2JCWA

Reduced bridge-broken yeast cu/zn superoxide dismutase room temperature (298k) structure
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
153
structure length
153
Chain Sequence
b'VQAVAVLKGDAGVSGVVKFEQASESEPTTVSYEIAGNSPNAERGFHIHEFGDATNGCVSAGPHFNPFKKTHGAPTDEVRHVGDMGNVKTDENGVAKGSFKDSLIKLIGPTSVVGRSVVIHAGQDDLGKGDTEESLKTGNAGPRPACGVIGLTN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CU/ZN SUPEROXIDE DISMUTASE
molecule tags Oxidoreductase
publication title A structure-based mechanism for copper-zinc superoxide dismutase.
pubmed doi rcsb
total genus 39
structure length 153
sequence length 153
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 1998-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 2jcwA00
3ECVA 1AZVA 1SXZA 2E47A 2SODB 1F1DA 1E9QB 1Z9NA 1PU0A 2JLPA 3QQDB 1CBJA 2Q2LA 2ZOWA 1TO5A 5KBKA 3ECWA 1OEZW 1N19A 2AQTA 2GBTA 1JK9B 2AF2A 1E9PB 2GBVA 2Z7YA 1PTZA 1XTLA 1COBA 1L3NA 2ZKWA 2ZKYA 1Q0EA 2XJLA 2VR6A 3PU7A 4OJAA 3T5WA 1F18A 1SOSA 4BD4A 2WKOA 3GZQA 1OALA 3F7LA 2Z7WA 3L9EA 2E46A 4A7SA 1SDAB 1XTMA 1IB5A 1RK7A 2WZ0A 1P1VA 1SPDA 2LU5A 3CQPA 2XJKA 3GQFA 1SXCA 4FF9A 1U3NA 3HOGA 1DO5A 1E9QA 1IBBA 2APSA 4A7UA 2AQPA 4U4IA 1YAIA 2C9SA 2VR8A 4A7TA 3RE0A 1CB4A 4MCNA 4N3TA 1E9PA 1JK9A 2AQNA 1F1GA 3K91A 3GTVA 2C9UA 3L9YA 1DSWA 3QQDA 3KH3A 1B4TA 1UXMA 5CU9A 1OZUA 3ECUA 2NNXA 4A7QA 1KMGA 1BZOA 1SXSA 2Z7ZA 1EQWA 1F1AA 3SODB 3GTTA 2V0AA 5KBLA 2AQQA 4A7GF 1B4LA 2WZ6A 4BCYA 3KBEA 3HW7A 1OAJA 3H2QA 2Z7UA 1SXBA 3CQQA 2AQSA 3KBFA 2ZKXA 2C9VA 1SDYA 1E9OA 4A7VA 2AQRA 1S4IA 1SRDA 2GBUA 2AEOA 4A7GA 2WWNA 2R27A 1SXAA 1YSOA 1IBDA 2WYZA 2JCWA 4N3UA 1E9OB 1TO4A 1UXLA 1QUPA 4BCZA 1FUNA 1PZSA 3S0PA 1EJ8A 1HL5A 4OH2A 1IBFA 1ESOA 4MCMA 3MKGA 1MFMA 1Z9PA 3GZPA 1YAZA 4L05A 3HFFA 3CE1A 3KH4A 3KM2A 2WYTA 1N18A 1IBHA 2VR7A 2K4WA 1JCVA 3GZOA 1HL4A 3KM1A 1OZTG 3LTVA 3F7KA 4B3EA 1SXNA 1BA9A 2WWOA 3MNDA 5KBMA 2WKOF 1XSOA 3H2PA 2WZ5A
chains in the Genus database with same CATH superfamily
1UYWH 1F2QA 3RNQA 3VQMA 3CC5B 3MLVL 4LVNB 1IGJB 1TDQA 5D2LE 3M1CA 2H2SD 3U36A 1PD1A 1QSEB 3N44B 4PWFA 3GRWL 3PWUB 2WQWA 2L4OA 4I0CC 5HY9B 4PJIB 4X80L 1WP6A 3LOWA 2EEBA 3DPBB 1G7JB 1WISA 1MCKA 1VADB 2WW8A 5ESVA 3WHXA 4PJEF 4R2GC 4LASH 3MV11 1GOGA 3BEVB 4DTGL 2HTKD 2YFNA 3EIFA 1TXKA 4CSPA 1CYXA 1UGKA 4X6CF 3VGAB 1JPSL 3RX8A 1KYUA 1KJ3L 4UV4H 4QY8A 2K3TA 2XI9A 1BFOA 2K0RA 2YAEA 2E9WA 5ICYA 3WN5B 4PRNA 3RTQC 2APXA 2WLLA 3QH3B 5FM5O 1I7UA 1R3IH 2VXQH 4D8PA 3PDOB 1T0MA 3Q5TA 1QRNB 4IRJA 4G6KH 3QUMH 3A3YB 1NFIA 1KGYE 5F7NC 4JEGB 1OHQA 1W91A 2IADA 3ZMRA 2V2WA 3DJ9A 5FA4B 4D9RE 5F7DB 1NAMH 3RHWK 1KB5B 4AXWA 5I66A 4WENB 2Q7AA 3BVVA 2NNXA 4TNEA 4I2XB 4MB5A 4EIBA 3K6OA 3SO5A 1KPVA 3MRCA 2VT0A 2Y7SA 3QPQC 2Q8BL 1NCWH 1HCYA 3W11D 4ELME 4JANA 3WE6A 3VSVA 3KW7A 3SJVE 5BUGA 1WC7A 2IH9A 3GSQB 3MOAH 1KTDB 2XVLA 2G4EA 3RWCB 1MIMH 4IGBB 3H4FA 2BZ7A 4RSVA 1AGEA 4Y4FD 1XH1A 3H7LA 3RIAK 3RRQA 2WLHA 2P80A 4P05A 4Z7WE 1NWPA 3DO7A 4I1PA 4UCFA 2P9RA 2YRZA 3WIIL 4BKLB 4O5LL 5BZDA 3DDFA 4CADA 1OF2A 2B9AA 2HMIC 4LPVA 3MRCB 5KVMC 4J3OF 2CLZA 2QZ5A 2J55A 4HHGA 1QFPA 2JB6A 3L3GA 4WTZG 5KOMC 1FE8L 5KYUB 4I3RH 3ZTEA 1A6VL 2AZUA 3ECQA 3TA4D 4JPWL 1A7RH 1IBFA 4FZEH 5H35A 5T3XD 4JX0A 2QSTA 1G4MA 1A7QH 5IB1A 1PG7L 2IAAC 3O45A 1WZMA 4KRPC 2BDNL 4WNSA 1U2CA 4P0DA 2ICEB 1MW1A 1PFOA 4TQIA 1QKZL 2YK1L 3R18A 1UZGA 5ANME 4QHKI 2ITFA 4IDJL 2DI7A 2IDSA 2BVPB 2CR0A 2C5DC 5EF2A 3MU3A 3GUFA 4XMVA 3M7OA 1OAKH 4X4MA 5EF3A 1XXDC 4NKMB 5I6NA 4TSAL 2QLYA 3L4ZA 3AS2A 1JD9A 3GO1L 3L95B 3OKOB 3BRDA 5JPMB 4OZGE 5CJBA 4ZD3L 2EUVA 3NCXA 4EIZC 3OWEA 5DS8B 1G1YA 4FYSA 3HBQA 1O6SA 1TTRA 1K4CB 4K71C 5C0BB 4L8BB 3WFHA 1MIEH 3PWLB 1XCQB 3TF4A 2VR6A 5DVNA 3NCEB 4YDKL 3MA7B 2WQAA 3T71A 3LHAA 3WKMH 3M1BA 3FQWA 4IBLT 3G08A 3BVNA 3GKWL 3IJSB 4H20L 2QDWA 4YJZL 2NZ9C 1OALA 5IROC 4DIXA 1NIBA 2V2XA 5KSAB 2P5EB 2W92A 3JWNH 3HVDA 5GS2D 1FLRL 5CD5C 1FPTL 2AABL 1X5FA 4AE0A 4U1HA 4BFRA 5IREA 1R3IL 1MHPH 2VXQL 1ACYH 3LKOA 1CE6B 3MXWH 4X99A 5EC1A 3EH3B 3TVMA 4APQA 5I19H 1IBBA 2BFVL 3F12A 3VX0A 2F53A 1PL3A 1AIFA 3QCUL 4TYUA 2EIMB 3T3PB 2VR9A 4FA7B 5AEAA 3O3EA 2NYKA 2ZNWA 2OR9L 3UZEC 2VWEE 3IMWA 2ZCLL 5T5FA 3LKPA 2F8OA 4MKTA 1K85A 1A9BA 2B0SH 4ZOEA 4KJWD 1QLEH 1UXMA 2JJSA 2JWYA 5CILL 4XO3A 2FYYB 5ITBH 4ZNCD 1AE6H 5L9DH 2HWZH 2NYYC 4W6YB 1OGAB 4NB7A 1O6VA 5DWUL 1S7WB 5IR1A 2COVD 3WDHA 4G8EB 4KV5E 3QULB 5T1LB 4IBYA 4KMTL 3HAEB 3D30A 1IV8A 4YAQB 4JFYA 1BVNT 1NSNL 5ANMA 5AVYB 2AJUH 1CDYA 1FAIL 1NM4A 5KSVB 3RKDC 1AZRA 1AR1B 1U8JB 3LV3A 4RGNC 1IBDA 1CXFA 2BFVH 3TFBA 1JZ5A 1I8MB 3BP4B 2APBA 1ZT7B 4KY1L 1QSEE 2GCYB 2N0MA 4ODSH 1TPXC 4PJ8B 1AQDB 3CBRA 4UNIA 3BUPA 2UV3A 2W9DH 1F4HA 2WLJA 5ID1B 3D08A 1LEGA 3LZNA 4TXVB 3G6DH 2BHUA 3AS0A 1KCRH 5ICUA 4HEPA 4MS8D 5D7JD 2H2PC 3N1QC 3MV8A 3AROA 4JM4L 3ZDWA 2MTPA 2I69A 2Z35B 4JFSA 1UJTA 2OSLA 5CIPA 5KVDL 1ZA3A 1ZKAA 3K72B 4G9FD 5AWNH 1RUKH 3EYVB 2KI6A 3FCBA 5FCUH 1ILUA 4XP4H 2WWOA 4JDZA 1EZUA 2Q86A 2D03H 2NY5C 2RGSA 3GO1H 3NJKA 4HGWB 5EZJA 2EDFA 3P3UA 4HS6A 1BZEA 1MREH 3DI2B 1PIFA 3HC4H 1NGYA 4P04A 3U30B 5IQ7L 1U8PA 5AW8B 4PD4J 3OPZL 3EDKA 