1P7CA 1KI6A 1U0HC 5FL3A 4EAQA 2D3WA 4AKHA 4IEEA 1GRNA 5EZ5A 3T15A 1PUIA 3HR7A 2Q6TA 4LYFA 4P32A 1OIVA 2YWEA 4X8MA 1KKMA 1TQ2A 2WIAA 1E2DA 2P5TB 2ZSBA 2WJVA 3EPLA 4NCNA 3DVLA 3RDPA 1GRRA 1W4CA 3NVAA 3BJIC 5A4JA 5EE9A 1DEKA 3NKVA 1KIMA 5JMTA 5J4KA 3PUXA 3ZIAD 4Q5IA 1Y63A 4PSAA 4M9ZA 4BFXA 1Z0FA 1IY1A 3TKLA 3AKEA 1CR0A 1XXHA 2JJ2D 2VRWA 4EPVA 5FBLB 3WY9A 1E3MA 1M6NA 4Q9LA 3BFVA 4B71A 1LY1A 1N2CE 3ZVNA 1W36C 1W0JA 1XXHB 2ORIA 4P33A 2CCJA 4B35A 4I1SA 2ZJAA 3RS7A 3K09C 1FNMA 5HCNA 5HZHA 2CJWA 3M6AA 3FMFA 1AGRA 1XMIA 3GLFB 2FGKA 5K8TA 5H8WA 3QI2A 2VP9A 2NG1A 5FOWA 4QNRA 5E3HA 1GZSA 5CDFA 4MYHA 1S0UA 4NDZA 3Q7PA 3EWSA 5FTMA 3BC1A 1TF5A 2OCPA 4XH9B 4TMWA 2YOHA 2JJ1D 5H70A 4MUAA 1E99A 4OHZA 4B33A 2ZRKA 5HE9A 4AKIA 4PSKA 1Q20A 1G3MA 3DOEA 3NC1C 4PQFA 1E9EA 2W0MA 4PO1A 3VTKA 2IYTA 1G64A 4P4SA 1XRJA 4DLZA 1TF7A 4YMWA 4BQSA 4URVR 4D6PA 1O3YA 3I8SA 4FMDB 1EK0A 2ODWA 5CDFE 5IHPA 5J4LA 2KJQA 4D4JA 4QRHA 4LYAA 1G8HA 4HAXA 4QM7A 2FSHA 3AVYA 3UMFA 3U44A 1JJVA 1RJ9A 1E2LA 2FNAA 3BH7A 3U3RA 1RYHA 1ODFA 2NO9A 3GLHB 2R6DA 3THWA 2A3RA 3EAQA 2WBLC 3KUCA 3O8CA 3FKSA 1IXSB 2BMDA 3L8YA 5EXTA 1E6CA 1G3IA 2BV3A 2XJ9A 3RABA 4ZI2A 3TGPA 1N0UA 4L15A 4M1MA 4LJ8A 3AUYA 4BGDA 2A78A 1ZVQA 2B6HA 4W7SA 3U3JA 4OKSA 2IYRA 2X2EA 4A82A 1QG2A 4AWXA 1SHKA 1JECA 2GAAA 4Q1DA 1GDDA 4TQUS 3NDBB 5TY0A 4EJSA 4PQRA 3HU2A 4UXJA 2GXQA 4WBSA 1KI8A 1J8MF 2WJYA 2VEDA 2ZRJA 2FPLA 2JJ8A 3IBYA 3SBDA 1KMHB 2Z5FA 1E1QD 1DO2A 1G17A 1MABB 3FFBA 1W44A 1U9IA 2MMGA 2REOA 2CDNA 4A9AA 3D6TB 1JBKA 1N3BA 2IYUA 4A0RA 3CNOA 4JJZA 4C2UA 4LCBA 3QPUA 2ZI6A 5BN3A 2ZRFA 1DAHA 2JLYA 1YZLA 3KQLA 1N6IA 2JLUA 1I4LD 1XZPA 4OQNA 4XVQA 2WWYA 3TAUA 1JI0A 1MT0A 5AK0A 4KFTA 4Q1AA 2V3CC 3VMFA 5B57C 1A7JA 2DBYA 1T4GA 1ESNA 3KTAA 4PC2A 1SKQA 3DEFA 5KOYA 3Q7QA 5FBWB 1LW7A 1M2OB 2XZLA 1OE0A 3CZQA 3RC8A 1P6XA 3PUWA 1SZPA 1X8JA 2ZYUX 2JLSA 4AI6A 1E1RD 1LB1B 3AVOA 1F2TA 3R8CA 2WTUA 4C0KA 4QC2A 2F3TA 4DLTA 2VL7A 3UPUA 1BO6A 1A2BA 1SXJE 4BLSA 1A2KC 5M04A 3THXA 4LV8B 821PA 3H4MA 2O8CA 1R5OA 5TXGA 4LYHA 3IIJA 3U4QA 4KHZA 2IYLD 4KYUA 2IBMA 3GJ5A 1I2DA 5GJWC 2P2LA 1S3GA 3NG1A 1HUQA 1F60A 4HLDA 1W7AA 1KK3A 1SVSA 1M7BA 2Z4SA 3A1SA 4PX9A 3IHWA 3RAPR 3PUYA 1G8PA 2BVNA 2W83A 5FPYA 5J5CA 1YE8A 1OXUA 5EZ6B 4FCWA 3CM0A 1ZMXA 3TR5A 2I4IA 2PT5A 1QZXA 2GVZC 2YZ2A 2ZYWX 3TH5A 3PUVA 4C0HA 2A7QA 3Q8XB 3FTQA 4LV5B 4RD6A 2HCBA 4XD7A 1OB2A 2QBYA 5CK5A 2GCOB 1W0JD 5AJZA 5JCPA 4DEYA 1YZQA 3U4QB 4KFRA 3LQQA 1JB1A 2GRJA 5EQTA 3LLUA 4MRRA 1T9HA 1G8GA 5JWHA 3RS5A 3VX3A 4DC9A 5F98A 2OV2A 3QF4B 1GKUB 4XWOA 4LHWA 1YZUA 1EFRA 3JZMA 3CH4B 4Q7JB 4WZBE 3SJCA 2Z4RA 4NYMQ 4L4UA 4GOKA 4LGMA 2FPMA 1VYTA 5FR2A 1IN6A 1LS1A 2FU5C 2IHYA 2IYXA 1G7CA 5J4HA 2FPKA 5AR1A 3V4RA 4LSGA 3ZGXA 4M0LA 1JXMA 2QPTA 5FI0B 2GXSA 1CS4C 2BKEA 1P5ZB 1JAHA 3HPQA 1Z6XA 3ADBA 3AQ4A 1NN5A 4P0TA 4WAUA 2RGEA 4AG6A 5AUQA 5KPDA 3MSXA 3TQCA 1LF5A 1LFDB 4V03A 3E2IA 4JIMA 4B3BA 2XZOA 2J7PA 1XDBA 1R6BX 3LNCA 4HB2A 2WPDD 1UKEA 4I1OA 2CLDX 3QKUA 4JVLA 2F1IA 5UKDA 4HUQB 4OI1A 1Z63A 5BQ5A 2E1RA 3IPXA 3KFVA 3U44B 4HUQA 3Q5EA 1OKKD 1S1MA 1UKVY 3AF3A 3OE7D 2CK3A 4JLKA 1OFUX 3VR4A 2NGRA 2EW1A 4OI2A 4KLNA 4TYNA 5SZKB 4ZI3A 4S2EA 2F43A 3VHLB 1J7KA 1NG1A 4AKEA 1JNYA 4A36A 3A1TA 3AF2A 3TUZC 3BFXA 1U0LA 4KSCA 4FCTA 1MO6A 1WP9A 1AQYA 2AHOA 1T5LA 4OYHA 2ZSFA 3CZPA 3KKNA 4FN5A 4LOAA 4B47A 1F5NA 4BFTA 3AVUA 3KKOA 5FOXA 4U7DA 2ZE5A 4ZCLA 3SYNA 3ND9A 3AM1A 3LO5A 1X8LA 2YVUA 3TE6A 2HT6A 1Z8FA 2OHFA 4NYJQ 1SULA 1U90A 1IAQA 1U99A 2F9MA 5J40A 5KUTA 1NVVR 2OEPA 2J7KA 1EWRA 2EVWX 2QN6A 3HU1A 3RRYA 5K8LA 1XEFA 5LDDC 3KQHA 3AP3A 2ZRLA 3ZYCA 2WKQA 1W2HA 1G21E 2IUTA 3I73A 4OK5A 3K09A 5EP4A 3I32A 4OK3A 4O25A 1RRPA 4K8OA 2KWIA 3OEHD 4IJMA 4POAA 4ZDIA 3NHAA 2XJ4A 1LTQA 1UPTA 4NL4H 3TMKA 5BN4A 5HR5A 1IXRC 4QNMA 3L0SA 2JLXA 4Q02A 4CW7A 4C0JA 2O52A 2WWXA 2ZS9A 2EYQA 4E09A 1OHHD 2QRZA 2ZRIA 2QNRA 4ZKDA 1E9CA 3MJRA 4RKEA 2VIIA 2F1JA 4O2LA 2PZFA 1QVAA 2G1KA 4XWKA 1VPLA 4M9SA 4R7ZA 3NH9A 3ETLA 3PUZA 3QXHA 4I81A 2QAGC 2FGJA 2FMXA 1OHHA 1VYVA 4ON9A 2XNDA 1VHLA 4YMVA 3SJAA 3L0OA 1XX6A 4TL8A 2I1VB 2JLQA 5P21A 4JLNA 1J2JA 1OLOA 3A4MA 4KBGA 4PTLA 4M53A 5BW8A 2HCJB 2J59A 5TV2A 3FDIA 5DN6A 3W9YA 4IDHA 2UZIR 1YZGA 4RD0A 4KU4A 4LDJA 3LD9A 1KSHA 1UDXA 2GK6A 4JSYA 1MRSA 2A9KA 3KJGA 3L43A 4MUBA 2XOKD 3N2EA 3U7FB 4ARZB 3KUDA 3TIFA 2QY9A 5FL7D 4IDPA 4J0QA 1G18A 1EX7A 4KXFB 4HB0A 1F2UB 4QM6A 4W5HA 1AS2A 3L0IB 1D8TA 2IA5A 4RCZA 5J4VA 5LD2B 4YLGA 4TQAA 3L82B 5EUQB 3A58B 1NY5A 4Q4AA 4M1TA 4NMMA 3OEEA 3O8DA 3LA6A 4B3XA 3RC3A 4O2RA 3QEJA 4WW0A 4RKFA 1UBCA 3UMRA 2NTYC 3BIFA 3RSOA 3BFKA 5LB4A 3QKRB 4C3ZA 