2JCWA

Reduced bridge-broken yeast cu/zn superoxide dismutase room temperature (298k) structure
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
153
structure length
153
Chain Sequence
VQAVAVLKGDAGVSGVVKFEQASESEPTTVSYEIAGNSPNAERGFHIHEFGDATNGCVSAGPHFNPFKKTHGAPTDEVRHVGDMGNVKTDENGVAKGSFKDSLIKLIGPTSVVGRSVVIHAGQDDLGKGDTEESLKTGNAGPRPACGVIGLTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CU/ZN SUPEROXIDE DISMUTASE
publication title A structure-based mechanism for copper-zinc superoxide dismutase.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 39
structure length 153
sequence length 153
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 1998-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 2jcwA00
1P1VA 2JLPA 1FUNA 1XSOA 4A7UA 1IBFA 2AQQA 2E47A 4L05A 1TO5A 5CU9A 3CQPA 3H2PA 3MKGA 1RK7A 2WWOA 4BD4A 1HL4A 3GTVA 1L3NA 1YSOA 1E9QB 3KM1A 3KH4A 3KM2A 1E9QA 2V0AA 3F7KA 2WKOF 4A7TA 3ECWA 1B4TA 2WZ6A 4A7GF 2WWNA 1XTMA 1E9OA 1OZTG 2Z7ZA 3GZOA 3KBFA 1N19A 3MNDA 2Q2LA 2C9SA 1QUPA 3GQFA 1OEZW 3SODB 3L9YA 1MFMA 1F18A 2AQNA 3CE1A 1IBHA 1EJ8A 4FF9A 3S0PA 1CBJA 2Z7UA 4OH2A 1DSWA 2E46A 2GBVA 1YAZA 3CQQA 3H2QA 4A7VA 2ZOWA 2GBUA 1SPDA 2AQSA 2XJLA 3HW7A 1SOSA 2WKOA 4MCMA 2LU5A 1BA9A 1JK9B 4A7GA 1E9PA 4A7QA 2R27A 1JK9A 1TO4A 4U4IA 1Q0EA 3K91A 1E9OB 1SDAB 1UXLA 1SRDA 2K4WA 2Z7YA 1OALA 3RE0A 1OZUA 1U3NA 2VR8A 1S4IA 1Z9PA 1DO5A 2JCWA 3HOGA 3KH3A 2Z7WA 1F1DA 5KBMA 1Z9NA 2SODB 2AEOA 2ZKXA 1F1AA 1SXBA 1OAJA 1XTLA 1YAIA 1BZOA 1PU0A 4A7SA 3GTTA 1SDYA 2C9UA 3L9EA 1E9PB 5KBLA 3GZQA 4MCNA 1IBDA 1F1GA 3F7LA 1IB5A 2AQTA 1IBBA 4BCYA 1PTZA 2AF2A 3LTVA 2WZ5A 2ZKYA 1ESOA 2XJKA 4N3UA 2NNXA 2APSA 3PU7A 4BCZA 1SXNA 2AQRA 3T5WA 2AQPA 2VR7A 2WYZA 3ECUA 1JCVA 1SXZA 3QQDB 1SXCA 1CB4A 2ZKWA 3KBEA 3QQDA 1SXSA 5KBKA 4B3EA 1AZVA 1N18A 2C9VA 1PZSA 1B4LA 1EQWA 2WZ0A 2WYTA 1KMGA 4OJAA 1UXMA 1SXAA 3HFFA 1COBA 2VR6A 2GBTA 1HL5A 3GZPA 4N3TA 3ECVA
chains in the Genus database with same CATH superfamily