5F9OL 3AM8C 5CP3A 5ID0A 2JI2A 1QUNA 3MXVL 3GMMA 3HPJA 2JXMA 5CN2A 3L16A 3E9UA 4OUOA 1B90A 3QJQB 5E8OA 2HZHA 3F3HA 5J6HA 1OV8A 2V9TA 5C9JB 3QDMA 3ZKMD 3GHEL 1W0WA 4BK8A 5HYJE 1RCYA 4UU9B 2EVIA 2IFFL 1RZFL 3BP7A 1W6WA 4KTDH 1Q94A 1TVHA 2RB8A 4FCAA 4G80B 1I4FB 2EVGA 1CE1H 4OZIB 1OTTD 3FH8A 5DJXB 4RFNB 1T1WB 4AL8H 3EYOB 2J6EA 1J8HA 1KXHA 5AAPA 1JMXA 3VYOA 1AQHA 1JG9A 2NCMA 1M9WA 2ITCB 4PP1C 2DRUA 2X41A 4OBSA 5B38B 5CJOH 4Z7NE 1EIBA 2OTWA 5AZ2L 3LQZB 3QJHB 3PGDB 4MRCA 5C0NC 4PJ5D 1S7XB 1MG3C 1I1YA 2ED8A 2DQIL 5DFWH 3WKPA 4N5ED 5JIIA 1XGZA 5L2KA 5C8JB 2NQDA 1SHXA 1T22B 4Q4EA 3RVWD 1KN2H 1XSIA 1HU8A 1E6JH 4X50A 4AQ8A 2FECL 3MDJA 1I8KA 1SJXA 1UOLA 3CX5J 3TZVD 5JNYB 1DJYA 1MSPA 2I9LA 4ODXB 4UZSA 3VWKB 2AV1B 3CFCL 5L2JB 4WKZA 4GIAA 4AEHH 4FQXD 4M3JA 1YEIH 3BPOB 4XO8A 1FYTE 1T22A 2I24N 4G6MH 1IGML 2M26A 4K15A 4Q14A 1BAFL 4QRTB 2VIRB 4WTZA 3PV6B 4IDJH 2E4TA 4UQ2A 5CBAB 5K1JA 1CGXA 2CGRH 3QUZA 2P47B 2RFXB 4JM4H 1KOAA 3VMPA 5IMMA 4KNUA 4U1GB 2WAQA 1V7MH 4FLOA 4ZFGL 1MFAL 2A4EA 2AJZB 1H3WM 4N6QA 5CUSL 3TBYB 1Q4NX 4AI7A 3I2CL 4NWUH 4JPVL 2J1KA 5K9JH 1KZQA 3SE9L 5EF0A 5FO9A 2J1XA 3K8LA 3FT4A 1ZLDA 1Q72L 2Y1AA 5AAMA 4R7NA 4ODTH 3MLZH 1JGEB 2Z8SA 1KFAL 3QXDA 1QTYT 2QBWA 1SMAA 3BP7B 1HQ4A 4HUXB 1G7LA 3MAWA 3DMMD 2RALA 2X2UA 4L1HA 2J6EL 5TH2B 3WHE0 2AANA 4TUJB 1QI4A 4PG2C 5CZXD 2CQVA 3CLEL 5LGJB 2ZD0A 2PF6A 2GB2A 2EUWA 1XTLA 3GDCA 2P8MB 3HN8A 4Y2DA 5CHNB 2FECI 3SGDH 4HAFA 1PLAA 4Z7QE 3S8FB 4JQVC 1LEKA 3TYFB 4HD9A 4RMQA 1A1OA 4EN3D 2E7DA 1HIMH 3EO0B 1WUZA 3HI6L 3NCMA 1CXIA 3GZQA 4P4KC 3SZKC 4EKXA 2Y5EA 4DO6A 2A1WL 3QQ3B 3GBDA 1DBJH 2R4SH 2Y7NA 2LU5A 2A5UA 1UM5L 2NX5E 5FOBA 5C3IA 4BFJA 1PQZB 4BSWA 3GDBA 1XXFC 4W4OA 1CFTB 2X1XR 5HDOA 4L1LA 4EVNA 1U3YA 1YEIL 2X70B 3L9BA 2W9EH 1A6UL 1E7VA 2ZTBA 1NWOA 5CJOL 4XRCA 1OGTB 1HOCB 4MBRA 2FLRT 5FHBH 4IKJA 2I25N 4L2LA 3RNKB 5DQDH 2Q9OA 3UYPB 3QQDA 3I9IA 1ET8A 4OSUL 3K3QA 1ZVSA 2JTYA 1UM4L 2XACC 5GJSL 2RBLA 1FYTD 1KCBA 2OFQA 1ZLVH 4WHTA 3VH8B 3MMEB 4HKBA 4JFOA 4Z7NF 3HBGA 5I1EL 5E56A 5KVFL 2EVJA 3PQYE 5HYJD 1VESA 4Z3EA 1HT6A 4TLSA 1KBKA 4RRPG 1GGCH 3LEXA 4KH2A 1HH9A 1U33A 3FU5A 3MJ9H 1A6WH 3ARPA 2BSTB 3BEWB 2GJ6B 4ZUSA 1ZLUH 2J88H 3MXVH 4NZJA 2DTMH 5IR1B 1LGVA 4C58B 1PZDA 4IRJB 3RWHB 4N2MA 1FWXA 2YEZB 2XWTA 3AMLA 3BAYA 4KXAA 2UY6B 5DTFA 2P52A 4HIEB 4RGND 3DROA 4I87A 1I7UB 4WWOA 5F70A 3JV4B 1JPTL 1EBAA 5IESH 5MENE 4LL9A 5DUJA 4WHCA 5HHME 5IF0A 3L1OH 1TCMA 3JWOC 4YS4A 3VXME 3MI6A 3O6ML 2VDNL 3TCLA 1TZOA 2NY3C 4P2OC 3U46B 5CD5D 3UPAA 4WAFA 5GIRA 3ZO9A 3GK8L 2JMRA 3WLWC 1FQ9C 2BOBA 4OF0A 3BN9C 2VZ3A 3F7VA 2AJVL 1QABA 2YLHA 1WCBA 4X5QA 3OZ9H 4V1DA 3WFDL 3LH2H 1U8QB 3N41F 1XR9A 2ADFH 2WMPA 3GINA 5LKNA 2NNCA 2WO4A 2XWBA 3ULVE 3HLAB 3VD3A 5FGRA 4NP9A 3U9PL 1A4BA 3S4SA 2DQHH 1YPZF 2KC0A 4XMLL 1P4BL 1S7SA 4PJEA 3H55A 1K72A 4DPRA 4KQ3H 3TWCH 1JUFA 3U4EA 4MJ6B 3H7BA 3RFZA 4NZUL 4R2GD 3UYRH 2BSDA 4J3OD 4FZEL 1RQ5A 2F15A 2OXGB 4WI0B 1KBBA 4CNIA 1H3PH 3QARA 2AGJH 4GW5A 4EOWL 1QSFD 1HSBA 1U3HA 2FX9H 1RD6A 3KGRA 4PJFA 5CGMA 5IV2A 3K4ZA 4NJ9L 3KR3L 4NZTH 1LO4H 2VLME 2ADGB 2FEDD 1SUJA 2NDFA 4EI0A 2UWEA 3AFLA 2VRAA 4HJJL 3D85D 3WSQH 1X7SA 3MOAL 1Z0MA 3PWPE 4Q7DA 2EIBA 3BAJA 2OP4H 4U7MA 2CLRB 2Z65C 2AV7B 2EE6A 3WHE1 4JKLA 2GJRA 2H32A 2VISA 5GJTH 1TZIA 1XGUB 3RZCA 2L3BA 1WGOA 3MV7B 1NMCB 3H85A 5KANI 1FFOB 5T33H 1NCIA 1BJ1J 1BZ7A 3S3CB 3MLXL 3JVGC 3SDDB 5SWZD 3C60D 1PJ9A 5GS2H 2KLSA 1KWGA 1CURA 2KQMA 3D25A 2R2HB 2B0SL 5A2CA 1VENA 4HFWB 3I74A 3A6CL 1NDGA 2Y25A 1HXMB 1Q9WA 2EINB 5E8EB 1KTDA 2AVGA 3RWCA 3B2MA 3H9HA 5C0CA 3G08B 3OAZK 3QEGL 2E56A 1UOWA 3FT3B 3L8QA 1Q38A 4ZBJA 5DD3L 5FV2A 4ZUTA 1V3KA 4KUCF 5LAPA 3FTGA 3QO0B 3J8F7 5K9JL 1F4YH 1A1NA 5CO1A 3V0EA 4N68A 1K4DB 1ZV2A 4PRHD 4AGPA 3AWFA 5F0JB 2CO6B 2CRIA 4MA1C 1AQKH 3EYVA 5EBMA 3FO2A 3MCKB 3UJTH 2HRGA 2YQ3A 2J71A 5F44A 3APMA 3EBGA 1BVKB 4L05A 4MLSA 2DQFA 1XF1A 3ZR6A 1PSKH 2FQGA 1SBBA 1T0NB 3S36X 4ECNA 3ZE0B 5EC2B 5HHPB 2WXJA 3QJFB 1X7TA 1K5NA 1LP9A 3BW9A 1F3RB 4KQ0A 5LNEA 1DBAL 3OKNB 4XH2A 2XPGA 5I18L 4GUPA 1FFQA 4XWGH 2DQTL 2PPFA 3TJEH 4LARL 3WNIA 3LEVH 5LLIC 1DBBH 3Q5YA 1A9VA 5DJXA 2H0EA 2KL6A 3MBWB 2BPBA 4XI5D 1A14L 3V0VB 1XF4B 4XXWC 4N0UE 5EC2A 4LSVL 3J7HA 3LN9A 4YSOA 4AMKL 2O30A 3ME0A 4YHPB 4XN7A 1BPLB 2WN2A 4XPTH 2A9BA 4GI8A 5DC0A 4PS4H 3FO2B 3FO0L 3MCKA 2JSFA 4A2HA 2V9UA 5FC9A 2LAGB 2G60L 4G6AD 1MRFL 1O75A 1DP0A 1KLGA 4Z7WF 1QFUH 2P8PA 4DVBB 4UT6A 3BKMH 2P80D 2I27N 4HEME 1WA1X 4NJAL 2J8HA 3P2DA 1J5CA 5B1JC 4F8TA 4PG2A 1UA7A 3B2VL 2K9FB 5HVHC 5D1ZB 3LEVL 5D9SB 2K8QA 4HFWA 2YPLD 4XHJC 3VGBA 1U93B 2EVFA 1EHXA 4BIKA 1F1GA 1IEBA 1DE4B 1I9IL 3NIDE 3OTTA 5J89A 4FQXA 1JWUB 3QUHA 5EORH 2O5XL 5J3HD 3QWOB 2YD4A 2WLIB 2FT8A 4QHPA 4NZFA 4AWJC 4G9DB 5AD0B 4HQQL 4Z7OB 2E7CA 1NKRA 1I7TB 2VJXA 3X1BA 4P9MH 4X4YB 1EDQA 4JO5A 2ENJA 1PCXA 2F2HA 2X4NB 4FE9A 4AYMC 5C0RH 2Z4TA 5C0BA 5DC9B 3GPSA 2A9NL 2GBAA 3P30H 8PAZA 4NIYE 4FLSA 2XXGA 3RDTC 4GKLA 3BYTA 2UWEB 1WF5A 2WKGA 5HHNA 1NIDA 3DTDA 3MLTB 4KI5C 4N3UA 1FNSH 2XKSA 5AW9B 2ODIA 1F42A 5SWZB 1UACH 1YMMD 5ALCH 4K0OA 3RDTA 2TSBA 2OW7A 1I8UA 2DLEA 3T3PE 5J6GA 3FYIB 4A2DA 2W5PA 2CKBB 