2CNWD 4R2HA 2B8TA 4BWYA 2QMHA 1DG3A 2EFGA 5BN5A 5CM9C 2FH5B 1NMYA 3EIEA 4ZDJA 1VIYA 4TWZA 4RJLA 4A8JB 3OIWA 2Z83A 3LFUA 5DYIA 4Q47A 3K70B 4TSFD 5DLQC 2VP2A 4PC1A 1ZC4A 1E79D 1VTKA 1VCNA 2R8RA 3BXZA 2AK3A 4DHEA 2HXSA 3LBIA 4JT2A 2QMUA 5JJIA 2HT1A 2O0KA 1XTKA 3EWAA 1XEXA 1WB9A 2GWHA 3PEWA 1NMXA 2QTHA 5FOVA 1H8ED 4PPFA 4GZMA 1XMSA 4D0LB 5FBQB 1E9BA 2ZVPX 3ASYA 1NP6A 4TMVA 1N6KA 1NIJA 4IOJA 5DIFA 2HXYA 2V55B 4NYIQ 2LKDA 2PZGA 3F0TA 3CKLA 2AFIE 3GJ3A 5KDDA 2BWJA 2W2TA 1G7RA 1V43A 2V1UA 2Q21A 3OEHA 4DSUA 4MH0R 5JHGB 2AXNA 3C5CA 4UNNA 4B73A 5KHOC 5B30A 4EPRA 1GUAA 1XTQA 2DWQA 4LRWA 4C4PA 4IDOA 1UEIA 3AVVA 3DL0A 1CKEA 2OCBA 3IEUA 2QRNA 5KTYA 1YRBA 1NIPA 4EPYA 3B8HA 1NL3A 1G291 2P3SA 4G1UC 1ZNXA 2QP3A 4TYYA 5L3QB 1CJVC 1ZP6A 2PX3A 3EPHA 3WYFA 4C0QC 4JYBA 4B2LA 1OXTA 3QENA 4BFYA 3UIEA 2EYUA 2GEDA 3FFAA 4FWTA 2VF7A 4ESHA 3AGQA 2MSDB 1SXJB 4UKDA 4TYQA 3CB4A 1X6VA 4JBWA 4NCIA 3ZQJA 5J47A 2RMKA 4B6EA 5BYKA 4NKRA 1E98A 1XU4A 4TT3A 2ODEA 5KSPA 5K8UA 3FPAA 5EXSA 2GXAA 2FDCA 2YJTD 4XVUA 1E2NA 2I3BA 1C4OA 2PMKA 1II8B 1X1SA 4Q1CA 2VA8A 2KI5A 3NHBA 3PVSA 1N6HA 1SVLA 3W6NA 2CHQA 3JVUA 1IN8A 1TEXA 4W5WA 3UXMA 3EZ2A 2CXXA 1S8FA 1NNEA 2O8CB 1E2KA 1TPZA 3A8TA 4Q9IA 4Q4HA 1RFLA 3OHMA 4EFMA 1T0HB 3TSOA 4TN1A 4OHWA 3AVXA 4TYWA 1Q3TA 3ZZ0A 1NBMD 3H0KA 3ND8A 2NPFA 2BIFA 2R65A 3BBPA 3R9WA 2ATXA 1CR4A 3KB1A 4QBIA 2VHCA 4B44A 3B9QA 4HUTA 5EE1A 4B48A 3ASZA 3H2YA 4EFLA 4F4JA 1P2VA 2BC9A 4FMCB 2DCUA 2GILA 4MYCA 5DHAA 5JCZA 3DPUA 4HLCA 4MKIA 5CK4A 4CEIA 3MWKA 3NIBA 1U0JA 3QEOA 2WMOB 1Q22A 2OBNA 1ANKA 1ZD8A 1CIPA 1DG1G 5LPNA 3CRW1 2F1HA 1VIAA 4GP7A 2HJGA 4DLWA 4A4DA 5C4GB 3SS8A 3QXCA 2A5GA 6Q21A 4RZUA 4OHYA 1Z0IA 3FE2A 4CEHB 4BFWA 3QKTA 2J0SA 4MRSA 5EE3A 2DFLA 2F7SA 2WSSD 3W6PA 5A0FA 4D25A 3K8YA 2R6FA 3NDPA 1R5NA 1E32A 3R9IA 5JFGA 4B34A 4K81B 4XIGS 2QPAA 3IIKA 5KU1A 4BPBA 2GESA 4TTRA 3SBEA 2OT3B 3GFPA 2XB2A 3QG5A 4LBVA 5JLJA 5DISB 1RZ3A 2O8BB 3WRXC 2J87A 4MDEA 4GOJA 2VHTA 4RD1A 2WKPA 4DB4A 3B1ZA 2QM8A 3C41J 2XAUA 4V0LA 4Q66C 3EASA 4HATA 4DDWA 1LVGA 4CT4B 4F92B 2P65A 3T5DA 1YU9A 3TSWA 4BASA 5K8IA 2AFHE 4IXNA 4KSBA 3I5YA 2BM1A 1C9KA 1Q0UA 1X3SA 2D4HA 4UJ5A 1CU1A 2D06A 1U9IC 1KMHA 2IYWA 4WZ6A 3AGPA 2AD5A 2ZRMA 1ZC3A 1X1RA 4TL9A 1G7TA 3CW2A 3HDTA 3QXSA 4O0MA 3ZJYA 4YDHB 2FSIA 3LAWA 2BCJQ 4DZZA 1HT1E 1D9XA 1YQTA 3PEVA 2IWRA 2XX3A 4YC7A 5FUWA 1VCMA 2EWWA 1G1MA 2WMNB 3KQNA 2ZRHA 3WMGA 3KX2A 2CLCX 2JIZA 2Q9AA 4DLSA 4B2IA 4HAVA 2ORWA 3TQFA 2ODBA 1DVRA 1GFIA 1RRCA 2IXGA 2PCLA 1FX0A 1T3HA 1ZYUA 4B76A 1W36D 4FXPA 1XPUA 1QRAA 4ZV4A 1SVWA 3K0AB 4C30A 1KI6B 2NIPA 3ZDQA 4TZ6A 1W5TA 4XSGA 4F91B 1GWNA 2V54A 2DFTA 3NH6A 3N2IA 3ZZUA 5F9FA 3UWOA 2RHDA 2ZSEA 3B13B 1OH6A 1NLFA 4Q9JA 1ELOA 4PFSA 2WWHA 1ZBDA 1MO3A 2BEJA 2YYZA 3DDCA 3B5JA 4C9BA 1X86B 4JVNA 3PV0A 1FP7A 2WSSA 5JEDA 4D4MA 2CMKA 5GVRA 2ZYVX 3LBHA 1OW3B 2ECKA 2GEUA 2VP4A 1GTVA 4L9WA 1T8UA 1ZM2A 3Q9LA 2ZAOA 4DKXA 4JLBA 2NQ2C 2TMKA 4L8GA 2ZS7A 1E2JA 1XTSA 4OQFA 3ZD7A 2GJ9A 1FNNA 1W0KD 5JS8A 4ARZA 4ZPXA 4JLDA 3HWSA 2R2AA 4PPNA 5CIQA 3VNUA 4M9XA 1P61B 1VG0B 4WZAE 2DYKA 4HZUB 1HY3A 2D2EA 3THWB 1CJKC 2OFXA 1Q1ZA 3RS0A 3BOSA 2XTZA 4D4KA 4ESVA 4OK6A 1F2TB 3CONA 3GD7A 4CRWB 5F3WB 3P4YA 4TMZA 4P4TA 1GL9B 1Q44A 4A2PA 2ERXA 4Z8XA 4FI3C 1XNJA 3FHTA 1PLJA 4II7A 4Y0VA 1OFTA 1G20E 4JZKA 2CHGA 4LJ6A 3AV0B 3CLVA 1Q21A 4QL3A 2XGJA 2ANBA 3WHLA 2GZAA 5CM8B 1S1CA 3HYRA 3GJ0A 1T3LA 3NBXX 3G82C 2V7QA 4EJSB 2IS1A 4QKQA 1YR7A 3J81k 1N5LA 4ZCMA 4IFEA 2JJ1A 4JLVA 4BZPA 2ZI7A 5CJPA 3AVWA 5AUPB 4M8NE 4MRNA 4G5QA 2R6GA 4G5OA 4TMXA 1SKYB 3W90A 1IBRA 4P3YA 4QXAA 2JLZA 2IXFA 4D0GA 4DLVA 3D7MA 2AN9A 2ZE7A 2J9RA 1VKJA 4AG5A 2GXUA 2A30A 1V5WA 3LXXA 1KZGB 4I4LA 1E2FA 1ZRHA 3GJ7A 4XSHA 2QG6A 3CO5A 3ZVLA 1E9AA 5DE3A 2OFOA 4UNQA 5ELXA 1L4YA 1Z2CA 2ONJA 3E5HA 1KKLA 3C7KA 3WRYC 5H68A 4ASUA 4UNRA 5C18A 4MYUA 1AIPA 2G0NA 3IDQA 1ZUIA 4I1UA 3ZIAA 2MMCA 1DOAA 5B58C 1P4SA 5FTKA 3X1DA 1AZSC 4M4SA 3SHWA 2V8OA 4DIDA 1DBSA 2XNSA 4JVSB 3GFTA 3BB1A 5DH9A 1GL6A 3SR0A 2EFHB 2MSCB 4ZDKA 3X1WA 1F2UA 2OE2A 2QUZA 2NZJA 2WWWA 4US1R 3CRVA 2ZJ2A 4X8OA 2IYZA 3CRMA 3MGCA 4G3XA 2WOOA 2W58A 2XEXA 2IYSA 4V0MA 2A2ZA 1OIWA 1CRPA 1PV4A 2ZRDA 1WA5A 1FP6A 1HTWA 2KBFA 1OF1A 1AA9A 2GVDC 2O0JA 2ZQ5A 3LH5A 3TW4A 1COWD 3A4NA 5IT5A 3Q72A 4A8JC 4EIWA 1MKYA 3MJHA 2DY1A 3SYKA 1NY6A 2Q9CA 4LHXA 5CYPA 2OXRA 1P72A 4IEIA 1RPZA 2QORA 1S2MA 2HUPA 4TLAA 1ZU4A 4EUNA 1Q57A 4W9MC 1NVVQ 2AKAB 2HF8A 2J0VA 2V1XA 1E9RA 4QBHA 2HDNB 3AF1A 4FWIB 1TU3A 2YOGA 3GLHE 2IYYA 4RD4A 2OXCA 4EQ6A 1UF9A 3M0EA 3BS4A 3W6OA 2JLRA 2KB0A 3PR1A 5BYJA 5E7IA 2WAXA 3AP1A 1QF9A 1DAGA 1HE8B 