3VRLF 4HWBL 3ZZQA 4M7KH 4MLIA 3MTXA 1JXDA 1P7KB 1XF5B 3KPRA 1ZT4B 2CUMA 2P5EA 5DYFA 3VU1A 5I1KH 3VFSA 4C57C 3IGFA 1ACCA 3HC0B 3U6RA 2X9XA 3JV4B 2WQAA 3UTZB 1ZJBA 1FYTE 2ZKHL 5FO7A 4K5MA 2AJUL 4K9EC 3GC3A 2ENSA 1FZKA 3MRLB 4BFNA 2DWXA 2YWYA 3KDMA 2V33A 3KWVA 1ZHNB 3X14A 5ES4B 1B4TA 1ZHLA 4Y4HA 2Z8WC 4K4KA 2QEJA 5HGHB 2ED9A 3BESR 1EEZB 5I82A 4HG4K 2CLRA 2WTRA 1ZGLB 2Q2LA 4W70A 5GRXG 2F58H 3GRGA 2Z64C 2P8MB 3X1FA 4EI5A 4ZPTB 1IEBA 2Q86A 3WY1A 5DRZB 5GJSL 4OUOA 3LKSA 1IM3A 1CBJA 1Q1JH 1GY2A 3B83A 3GUFA 3EBHA 1BLNB 3PLYA 4A7VA 3VXSD 1AC0A 2VISB 1ZA3B 1SPDA 2DBLH 1MCOL 3CFUA 3KPSB 4QTIL 3SGKA 3ZXAC 5BVPH 3BGFC 3BIKA 3WLBB 2DWEB 3QUYB 1MELA 5EPMA 2H4EA 3FSVA 1JK9A 2UY6B 1F6FB 4HK0B 2WLLB 1LE9A 3C6LB 1BIHA 3E80A 3OAZH 2AKRB 4J6IA 2GPZA 1X5ZA 3RDTC 3CH1A 3U4AA 4X5XB 1XR8B 2OJEB 1D5BB 3JSSA 1Z3GH 2HA1A 1GGIH 2NY2B 5E8EB 1TT6A 5AVZB 2IALA 3N5AA 5LBSH 2NW2B 2AEIT 4Y1AA 4G7SB 2GK2A 3BWUF 4B3VA 1ECYA 1BM7A 2AEOA 1VDGA 3GXDA 3O2WH 4OB5L 1B2WL 4BHUI 4EXPX 1CK0H 2ZUQB 1TCMA 3I9GH 3QORD 1AACA 2EP6A 4MA7H 3WS3A 4KVNH 4HAGA 4G42B 1UWFA 5SWZD 4O4YH 1QLRB 4IS6A 2WO3B 4OY9A 4N5EC 3S36H 1FVEB 4ZBJA 4MMYB 1CU4H 3ZKSD 2K70A 3HVNA 4XP1L 3MV7D 1REIA 4KUZH 2VLRB 3NFPB 4JJ5B 1M4KA 5CJOH 4FCAA 3GKWL 2WUBL 3IU4H 1FYTD 5D1QC 3VGHA 5J8OA 2ZUQC 3GXNA 3UBXB 4OJFL 4BRJA 3KW7A 1S3RA 4OSUH 4WI7A 3CFCL 2VKXA 1M53A 2VDMB 3CSFA 3RIKA 2R7EA 3GSNB 3EFOB 1EUUA 1KTJA 2XYCA 1JG9A 4FQ1L 3F7RA 2PPDA 4GI8A 4MX7A 3GDCA 3BE1L 1SJEB 4KTEH 1P1VA 3ZTEA 3OR7B 4N1HB 4P8QA 4JKNA 4CRPA 3FB7B 1IGFH 3GO1L 3U6XS 4LGPB 1TO5A 4J1UB 5T8IA 5J3HC 5FO8B 1TSHA 1U8QB 5ICZA 1IBGH 1HHJA 4FFZH 1U8OA 5DFVC 1AFVH 1TQBB 4S1QH 3BEWA 1KJMA 3DOHA 1ZY9A 4MJ2A 4W9FC 4OZFG 1IFHL 4JAMB 1MHEA 2JXMA 2R2CA 2Y25A 5BCAA 1U95A 2XFXB 4HGWA 1X5XA 4Y5YB 1KXQA 4XH2A 5DK3A 2P7TB 2BNRE 1UKSA 1GC1H 2HFEB 2AXWA 4M1CC 4XP6L 2A0LD 4YXHL 4L23A 1E4JA 1RI8A 3WXVH 4EOWL 4HKBA 2XA8L 3SPVB 1XSJA 3HZVB 4LSQH 4AXWB 1N4XL 2FQGA 3FTGB 1T1YB 1J88A 2HG5B 3TJEH 4MSWB 3ZDYB 4U2YA 1TFPA 5ACLA 1AG0A 1XR9B 1A8ZA 2ZAHA 2JNZA 3MI6A 5C3IA 1TMQA 3P2BA 3HHRB 3FONB 4OU3A 3ARED 4JN1H 4H8WH 4M1GL 1U4FA 1ZV9A 4PJEF 3P4NA 1T1WA 2DBJA 5I30L 1SMOA 4BQ8A 3K6OA 2C3WA 3WTSA 