5IB4A 1HTYA 1M05B 4ZFOB 5KYWB 4J6RH 2VN5A 4DGYH 2B16A 3AQXA 2DLGA 4MVBC 1CICC 4GYBA 5I76A 4FTVE 4NCC2 2DJUA 3D85B 3KLDA 2K4AA 1SQ2N 4UQAA 3VYNA 4B9YA 4LSQH 4CVZA 4N2CA 2CJUL 2MPAL 3U7YH 3QUXD 4HSQA 2X4RB 4XZUB 1KEML 3CFJB 1EZVX 2C3HA 1P4IL 4FHKA 4A63A 3O41A 2EDEA 5D6CA 5LAXA 3UTTE 3TEUA 2ZAHA 4M1GH 4PJXF 2X40A 3LS4L 5KBKA 1JYXA 2WSKA 1HWHB 2H1PL 1RSFA 2ZF8A 4M7KH 4XMXA 4RBPH 4HZLA 2PO6B 2FWSA 3LZQA 3K5RA 5FHAH 2WIMA 4HMCA 2JFCA 3PU7A 4NC1C 5D7JA 5EZOH 5TPWH 3WIFB 4DP9X 2BNRD 3LD8B 3V5KB 2HJLB 2WBJB 1JDCA 4ILDA 2P8PB 1AANA 3QBTB 4PJ5E 4Y16C 2DYRB 4HOXA 1PY4A 5DHYA 3TN0D 2WB1A 1KCUL 1KN2L 1SDAB 3LNFA 4DQAA 2NXYD 2WBWB 2WZ0A 4FFYH 3VJ6B 2YD6A 3C6LD 4MRBA 1TIUA 4IRSA 1AHMA 2IXQA 1V05A 2FJFA 4IMLB 1YUKB 2GJ6A 1K8DB 2BSTA 3ATAA 1J86A 1MFUA 5D72H 3RE0A 2VABB 2SEBB 4BWWA 1LO4L 5FW7A 1DJWA 4LNRA 4R0LB 4YFDB 5DJ6A 4JCMA 4F15B 2CHXA 1K5NB 4GKNA 1KB9K 3ECBA 1WIPA 4X98A 2H1PH 3VUAA 3JT2A 4ANUA 3KWUA 3WNNA 2PO6D 4I13B 5I8CB 5K59E 4JRXA 4KH9A 3RTQA 1Q90A 2BO0A 4F7CB 1Y07A 4N86A 4JFFD 3Q1SL 2R23A 3ZGHA 4L5FH 4PGDA 4H88H 4HJGB 4G1EA 3PDDA 4ZUWA 4E41A 1KPUB 3A21A 5BV7L 3L54A 1YEGL 4G7VH 3TBBA 3WUWG 4FL4C 5CEXA 1UHVA 4PJIA 7TAAA 4CADB 4YSPA 4W9LC 1DVFB 4MJ5B 2W1NA 1SZNA 2VR3A 3NYKA 4JJ5B 4MAUL 4XP9L 4EDWH 4H20H 3W9EB 3DGCR 2ZWNA 3B8SA 4Y8AA 1G7HA 4Q0XH 4D2NA 4NENB 3BUQA 5HYSB 1YYLL 1M53A 1WWBX 5FR3A 4C4KO 2QT6A 2F8IA 4UOZA 2ZXCA 4GOSA 3DK0A 3IDGB 4GQ9H 4EIGB 1JZJA 4I3RL 1AD0A 5F97E 5EEVA 3ARFA 4F8NA 1NBQA 2OR9H 2W81C 4IBTA 3BSZL 4X8CA 3UMNA 4F91B 1TZHA 1JPEA 3FS9A 4FXKC 4K5OA 5BRZD 1S7QB 3TU6A 1CDIA 3IFPA 2KMWA 5C08B 5F3FA 5HGAA 4HXBL 1VJSA 3OM3B 4LCVA 3QISA 4UB0H 2AXFB 5D1QB 3TBSB 1JK8B 3VO0A 3HPLB 2HT4C 4BFBD 4U6HB 3CMOL 5DQJB 4MAYD 1R33A 1FVCA 2KS0A 1IIIA 2EDYA 1P2CA 5GSRA 1O7DC 3K6SA 1VKXA 1YN7A 5JLZB 5D4JA 2R56L 5HPMA 2HVBA 1RK1A 4LZKA 3J07A 3QWNA 2ZOLB 2ZT9C 3TCTA 1IMHC 4FP8L 3S34H 2LR4A 3WY4A 3PWJA 5E2WH 4YFLI 2ENYA 5I1GL 4P2QB 2F1BA 4JCLA 1WAAF 4QHMB 3FCGA 2ROXA 4XVTL 2Q8AH 4E0RA 2OQJB 4I9WD 3IMSA 2OCFD 2FGZA 5FUCC 3WKYA 4J3TA 4OFIA 5IJKC 1YNKL 3MRDB 2PR9A 3H7BB 4XN5A 4FQPA 3GMOA 5BNXD 3PJSA 2R1YA 2FWOB 2CKNA 4R3SA 2C9XA 2WBJD 1N70A 3IETA 4EI5B 4K9EH 5HHXL 2A77H 1OAXH 2A83A 4JRXB 3RTQB 3ECUA 2CLVA 2VDPB 3MLRH 4HV8A 1XD0A 3ULUF 1WBXA 3B3BA 4KNQA 5I1KL 1E4KA 2BW5A 3K1DA 4L0YA 2X7LA 4KKAC 1RZPA 3A6BL 4DGIH 5MEOB 3UAAA 2ZAGA 3GSWB 5EORL 2ITCA 1UH2A 4OLYL 2WJ7A 5AB2A 1MCCA 4W9FC 1IQWH 4RNRA 4MZIA 5IM7A 1ZHBB 4QLWA 2XXFA 4NN5B 1UGNA 4LLUB 3V0DA 3OB0K 4XWOC 2YPKA 3N50A 2VDPL 3GLAA 3OHXB 5DUML 5JHMA 1EGJH 4K94L 4YHKL 4N2OA 3BDBA 4AIZB 1QFWL 3TGXA 3RY6A 1NAKH 3IMRA 4XOEA 2F19H 4Z95L 4JO3H 1O7VA 2UY6A 3ARUA 1DBMH 4L1SA 3ROLA 4LCUB 3ULVD 3WO3B 1BZ8A 2DMBA 2GT9B 1IC5L 2VLRA 2VOTA 5IJVB 1BHGA 5FUZL 2YXVA 1GAFL 2EDNA 3B9DA 2G3ZA 1DQMH 3GC3A 3MR9B 4Y4KD 4AYBA 1C16A 4QRSA 4XN4A 1P5UC 1VCAA 1UUSA 2YPLA 3BE1H 2Y1YA 3PXJA 3O6FC 4AVIA 4FABH 3UPRB 3UC0H 3VB9A 1DSFL 1MY5A 3AS3A 1DQQA 1T4WA 4OCSL 3V7MA 2ORBH 1E5BA 1P0SE 2R15A 4X6DE 5BRQA 1DVXA 2OYPA 3ULSB 3GLDA 1ASPA 3U4BH 1XWVA 1UWEH 4GRLD 4NC0B 2GIMA 4LPWA 1MJJA 1OVZA 2SODB 3HUJB 1TJXA 3B34A 3FXIC 4JO2H 4MQXC 1GGBH 3QQDB 3D85A 1WSST 2JJWA 3PREA 5DJ0B 4YL4A 4ZDHB 3DOSA 4JKMA 3HS8A 1P1ZB 1OTUD 3D34A 1RVFH 2F6AA 1MWAA 3K6IA 2Z7YA 4MSWB 3ZE2E 4HJ0D 1UH4A 3RY4A 5IJDC 3NFNB 3E1F1 2GSMB 3SDXF 2E3VA 4IBSA 4KTDL 1IBGL 3ATFA 3QI9D 4AY0A 1JHKL 4D0CA 5KUKA 3MNWB 4MD4A 2CCLA 1N64H 3RB7A 2O6CA 2XPYA 1JHLL 2VR4A 3HZVB 3ABZA 5LCVL 2YPLB 4MXVE 3HHSB 2RQ8A 2GCYA 3CZFB 1OTTC 2DAVA 1QFWI 3V6ZB 3MLVH 4RZCB 2H1XA 3AREA 3WNOA 1UM6H 2GFBA 1YEDB 5H2BA 5D7SH 2K9UA 1CE1L 4FMKA 3VW3L 5AYQA 1NCCH 3ABLB 5C0ND 4Z3GA 1D5MB 3PGCA 1W72B 4GRWH 1INEL 1IUZA 4MXWL 5D7LD 1GGTA 3K91A 5D7IF 2Z6FA 1JK8A 2FGWH 4NM4H 4LEXH 4MVBD 1NUDA 3HE7A 1B2YA 1G0DA 5HHMB 4PRHA 3X12B 4R2GB 3RTLA 3FJTA 5AZ2H 2VXUH 4TVPE 1KJ3H 3QUXC 1U42A 3BLPX 1SN2A 2ZPKH 5E5MA 4P2OB 5HPOA 3CFNA 3NRPA 4E42A 3AGWA 3QJSB 5L4JA 1NC4A 2K7PA 4I4WA 1CD9B 1ZTXE 2D3LA 2M83A 3HJEA 3KE0A 3QVAA 4A55A 7FABH 2J2ZA 4FQXC 3WJLC 1X4YA 4WIQA 3S3JA 4JM2A 4YZFF 5JHLH 3E8UL 1AP2A 5F7MC 3V95A 2PXYC 4S10A 3PDGA 5CBAA 1BEYH 2IFFH 4HZ1A 2UVEA 5IK3A 4W4NA 1NLBL 2EC9U 2NX5B 1I1AD 5J12C 3ZBMA 2VXVL 5I74C 2CCVA 1X9RA 4AGNA 1M6OB 5LQBL 1DJHA 1KY7A 4OAWB 4BXSV 4ODWA 5FKAB 3PL6C 3POCA 3MRJB 4J3BA 1E8ZA 2E27L 2ZX5A 3T0BA 1DSYA 5JA8B 2OMUB 3WTSA 1HH6A 5HDQH 2DOCA 2UZXA 3QDGB 4GLRH 1E7UA 4XXWA 2W9LA 1MQ8A 4BGDA 2HKHH 5I8EA 3SB3A 3C9NB 3GXPA 5EMYA 4XPBH 5F0MB 2XZAL 2CHWA 2H4EA 3FQ2A 3EDEA 3MODH 4W9KC 5BUAA 1RUAL 4DN4L 3A5VA 4ODUB 3SDDD 4Q9RH 2PCPB 1G5GA 3CFCH 1IVLA 4OZHB 3LZFL 1HX0A 5CGTA 1D6EB 1BF5A 1XVSA 3DV6A 3AS1A 1NQBA 4NSKA 5GRJL 4Z3FA 1T1YA 5IFJB 1EFXA 3PV7A 2FNBA 2XTLA 4Z5RB 4UUJB 4HSAC 1EUUA 3VWJB 3MPCA 4GSUA 4XNXH 5I1HL 4PJCE 3MQIA 2NZIA 4TSCL 1X5IA 2JKJA 3T0XA 4R83A 3IGKA 3KYNB 3TBWB 2DLIA 3TZVA 2G2RA 2Z91A 1JHTA 4AG4L 3RAJL 4OCWH 4AZUA 3ZXAC 1K3IA 1T1YB 1CXKA 4JRYE 4JPKH 4MA3A 4L1BA 3P4OB 1QASA 3GTVA 2NY0B 1QSFB 3AT8A 1N64L 4G8GD 2ADFL 2KH2B 2OJEA 4NDMA 2D3VA 1WQVT 3V5HB 1NUNB 3S5ZA 4FZ8L 2F7PA 5BO1L 3KW8A 2ENQA 5HHVH 3AY4C 5KBDA 