4HB3A 1KSJA 2CNWA 1K6MA 4H1UA 1N6LA 2FV8A 3KXKA 1W47A 2RGNA 2ODNA 3U7EB 4NYMR 3ADKA 1IM2A 4B32A 5AJXA 1TUIA 2SHKA 1C1YA 4MGIR 1CJUC 3E1SA 2EQBA 2RB4A 2QSZA 4JVMA 4B43A 3MCAA 5ANRB 4MKGA 2GAOA 621PA 3CNLA 2V9PA 3UG7A 4DVGA 3EARA 3EC2A 2I1QA 4QHSA 4GP6A 2WKRA 5CLLA 2ZJZA 1N6OA 4A15A 4HAWA 1FQJA 5KNBA 4NPHA 1II8A 3DM9B 1Z07A 4B3DA 2H57A 4QGGA 2BHRA 1OB5A 1ZNZA 2XOKA 1JPNA 1OJLA 1E2GA 4URZR 2OUKA 2O8FA 1H8HA 4Q01A 2ANCA 2B7CA 2BM0A 5L3RA 1P75A 3PFIA 3VFDA 4PC6A 1G6HA 4ASUD 1KDRA 3PG5A 2GK7A 3EIQA 2C8VA 3VHXA 2G77B 2ZANA 3HU3A 4EPWA 4BE7B 3JVVA 3L2OB 3CR8A 2ZR0A 3EXAA 4Q19A 1XPRA 1IXZA 4QFMA 2G88A 1RJ9B 3NTUA 2O8BA 4RFVA 2QQ0A 3B85A 2Q3FA 1KTVA 2F1RA 2QENA 2XZPA 3NEJA 4IOMA 2X1VA 2JA1A 5D3QA 5JWRA 1QHIA 4JL5A 3FB4A 2QMOA 2ZXUA 2HLDA 2OLKA 3I72A 1JAIA 2D62A 4P4UA 4TT3D 1F3OA 3RS3A 2C04A 3GEEA 3RS2A 2H18A 5TB5A 2BOVA 121PA 2PCJA 2GA8A 3DKVA 3AVPA 1D2EA 3MFYA 3TW8B 4BZQA 4N3NA 3UMSA 1G3RA 5KSZA 3O8BA 4B3GA 2IYQA 2FJUA 5KO2A 3RWOA 3U61B 2C9YA 5DNYB 4G5GA 2W6JA 3NWJA 1X8KA 2PEYA 2XTNA 2YWFA 2LKCA 2WWGA 5GJVC 5KYKA 4OBEA 4QHTA 2PBRA 1Z47A 2ZR7A 2ZPTX 3KXIA 4XOIA 3BD9A 4M9QA 4LJ9A 5LD2C 4IVQA 2J3EA 3D8BA 5IRCD 3UATA 1KY2A 5FI1B 2R44A 2GF9A 4PC7A 1XF9A 4HAYA 3IPYA 4BRUA 5A5GA 1W48A 4AC9A 1OIXA 1CF4A 1XTIA 4PHFA 2J0QA 1KI3A 2RGGA 3CNNA 2OCYC 5L3QA 1U98A 1DAKA 4NYIR 1KZ7B 1VG8A 2B21A 3B1YA 3U3KA 3EX7C 4TTPA 3R8FA 5BWMA 4Q1EA 3OIVA 4IHQA 3SNHA 2PL3A 1ETUA 1FPMA 2BMEA 1KNQA 3LW8A 3LVQE 1KNXA 2EFDB 3KB2A 2AL7A 1E4VA 3OE7A 221PA 2ZTSA 5JZVA 2DPXA 3GJ6A 2FX3A 3DZDA 5AJVB 4AKGA 2YC4C 3PEUA 3U2QA 4R9UC 1OXVA 1G5TA 1Y3AA 4JLMA 2DWOA 3LVRE 4BFVA 1YZTA 1OFHA 2QL6A 2FEOA 2LCFA 3P1JA 3LDAA 4F38A 4H1VA 4M22A 4NP6A 4GPTA 1S9DA 5F9HA 1XD2B 4MRPA 1WF3A 2DFNA 4W5JA 4D2IA 3SQXA 1YVDA 3LQRA 3KQUA 2F43B 2RGAA 2HYDA 3EZ6A 5B64A 1NVXQ 2QSYA 1L7VC 5JJKA 1GILA 2WM9B 1G4AE 5FUVA 1QHSA 1KMQA 1D2NA 3CWZA 1Z6AA 5FOUA 3TVDA 2QTVB 3AKYA 1FMLA 1G3QA 2GJAA 3IUYA 1VHTA 2C03A 3RWMB 1FX0B 2JIZD 5KSYA 3FVQA 1JXOA 2X77A 2QE7A 4OI4A 1GL7A 4HAUA 3U7GA 4ZIRA 5GADl 1VCIA 3MD0A 3MLEA 2OCAA 3RSLA 1IJEA 2JLVA 2OAQ1 2XITA 1SKYE 4Q7KA 4TL6A 5KPJA 2WVJA 2WSMA 1CXZA 1MABA 1OXXK 1NSFA 2ZI5A 4FINA 4DB2A 3SZRA 2YOFA 4ABYA 3K70D 1LV7A 3DOFA 1W4RA 5FL7A 1SQ5A 1HURA 4MKHA 4IFBA 3U3OA 2V6IA 2FF7A 3RRNA 5FOTA 2JASA 3CH5A 3REGA 3OF5A 4TZ0A 2FOLA 4D0NA 1Z0AA 2ZROA 4ILEA 3SI7A 3LRPA 5JJLA 3X2SA 3GMTA 1NN0A 1Z0DA 4M1OA 2QU8A 1E96A 3SFVA 1CR2A 2L0XA 5TARA 3WYAA 3QBTA 2FG5A 4YDSA 1E2MA 1NRJB 2XNDD 2QT0A 5AUOB 2REBA 5KSOA 2O8EB 5DO9A 1ZW6A 3K0FA 3UKDA 4GMDA 1M7GA 2ZREA 2N42A 2BMFA 1NSTA 4JJKA 1GOTA 2G0TA 4NZYA 2FZ4A 3M4YA 3GLFA 1TQDA 1SXJD 4JLJA 3AEZA 4M1WA 3RVBA 1I4DD 5C2JB 1GNRA 1WE2A 4M1SA 3CBQA 1QG4A 1ZM4A 1AS3A 2H7VA 1KO1A 1COWA 4PAQA 3GJ8A 2QBYB 4BLPA 1CJMA 2IWHA 4CGZA 3AVTA 3KFXA 4R98A 4YXWA 5JWOA 3BERA 4DCUA 3AH8A 2ZEJA 5FTNA 3GLGE 3TAHA 1U8AA 4IW3B 3F5FA 2GNOA 1U94A 2ZUCA 3VU9B 2P67A 1KO5A 5JI3E 1JPJA 1TQ4A 2EFEB 1QHNA 4Q00A 2G83A 3FMOB 4TYPA 4Q4JA 3SYLA 2HF9A 2R6CA 4FMBB 3A4LA 3KDSE 2RH5A 3SJZA 3L0PA 2ONKA 2GCPA 4JLPA 2ZRGA 2GHIA 4PO8A 4TQ9A 1R0XA 3MRSA 2BBOA 2ZYTX 3LW7A 3TR0A 4AIIA 1AJEA 1R5BA 3GLGB 2IT1A 4WIAA 1NLYA 5FTJA 3W8NA 4KVAA 4Q9HA 2CL6X 3B1WA 2WWIA 2ZE8A 1N0WA 4S35A 1BIFA 1FZQA 3LBNA 1RYFA 4KVGA 2N46A 4XWAA 4DUGA 4OHXA 1S9HA 1SVMA 1BMFD 2QEQA 3W5IA 1CEEA 4IVRA 3GLIA 4RFSA 1AKYA 4Q03A 4GT1A 2QM7A 3K0CC 5DSZA 4F7WA 1S96A 1JALA 5KNDA 4Q4LA 2CK3D 1WXQA 1IHUA 3QJYA 2CBZA 1K8RA 4BLOA 3CRRA 3NEYA 4CYMA 1Z6TA 5FH9A 4WVFA 1HQCA 5FUXA 2PLFA 4BFSA 2QTFA 2KE5A 3C15C 2D7DA 3QSYA 2ZITA 2V7QD 1DO0A 4DRZA 2FFQA 2VHJA 5DHFA 2A5JA 1J90A 4ZCIA 4G5RA 3EZFA 3I4LA 4GMXA 4L9SA 3EZ9A 1T91A 1ZNWA 3P26A 2F3RA 3E70C 1YR6A 4R2IA 3ZZTA 1DPFA 3NXSA 4MGYR 3VR1A 4URWR 1XFAA 2QAGA 1W5SA 3FOZA 1N6NA 1Q1EA 5E4FA 5G3ZA 1A1VA 1XEWY 2QP9X 1US8A 2X19A 1NBME 2VSFA 1MH1A 3T06B 2ATVA 1OYYA 4NCKA 2R6AA 1XCMA 2B8WA 4RZ2A 1M1YE 2VF8A 4LUCA 4EDHA 1EX6A 2H8KA 2Q0HA 1XCGB 1KJYA 2PH1A 3BRWD 2NO7A 3CX6A 3I92A 1P62B 2XB4A 3WP0A 1ONBA 1HA3A 3QXJA 3ICQB 4DCVA 2Q3HA 1ZM3A 4BLTA 1KO8A 3WNBA 1U81A 3WYGA 3FHOA 3K1JA 2FA9A 4WXRA 1KI7A 2DHRA 4HEJA 4HYYA 3ZLJA 4QJ3A 1VECA 4CEHA 2IXEA 1G19A 2GZDA 3OESA 3P27A 2GF0A 4DSOA 4LBYA 3DMDA 1GG2A 4IKEA 1ZD9A 5FTLA 3FMIA 1E0SA 5JECA 3QVVA 2NOAA 1SXJA 2XSZD 4AK9A 4UQOA 3WP1B 4URXR 1PLKA 2HLDD 1OXSC 2WJHA 3UG6A 4URUR 1G8FA 2GJ8A 2FN4A 3D3QA 3P4XA 4NHOA 5FPHA 3TUJC 2CLSA 1ZM9A 3QQ5A 4NYJR 1TTTA 1UADA 3PENA 1GRQA 2WV9A 1UEJA 3C16C 3WNCA 1SHZA 1IJFA 4PPGA 4OJKA 5SZHB 3SDZA 3SU8A 1ZIPA 4JLAA 1QHXA 1TADA 2GDJA 2VO1A 4G0NA 3T5GA 4MGZR 4L16A 3R7WA 2QZ4A 4QGFA 