1RVFL 1CTNA 4QXUH 1BLIA 4WI3A 5B8CA 2K4WA 1QFHA 2G5BA 3O4LB 3TNNA 4D0BA 2OJZL 2WN2A 3CPLA 5CEZL 2IG2L 4JQIA 3TV8A 2NYYD 5C70A 5BXFA 2Z4QB 4O02B 4WI2A 2HKFH 1N7MH 1EH9A 4G7YH 4TSBH 4Y5VB 1AS6A 4RCAA 4LL4A 1JRHL 3IU3A 2BSTB 1DBMH 1QSVA 4PJEA 4KI5C 4FQJL 4GRMA 4MCNA 4YR6B 3MRDA 1JF1B 1KGCE 2DQCH 1IAOA 3MBEC 3QHFL 4NBZB 2AHIA 2YAFA 4MVBD 4M5TA 2HFFB 4YVUA 3L4TA 5EEUA 3JUYA 3TV3L 1HN1A 25C8H 2M26A 5HYEA 2LE9A 5AW7B 5IESH 4XNDA 4OLZL 5SWQA 3CZFB 5CBAA 4Z95H 3TJPA 4L29B 4KU1A 5DC0A 1ASQA 5FDYA 3T3PB 4M61A 4G71B 3WN5C 1T0NA 4OGXL 5D4IA 3CFKA 4FX5A 2HP4A 3K8MA 5C0AE 2YEQA 2IH1A 1ZMYA 1LEGB 5D96C 2ICEC 3FOLB 2HRPH 3UBGA 2H0PA 3AS3A 4MXQD 4XI5D 4QOKE 1S9WB 2OMNA 1JYVA 3CQFA 1RLBA 1WDAA 3IDMA 4L1TA 1JFHA 3MJ8A 3RIFK 1FNLA 4KVCL 3V9EA 3QBTB 3IJ8A 4JQXC 5DHYA 1TG8A 3OKOA 1S78C 1IL1A 4IBSA 1W2KT 1FVDA 4HX1A 4JFPA 4HDIA 2R1XB 2Z1KA 1T0MB 2IAAC 3NH7H 3CZNA 1FHNA 3EOAA 3GHEH 5F6IB 5LG6A 1BAGA 5I5RA 3PUUA 3RWCB 2QVMA 3GQFA 3VXSA 1XGRB 3Q6GH 2PETA 3VFOB 1NEPA 2BMKA 3K4AA 5A1AA 2VRAA 3IXAB 3P30L 1AR1D 3MLVL 5CM1A 2MPVA 4OLYH 4M5YH 2AJSL 4GRWF 4ZDHB 3ZYJA 5BJTB 4Q4IA 1QFUL 3DYPA 4LU5H 5CGMA 4LP5A 4JLRB 1KGCD 2J1KA 2Y6SD 5HHME 1NIEA 3OC5A 3MRGB 5ANMB 2DS4A 3DRQA 5F6IC 1OP5H 2WQVA 5AKTA 2AMUA 3VI4A 3EXJA 1JUFA 3UTTB 2BOCB 2OX5A 2GUOB 3GNMH 4GAFB 1S7TB 4XPAL 3QORA 3AS1A 5F3HB 2PW1A 4GW5A 4PS4L 4QCIB 3P3YA 5K33A 5SWZA 1I31A 4JFTA 4ZMZA 1CFQA 1CJYA 2B0SH 5H2BA 5IMOA 4XP5H 2R1WA 2FLRT 1FYHB 3BQUD 2BINA 1BOGA 4G59C 4YHIA 5BQDA 3HC2A 4FEIA 5L2JB 3CSYB 1LO2H 1E28B 1RIUH 3EUDA 2FATL 4AW4A 2FZ3B 4L9LA 1DEEB 2L4OA 2LAGB 3H9SE 2EXTA 2YRLA 5CJXC 1FYTA 1CWVA 4G6MH 1F90L 4LSRL 4NPYB 2WXIA 3GM8A 4AEIL 2CR3A 1SHWA 4QRRE 4PB0H 4IMKA 5DJ0A 3GSVB 1IVTA 1JI1A 4KQ0A 4DFIA 2NY1C 4PLJD 2XQBL 3NGBB 2HX9A 5EO9A 3DV4B 4J2XA 4N0FA 5JNYB 4BJLA 4FLRA 3UP6A 4BDVA 2NY5H 4PG2C 4LOUC 1KXTA 2YQ3A 1OWWA 3RZCB 1HIML 3SQRA 3W2DH 3HFFA 4CA4A 2N56A 1KJ2H 3BZ4A 3LHAA 3OLIA 1SM3H 5KEZA 2EDNA 4B0MM 3QWRA 4FGMA 5IW1A 2V5MA 5B38A 4MJ5B 2GVYA 4LSUL 5IJBC 1RMFL 4I0KA 4L05A 2X40A 1EDQA 4XWGH 5C0CE 1BQSA 4PRHE 2CIKA 2BNQB 3V55A 