4LRNH 2ZYSA 3DV6B 1BD2A 5AALA 4PJGB 5JHDE 1JXDA 5CEYB 5IHZB 3H2QA 5D7SL 5CCHE 4IYKA 2EYTA 1IGCH 2K6YA 1JF5A 3JWDH 4XVUD 5CIPB 5LDUA 3ZE1F 1CS6A 4OV6F 1E27B 4ZYKB 1LDPH 3I6KA 1S3RA 3NABL 1EVTC 2QQNH 2X1PA 2O26U 2YR3A 3FTXA 2WYZA 3VGHA 4J8RA 4PGBA 3ZHKA 2MJWA 5C0IB 4WUUA 4HT1L 1OB1A 1KIQA 4LGPB 4R9HA 4HIIA 4JQIH 4OGXL 4XC1L 3P9MB 4JDTH 4MMZB 4FJYA 2IXQB 2YGVA 4IMLA 5HI4C 3FRPG 4P2OD 5EOCH 1XSKA 3I6SA 1ANUA 3X14A 3KWXA 4A6YA 4R84A 4XVOA 4DERA 5CKAA 3U6XA 1ZK5A 5E6ID 2HVJA 2Q6WB 2G4GA 1YY9C 3FN3A 3O9WD 3ZKQD 2HAZA 3R1GH 4UILL 1GY1A 2X4UB 4DW2L 4IRJD 2CXKA 3WAJA 3LB6C 1AD9A 4Q6YA 4YDMA 3VXPB 4BDVB 1OWWA 3K80A 3K81A 4BQ6A 2F5AH 1A9EA 3JVGA 2E0PA 3RB5A 1L5GA 5L4FA 3NABH 4F7PA 5B8CA 5C0FA 5IEKB 5EF1A 2DMHA 1L9PA 1VEOA 5LAXB 4FDWA 4JB9L 1J18A 1KB5L 4XCEB 1NFAA 5JW4R 2V2XB 4TSBH 4KJYB 4KJQD 2G0KA 2E27H 3QEGH 5F9JA 2WV3A 3L5WB 4JFDA 5HGHB 4XBEH 3L3JB 5TE6L 4JRYD 3QZWG 4LU5L 3OGCB 4DWHA 3U7WH 1NJ9A 4FI8A 2WPGA 1P6FA 1T7VA 5KSUA 1BFVH 2FJGA 2I7SA 2X0UA 1C7SA 3C6LC 3FOMB 4LDEB 5DTFB 3H3KA 3QZWB 5AVSB 3ZHFA 4CILA 4FS0A 1Z1WA 4OZFG 5AYUL 1XCTA 3X3FL 4JFEE 1U8LA 3NJHA 3QZNA 5DURB 4PRPB 4KK8C 5JHDD 4I1RA 4K8RH 3QZMA 3VG9C 4F2FA 4S1QL 4DUWA 4M9OA 1URZA 3B5GA 4HOWA 5GGSY 4AQ1A 3VRIB 2YN3A 2R56H 4M8UA 5IHUL 1JRHL 3MBXL 5TE4H 4WO0A 2CUMA 3UAFA 4KZEL 3JTTB 3VCLB 2X10A 4WU5A 4MXQC 3TA3B 2J8UE 1JZEA 1ZE3C 3UYPA 4DVRH 2W94A 3D7PA 1NFDA 5A16B 2HTLC 3RA7L 3OKDA 2CRYA 1ZPUA 1IC4L 2AXGA 3ARFD 4FTVB 3HC0B 4RWYL 1AS6A 4ERSL 1KCSH 5L2KD 5KOVC 4JS7A 1JWUA 1QBML 4Q97A 3RWDA 2ICEC 1IT9L 3EXLA 1AXIB 1JPSH 2CO6A 3LY6A 1AXTH 3QB7C 2AFNA 3ILQC 4B3VA 3UPRA 4NIKB 2ZUQC 3ZKMC 4XMKL 1HEZA 3GSQA 2CO7B 1G9MH 2YGPA 4JO4H 5IFHH 3OLIA 2EUXA 1TKWB 3D69A 1VPOH 4M5YL 4GAGH 1I85C 5D2NE 3D0LA 2VN4A 3MUGB 3CMOH 4H1LG 5JORA 3QEQB 1GCYA 4KDVA 3GRWH 4JRXD 3EBIA 4KKCD 3RTQD 5C71A 4JHBA 3QEUA 2HT2C 4NPJA 3N91A 3WIHH 4OZHF 4TUJA 5E0QA 4EBQH 3HFML 1TJGH 4H8HA 5AVZB 2ENPA 3T4AA 4Y19D 2Y7QB 4LESA 1RUQH 5DHYB 4Z7OE 4HOMA 1PBYA 2P5EE 3D2UD 5FA4A 1E6OL 4PRNB 5TDNB 3EYFA 3KPPA 2WWKT 4ZW5A 4JFDB 4EO5A 3D87B 2C1PB 2O5YH 4WTQA 3FUHA 4D8PB 3IJYA 1G4RA 4LU5H 4OW6A 4G9FB 3VXUA 2QVTA 4KO7A 2VKWA 3DX9A 4YBQC 5FM8A 3AADB 3K1KC 4ZXBD 2AJYL 5AOIA 4YO0A 1SOSA 2XU9A 5CJQL 4DGUA 2QEJA 3ZOAA 1KG0B 2C1OA 5D1QD 2NY6C 1RK0A 2JH2A 4GW5B 3I75A 4Z7OF 4R3SB 1IEHA 4FKEA 3W0WA 4GRMA 3J2PA 4L4VA 1LO5A 1S9YB 1GGBL 2BIHA 1F97A 4YL9A 4JZNA 4OZGF 3EGSA 5D1XA 4NAMA 4S1QH 3WKML 5BRZB 1I9JH 3POHA 4GG8B 4M43L 1AP2B 3BWUC 3ZE2B 3WKNA 5BZWB 4K3JL 1F86A 3G6JB 2Z0UA 5EOTB 3P73B 3MV9D 1AGBB 5MEQA 2XWRA 4K9JA 2ICWB 2P24B 5AYUH 3TT3H 3IJ8A 5I8OH 3AXLB 3FL7A 4YDNA 2PWEA 3O8XD 2QGEA 5SX5K 2JQZA 4FQHB 2A9MH 1FLTX 5HXMA 4EBQL 3WENA 1E9OA 2PW2A 5I1AB 7CGTA 2J88L 3E2HC 4MBOA 3B9KC 1A64A 3QNXA 4J3UA 1E90A 3SDDC 2ZONA 5C0CD 4PY7B 2GITB 4WI3A 2ALAA 3B6SB 5FGBA 5PAZA 4KKZA 4DJMA 5BPPA 4R96A 5EOQL 4MZRA 3IFPB 2JQMA 3TASA 3CDZB 4HPOH 5IESL 3GZKA 2I9TA 3DJSA 3MRFB 1JV2B 2H6PA 3P69A 4AX3A 2DQUL 2RFXA 3MOBL 5GSVA 1JFQH 5AUMB 1GW0A 4P5SA 4WO4D 4JK0D 1KEGH 3FTYA 1IBHA 2CBPA 1U3HB 3GZOA 2WB7A 3BIBX 4RAVA 4GAYA 1AOHA 2YIHA 2ZCKH 5DMJB 5AQ0A 4CC4C 3FSZA 1U95B 2H2SC 1BJ1H 2WZ5A 5DHVH 4KZDL 2BVOB 2Y3NA 3LXUX 1PAMA 3CZJA 2VAAA 4QRUA 3WEXB 4DZBB 5CJ5A 1H3XA 3T9WA 2Q2LA 3ZRCC 1NC2A 4AL8C 5IFJA 1TFPA 4LFHG 4WFGD 2HUEA 2FSEB 3BD3A 5JPNA 2J1YA 4PJAA 4OU3A 3ARQA 4AEIH 2DQ6A 1ECZA 1R19A 2DWXA 1XDTT 5DRWA 3ZSSA 3VXSA 2YC1B 3B9KA 1A7PH 3TEYA 2BM3A 5B1JA 3J27A 3H9SE 4PWJA 3MLXH 1A6UH 2AJ3B 1FNSL 2MRYA 3KDMA 4M5TA 1QLEL 5IQNA 5LBVA 3WNPA 4Z8FH 1KXQE 2X38A 1ZJBA 2EAEA 2EEFA 3H9SB 1OE3A 5EWIL 5CEYA 3BUYA 3KGUA 3DRTA 4PJGA 4PP2B 1SDDB 4FF9A 3U9UB 1EH9A 3I6GB 3L2NA 1MWAL 5T1MA 4WU7B 4BQCA 2RHEA 4DQOH 4Q6KA 3V7AG 5DJ6B 4HK3J 5EU6E 4AKQA 4G7QB 4PHZA 4TUUA 3SDCA 1PZ5B 1CQYA 4LLDA 1A4KB 3MRHA 2K70A 4Y9CA 4HUVA 1BLNB 6CGTA 8FABB 3VXUE 3EHBB 5SX4I 4TVPD 5LCVA 1WT5C 4MNHA 3TL5A 1G9HA 1SJHA 5HGGS 3LEYL 4M56A 1LNUB 1JFQL 4L5FL 1JGVL 4R4BB 3NBNA 2DWDA 1UXWB 2AJVH 5GGRB 3T1FB 1AYRA 3HI5L 1HJBC 4KNTA 3FT9A 1N6QH 5I17A 3VU2A 3RJQB 3AGVA 4G42B 3DIFA 3KG5A 5LN4A 5D6CB 2V9QA 2X9XA 4WNJA 4MXQD 2BCMA 2WQUA 3R4RA 4HZLB 3PE9A 4H8QA 3MLUL 1Y1DA 4NOBA 3MLSL 2K78A 2N56A 3P3YA 4WI4A 5ES4B 5GS1B 4Z0BH 1A3QA 4L23A 3PGFH 3BQVA 1UTDA 4K7PX 2V7HB 1A9EB 3P77B 3PHQB 4F33A 2ZQKA 2DPKA 1F4WL 4C4BA 2MPVA 4WDIB 3ZYIA 4OFKA 3GS7A 4KO5A 4NFDA 3QWQB 5L7XH 3LPOA 5I1IL 1L9RA 4KKLC 1AZUA 1R3HA 2V5MA 5E08L 4W9CC 3HFFA 1XGRA 5EUOA 1N18A 3S5LG 3RBGA 2K4WA 1W72H 3RKPA 3JV6B 1JZ3A 1FDLH 2ZOOA 3P02A 3BFQG 3V6BR 2CKBA 3ZT7A 3BRGC 1DQTA 2ZOKA 1E5ZA 4DCQB 4LLMB 1XF5A 4BQBA 4PJDA 1MFDH 5DK0B 5CXPA 3KPSB 1B2WL 4L37A 2NY2D 3HRZC 2NCEA 4B53A 4OGQC 4EDXB 1OB1B 2WXOA 5C0IA 1GGIH 4TOYL 2A74B 4PUBL 4G6JH 4OCXH 3AB0C 5KW9L 4XN9A 1G7LB 3C09C 3DDGA 5DJZA 3IGAB 3I50L 4PJ9C 4WK2B 1ETZA 2WUBH 4LMQE 4L5FE 3QZWA 1GPOL 3KYMA 4PRIB 4U1LA 5AB1A 3E6HA 3SE9H 1JPGA 1KJVA 2X09A 1FIGL 2DBLL 1UWXH 4N0CD 4CMMA 3CN3A 1Q0EA 2VM9A 4G8IA 4XPTL 2GG1A 4JFWA 2OBGA 2P5PA 4KROD 3VXQB 2YD1A 4QYAA 5LG6A 4GUOA 4OJFL 2Y2TA 2KYIA 3EO1A 4HH9A 4PJHA 4F3FA 3MA9H 4PW9A 1KTLA 4OGAD 3DX7A 