1KI1A 1E0JA 3AF4A 2H5EA 2R9VA 4TLDA 3R7WB 3RLFA 3ICEA 4DEXA 2RHMA 1KSFX 1Q12A 4OQXA 3I1FA 3WBKA 4DCSA 3W34A 1E2QA 4PAOA 1DS6A 2Z0MA 4C0AC 1Z29A 3UWKA 4A92A 4DCTA 2IS6A 5FUYA 4Q4AB 1Z28A 2UKDA 5CIWA 1W2GA 2RGBA 5IK2D 2C2HA 2QE7D 2ZU6A 3AB3A 3OIYA 2FE4A 3CX7A 4GZLA 1WCV1 3ADCA 1FMJA 2F6RA 1GSIA 4WOPA 2ZJBA 1NN3A 2E9SA 2O0HA 4LJAA 5JSZA 5G3YA 2HYIC 4DXAA 2P5SA 1JR3A 1M74A 4DLUA 3THYB 3K0EA 2BCGY 1M7HA 4MQBA 3IGFA 4A6PA 3SFZA 4EQ6B 5JHHB 4DDUA 2QROA 2ZVQX 3ZD6A 4C7OB 1RRGA 1UKZA 3Q5DA 3EIHA 4EPTA 4Q4JB 1E0KA 1E1QA 1RRFA 3VR2A 3GFOA 4IOLA 4F4CA 8OHMA 3I62A 1E9SA 1N25A 5CJ2A 2OILA 4JS0A 4Q18A 1AZTA 3LX5A 1XXHE 4DT1A 2YWHA 2O8DA 2YWGA 3MWLA 2AXPA 1XWIA 1QBKC 3A6PC 4KITB 1NI3A 1ZCAA 4D4LA 3LLMA 3QKRA 4NU0A 2NZ8A 2FSFA 421PA 4RCYA 1R4AA 1GKIA 2GCNA 4PQYA 1QHHB 4AYTA 4U02A 3MUFA 1KYIA 5KNCA 3VX4A 4A0FA 1KSGA 3KKPA 2VQSA 1XJCA 2FWRA 3FYHA 4DLYA 4BZXA 1AS0A 1KAOA 4KBFA 1R0ZA 3PIRA 2NMVA 3IO3A 3REFA 5JI2E 5KDOA 3B60A 1TX4B 1AN0A 3U5ZB 3AUXA 4UNPA 4IDQA 1OV4A 3SOPA 2QMEA 4Q1BA 2DFKB 4EPXA 4H9GA 4PHGA 2REXB 4DSTA 5F2EA 1G6OA 2PX0A 4E5UA 5CYOA 2C9CA 4A2QA 4BECA 2AX4A 2GJKA 3HR8A 4V0ME 1KJZA 2Z6VA 3HPRA 4HZUA 1O87A 1CR1A 4B3CA 4YMTA 4JSTA 3KKQA 3K0FB 1R0YA 1T0JB 3OAAD 5DI9A 2BJWA 1IOZA 4URYR 5B2ZA 2IW3A 4C0LA 1RW4A 1KDPA 2VLIA 1I4TD 2D2FA 1ZD1A 3T1QA 3KJHA 3RHFA 4IXMA 4L5BA 1Q1QA 5EJEA 3THOA 3B1VA 4QJ5A 2WPDA 1IQPA 3DKPA 5C1BA 1UBFA 2P6NA 2PZEA 521PA 4DBLC 1AGPA 2BJVA 2XTMA 2BEKA 1E9FA 3QIAA 5AWFC 3T1VA 1FFHA 2X8AA 1MOZA 4LHZA 1EFCA 4OI0A 2UZ3A 3MWJA 4AD8A 3R20A 4HI0E 5E7JA 3QF4A 3K9HA 1YJ5A 3VU9A 1DTSA 1UJ2A 2CVFA 3Q3JB 4US2R 3C14C 1XBTA 1PVOA 2P0EA 3B1XA 1KK0A 4NTZA 2XXAA 2G6BA 3V9PA 4IOKA 4LC1A 2YNMA 3TRFA 5HPYB 3EPKA 3EW9A 1TQ6A 2IF0A 1W0KA 5GVSA 2OAP1 1Z06A 1GAJA 2PLRA 4GFDA 1N5KA 2VH5R 3ZS8A 3AP2A 4QBFA 4HLUA 3TLXA 4N0EA 1BKDR 3JZAA 1H8EA 1EFRD 3MG9A 3RNLA 1NJGA 5C4MA 5EE0A 1KI2A 1Q1BA 3LY5A 1W4AA 1S3SA 2BBTA 3OZXA 1XB2A 1D5CA 4NE2A 1RVDA 4KLZA 4V0NA 4CZ2A 2IHBA 1ZCBA 4PSVA 1BOFA 4JKIA 3CPEA 1E79A 5CLQA 2G9NA 3LV8A 1BS1A 1E9DA 1QDEA 1FTNA 1N6PA 3N70A 4YMSA 3U60B 2HV8A 3GEHA 4IVPA 4OHVA 5HKKA 3GQBA 1P2UA 1XTJA 2VPPA 3T1OA 2NO1A 4CVNA 3GJXC 4PPQA 1HYQA 3GCGA 4JBXA 2ZJOA 4C2TA 1FUUA 2ZJ8A 1NVWQ 3VNVA 2IUSA 3U6BA 4LHYA 4PZYA 3ONWA 4BLQA 1B0UA 3SE0A 1GIAA 4F4IA 4MRVA 3K0CA 4CEJB 1N0VC 2WIBA 3CF0A 1RE0A 4MITA 1DAIA 2ZRAA 5GJBA 2ZAMA 5IK2A 3N5CA 1EFHA 5HZKA 2H16A 3QKSA 1Z6GA 4TTQA 3ZH9B 2C99A 4FD2A 4Q1FA 4KI0A 5G40A 3G0HA 3QBVA 1WMSA 2QGZA 3KL4A 1EXMA 4LBWA 1DE0A 1M34E 2AWOA 1SVIA 3NC0C 2CL7X 3PITA 5FFMA 4R71A 2OFWA 5HTKA 3CIOA 1E1RA 4KAXA 1NN1A 2WJGA 2D7CA 5L8VA 1E4YA 4PANA 4LY6A 3WMFA 1D9ZA 3TJZA 1U8YA 2OM2A 3K9NA 3S1AA 4CIDA 3BWDD 1W49A 3VR3A 2JAQA 1E2EA 3TVTA 2CCKA 3O47A 1P2SA 2JATA 3TK1A 1NG9A 1VYUA 4Q4HB 2J41A 4CEJA 5DGXA 2NO6A 2QT1A 2DR3A 3DHWC 3NBYC 1SVOA 4ZIRB 3W3ZB 4N0DA 4PXAA 3WXMA 5J4YA 1P73A 2IC5A 1MRNA 2VP5A 1ZIOA 3P20A 5EP3A 3ZVMA 2N1BA 1DARA 1P9NA 3AF0A 3K9LA 1PZNA 2OO7A 4QHYA 2AD1A 4MYTA 2ZE6A 1CRQA 4MGKR 4ZO4A 2V4ZA 3BAFA 3IKJA 3B7GA 4TMTA 5CB8A 2WWFA 4JL6A 2B7BA 2KSQA 3I61A 1J99A 5LBIA 3CWQA 2IS2A 2IUUA 4A6XA 2C9OA 1HQYE 1ZM7A 3K9GA 4GNKA 1PJRA 3B6EA 4AURA 4D82A 3VKHA 4D80A 3UANA 4MA4A 1QVRA 2C95A 5AJYA 1VG9B 2CEAA 3C8UA 3DZ8A 1CTQA 1SVKA 2P6UA 2YKGA 1KJWA 3FKQA 5IF9A 4KJZA 3BK7A 4Z1MA 1G5PA 4LZZA 3F8TA 4JYCA 4PZLA 2A5FA 4G5SA 4LV6A 2IX3A 4UNSA 2XXAB 1ZUNB 3T12A 4XVRA 3I3SR 1G8YA 1NBMA 4GSYA 4TLEA 4DSNA 3EG5A 1PUJA 5DYGA 2GJSA 1GNQA 1IN4A 1OFIA 1A82A 1OPXA 3GLGA 2JDIA 1Z5ZA 4F93B 2W6IA 3SEAA 2ZRBA 4BUJA 4E03A 4HZIA 1N6RA 3AKDA 3Q85A 2PEZA 2ZUDA 1G41A 1R7RA 3SN6A 1GKYA 4JBYA 4US0R 2JCSA 1WRBA 2WAYA 3EA0A 1TU4A 1YR8A 2QPOA 5BXQC 2QQEA 4P31A 4JMPA 2RCNA 2KBEA 4HDCA 4EJSC 4LX0A 1MO4A 3DM5A 4FIDA 1NLZA 4QOSA 5DI3B 4A2WA 4A8JA 3QNUA 3EA5A 1KAGA 1ZAKA 4PO9A 5AUNB 5DI3A 1KDTA 2W0SA 2VP0A 4Q7LA 2YC2C 3GPLA 1BYIA 2WJJA 5HCIA 2J7PD 2QGNA 1G9XA 2ZETA 4LPSA 1FQKA 3O8RA 2XSZA 1G16A 2C5LA 4ZDWA 1K5DA 1T5IA 2BBSA 2A5YB 2EWVA 2FSGA 4YQFA 5JBQA 3IQWA 1YKSA 3NBFA 5GJCA 1OSNA 4LHVA 2VBCA 3BH0A 2CE2X 4HAZA 2ZS8A 3THYA 3T61A 5AJWA 4Q21A 4HSEA 5TMPA 2QAJA 5JSZB 1EESA 1MV5A 4OJQA 5EXXA 5JEEA 4U5XA 1SGWA 3QKSB 3A1VA 4I1VA 1CLUA 2H1LA 3SC3A 1KO7A 2V6JA 1VCOA 2ZUBA 3GP8A 3KZ1E 4ERNA 4EFNA 4NONA 1XCPA 4NCHA 2ZRCA 2ZSAA 3HJNA 3OIUA 1NKSA 4OQMA 1B23P 3BH6A 1AM4D 2J1LA 1E94E 4RD2A 3WNDA 1MR3F 5H1YA 1DELA 1KK2A 4BFUA 2F55A 1M8PA 4FMDF 5TDHA 3U7HB 2GKSA 2B92A 3RRZA 1XEXB 5L3VA 3QE0A 4DLXA 4UXHA 3RYTC 3T35A 1KO4A 2VHUA 3TNFA 4KODA 1TF2A 5FBVB 1I2MA 2VHQA 4KO8A 5JS7A 2MSEB 5FBRB 1XTRA 2VYFA 4K46A 3B9PA 3FWYA 1H65A 2A5DA 1S4QA 4DDTA 1CBUA 4B2PA 2OSBA 2ZI4A 4Z51A 4B3FX 4KFUA 2J46A 4PC3A 4TSFA 1QHHA 2GBLC 3A36A 2C98A 4C7OA 5L3SA 2NO0A 4CF7A 2WZQA 2G3YA 1DAMA 1IY0A 1IN5A 4DJTA 1DAFA 2CHVA 1ZINA 1TMKA 1F48A 4HDQB 3KJIA 1EGAA 3QPWA 2WHXA 5SZIA 4LPKA 1BMFA 3QF7A 4D81A 4P4SB 4RY2A 4DUGD 3BORA 1NJFA 2W6ID 3IIMA 5FR1A 3W3AA 1GM5A 2RGCA 1W4BA 3OEED 1BYUA 3T1TA 2IK8A 2C96A 3KJEA 4FCVA 1BH2A 1L8QA 3IQXA 2QP4A 3KTAB 3QG1A 1II9A 3OFND 2Y8EA 3PXGA 3GLFE 2WOJA 5E95A 2CJWB 3QUSA 5EUMA 1NMZA 1HH4A 1GP2A 2IF2A 1E2HA
chains in the Genus database with same CATH superfamily
1M5RA 4M1YA 3IEVA 1T2DA 1D6JA 3OM0A 4FOSA 4KX3A 4JOCA 1XLTA 4MUKA 4OIMA 3TYXA 2BE7A 1QGDA 3ZVRA 1ABBA 4CEIB 4M7WA 3NFYA 2BBWA 4W9NC 2PAAA 3R5JA 3BB4A 5IG2A 1WTCA 2A4KA 5H9WA 1JEDA 4MPRA 1SURA 1HV8A 4PONA 2ONYA 3MTDA 1J8YF 5BOVA 4X90A 1C1XA 1S89A 1MVOA 3HEAA 5IAGA 4QG7A 1RXSA 3DLPX 1N5IA 3GLIB 1RAFA 2WQ6A 1LI5A 1XIVA 4KXWA 2PUGA 4IDNA 2VAMA 3SQWA 4IVNA 5CVEA 3VTFA 3CRQA 4WCDA 1XVVA 1OYOA 3ZQ6A 3V4OA 1XEWX 1VDMA 2QVXX 1I5RA 4AYWA 3IRVA 1PV2A 3OZEA 3FPLA 4A16A 4TSRA 1UM8A 2YHUA 5JCXA 1KYTA 3RROA 1N32B 1CUGA 2YX1A 3V1KA 1NW8A 4G01B 2E7ZA 4KRXA 4M1KA 3PRYA 4WACA 2DR0A 3FM9A 2PX5A 1GTL1 4PGGA 1MENA 5ADHA 3OHPA 2F67A 3QYPA 3V8MA 4UOQA 3VZDA 2GN2A 3MRTA 4RY0A 3HEMA 5JAUA 1RI4A 1GL3A 1IUKA 2WIDA 3DMPA 1CP2A 4PHTA 1XRRA 3ETDA 5HRAA 1TNDA 2GK3A 4R0VA 2E6KA 4CDGA 2Q45A 1C9MA 1CK4A 1AUQA 3ZGVA 3AESB 4FSDA 2O23A 3LPMA 4B75A 3E22B 3IILA 1J2EA 2JFVA 4HNGA 4IJVA 1HX7A 1ST3A 4ZYZA 1N92A 4HV4A 2C61A 4FBLA 1IOVA 1LXCA 4R1TA 4ZOCA 1E1KA 1LX7A 1Q15A 1TJYA 2WYUA 2Y93A 4LKOA 3C4JA 2I03A 3QEBZ 3I2FA 3A4IA 4LNUA 1GYRA 1T6XA 4G4SO 2VTKA 8ATCA 1M6WA 1M0EA 3JY6A 4RMHA 3IO5A 4XDGA 2HU8A 3EBLA 3DQQA 2HMAA 2ZIEA 3QOXA 4YWHA 2A1IA 1GQOA 4DW8A 2I54A 4AO8A 1TE2A 5A4AA 2DOKA 1DAEA 1QK3A 1T26A 4MVJH 1YL6A 2J5XA 4LYJA 4OSPA 4P4GA 3UAXA 3D8HA 2AUNA 1TUBA 2QW0X 3AJEA 3I64A 3I9OA 4V0RA 3QLVC 4DDMA 3WHKA 5D3MB 3E18A 4YCAA 5HVNA 2J45A 1R8QA 3AR9A 3RS4A 3RSZA 1MN6A 2O3JA 3LOQA 4GXRA 2IH4A 5DASA 4DWJA 2NVBA 1ID8A 1FFSA 3TW0A 3AETB 3N53A 1SIOA 3VR4D 1UDWA 1RKQA 1RHQA 5E4TA 2EU8A 1AKEA 2PJZA 4EW6A 4H3VA 3PU6A 3AL0C 2QKYA 4RVCA 3UCFA 7REQB 3PKZA 1CQIA 1RKBA 4PZAA 1CERA 4BNDA 3G7UA 2NPOA 3WL3A 5GIOE 2R62A 1YF3A 2D00A 4NE9A 5FPTA 4DLLA 4YV7A 1MG0A 1C0LA 2X2FA 2FZLA 2G07A 3HGMA 2B8NA 1ULZA 4ZEXA 5M3BA 3W5DA 4C0SA 4CKZA 4CCAA 2O1SA 3NBZC 1UBGA 1CETA 2APJA 4I6EA 4QGHA 5KJCA 3DA8A 5AOBA 1RNLA 4GP9A 2JJ2A 1FOEB 1HE5A 3AXTA 3JQ8A 4KQ9A 4KPFC 4WADA 3T9EA 4D4IA 4OXRA 2P8SA 1Z6YA 1NJSA 2PMBA 4DJDC 1VE6A 2RCYA 2ZR9A 1EFKA 1TTPB 3LECA 4BO5A 1XPOA 1PS9A 3VVMA 4UZSA 4CM1A 1EJ6A 1TI7A 1PNTA 2GBLA 2TMDA 4WUTA 1QYXA 4LJYA 4F5EA 1F12A 2W8BA 2WFLA 1QR2A 5G41A 4IHJA 1WBBA 1YC2A 3ISVA 3IQDB 2C4HA 4M2LA 2XW6A 3I5XA 4AS1A 4U6QA 1L5WA 4DQXA 4MPJA 7MHTA 2M32A 1HDEA 2OZLA 1GITA 2FQWA 2P2SA 1KK1A 3I6MA 1EQAA 3M5PA 1HDRA 1SCKA 1U2RA 5KYYB 4UXIA 3HJGA 1YRAA 1XRQA 1Z74A 1SBNE 2WM2A 1V96A 3PDIA 5ED4A 3N0RA 5LQCA 3DOHA 5DTQA 4D57A 3ZDRA 1LDEA 2XYGA 3V00A 4V0OA 3WHIA 4YONB 1KBZA 2O7VA 3W8DA 3G8YA 3IV6A 2ID7A 5B6JA 4M88A 4ZARA 1ONOA 2Y27A 3HO1A 1Z08A 4L3OA 2J4FA 4GE0A 5ALXA 1XAHA 6ADHA 1MEOA 2P3QA 3STWA 4OQLA 1UMDB 1SCAA 3GJTA 1HSZA 4XD7D 4KUEA 5JCJD 3T7KA 1QPZA 3QWHA 3BB3A 3R3YA 2DR2A 4KO1S 1QJCA 2GBFA 5AM4A 1M5UA 4YV0A 2WICA 5AW3A 1KKUA 4URHA 5LJLA 1RKUA 3FETA 4WXPA 2ZI9A 3LXRA 1IM8A 3ORFA 2O0MA 1JVNA 2IHTA 4M8SA 7REQA 1P9WA 2VQDA 2H54A 4WBNF 2ZU0C 1SVNA 1VBKA 2RGXA 3HYNA 5DCYA 3U5TA 3EW7A 3PJEA 4FJ2A 2BEUA 3EVFA 3LUHA 3TJMA 5F23A 5C81A 5DK4A 5ICEA 3R6GA 5IT9A 4DA6A 1UEXC 1EFTA 1R8SA 2RGNC 4FIZA 3UVEA 1KOFA 3E7FA 1TZJA 3BD6A 2W8ZA 4IRUB 4U2CA 3MCUA 4K9PA 4R1PA 4LYYA 1YR9A 1T4MA 2XT6A 1IY2A 3KU1A 4RLQA 4U3JA 4R01A 5CA1A 4JLOA 4MOWA 1VIMA 1V48A 5CH5A 3KXLA 2CDRA 3REOA 1M76A 2JB9A 4D9FA 3LS2A 4Z3KA 1W46A 1QHYA 3OO0A 3C5WP 3F2IA 3Q1LA 3ULKA 1VLLA 2YHBA 2XXJA 3VKWA 4A0SA 2Y1CA 3N2GA 4BLUA 2OZEA 3IXMA 2Q5EA 2QXUA 5KNLA 1WZ2A 5JZSA 1QGAA 4TVOA 3X1ZA 2Q50A 1GNPA 1S6YA 4ZO7A 3E03A 1C3OB 1T1IA 2WJ3A 1SEPA 4KB5A 5EXPA 2YINC 2O5RA 4C4AA 1JR3E 1QIMA 3OFNA 5FPSA 1HG1A 3QX9A 4AMYA 5IAOA 2VHVA 4R68A 3FVVA 4ZYUA 3UQZA 1X94A 1KGDA 2AZDA 1WWKA 1V1MA 4L8WB 5D3MA 3WAJA 3MAGA 2UUBB 3G2HA 3KPYA 1KY3A 4AL4A 1Y6GA 1YQWA 1TM3E 3TSAA 2AWNA 4WWHA 3H86A 2R96A 4RPLA 3STTA 4X7PA 4EHAA 1CQIB 5KI6A 1YIOA 2EFCB 2AV6A 3EY4A 4GLLA 1OA1A 2OOKA 2XVYA 3KB6A 2FP4B 3GQBB 4IQ4A 3WNQA 3AIMA 4KCGA 4FB4A 1NM5C 1QO9A 4ZVPA 4BY9E 5FEUA 3CSUA 1K88A 3KNZA 5BYBA 2LWIA 1Q92A 1SWWA 1PV1A 3I04A 4GOXA 4J7CA 4MCJA 3WAKA 3IBTA 5U4QA 4EB6B 3O4JA 4FOPA 2RGUA 