5F7EH 3BLKA 5CSBA 3UJJH 2QKIA 3ILQD 1DBBL 3L3IB 4FFWC 3GEFA 4FQXB 4KDWA 4ZPVA 1ZTMA 3X2QB 3B2DC 1VIWA 3FCUB 4IU2A 5B8CB 5C0FB 5BUPA 5IEKA 2F61A 3F7VB 3OLGA 1JTOA 2WOBA 1I8IA 2WVSA 1S7TB 5I1GH 2E59A 4NC2B 1QPPA 3TZVB 4B7LA 5D2NA 3UCQA 1ZS8A 1E4JA 1BJ8A 2A1WH 2IG2H 4MA1B 1D5MA 5IJKA 5I17B 4FAAB 3AG3B 1IU1A 2R51A 4NZ8A 5JQHC 3OZKA 3US9A 3OKKB 1MCOH 1LO0L 3OXSB 1G6RA 3DUHA 4XBGB 3T0EE 3OAYH 3VFWA 2V2WB 3WXWH 4AVHA 2YPKB 3ARGB 2WIIB 5ICZA 2ZYIA 2FH8A 3PL6B 1FFTB 3NJIA 4FYQA 3TOPA 4Z7VF 3AWGA 3NIGE 1NMBH 1NGWA 2CIIA 1DDHA 2CDEB 1OP3H 3VFRB 4TOYH 2VQ1A 4WWKC 1AH1A 4KXZI 2EDHA 1R5IB 5TK4A 4JFUA 5C0AD 2NUPA 1D5IL 1FO0H 2DM3A 2J25A 4XNZB 1F6FB 1OPGL 4D7BA 3D2UA 3UTSD 4WEUD 1XQ4A 5AB0A 2OJZH 3HUJA 3MKGA 4YXHH 3VRLF 4Q6IB 3NGBC 3O9WC 1NIEA 1UD8A 2VDKL 1NGWB 2CIIB 2ORBL 4KVCL 1NBZA 4QGYA 1SYSB 4AW4A 3LNGA 3ATBA 2XQ0A 3ULSA 2WBJA 2EEXA 5TDOA 3RJOA 4JFFA 4AK2A 4BSWB 3CDFA 2EDQA 2IH8A 1MOEA 2BRRH 4N8VG 1OAZH 5CS7A 1ZLSH 4GXUN 2ARWA 4X6CB 3IDNB 2GKIA 5J3HC 5D7KE 4XB3A 2CNYA 1KYOJ 3FQRA 4XP6H 2A6JB 3WXVL 2I60L 3KDPB 3S3PA 1BXUA 2FBRA 4UTAH 5HI3D 3RWEA 4A37A 3FT3A 1WIUA 4HGWA 5JW5B 5EZIL 3WNKA 5J57B 4Y1TA 1JGUL 4YC2C 2BOCA 1QFUL 2W91A 3QUYD 5E03A 4M8QA 1U8IA 5LBSA 2CUHA 4U33A 3KYKH 1T0OA 3G9VA 2XN0A 4HWEH 5FIEA 1FGNH 4JL1A 4OZHA 3PY9A 3NJNA 4JFED 3EUDA 1NOLA 4ZQTA 3T77B 3FRPA 4ZRGA 3BKCL 2WLMA 4ONGL 2ZX8A 4H0IA 1P1VA 1WPCA 2QVKA 3LHPH 1AR1D 1HZHL 4X9FA 3PGCB 1B3IA 5IG7B 4WHDA 1O6SB 1UOVA 3EGXA 5TE7L 3OZ9L 1I3VA 5T1KD 3I84A 2NSQA 4NKIH 4E41E 3OJDB 2J7LA 2BP0A 4MMZC 2WHVA 1RPUA 3QA3B 3L1FA 4PWGA 4J3OH 1R5VB 4NENA 4D7PA 5I71C 2J5LB 2QQKL 2W8CA 4OSUH 5ITFB 2NW3A 3B1TA 3FFDB 2V0AA 2K3HA 1FL3B 2K8MA 1NFDF 2NTFB 4B0MM 3BFWA 1G7IB 4MA7L 3QQ4B 2RD0A 1YCSA 4ICWA 5C97A 2DIAA 2R0KH 3CC5A 4WKZB 1LMKA 2DMGA 2ICEA 4QUOA 3HLAA 4W1TA 4ODVH 1OO2A 3SKNB 5J56B 2APVA 4MSWA 4WHYH 1S9YA 1CLYH 1GVIA 3MCYA 1BSIA 1R34A 1JZ7A 5GS0L 4J3OC 4JQXC 2E5EA 2YSSB 1R4XA 4WVRA 5D8JH 1NICA 2R27A 1LO2L 4ZFZB 1YMMA 4D9QE 2XDHA 3IVKA 2VN6A 3HEIB 5T8IA 4BK5C 5AB9A 3A6CH 4XC3H 1TJIH 2WQRA 1IC7H 4AV4A 2MHAA 4L0PB 5L0QB 4IS6A 4MCMA 1D9KA 2CPUA 3DC0A 5GJSH 1U3JA 1UH3A 1FGNL 1AZZC 1DQJB 1NGXB 1A6AB 5CLYA 2WY3B 1QEWB 4ELMF 2E75C 1CIUA 2BZCA 2Q3AA 3H0TB 4NRYB 4BRJA 1Y0LA 2YGOA 3EW3B 4RWYH 2ID5A 3GSXA 3UGXA 1ZD6A 2DYSB 1KULA 2DLHA 3HE7C 1HHHA 2EEAA 4ZFFB 3MRKB 4F7MA 2EO1A 1A6TB 3H2WA 3QGVA 1G7MB 4K7FA 1HI6A 4QDGA 1PY0A 3U82B 5TE7H 3HR5A 4GAJL 4WU7A 2N4IA 3ALWA 2CR6A 4NQSA 3MBWA 4DKEH 1S5IL 1ODAA 4QHNA 5D1XC 1KC5L 3O2WH 5GRJH 4KFZC 3MOBH 2PO6A 5F1KC 5LXGH 4X6DA 1BREA 4NO5A 5BJTA 3KLHC 5D1XE 1YY8A 2Q7YA 2JF1A 4YK4C 4YXLL 1NBYB 3OJVC 1H3PL 1BEYL 4OFDA 4MMXC 1HEZB 4RDQG 2AXGB 5C6WH 4UTAA 1VZGA 2C9RA 5DRXA 1LEIB 2XJKA 5DUPH 1DO5A 2APSA 4LQ1A 5AKTA 1Q72H 1T5WA 3SHSA 4B41A 1Z3GL 2QGBA 3HG1A 3N3EA 1CU4H 4RISH 2DQHL 3NZ8A 1DN0B 4XMLH 5EBLB 5TK2A 5MP6L 2WNWA 3SPVA 3IU3B 4PSPA 1MCWW 2KDGA 2DWEA 1QI3A 3FTGB 3P0VL 3QO0A 3TBTB 5DDHA 4ABWA 2ZP0T 3QDGE 4OZGB 4KUZL 2NY4B 1INQA 4XPAH 1KT2B 1U8NB 4LHQB 2YQBA 4YHZH 1D7BA 4AQ1B 3MR9A 3O0RH 2HG5A 1IGFH 3V0WL 3LV3B 1EGJA 4ZTOL 4HUXA 2OAAA 3HE6B 5KS9E 1HKFA 1YN7B 3BUIA 5EEXA 2ZIDA 1PJWA 4XI5C 4DP4X 2J12B 5ANMB 2W0FA 4AEHL 4Z7QF 3A4AA 4OGZA 5A2KH 3HBZA 4WW2A 1R47A 3H42L 4ENZA 3N1MC 4V2BA 5K93A 1JV2A 1I8AA 3STLB 5KAQG 1EXUA 5H94B 4ZMLA 3EYQC 3BGFC 1QO3B 2DV6A 1HSAB 1M7XA 3TVMD 4APQD 4DFIA 1VA9A 3LNEA 5DJDB 4PR5A 3CTTA 1NCDH 1OAUH 2HRLA 2DN7A 3PS6A 3HCVB 1UA6H 4KVPA 1NCWL 4QRTA 1QWHA 3LKNB 1I9IH 1ZV9A 5CN3A 1AD9B 2UX6A 5C6TL 1OAQH 3K46A 2VM3A 1OPGH 1FE8H 2H47C 4LGSB 4RETB 3N9GL 5FO8A 2IH3B 4QEGA 2MWCA 1E0OB 4F7PB 1JZDC 3L1EA 1L5GB 2EVHA 3IJHB 1M7UA 2VTFA 3WLBA 2ICWA 2ZCHL 3LIZA 2A7BA 2PTVA 2WBJC 2VIRA 3EGSB 1WICA 3QNFA 4WFGE 5AW5B 3VAEA 4F7TA 3AVEA 3IMTA 1JUFB 4HXAH 1DEEB 3VXRB 2A6DA 4B9JA 4YDIH 3G6JA 4OLEA 2OMNA 4ZAKC 2NTFA 5D6DC 3F6LA 1G0YR 4AQEA 1TQUA 1FCGA 5TQ0H 1AR2A 4YSEA 3QO1A 2YD5A 2V7NA 1AQKL 1OIOA 1S7XA 2IH3A 4PH8A 1GYAA 4FG6D 4K7PL 1S3KL 3NESA 4U1JB 4A6YB 5JLZA 1B4JH 2WQSA 4HJ1A 5HDBF 4XNQB 4FI7A 3T6VA 1BXXA 2WP3O 1H8LA 3MRRA 3F7YB 3QR2A 3SYAA 1KIQB 1EGJL 4K94H 4YHKH 2YD2A 3L6FA 1ZRUA 5L88H 1N0XL 2MMXA 1P84J 1MELA 1KB9J 2XBZA 5KBPA 3PHOB 1BX2B 4PUBH 1XHHA 3DGDA 4FNTA 3X11B 1UJ3C 4GRWE 4HJEA 1ZLVK 1A3ZA 2WSPA 4N9GB 4FL4B 4LAJH 3HUJE 2G75A 1NPJA 3D2TA 1F3DJ 4OUUA 5F1IB 3ULAB 2OL3A 2PN5A 3CDYA 2XYBA 4YDKH 1B88A 3FQTA 4RFEA 1DVFC 1BOGB 4F7KA 4CMHC 4DTGH 5CJ8A 4KI1A 1A3LH 4ZMTA 1NFKA 2C8NA 5FX3A 2HLAA 2HH0H 3VD5A 3K6DA 3LX9A 3ZVVA 3DX2A 1Z5YD 3DI3B 4FQCL 5IWLC 1BDYA 1NL0L 1WZ1H 3BPLB 4HH8A 5ECJE 1LK3L 5E6IA 1U3HC 4A2MA 1X5MA 2AQRA 2X9ZA 1I8IB 1OTUC 4FXGC 5JW3L 1SM3H 5CINH 1CT8A 1NBCA 4W81A 5L2KE 1UCTA 2EYSB 4ZFQA 1TKWA 4XP1L 4IRZA 2I5YL 3SJVD 3CFJA 4CBPA 1KPUA 5EU6A 4NQDB 1XGTB 4ZAKB 2F7OA 2ZXBA 4Y16D 1GMEA 4QOKB 5IIEA 2ZG2A 3GBLA 3EF7A 1EEZB 1FGVH 5ALCL 4JDEA 4DCQA 1U8CB 3GSNL 4N0YH 5E6RB 4NN5C 1KFGA 4AQOA 5AAWA 1LK2B 1T0MB 2MCMA 1ZT7A 2ZNXA 2ED6A 3BP4A 5FYKU 2CHDA 1QATA 5AKSA 4UNUA 3NA4A 2DMCA 5GRXG 4EJ1C 5ID1A 1KYDA 1UD5A 4XCFH 2VABA 3EOBB 1KELH 5A6LA 1AZVA 1CLOH 1QBAA 2D9QB 1O9WA 4YSTA 4B9IA 