1F8FA 4K6CA 1JUDA 1EWQA 1G4UR 4BFZA 3I52A 4HPXB 2CF5A 4J1SA 4BEJA 3HP1A 4PR3A 5KYWA 1WBDA 3HDGA 4TTVA 1LWOA 2YV5A 1N4AA 4AYXA 1D09A 4KDCA 4LVOA 5EKDA 3QP9A 3UCXA 4PLGA 3ROKA 4AKHA 4F97A 1KAHA 3HR7A 2GQ0A 5DMXA 4FBGA 4LYFA 4BO8A 4F2DA 2B1QA 1OIVA 4DF3A 3SX2A 2HSJA 2YWEA 3T4UA 1KKMA 1TQ2A 2WIAA 4FD3A 4WLFA 1XUOA 2ZSBA 1QKKA 3OP4A 3E9NA 4PIMA 4EG8A 1PEAA 2CUNA 4YJ2A 3DVLA 4FOTA 1ESEA 4EO4A 1E7SA 3NVAA 1I5OA 4L73A 2VAXA 5A4JA 1DEKA 3VMMA 1L5MA 1A9RA 3IAUA 1KC3A 1IY1A 2P41A 3AKEA 2EBWA 2H9IA 4AF6A 1PDWA 3LIIA 3HJFA 4ZAFA 3ANTA 1I32A 3KZOA 5DBGA 4W5OA 3IE0A 4R84A 3ZVNA 1NBOA 3T7SA 2ORIA 3H1GA 3K9QO 4G0VA 4OP2A 3LKZA 4B35A 3DBVO 1TQ8A 3N8IA 1JU3A 1WUKS 2IE8A 4JI8B 2AI2A 1FNMA 2V7VA 2X5KO 3BJEA 5HCNA 4EQZA 2OZPA 5HZHA 1USVA 4JDPA 1Q84A 1GYPA 2XCUA 4LISA 4R8VA 1AGRA 3H11B 5K8TA 1CY2A 4C20A 4CMIA 3ZLTA 5E3HA 5CDFA 3DHEA 4MIKA 3ESCA 3MPUA 2XDYA 3HKBA 4ZAVA 1LSSA 2DPHA 3GOQA 2HY7A 5FTMA 1L6IA 1NYTA 1NUHA 2OCPA 3GMSA 4XH9B 2JJ1D 5H70A 4MUAA 1E99A 2FPPA 1RBZA 3ZCTA 5HE9A 4PSKA 3VUEA 3SF0A 4YUYA 9ABPA 2WQ7A 1PE0A 4F6LA 1E9EA 4U3JB 1G64A 3C3KA 1K7SN 4P4SA 5A4FS 3IMEA 1XRJA 3K92A 4IAOA 1RM4A 4MINA 4CR8A 2YWJA 3QX7A 4X00A 1XQ9A 4D6PA 4ZOEA 1EK0A 4FNMA 5JALA 2LD4A 1OCEA 3F49S 5J4LA 3CINA 2KJQA 3I83A 3B36A 4D4JA 2PJUA 1N2BA 2WYOA 1GFZA 4MXDA 1TK2A 3AVYA 2P2CA 1AO3A 4E5KA 3U44A 1JJVA 4KH1A 3JQDA 2Z2IA 2A9RA 1H23A 4YNBA 1ODFA 5AHRA 3WYNA 2NO9A 3C6MA 3EZXA 3THWA 3DXFA 4L9RA 1CUBA 1B0AA 2QMQA 3FKSA 1RI3A 1TDJA 2V65A 1C0EA 3FAZA 2VLBA 1G3IA 1LGYA 2BV3A 2G06A 2GHRA 2GX6A 2ZT6A 3PQ3A 4L15A 1QH8A 2IXDA 5LYJA 5NULA 4LJ8A 4BBZA 4BQIA 2PZBA 2VAVA 3AUYA 2A78A 4KR9A 1MTZA 1LZKA 3A6JA 3FOWA 3U3JA 3N8KA 4OKSA 4W6QA 2Q6OA 3FPGA 2X2EA 1SUPA 4L95C 3KQQA 4GOLD 3Q2OA 1QG2A 4ZVRA 2NSHA 1JECA 2JD2A 4Q1DA 3OCWA 4GXTA 2C31A 1A8IA 2DHQA 1QF7A 4PQRA 3TOZA 4FCCA 5AKYA 2BKAA 2GXQA 3C3JA 1KI8A 4J6EA 5LWHA 1J8MF 1V5FA 2AGVA 2VEDA 3RK0A 1ISSA 5CEFA 4O2AA 2LE0A 4S1TA 1KMHB 3EXFB 4F6RB 5IBPA 4IWYA 1G17A 4C4TA 1ISPA 1Q0ZA 4FR0A 2YN4A 4QPDA 3D6TB 3WKCA 5WRFA 2OQVA 4RH0A 4OLFA 4A0RA 1YQXA 2Y0PA 4U63A 1EFVB 3Q3IA 4C2UA 4LCBA 2P7HA 4QTZA 3O73A 3ZU6A 5IAAA 4K87A 5C52B 1KY5A 1DOZA 3D7LA 2G36A 1QGZA 2JLYA 1YZLA 2WT8A 4WFKA 4AP5A 3BTVA 3DKRA 1N6IA 5ALTA 4C0XA 1XZPA 1FUEA 1LNSA 1ZN2A 2BI8A 4L5CA 2WWYA 3JYLA 3CN7A 1MT0A 4H08A 3CEAA 2BFMA 4WJKB 5AK0A 4LE0A 3HUTA 2AOTB 4Q1AA 3U48A 3VMFA 3RC1A 5AVJA 4MVYA 1T4GA 1NP7A 5IBQA 3WXBA 3HFRA 3QMVA 3EVNA 1MOPA 2Y0DA 3PX7A 4LF5B 5JC8A 3UHOA 5KNBH 1SKQA 1SZJG 1U5AA 3DEFA 3RUIA 3I5AA 2PLAA 5FRDA 4N0QA 5LA6F 4FS3A 1IFXA 4YIHA 2XZLA 1FU4A 1J5XA 3NJ8A 3WIBA 3KL2A 3PUJA 3TLKA 4F7DA 2D0PB 3UOGA 3PUWA 2ZYUX 1ILEA 2JLSA 5AKHA 1E1RD 1EFPB 3R8CA 1F2TA 4X71A 1WL8A 3GNQA 2XUZA 1V7ZA 1XTVA 1BO6A 4HWSA 1A2BA 1ESDA 5C5EA 2FEKA 1EX9A 3HACA 1R5OA 2QLNA 1OX4A 4DRXA 3L84A 2FP3A 2II6A 3WLHA 5KYXB 2IYLD 3QK7A 5TRTA 2GM4A 4XIJA 2IBMA 4DYHA 5FJJA 1OWMA 5EIFA 1DQYA 1KQPA 2P2LA 1U7DA 1JJFA 3NG1A 1UWLA 1HUQA 1F60A 1R37A 1UMDA 1Z88A 2GYUA 2DPYA 2XUFA 3OJWA 3PGLA 4WUVA 3F7TA 1M7BA 4WHMA 2Z4SA 3YASA 2DTXA 4EW3A 5E9JA 5C2JB 4JUFA 3MGBA 3ANNA 5TGDA 4LJRA 1U8EA 2BVNA 1POWA 2W83A 4G5YA 2QXYA 5EZQA 3PFCA 3KRTA 2HFJA 1OXUA 4PM4A 3W4IA 4EVSA 1OZFA 2YV4A 3FGOA 3QV2A 4YMLA 4Z4GA 2QRUA 2I4IA 2PT5A 4C78A 4QUDA 5CX1B 4P2BA 2Y1LA 3TH5A 2JBAB 1KVSA 4C0HA 1N9GB 3TI9A 3RYCB 1N34B 1ZH2A 4GECA 2N1MA 5DLEA 4LV5B 4R9SA 4Z7QB 3TDKA 3CCCA 2VJKA 4N5NA 4Q4CA 1OB2A 3R24A 4IGIA 5CA0A 2ECQA 4FI3F 4OHRA 4DMFA 1QC5A 2VTVA 3OT1B 5JCPA 2VT2A 1GHTA 2B99A 3KZVA 3WK9A 4D9CA 1YB4A 3LJKA 4KFRA 5KU7A 1JB1A 2GRJA 4RSRA 3JVEA 1T9HA 1G8GA 1NVKA 3ELDA 1VMIA 5JWHA 2O1EA 2ZT7A 1ZLXA 2MYUA 4IJWA 3VX3A 4BL5A 5K20A 2DWCA 4G1MB 2WNIA 4HS9A 2AZXA 3JZMA 3ER9A 1ZUWA 1PSZA 4D1YA 1H85A 2Z4RA 3WL8A 4W5QA 5C80A 4L4UA 4GOKA 4LGMA 4RGQA 1VYTA 3C3DA 1F7UA 4UBKA 3HM2A 5AXBA 2BTQA 3NRBA 2H9YA 3E0XA 2BSQA 3WMWA 1GGEA 1J4AA 2FU5C 1AF7A 1G7CA 2GZMA 2SKCA 3AOEC 3ECSA 3LUJA 2C94A 2BFFB 3N58A 2FPKA 4MRAA 4E88A 5JAHA 5MGBA 4EZBA 3MCZA 4EF4A 4LSGA 5H16A 3WKDA 2QPTA 2PK3A 4HFRA 1O94A 3IP7A 4GI5A 3K6SA 1QIFA 2XWQA 1JAHA 1OC2A 5IDYA 3ADBA 2XWBF 3LHIA 4L5IA 4MEAA 1NN5A 3B3JA 3SLGA 3ZYZA 3NS7A 1MZPA 3MSXA 2FWPA 5IFKA 3E9YA 3DCYA 2Z2ZA 4C3OB 5SYNA 3HB0A 3FCCA 3INTA 1ECGA 1LFDB 3GIDA 3E2IA 5EG5A 1KQNA 1EGHA 2PVPA 3E5NA 1I6LA 5DBOA 1PWHA 3RFFA 2OB1A 3WK8A 4BO1A 1XDBA 2VJPA 1SJ9A 2QK4A 1H5QA 3AHCA 3NHPA 4X92A 2NU7B 3CIFA 4I1OA 4LGVA 3U7QB 2CLDX 3ZDAA 2OHOA 4AQ7A 3TRJA 1ZLYA 4O2AB 3RCBA 4A5SA 2HRCA 1NNUA 1X19A 5J23A 2E1RA 4HUQA 4NZNA 1UKVY 3AF3A 3OE7D 4NR0A 1Q16A 2VAWA 3TRDA 5IAEA 1OFUX 5IK2D 3EEOA 5C5IA 5SZKB 4ZI3A 1NG1A 3DFZA 3T6KA 4A36A 1X42A 1H6CA 3W6ZA 4YP5A 5JS1A 4KQMA 2C7VA 1U0LA 5KYUB 1Y1LA 4QAJA 3ML1A 1IWOA 4UAUA 1ICEA 4MAAA 2OPHA 4GLFA 1DBPA 3UZUA 1PWXA 5HUJA 1DCFA 1X1EA 3LP8A 4QYIA 2D1TA 3VR6D 1SCIA 1UBLS 2OC9A 3QW4B 3AVUA 3KKOA 3W6UA 2ZE5A 4ZCLA 3ZE2B 3FOAA 3AM1A 1T36A 3DAGA 1RYBA 2FRVA 2VUHB 1OFVA 1UFOA 2G67A 2YVUA 3P9XA 3QFRA 2A0UA 1Z8FA 2OHFA 5AMXA 1RI1A 4NYJQ 2HA2A 3HMKA 1U99A 3SZ3A 4JNCA 4ARBA 1NVVR 1KIAA 1VJ5A 4BVKA 2QN6A 2XDAA 1FJ2A 1XEFA 3KVYA 3UV3A 3AP3A 1T13A 3VKVA 1DV2A 3ZYCA 3B8EA 1TT5A 4BGVA 4KRFA 4C87A 1YSCA 3CISA 1UXOA 5F51A 3TLYA 3N05A 1G21E 3AZPA 1B6SA 4TKUB 1K75A 5CBPA 5F52A 2O48X 3TS1A 4OK3A 1A9XA 3BX1A 4AROA 1P1BA 5BV1A 2PUFA 2XJ4A 1F9AA 3NVDA 1QQTA 5HZMA 3EXG1 1IXRC 2NU9A 5EFOA 5HKLA 2Y1KA 3HUDA 3MCWA 2WG1A 4ZANA 1Z3CA 2XRYA 4CW7A 3QKWA 1NBAA 1KDYA 3U49A 1CUFA 3A1FA 4GXQA 1CE8B 1XN4A 3H1BA 1IZ9A 5CNKA 2HMUA 1R0BA 1V7QA 3IDZA 1HMYA 4BE4A 5JCOC 5JVDF 1OI4A 3A70A 4AY3A 1C1DA 1DBIA 4IJKA 1SAYA 4RKEA 4X41A 5FO1A 5JTUA 2YVKA 2PZFA 3EUWA 4M9SA 5C34B 5KVSA 1XYYA 1H2RS 3PUZA 2XGJA 3PF8A 4I81A 2EKDA 4IWNA 2FGJA 5ICGA 5DM2A 3DUFA 3Q10A 2XNDA 3F3SA 4ON9A 1ZIDA 4UUQA 3UO8B 3SJAA 3FNEA 1XX6A 2C1ZA 4QO7A 1R9GA 1AOXA 3HUFA 4OAPA 3I58A 2JLQA 3LT1A 1NOKA 5AJUA 5LDGA 3W78A 1HTTA 3AL2A 3LC7O 4CTJA 3A4MA 1VHDA 4Q3AA 4HOYA 2Y2VA 3MVEA 5JROA 3FDIA 5DN6A 3H5NA 4FYXA 4IDHA 1HC7A 1YS1X 2UZIR 2VOJA 2PH5A 5FYQA 1PUXA 1WD7A 3QX8A 1UDXA 4FSHA 4BQPA 5JFOA 2GK6A 1IN1A 1MRSA 2A9KA 3KJGA 1R4NB 4G5HA 4MUBA 1TO1E 3D59A 3KUDA 2JD1A 1EX7A 3T7JA 4KXFB 4HB0A 2IHJA 1F2UB 4AJIA 2PKQP 1T6BY 1HDGO 1PZXA 2MSWA 3X0DA 3L0IB 1XEAA 5IC5A 2J3QA 3CPSA 3V6LA 1RYDA 4BS9A 4R1UA 4DNPA 1O8BA 2WJ6A 1Z8DA 2VJMB 2C2KA 2A1TS 1J21A 3L82B 1WMBA 4Q4AA 4TWIA 4NX2A 1EWKA 3OEEA 4V38A 4O4JF 3LA6A 4OV6B 4B3XA 4B4KA 2BFAA 3RC3A 1EEXB 1O95A 3FOEC 4O2RA 4BMCA 1UOEA 1JZQA 3AR5A 2AG0A 3LQ4A 1S2OA 4QDXA 4FFVA 3WKBA 2PFGA 5F7XA 3DE0X 1SWVA 1E4EB 1V8OA 4LHSA 2Z9CA 3QKRB 3FWZA 4G0QA 5D85A 5LB4A 2PKWA 1AX9A 3EEBA 4IUYA 3UM9A 3RRXA 2ZUSA 3I0ZA 2EFGA 1KEUA 3VPGA 5JDCA 2WUWE 3G8BA 1T3GA 4TWZA 4A8JB 3GFSA 4FGUA 4DG9A 3VVCA 3LFUA 4IGFA 4KRYA 5DYNA 3ZU2A 1KBOA 1C7ZA 1N9ZA 1YE5A 4KTTE 4Z3DA 3ZU4A 1U0BB 3L5OA 2VP2A 3TEMA 1PO7A 4KPEC 1DQSA 3WLOA 4UUNA 4AP6A 4PN3A 2Z6AA 3HI6A 1U8FO 5C53B 1PR1A 1PJCA 1I7QB 4BGIA 2HT1A 1ZO8A 4L22A 3NCHA 3EWAA 2ESRA 1M2KA 1Y9EA 2A35A 4UPVA 3G0OA 1NMXA 2QTHA 5FTWA 4GZMA 2VDJA 2GZ3A 2YIJA 2P11A 4PTYA 5I4KA 2ZVPX 1DUIA 1F4VA 3Q2IA 1EVQA 4NYIQ 1FZTA 3SQNA 3IULA 4HAOA 3GJ3A 3SF8A 1SQ0A 2BWJA 1J56A 2CHUA 4FZVA 1V43A 2CLMB 3PKJA 3F7OA 2Q21A 2GK4A 2XGSA 2XA9A 3A4YA 3OEHA 3QXGA 4DSUA 2BFCA 2F9FA 2A9JA 4MH0R 5JHGB 2JA2A 4AJ1A 1ENZA 2AN5A 3EXHC 4GGMX 2V9CA 1ULAA 3DMTA 3FDZA 4QBTA 3N2GB 3ZE1B 5KHOC 1AH2A 1NWCA 4P93A 2ZULA 4EHBA 4C4PA 3ZIDA 2VI5A 5ALMA 3G79A 3DL0A 1KZ6A 3MQ4A 3ZX5A 4Z3OA 4P1ZA 3IEUA 3VNSA 4B8WA 2CSXA 4AWBA 4AMZA 3OZWA 2P3SA 4AUNA 1C8VB 1FFEA 1ZP6A 2NUBA 2O57A 2QG4A 2RHGB 3O0DA 3ODPA 4B2LA 3QENA 4BFYA 3HFJA 1ZOLA 2R1ZA 2VF7A 4F56A 2MSDB 4JEHA 3OZTA 4UKDA 4AY4A 4NCIA 5J47A 4F5YA 2V3WA 3PC4A 5ECYA 4B45A 4DA8A 1FDVA 3F5SA 1ZA2A 3ZDZB 4LJKA 3FGZA 3EK2A 1YGYA 2Q6KA 4MUJA 1AQJA 2ICAA 3LXMA 3FPAA 3OBBA 4INAA 4TPKA 1N2OA 5EXSA 2GXAA 1E3WB 2YJTD 5THXA 2QN3A 3MAJA 4F4DA 2QYTA 2PMKA 2PZLA 2UUOA 2VA8A 2BKVA 5H4HA 3PVSA 1U0EA 2F3PA 1F0PA 1N6HA 3GVCA 3N28A 5ALEA 3KIPA 5JAZA 3GBSA 5K7SA 5KYNA 3JVUA 2P9TA 3INYA 1CY7A 4W5WA 1P5RA 2EF0A 5CDGA 4BCBA 4MUHA 2CXXA 4ZMBA 1GTRA 1TPZA 2H52A 3CMCO 4PIVA 4S1OA 1H4VB 1KARA 4Q4HA 1RFLA 3ONEA 4Q9IA 5DF1A 5TF4A 1T0HB 5LP6B 1UXGA 1L4LA 1X1TA 4DCOA 5IKEA 4DGQA 1YB6A 1OAOA 2RAVA 4Y2UA 1CEXA 1TK9A 2HQSA 2R65A 3H0KA 3BBPA 1YAJA 3ND8A 2HK9A 4M49A 2ATXA 4TKLA 3LT2A 1CR4A 3KB1A 3WRXA 1NF2A 4HUTA 4RPKA 1QAMA 1T9CA 3GNTA 2A86A 1K68A 3I76A 3H2YA 4J3FA 4AF8A 1P2VA 1DTEA 2BC9A 1ORRA 3ONNA 2DCUA 4FMCB 4MYCA 5JCZA 3RVPA 4MKIA 1KRXA 2KQUA 3FYUA 5LOVF 1RPNA 1U0JA 3SAJA 4CDNA 2CHEA 3HJAA 5A62A 2C5BA 5E6RB 1RFGE 1ZD8A 4LWQA 3EH1A 5IYZF 3AWIA 5TQJA 3UOWA 3AONB 3DUWA 4DLWA 3ZX4A 1PJBA 3EFBA 3SS8A 4DV3B 2ZDHA 4G5FA 4WBNA 2BGRA 3O8NA 2QTLA 3N0WA 3R9KA 2G40A 4FHEA 1K66A 4R3UC 4TTIA 4Y2JA 3RYHB 3CO0S 4YUVA 4CEHB 1NXQA 2J0SA 2FCRA 3JVIA 4OMDA 5KYGA 3LA8A 3K73O 2HMTA 2R6FA 1U8UA 1R5NA 2G1AA 2VDNB 3IR6A 3NDPA 2DBQA 3R9IA 3U17A 3EVBA 3TW6A 3IIKA 5K8CA 4BPBA 2XB2A 3DBHA 2IBTA 1UMBA 2OT3B 3EN0A 1Y4ZA 1Z73A 3DW1X 1FRVA 2VT6A 3QNMA 4RE5A 3JQ7B 1VRWA 1Z5GA 3FCOA 4GU5A 2QTGA 3SDSA 5D00A 2FR8A 1MXFA 3K9CA 5KKAA 2WKPA 3A6EA 4MRMB 2DUUA 2QM8A 3BWEA 2YZGA 4N01A 4UEWA 5JNTA 2HU2A 1Z4LA 2P4QA 5DTRA 4YYEA 4V0LA 