5IVXB 1MEXL 2JLPA 1AQ8A 4EUPG 1NGZA 1XGPA 1Q9KA 3WEMA 1JRHI 4IKLA 4N0CC 4YHOL 4BFKA 4UAOC 4X5XA 5FCUL 4PV1C 1GJWA 4UNTA 1U30A 3M7FB 3RKDD 3WJJC 3TFKC 3E8VA 3P2TA 5HGDB 3FCTB 5AZUA 4PBDA 2XY1A 5D71H 5FM5M 3LKPB 2V3FA 3AG1B 1C1EH 1P4UA 4OZ4A 4BFGA 1OXYA 4CMHB 2WTPA 2BHZA 3RL1B 5HDBB 4KVNL 2TAAA 4H40A 2E46A 2FYYA 4WCYL 3VMOA 1LO0H 3L3DA 2FQDA 4GH7B 4Z7UB 2FR4B 1BOYA 3ISRA 5IW1A 1MKFA 1DJZA 1CD1A 3ZLQC 4ZPVB 4J28A 5DRNA 4L8DB 1TQVA 2FT6A 4XHJD 1MCSA 3KGTA 4P2CG 2FO1A 4I48A 3DTXB 2IBZX 5AOLA 1NINA 4HMDA 4N3TA 3SGEI 4X6FA 3SCMB 3ES6A 4ALAC 2H41A 3X13B 4RX4D 1S78C 4H5SB 5DMIH 4PTUB 4MMXB 3KBHE 5EU5A 2DF3A 2HRHA 4MGXA 4N0YL 4YPJA 5AG9A 3LJ3A 4G7RB 1HHKB 4TRPL 2Q8AL 3GHEH 3ATEA 3GKZA 3AQYA 4NQXB 3HG1D 4OZFB 5TJWK 3RWHA 5FKPB 4BCYA 4ACTA 2IAMC 5BRZE 1BJMA 1EEUA 2GUYA 1MLBA 2P7TA 1YQVL 1X7QB 4PAZA 4EPSA 4YDIL 6PAZA 4M5SA 1K4CA 4HUKB 3JTBA 3SCMD 4PIBA 1P4IH 3QUKB 1GXEA 1GC1C 4QHUB 3RIAF 5E1QA 1IARB 2Q76A 4NNYB 3FN9A 3PUCA 3O6FB 3IM1A 4E9WA 3QR0A 2IV8A 4X5RA 1BD2E 2B59B 1N2RA 2JKWA 5I73C 3V4UL 2CHZA 4XODA 2QKIC 1KXVA 4I3SH 4APXA 5JOEA 3DVFA 1EAPB 2Y6TE 1JBJA 2XA8H 4N85A 2YUWA 1QMUA 4E9XA 5EN3A 4U1SB 3QC6X 1WGVA 1Q94B 1TVHB 2YJQA 4JQXA 2A73A 3VGFA 2QGDA 2DL9A 4N0UA 2VLLA 4TUOA 4N2AA 4G6KL 2QV4A 5AG8A 3RGVD 3TH2T 3UIZA 1DE4A 1DQQB 4PREA 1G7PB 4OVUA 2VAAB 5E9DB 3WTYA 1HZKA 3OKKA 4OIFA 1HFUA 3D4ZA 1LO2H 2G5BB 5I74B 4PGZA 4PLJD 3QPXH 2KPWA 5F72S 3U4AA 3EHBD 2HUHA 3VG0H 2CALA 3NSDA 3UBFA 2LQRA 3C60A 4AQAB 4KAQL 2A9ML 4UUJA 4ZOAA 4X7SH 4IGBA 5F9AC 4HLZG 5DJ8A 5I5MA 3ZTCC 1JN6B 1KCLA 5EUKA 1K5WA 1AI1L 5C9KA 4J4PA 4E9TA 3JWDL 1IFGA 3IJ7A 3R0MA 1I7ZB 1R24A 3BEWA 3JVFC 1XH3A 4Z9KB 1OL0A 3UC2A 1H0DB 5IFAH 4YBHA 2PCYA 4TNGA 3TV8A 1BAGA 1HHHB 1INEH 4PGCA 4HWZA 1TZIB 1N5AA 1Y6MR 1AGFB 2B15A 3V0IA 2RMNA 2XSKA 2CJUH 2MPAH 2FX9L 5EO1A 1ZHKA 2H0JA 3U7YL 2I60H 2CLRA 4DP1X 3TM6A 2D31B 3BI9X 3UEZA 1QSVA 4NWTL 2CD0A 2BS71 3Q0HA 5DJYB 5BS0E 4B6ZA 5M95B 1MXDA 2GHWB 5D1ZI 2DIEA 1R3KB 5IB5A 2EDBA 2I26N 2X70A 4PJFB 4YWGH 5IV2B 4PLOB 5KVGH 3UYOD 3WTUA 3IN0A 4FTDA 4WTXA 2YSSA 1WG3A 1NDMA 4HIHB 3UBGA 1KNOB 1DCLA 3B4NA 2NY1D 4GMSL 1HDMA 1S4IA 3NZUA 4LSRL 4P2AA 5G2NA 1GHFL 1ROWA 5KZCD 4XXCA 2IPUK 4EXKA 2OMVA 2Y6SD 4LHUG 4JM2B 3B7UX 3MRBA 5K9KA 4POYA 2WZPA 3UTQB 1LD9B 2GAZB 2AEPL 2MCPH 2YMXH 3DX6A 4M29A 4ETYA 3MRLB 4O58L 3DTXA 5E08H 4CUCA 4OF6A 4FNLH 2I32A 4GFXA 1UQSA 4Q9CA 5DJYA 5D7IB 1NCTA 2FLMA 1KJMB 2P42B 4LHUA 4NERA 4QXTB 2WINA 3FUJA 4JFZL 5JUEL 4BQ9A 5KAQF 1CBVL 2HCZX 3U4KA 5I1KH 1PG7W 3IJSA 1H3VA 4ZQKB 3MV7A 4ZMPA 3C6LB 2VQ4A 4YIQB 4Y2LA 3MJ9L 2EKSB 4UIMA 4WW2B 4CGUB 2IG2L 3WDJA 4YE4L 2AV7A 1AVAA 2CO1A 5GGTL 2V5RA 2A9DA 4J4PC 4DP2X 2ZSWB 2P4AB 1UXWA 4HF5H 5D7LE 4BZ2H 1ETZB 1CPUA 1F1DA 4LHUB 5DMGC 4BFOA 1CLCA 1P5UA 4HIJB 5EO9A 2Y06H 1SY6A 3SKMA 3CFDB 1JNHB 5D93C 4NKMA 1T1XB 2AF2A 1YECL 1IM9D 2P5WA 3MRLA 4NOFA 2EYRB 2H0FA 2GY5A 3PWNB 3NEEA 3P73A 2A9NH 2P8LB 2VC2L 3HRPA 3SBWC 4WI0A 4PCSA 2A74C 2XBDA 1F3JB 2B1HL 1OE2A 4CVXB 4GSDL 4MJ6A 1H8NA 4RQQA 2AK1H 3PXLA 2A9AA 2VDKB 3ZO0A 4LOFA 1NDTA 4J7RA 4NYLA 3VD4A 3TBCA 2NT1A 4LVEA 3GJFH 2PR4L 1QHPA 3GHPA 1FPTH 2AABH 3KL0A 2VSKB 4NRZB 4F9LA 4UTBA 4FQ2H 1BBJA 4AC4A 3EJJX 2WBXA 4PJIE 3NIFB 4NAJA 3HI1B 4U3XA 3ETBJ 3W2DH 3SZ6A 3QORA 5JHBA 2GC4C 5DRXB 1LEIA 1XH2A 2Q20A 3NK3A 3P3RA 1AGEB 1KMGA 3NSFA 5KVEL 2DQUH 3ENEA 2JCCA 4JGUA 1OK0A 5F7AA 5CWSB 5D96B 2NXYB 5ALBH 4ZXBA 1W0VA 2C9QA 2ISDA 15C8H 4ODBD 1T2QL 4Z3TA 1ORSA 4ODSL 4QKXB 4YSRA 1T83A 1CO1A 1O6TA 3JBG7 5K1NA 1FFNB 1N6UA 2MNJB 5BV7B 1TEYA 4YE4H 1VDGA 5FECB 2CO2A 4QGTA 2E6PA 4V2CB 3CMGA 2DJ4A 4XMZA 3G6AA 4WNQB 3PPEA 2CRZA 5CZXC 4WI8A 3RVVD 2F53E 5GGTA 3OAYK 1MLBB 4NQSB 2O5YL 2NMSA 2GT9A 5DD5L 4YFLF 2D0HA 2D7MA 2HKAA 1IKFH 4JG0H 4BUQA 3IF1B 4ZXBC 4F7MB 3BDYH 4ICXA 4QTHB 4TL5A 4I89A 4PSRA 2CIKA 4Y1AA 5KEZA 1QFWM 4M1CD 3HC2A 3GM0A 5GRUL 3QUXB 1TJGL 3Q44A 4IIQB 4KPHL 1KGUA 2G30A 3TC9A 2GSIA 3PNWB 3V0WH 4YFEA 1KXVC 1XAKA 1S7TA 4HALA 2FEEI 5F3HA 3V4PH 3CV5A 2ZP8A 4M7LH 4RRPM 2AC0A 1TEGA 2BW4A 2FWOA 4Q2ZB 4W9IC 5ISZA 3PJSB 4XC1H 4FXKA 3LQAL 1AAJA 3EJCA 3QI9B 5M7QA 1BVZA 2VDMH 1P9MA 3FPXA 2CSPA 1G7JA 4UOW1 3WE1A 1ZXKA 2C7FA 1U6AL 2R29H 2VRKA 3OD3A 4UM9D 3VXSB 4UQBA 1S9VB 3QJRB 5L8KB 2CLVB 2YZ8A 2GJZA 4K73A 1UB5B 3RUGA 1XGYL 3ZTNL 12E8L 4ODHL 3FQWB 5EPMB 1AHWA 3L9RA 3H3PH 4RAUB 1ZEAL 5E1IA 1P6WA 5CLWA 3FB7A 1JZFA 1L7IL 2BHFA 3BWSA 5I1LA 2DY2A 2YKLL 2XQYA 1OPOA 3DSFL 4KRLB 3ZT5A 5KYWA 3RVTD 3CN4A 4BH7A 1IKNA 4XVUC 4HW6A 4XXCC 3SGJC 1C7TA 2XETA 3HI5H 4Q56A 5ICXA 4AM0Q 2BP5M 5CHNA 4NT6A 1BV8A 2K6WA 5GGQL 5IQMA 3H9YA 1UWXK 3LKRB 4Q9QL 5AUMA 5GQBA 1X5YA 4AM0A 1XX9C 3SE6A 3Q2NA 1MW0A 2YUZA 4PMEA 2RH0A 3GQFA 3TJHD 1HZLA 3PP4L 3QDMD 3CXHJ 3QW9A 4OBRA 1HSAA 2ZSWA 4LPCA 4WWPA 4P57A 4AIOA 1SOKA 2VLMD 3LRLA 4MD5A 2WXQA 1GYUA 1VGEH 4LCIL 2AXFA 4ZS7H 2Y1VA 1VZHA 4UT7H 1HC1A 4RX4A 1PZUB 3G6JE 2VDQB 3S4SG 1E4WH 2IALB 3OAZH 3QZLA 4PLNC 1TMCB 5EC1B 2A6JA 4UM8A 1IEBB 2VDOB 2LV4A 4LEEA 4FNPA 3VGAC 1WBZB 2PR4H 3WV0A 2ATAA 5FO7B 4ATWA 2VE6B 1NEZG 1R46A 1MFBL 2XN2A 5E6IB 3ZZQA 1JNNH 2TRHA 3D39A 2XC8A 4ZMOA 1PMYA 3ARXA 4LLVB 4WFHE 1KIRA 4YEEA 2VWEC 3BSZA 1RZJL 3HI6H 1DN0A 2X6UA 3FTWA 1ACYL 3LZOA 3E80A 4FFZL 3VXSD 2L7QA 4PJBA 4FNUA 3P30L 1R3LB 3DUSA 3W0WB 4FOMA 3WS3A 2XWCA 1RIHH 4N1EA 2YN5A 2FT7A 4G8FA 3MUHL 3ZK0A 2C1OB 1LO3H 3CXFA 3INOA 5TF0A 2CGRL 2EABA 1IT9H 1WZKA 3FQUA 3O6LL 5EOCJ 3FUEA 4B50A 2WWKO 2OW6A 5FHBL 1AZBA 2P28B 3HHRB 1WAAA 1OZTG 3ARGC 1CDJA 1MAJA 3ESMA 3QIBB 4MMYA 2ZUXA 4ONHA 5C09D 4X6DB 3A24A 5JYLA 4PVMA 4F7CA 1B2WH 1GZQA 4QY8B 5ICYB 1DCEA 1FZOB 4TF4A 5KJRH 3MRRB 3RL2A 2NRDA 2IF7A 4TSAH 3UXFA 1ERNA 5J7CC 2V33A 5E7FA 4RWHA 1U8MB 4MHHG 2EXYC 2P44B 3ARVA 3PWPD 5IWLA 4YDVB 5EIIA 1O7SA 5F9WC 4X4XA 1WA0X 2BMKB 3HG5A 5F96H 4GBXD 5CGBA 1C5BL 3S35L 2VITA 3ZHNA 3N6YA 1I1CA 5C07A 5DZNA 1S2EA 3ARFC 2VMEA 5ESQA 1T3FB 3ULUC 1SF3A 4BHUA 4LOVA 2O6FA 1MHEA 1ID5I 2JB5H 2CO3A 1N8ZB 1VPOL 1FO0B 1PLGH 1QBLL 4LHUD 4OQ1A 2IAMA 3B2XA 3RX9A 1FLRH 1Z3GH 2EDDA 4Z95H 4WZ9A 4YHNA 1V10A 4RIRA 4UOW0 2CKBH 1YZZA 3QHFH 5L6YH 2WWMD 3EUUA 4AIEA 1JYWA 3JT0A 4FEMA 2UUDK 3BVXA 4LKCA 4A7TA 3D07A 3MRMB 5FO7A 5E9DA 1GH7A 1KCSL 1Q0XL 4MA8H 4HC1H 3VACA 3B8YA 3MGOB 1BVLB 5LBSL 3MREA 2Y2YA 4TSBL 2WLNA 4CU8A 1T21A 1UEMA 2ENSA 2VL4A 4A67A 1ET7A 3IXAA 1GZHC 1L9SA 3P0VH 5I6KA 2LFEA 3NFSL 3P4MA 2ZP9A 5F7KC 3IAPA 1S7UA 4DOHB 4G5AA 3MBXH 3ZUCA 3ZIYA 2WXLA 1Y6KR 4B95C 4BEIA 3G5XA 3C9NA 3F00A 2LLNA 3D4CA 4QXGL 3TP4A 3SPCA 4ZMZA 3VD2A 4GAGL 4G8IB 1AQDA 1U4EA 1A8JH 2UYLB 4NN6B 4AGLA 4AH2A 3UADA 1PLBA 5TD4A 2FZ3A 4C47A 2JCCF 2EECA 5LNGA 4JREB 1TQBB 2D03L 5DVKA 4BWUA 1XGPB 2WWNA 2XV6B 1HYSD 4WUKH 3NZHL 1FYTB 1IGYB 1PEWA 2NY0C 2WNXA 4M6OL 4IHOA 4R7LA 3U0WL 3L5IA 1NOAA 5L88L 3QFDB 4X6BA 4I5BA 4YHLL 4PGBB 3ZHLA 3DX0A 4GKOA 3ZKSD 3FONB 4OJFH 4LSPL 1XD1A 2OXGA 1KCRL 3O6LH 1BFVL 2N01B 5BVJA 5DD5H 2YEVB 3SE3C 1A65A 4YLQT 3ZDYE 3B1UA 1DQKA 1D9KD 4MKMA 5D7JC 3VFGH 1H9DA 4JJOA 4MMXA 1VEMA 3TYGL 4JHAH 2XZCH 4X0KB 1CGUA 1MCEA 1CMOA 2BNRB 4NP4L 5HI5C 4JKWA 4NQDA 2ED9A 3VRLE 2XQYK 4Y9BA 1I9RH 4XPGL 2EH8H 3V5HA 3RZCD 3F7RA 4EEEA 3OKEB 5HYJA 1NOFA 3EGDA 2WMPB 3ZUNC 3HZYA 3QPKA 2BCKA 4O58H 1ECYA 4P4KA 3KEHA 5ISZB 2HLEB 5FFOA 5AOJA 2DLFL 4NO2A 2GBTA 4WWID 1LO3L 4PD4K 4LP5A 1BVOA 1IAOA 3T3MB 1FI8C 5J13B 1YMHA 3APDA 4P46A 3CSYA 1NC4D 3ALPA 3II3A 4TLKA 2KUTA 2G5RA 2HMID 4RGNE 2ROYA 1SLUA 3T3ME 4OB5H 5CCKH 1A5FL 1I7RB 3VXOB 1JXFA 2IAMB 4F9PC 3S2AA 3DLQR 5DS8A 5I1HH 2ITDA 1SHSA 1XTMA 3UTSE 1M7DA 1Z5LB 2OTPA 3A6OA 3JTSB 4NSKB 1SDDA 3ARWA 1YEWA 3C75A 3B2UD 5DYOB 4WHTB 5CGYC 1G94A 3S5LB 4UQIM 2AJ3A 4Q9QH 4GLRI 3WTXA 3ZDXB 3UZEA 1HCZA 3LEXB 4PVLA 3BW9B 3UAJA 2ZWSA 3UTPD 3M17A 5EHFA 5BO0D 3DRTB 4YXKH 1UJ3A 4H8VA 2NY5L 1U41A 4WI6A 4FQ1H 4U1NB 3BESR 4UDUA 4F7EB 1ZWIB 2QPSA 1MVYA 3D05A 3KCWA 3VI4E 1P7KA 3Q9PA 4F5CE 4YHYB 4HXAL 4XBEL 2HTLD 4HPOL 4JL2A 3HKFA 4ZFZA 5IFAL 3ABKB 3ZDZE 2OMYA 4J5VA 3KPLB 2R1YB 4YHOH 1LP9B 3Q48A 2X6CA 1FVEB 3QIWB 2GI0A 3DPBA 4EN2A 1SDYA 2CLZB 5IBTH 2FBOJ 4PS3A 3E6FA 4FQQB 2HXAA 4LCYB 2ZXGA 1FZJA 1C5BH 5B4MC 1AKPA 3Q5OA 4RAVB 3U36B 4U6YA 2BIPA 3QE5A 4ENED 1WBYA 3GD1C 2F8VA 4B5EA 2F5BH 3UG5A 4CSZA 3KYNA 4EZMA 3LQMA 5DSCA 2FCBA 3EH5B 5D1ZD 2V2TB 1WWAX 4ZS6C 2AERT 1BVNP 4LLVA 2AK4E 3O6KH 3WNJA 3WELA 1BMWA 3ARDA 1I1FA 5IEHB 3HZ3A 3DGGA 3RHWF 1A6TA 4K7FB 4QPEA 4QNPE 5JQIB 5E8EA 3WFCH 2DKUA 4U49A 3GGWB 1S8DA 1MFEH 3KL3A 1OCOB 2IADB 1FZMA 2DICA 4OM0L 4Y16B 3UJIL 4FFTA 3T1WA 4LBEB 2PW2B 1C5CH 2NNFA 5KBMA 4OD1L 3GHBL 1XSJA 2NY3B 4MAUH 4TM9A 2R0LL 2WINB 1ED3A 3SO3B 1SBSL 2ZUQB 2GITA 4KK5D 2F19L 3B7TA 2YOCA 1JPFA 4HIPA 3RWJA 2PYEB 1EEQA 3LKRA 5DA0B 4J1UB 4Q8BA 2XNAA 2DM2A 3GBMH 4QT5A 5B38G 1BYNA 4RFOH 4I0KA 5B3NA 1EHKB 1KYAA 5IUCA 4JVWA 2HT3D 3S98A 2DIBA 4O02H 3ZE1B 1FBIL 5LGYA 3T0EB 1KCVH 1DVUA 3N1FC 3MRBB 4PJEB 1LP9F 5C07D 3OR6A 1A6WL 4PV9B 3VQ2C 4RDBA 2KKQA 5C1MB 4IJ3C 2W9EL 1GS6X 1M1XB 3N1GC 4N24A 1HHIA 1AZNA 4XP5L 5FYKH 4DQOL 4S0TD 2WWMC 1ZT1A 2YJLA 1QVOA 3QIWA 3SDYL 3ZJAA 4PRAB 2ADJB 4JFTA 2O61A 1WZLA 4K5NA 4TTDD 1ONQA 1P7QD 2X5PA 4MZ2A 4XNYH 1JRHH 1WH0A 3OXRB 1ADQA 4LEOA 2VC2H 3DETD 4UT6L 5K9OA 1EQWA 3QHZL 3ABGA 4C56B 4U6XA 5CZKA 3Q8CA 3QPXL 1KXQA 3EOTL 2FE0A 5GGQH 1TVDA 4H2AA 3X1NA 1J0HA 1IZKA 3A0OA 5E5MB 2AK4D 2C3GA 4YSQA 3DROB 2BS8A 2AJSL 3SBQA 3CFQA 2DLFH 4HPHA 3AU0A 3CSPA 1IAMA 3GEWB 3LNDA 4NFBA 1A7BA 2YO3A 2LW3A 4Y2OB 5A1AA 3U2SB 2XKNB 4IQHA 2ZCHH 2KHAA 4MAYC 5HGBA 2D8KA 2ZYHA 2ZJSL 1JP5A 4A6YH 1B0RA 1WAPA 2X6BA 1G6RB 4XVSL 2OYLA 3APCA 2BOCB 4GEIA 5HDRA 3W9DB 2CBMA 3MROB 4JFHE 2XZCL 1GOHA 4K3HA 3A23A 1AY1H 2XYCA 5B39B 3DGGB 5E94B 3V4VB 3I6GA 1OSPH 2PCFB 2JELL 2VLKD 2HG5B 3ISWA 1X5ZA 4KUCD 5ANHA 1G7HB 1XZWA 3GJFB 4WFFD 5C0EA 1MFEL 3MNVB 3ZDXF 4MTMA 4JDTL 2D7PA 4ABQA 2XX1A 5C70A 3QS3A 1SLWA 4ZMAT 4JFFB 4K5LA 2LHAA 2BNUB 5AYTA 1HOCA 3I9GH 4NZDA 4XCCL 4NRZA 5CWSA 1RL1A 4PJFF 1F02I 4HU8A 2XWEA 2WTRA 2FSEA 5HI5D 2X88A 1PQZA 4WSJA 1XIWD 2FHFA 4U6VL 4F8OA 2OMZA 2PP9A 5CD3A 4IBQA 3K2UH 4PJ8A 1OGTA 3QUZC 5DJAB 1S5HB 5LHDA 4WO4A 5GJTL 3CZLA 1N4XH 3I02A 3QFJD 1M1XA 3T2NL 5L7XL 4CVUA 2R2BB 3BE1L 3BO8A 3GMQA 4FABL 4AQ1C 1E4HA 5DD1L 1EVUA 1YNLH 2FL5A 3T0EA 1CYGA 2VDRB 4KWUA 2Y22A 1AI1H 5C0EB 5JIPA 2E86A 3VXRD 4O2CA 5GRWA 4XAWL 1F3JA 5A2AA 1JL8A 