4Q66C 1AUOA 2WHRA 3PZRA 2FW1A 3R74A 1HQDA 2XMQA 4DDWA 3M49A 2D0IA 2P65A 1QFMA 3JASA 3BXOA 4GEKA 4IGAA 3TSWA 4MV7A 4KLAA 3H0EA 4PINA 4CTOA 1MA3A 2AC7A 2JD0A 1WHTB 4RZHA 2BUBA 5AK6A 1HEUA 4BNKA 2QQGA 1M3SA 3AGPA 1JHDA 1R4ZA 1OB5A 2IZZA 4OYYA 1XKQA 1G7TA 3ZJYA 5CYGA 1JAZA 3ZCSA 3UB3A 3Q7IA 3B3FA 2R1TB 2BCJQ 3WLAA 5B4TA 4NG4A 1R9JA 1HT1E 3IT0A 3KS9A 3LKVA 1D9XA 4LGYA 4DR6B 2XWPA 2IHZA 5LBTA 3TLCA 4F9EA 3JWIA 4M3NA 1YU6A 3PD1A 5C35A 4A27A 1UT8A 1G1MA 2WMNB 3F71A 2I3ZA 2ZRHA 4KEAA 4DCMA 4IIJF 4EYGA 4JDUA 1E6UA 4B2IA 1KYWA 3FUXA 4AZVA 3VJLA 1P0IA 2BJHA 2W2LA 4JX9A 1T6YA 2F8LA 4RTNA 2WUFA 1RAAA 1FX0A 1RABA 4ZC1A 2PZJA 2Y92A 4BKQA 3AERB 5K3FB 4ZV4A 2O2ZA 3JQGB 1R0LA 1A8PA 2GRAA 4RX1A 2NIPA 4HADA 4YH1A 3W2FA 1PEYA 4NZ9A 3ZDQA 4TZ6A 3O3NB 3UT0A 1VCHA 4OM8A 1GWNA 2V54A 2DFTA 4BP9A 4DILA 3N2IA 3ZZUA 5F9FA 3UWOA 2VSNA 1Q0LA 1P7ZA 2R7AA 1F2VA 1TM7E 3N2KA 1Y3HA 3E7XA 3OT5A 3OTOB 2VUSA 1MEEA 3D2LA 1ZBDA 2YYZA 5I4IA 4RC9A 3L8GA 1H1LB 2OWDA 1KS9A 3VGPA 1B43A 2YASA 1F3LA 4Y1RB 5INTA 5JEDA 4D4MA 3FNIA 2CMKA 2W48A 3LHKA 4HS4A 3RARA 2GBGA 3L04A 2ZYVX 2H1VA 4Q0MA 2ATIA 5DNVA 4DV1B 1DWUA 4L9WA 1GTVA 1QO0D 1CVLA 1OLXB 1T8UA 2PR2A 2ZAOA 4DKXA 2NQ2C 3TIXB 3UMBA 1E2JA 4IDEA 4PBTA 1R0KA 3E2MA 1W0KD 3A9VA 4JV5B 5D51S 2C3MA 3HWSA 1N2HA 4F1JA 1TAHA 1ZOOA 1WUHS 2BZSA 2QTVA 3ZE6A 4DAOA 8ADHA 3IOBA 5B2EA 2W6PA 1RJDA 2FSVA 2EIHA 3TMYA 4BO3A 4YAJA 1NOIA 3H4TA 4L0CA 1BA2A 2XTZA 5EZYF 4Z0NA 4ZV9A 5AW9A 1ESCA 1P1RA 3TOCA 4OK6A 5CG2A 3GD7A 5EKXA 5JIBA 1DAPA 4AN1A 1P9OA 2XE8A 4JI4B 3KSAC 3WKAA 3FHTA 2VAPA 1PLJA 3ES9A 3QMMA 1PEDA 1OFTA 3N07A 4II7A 4Y0VA 3SHQA 2P7IA 2ZBGA 5BQFA 2OO5C 5E3JA 3T4XA 1QOZA 2FZKA 1BS2A 4QL3A 4YGYA 1A95A 2IU3A 2C8KA 2YVQA 4II2A 5FWNA 4FGSA 3FTDA 4DJ5X 4MJLA 3P9ZA 4XUEA 3S0JA 2V7QA 4Z9YA 4YIKA 3I9KA 1N5LA 2I7XA 1MC5A 5D1HA 4A8TA 2OL4A 1LLFA 3ROGA 3MWEA 3BMOB 3E9ZA 5GY7A 4O4HA 4G5QA 1PN3A 2PUVA 3HJCA 4LXYA 4ZODA 2VJMA 4G5OA 4ALNA 4ZHSA 3NONA 4PZDA 1UFKA 1IBRA 3JWGA 1I8TA 3PHJA 4CV1A 1T6ZA 2O19A 2IUFA 2FX5A 4JQCA 5AW4A 2AN9A 1FYDA 5C8DA 2J9RA 3K30A 2GXUA 5JY1A 1V5WA 5DNUA 5CPFA 1MQ9A 3H2SA 3NATA 4UBJA 1C7EA 4B0PA 3W5HA 1B1AA 3ABRB 1RXWA 4XSHA 1JJBA 2G08A 3I2KA 2HPVA 5DE3A 2EBHX 4GUAA 4UNQA 4PYNA 5JE8A 1L4YA 1IE3A 1SIWA 1Z2CA 2RARA 4FGZA 1JSXA 4HWRA 1KKLA 2BFPA 1CR6A 1SZDA 2E1PA 3K1AA 3QLUC 4X45A 5H68A 4ASUA 1DIHA 1VSBA 1X38A 1AIPA 2G0NA 4P7FA 4YJKA 3ZIAA 2IOHA 4YWJA 4KN5A 3SKVA 3X1DA 3TQOA 4D9NA 4K9OA 3IKLA 4NOKA 3KKLA 3V80A 3ZLVA 2FQ1A 3QWBA 2WYHA 2EFHB 3EXFA 2GA9A 3KSRA 4OQPA 2X4DA 2VQ3A 4F6RA 1VJCA 3TOVA 2WWWA 2VDKB 3NXKA 4FOOA 1XMOB 1SUAA 3UT5B 5FO0A 2AG8A 4KR6A 3KD2A 3M6FA 4CPDA 4EATA 2WDPA 1OJ7A 2W58A 2IYSA 3DWIA 4MZXA 4Q3OA 3FZQA 1OIWA 3IB3A 1FRFS 2WVHA 1WA5A 4W9RA 3WYEA 3N5KA 1AA9A 2GVDC 4KQGA 3FLAA 1YR3A 1IZ7A 4A8JC 1PT8A 4F84A 5HKBA 2ZJ3A 2AH5A 3MJHA 2AMYA 2X0KA 2QRVB 3SG0A 4LHXA 5LNK1 4YCJA 1WEHA 1F1BA 1SHUX 1Z56C 2F3UA 3R3HA 4J16A 4PZ0A 2HUPA 3RB8A 3M81A 4DIMA 4F71A 2OFPA 1Q57A 2HA4A 2HF8A 2QIPA 3FDZB 2J0VA 2VCEA 3LU1A 3SQDA 4DBLE 5CBKA 1N57A 3D4IA 3GLHE 2IYYA 4MUGA 1N7JA 1MW8X 3OLXA 2WMDA 3HCBA 4EQ6A 4MIOA 4GNRA 2LV8A 5ALIA 3WX0A 2KB0A 3S2UA 3PR1A 3ZEIA 3SCZA 2WAXA 2R8OA 4PS0A 1RC0A 4UU0A 4MIYA 1WTAA 1DAGA 3VJRA 5DGIA 2MHCA 4HB3A 4BAGA 5BVHA 3Q7EA 3KB8A 4H1UA 3H42B 1N6LA 4YRTA 1JHYA 1I6KA 4JP2A 3DDZX 4N5MA 4YMIA 1TD1A 2ZPAA 4XPIA 3HR4A 1PR0A 3MBIA 4GYYA 4MGIR 2RFLA 3X2EA 4RJKA 3E1SA 2PSFA 3DGFC 1O1YA 2O2CA 2QSZA 7AT1A 2BN4A 4MKGA 2GAOA 1RHUA 2PS0A 2GEBA 3VM6A 2W4MA 1RM0A 2Q8NA 3CZ9A 1J0EA 1XNHA 4DVGA 4QHSA 1FDTA 2WKRA 4RH1A 2ZJZA 2P5YA 2XVXA 3DXXA 1N6OA 4UCWA 4HAWA 4XWYA 1H3EA 1Y1KE 2I67A 1H0KA 2O4UX 2VDWB 4B3DA 3UK7A 4QGGA 4CM8A 3CUWA 3NYRA 4JI1B 5KHAA 4O29A 3VH1A 3U4AA 3SVLA 1JPNA 2RAFA 1JFFA 1OJLA 5AVWA 2W98A 2EKLA 4URZR 5K3OA 5CIYA 5D3KA 3EDCA 2O8FA 1NR7A 2I55A 1H8HA 2DQYA 3T3IA 3O75A 2B7CA 2RJOA 2Q1YA 3KEGA 5K3EA 2E3JA 4HPJB 2PT9A 1O0CA 5JSQA 1G6HA 3PHCA 4ASUD 6CHYA 4NXMB 1KDRA 2FOIA 2ZP1A 3FYSA 4ZEVA 2GK7A 3EIQA 1R6VA 2G77B 1I2CA 1QGYA 3JVVA 3V7FA 4RVUA 4GLOA 4BE7B 1QE0A 3SXUB 2P9YA 4QFMA 5ED0A 1P44A 4FDAA 4ZXFA 3IUMA 2QQ0A 1QTQA 2QENA 3KLMX 2X1VA 3QTLA 2XMCA 3A1NA 3W5BA 2Q5QA 1L1EA 4G1BA 2I6TA 1MT3A 4C2BA 3I72A 2VJOA 3EC7A 1BDIA 2QX9A 4MVJA 1DC3A 3ZHUA 1QIEA 3N3AC 4QSHA 2YHIA 1DT5A 1KTIA 3UMYA 2JFYA 1G5HA 1F0KA 3HCPA 2OUIA 3KC2A 2PUBA 1D2EA 1L4KA 5A9TA 3TW8B 1BMTA 4OMCA 1G3RA 2UVDA 3UMSA 1W30A 4LE2A 2IGBA 2XNHA 3HN2A 1QRTA 3HK2A 2OM6A 2KLBA 2OP1A 4I1YA 1K7FB 2HCTA 4O3FA 1MB0A 1U0GA 4OTZA 4XJTA 2P2ZA 3QA9A 1X8KA 3WO0A 4MCIA 1IBLB 2YWFA 4RMNA 2R6JA 5KOJA 5KYKA 4OBEA 3B89A 1NXWA