3GXUB 1Z9LA 3MRFA 5C0AE 4JCWA 1DLHA 1TUPA 2I9TB 3RG1C 1A1MA 2FEDC 2E7LC 2W07B 4MJIA 4YSCA 2L7UA 3B7SA 4HS8H 4PJ9B 4Y4KC 1P5VB 3W1ZA 2OMXB 1NMBL 4JBSA 2GJJA 1ZSDA 5KZCB 1FL5A 3LPFA 4YWGL 5J9PA 5E8DL 1T1ZA 4DN3L 2IGFH 4BELD 2GJ6D 4BK5A 2FK9A 1JHKH 4L4TA 3V0HA 4TVPL 4XCEA 3TVMB 4APQB 1MNNA 1B4LA 2DQDL 3KPNB 2PETA 3WFBH 1KTLB 5L0QC 3MV8D 5D1ZA 4W93A 2R29A 2JI3A 2YOAA 3UTQA 2BNRA 3QIUC 3HS0A 4CN1A 3BHBB 3WFCL 2DLTA 2G2NA 1W6LA 3I50H 3BUBA 4NBZB 2Y07L 3NACL 4XMPL 4LLWA 1CN4A 5JZ7C 2ZXWB 4KK6D 4YSUA 2NW2A 1IKOP 1RUPL 5EFIA 4P2QA 1FL5B 4QHMA 2BLFA 5LWYL 1AR1C 1NKOA 2IWKA 2RR3A 3KLQA 3MACH 4NHUB 5FYJL 5T1DH 3UEQA 3ZQXA 4B9ZA 1XF3A 2PWHA 4YLBA 4JG1H 3LQZA 3LTVA 3NJVA 1U8MA 1RP9A 4BE5A 1QWNA 1OAXL 1XCXA 3X14B 2ESVA 4UIKL 4G9FA 2NYYD 2BWDA 3NCFB 3KLAB 4BCZA 3PFQA 1KLUA 3QRLA 2VM4A 4URKA 4E2OA 3LIUA 4CBZA 5TDNA 3ESOA 3GSRA 4PGEA 1CIDA 1M9SA 3G6JF 3FTVA 3B37A 5E1AA 3CFMA 5E9DD 3NGBB 3O9WB 2VLJD 2HFGL 2OKMA 1VGKA 3KYAA 2IMMA 2VLKE 2R9HD 3CUPB 3WGUB 2YRLA 4YDLB 4MDRA 2A6KB 2NNRA 4HCRA 5IIEB 2WKOA 3JZ7A 1HILA 3FU3A 4P9ML 1U95A 5JDJA 3D12B 1MCPH 3G3LA 5E5RB 2YUXA 5KVDE 4DPCX 3CN0A 5E6IC 4KZ0A 3S97C 4H26A 1YHPA 2G9HA 3VXNB 2Z92A 1BPVA 5D2NB 2CO7A 4I18B 3IDNA 3H9HB 3IDJB 3D50A 5E9NA 3L45A 4DZ8B 4KOCA 1MCIA 1IAOB 4XVTH 4B9CA 4ZMYA 1MCNA 1MFCL 4WEMB 2FD6H 2JIXD 3HS9A 2PYEE 2QGCA 3EGDB 1HNFA 1ZLWK 5F9DC 3B5TA 5F7BA 3LS4H 1TITA 4P5MB 2OZ4A 2NDGA 3VB8A 1JJUA 3D33A 3E3QC 3RX5A 3U1QA 3S36H 4TQEL 1MRDH 1JWMA 1KBWA 2HKFH 1HCVA 4PLKC 4PY7A 3I6LE 3U9UA 4YH6A 3HHMA 4WU5B 4BSJA 2BJMH 2VLLB 1DBKH 1N2RB 2GUOA 4H25A 3RL2B 4E9YA 1SGKA 3QYNA 1MVUB 1R5IA 4LKXA 2J73A 3CPUA 1NCGA 4R97B 1FC2D 3GSWA 1MI5E 1ZIAA 5FYJU 1T5XA 1AKJB 1IGIH 1YJDL 2A74A 1OOAA 3NCJH 1JHLH 3CVIL 3VI4A 1NCJA 2GI7A 4OCSH 3KLHD 5LGHH 4L8SC 5IVZB 1IC1A 2WZPD 4ZW7A 5I1IH 5MEQB 1JZ4A 2WCPA 1J5IA 3FO1A 3VFSA 4TPRH 1A7QL 4XMTA 2BDNH 3BD5A 1NCBH 3T0WA 1OAYL 4NUGH 2EXTA 3QHTC 3DKHA 1TOXA 1TYEB 2J56A 5GRUH 4XMKH 1YPZE 2IDCA 1M6OA 1ZS8B 3ZIMA 3B2VH 3CLFL 1QLEB 2UX7A 2OR7A 4K94C 1IFRA 5DFTA 3KWVA 1SNRA 1I3UA 1EMTL 1Z2KA 2EEDA 4C8XA 1HHJA 2AK4A 4AJYV 4H8PA 1R1CA 4ELKB 2C4FT 1GYCA 3TV3L 1BM3H 2B8OT 3FHAA 3MGOA 2BZDA 4P2OA 4RVBA 3BIKB 2KZBA 1BZ9A 4X4ZA 1MW2A 4S1RL 5D9SA 2UY7B 5H4YA 1PG7X 1CF1A 2R7EA 5FB8A 4MX7B 1GC1L 4UTCA 2OZNA 3B6SA 4PB9H 4K8RC 3IS1X 4L8DA 2W38A 4XX1G 1QTSA 3Q1EA 4X6EB 5I1DB 4D8OA 3PQYA 2BHYA 1KJVB 5KSAA 4RZKA 5C08A 1SFDA 5GGUA 1UT1A 3OKMA 1RK7A 4BWTA 1NLDL 3NACH 2E7HA 4CC0A 43C9B 3IRPX 2WAHA 3Q05A 4ZJ9A 3GGWA 1SY6L 4X8GA 3C8HA 4JQVA 2PTTA 4L37B 4Y19B 1UT9A 3EYSL 4UV4L 1J1PH 4YHML 5J0BA 2AHIA 1DLHB 2DS4A 2YGNA 1VRSA 1RHHA 3IPFA 5BW7A 4PN6A 3HHSA 4BHUI 1LO5B 4OB5L 1Y18B 4I1NB 4GRMB 4L4VB 1T7ZA 5A2FA 3BXNA 5H35B 3Q2CA 1YEFH 2WZ6A 5H37A 3O11A 5EPMA 3HR6A 5JQ6L 4R5XA 1RUAH 1B9KA 1XIWC 3ZQ9A 3MFGB 3ZL1A 4OJDH 3SGKC 3ZDZB 2VMFA 2ZXQA 4Z7VB 5JIMA 3FUIA 1FVDA 3ZDYB 1DVQA 4KJQC 3S34L 5A3IC 1CT8B 4BZ2L 3NFPB 5EBGA 2WOYA 3UTOA 3N9GH 1R3LA 1W16A 3MNVA 5I0YA 3IJYB 3KPSD 5DXWA 1V3MA 4PJ6A 3KS0J 5J11B 3MRPA 1Z6JT 1CFSA 2GHZA 3MJ8B 4Y5YA 1TQTA 1EJ8A 5FLUA 4AJVA 4LVNC 4X42A 5E00B 1AO7D 4RCAA 5JZ7D 3MN8A 4LAQL 3PWNA 1KIPA 5MERB 1T89C 2WUCH 3IF1A 4K9EL 4H1LB 1JXKA 1MUJB 1WYJA 1IAII 1SJHB 4TNWF 2ALWA 3SBWA 2FJFB 2WYIA 1KLFB 3CFTA 4K71B 4CDHA 1FSKB 4ADJA 2E6JA 1YYML 2EH7H 5E2UL 3U2SA 3CPLA 3P11L 5I6LA 4D9RD 2WKOF 2BSRA 3O8XC 3QCVL 2EXYD 2OULB 3W57A 1MI5D 2WLLB 1AE6L 4B96A 2QSCL 3F58H 4L9DA 5C07E 2GSGB 1GIGL 3NCCB 1OAYH 2XKNA 4NUGL 5HGHA 3N42B 2GQHA 5KSBA 1VCBC 5CINL 3COOA 1KIUA 5IGXH 4MZ3A 1QRND 3DO3A 2DL2A 2OMUA 1RZFH 4JPSA 2IDUA 1TJMA 2WUBL 1MAKA 5FUZH 1LE9B 1T2QH 3DBXA 4CDGC 1SEQH 3AG4B 4PJAB 2QHRH 4RGOL 4BFIB 4O4YL 4WUUD 3IDYC 3NG5A 3THML 4LSVH 3SE4C 1JVLA 3MRNB 5E23A 1YEJH 5K9QI 2A3TA 1IGJA 4XGZA 3KXFB 4LCWE 3CX2A 1PKQE 1WD9A 1C1EL 1NPUA 3BH8A 3V6OC 3VFUB 1HHIB 1XB3A 4JKNA 4FQ2L 2IPTH 3O4LB 4LGRB 1DVZA 3SOBL 5J1AA 1J1XL 4MCYA 5GGSA 3O3UN 1LE5B 1FYHB 4ONFL 5AWNL 3NRFA 4PB0L 4F7TB 1YEFL 4NM8L 2ITEA 4F57L 4QCIA 2R2HA 1JNHA 1M1SA 2AMGA 4QRQB 1JPFB 2B08A 3Q8EA 4KQ4L 2HN7A 3B56A 5E24E 3KD4A 1TTGA 5EIQA 3EOYG 3LRMA 1WCBB 5IY5B 3SDDA 3JWOH 5F3HB 1J8HD 3C5ZC 2CGZA 3P11H 4KKAD 4XZ4A 3QS2A 2J5WA 3EGXB 5E8NA 3TTYA 1EXUB 2DIJA 5GIRB 1HYSC 4OF5A 4KRPB 1XGUA 2BWIA 3UPCA 3OGCA 5FYKL 4P2RB 3GBNH 1QFWH 2OMXA 3APFA 4LDLB 5BS0B 2NY2B 3DVNA 4EZKA 4NQTA 1UWFA 4OIIL 4UU9A 1HL5A 2Z34A 3R8QA 4GPVA 4BZ1L 3N42F 4HWBA 4JFQA 5AW3B 1UM4H 4R90L 5EU4B 3U30C 5E8OB 3VE0A 1E4XL 2FUQA 5I23A 3EH1A 4LKCB 4IRZH 5FECA 1MHHB 3U1SH 1YEEH 4TNWK 1KZYA 5IMLA 1S6NA 1TLKA 1EWHA 2PO6C 1N9PA 4ZNEA 1BA9A 4LCCA 1OM3L 4X6CA 1WEJL 4Y1SA 3C60C 1S5HA 5I6OA 1KT2A 3RFRA 3ZPDA 1T5WB 3HG4A 3ZTNH 3IPBA 4OTXH 3H9SD 4IKNA 4FFZA 3S6CA 3SKJL 1LVEA 1QLFA 1VFAA 4QXGH 4B9PA 3PWVA 2H8PB 3CVHL 4D0DB 3CN2A 2GK0B 2D7QA 4OLWL 4FTVA 4AV5A 4YMPA 3B9AA 3A6BH 3CSTA 3Q6GH 2QL1A 3PGDA 1CFTA 4EVNB 2Z93A 1O9VA 4N90D 1TZAA 3TA3A 1KACB 1SEBA 4WFFE 1WTGT 5DUBA 1MY7A 3VTAA 5E2TH 1A4AA 3QQ3A 1P9MC 4LLAA 4KKNA 4X2UA 3UG4A 2HTKC 3ILDA 1G1KA 2EYTB 3N85H 1CI3M 3V4VL 3QRGL 5EU3B 2DKSA 1YY8B 4B9KC 1JERA 1EK3A 2DQMA 3QEQE 4KZDH