1FIEA 1DJZA 2Z93B 2CIIB 1FBIL 3ABKB 4RDBA 2OMXB 4P4RB 3NN8A 2EVIA 3FK3A 3IFPA 5I1KL 4NQDB 4W9GC 1RZGB 2HT2C 2QTEA 5MEQB 3U9UA 1KN2H 5HHNA 2GW5A 3N40P 1JD7A 1QAWA 4R0LA 1JWUA 4XVSH 4WWKA 4F5CE 3MGOB 2DKSA 3LRSA 4G7VH 3VGDA 4HJ1A 3G5ZB 5MEND 2AJYL 4XOCA 3O3AA 3A4FA 4DCQB 1JZ4A 1C5CL 1EJ6A 3TYFB 2FTAA 1LMIA 2GTWB 4HCFA 2DMCA 1I85C 3AREA 5IMKB 3CN2A 4RMTA 4TQPA 2DQDH 5GGSA 5DCCA 3AROA 5DUPL 4OH2A 3SE3C 1B0WA 2Z4TA 1G0XA 5L6YH 2BNUA 1OTSD 5E00A 2L7EA 4F7MA 1EHXA 4I48A 4EIUA 5E8NA 4QHUA 2Y3AA 1F5WA 2I9LB 4ES9A 1Q1JL 1DBJH 5T3ZH 3UGEA 3BZ5A 3H9SD 1MJUL 5FCSH 3ZE2F 1M2VA 3JTSA 4JPIB 2HLAB 4MS8C 1K3ZA 2RACA 3RVVD 5IT2L 1FI8C 1RK1B 4GAGH 4QRRD 1FC1A 2R0KH 3HAEA 2QVTA 4OQ1A 2GC7C 3QO1A 4ZMXA 5I1IH 4PVMA 1QTYT 2C7UB 3S37X 1TJXA 2X05A 3HI5H 5K9KB 3BSGA 4U49A 1GGIL 1HAWA 3KYKL 2F8VA 3OMZA 4ZOEA 3REWB 2D9QB 4OCYH 2APFA 3O2WL 3BKMH 3OKLB 1U8IA 3SYQA 4LF3A 1W15A 3DYMA 1HSBA 1IM9B 3RY5A 2YQGA 3Q2CA 4L8DB 1FA4A 4PY7B 4U1NB 1GPOL 3VSQA 4XE0A 2EKSB 5HY9B 1KBGH 3VFWA 4PRHD 3VXME 3EGSB 1NCGA 5AAWC 2GIMA 2ZP0T 5IZ7A 3KMDA 5IMLA 2KYIA 3QE5A 4EKJA 2BNRA 3DUUB 1BCIA 5GRWA 3W9DB 5MERB 3BKJH 2XT1B 4CN1A 3MOQA 4N2BA 1H5BA 5CJOL 1A2YB 3QPQD 4AGPA 5IEKA 4WHYH 3DGGA 1MFEL 4AK1A 3WSQL 1DVSA 3GXFA 3LQAH 5GRVL 5EA0H 5I8CA 3IETA 4OSUL 1S7VB 4M7JH 3O6MH 4ZFOL 2ZPKH 3KJ6L 3EGDA 1BVZA 1L0QA 3SPIA 3ECBB 3B5TA 2JFCA 1LP9B 4PP2A 4KTEL 5JYLA 3ZHNA 4UNVA 3E2HC 5IMMB 1IRAY 2VC2L 4HH9B 4N2NA 3U30B 5BZDB 5IJKA 1YMHB 5K1NA 1IGFL 2NY7L 3QW9A 3W39A 4IOIA 2FEEI 3VRJA 1AFVL 1B4JH 2GT9A 2ZOTA 4S1QL 4KKAC 3LS4H 1N3NA 3GRWA 2OYPA 4RFOL 2C9SA 2FR4A 5F9WB 1KYUA 4NQUA 2K78A 3FRPA 4LSVH 1K2DB 2R51A 1UJ3C 4TL4A 1XGQA 3ZTJH 4HGMA 1RULL 5ADPH 4N8PA 4A6YH 1OLLA 1JVKA 4MQXD 4WTZG 4K8RH 3X3GH 1J12A 5DMJB 4ODWA 1A47A 1ZS2A 3KEDA 3FUKA 1MCRA 3MUZ1 4JO3H 3IDUA 4LPVA 4U1MB 5I0ZA 3TJEL 2UXFA 2IOMA 4F3FB 5GZOC 1A7QH 4A7QA 5AZEH 4J4PC 2DDQH 3OAYK 1WRFA 2N0KA 5KZCB 2PMZA 4JN1L 1E2WA 4DEWA 4NXSA 4NAJA 3L95B 1E5ZA 1N12A 3HCVA 1UD3A 4Z7OE 2VM9A 2G75A 3BH9B 1JV2B 2R2HB 3ISWA 1KCKA 4M7LT 4MZ2A 4QXUL 3L45A 4PCYA 2FIKB 3BRDA 1HTYA 3HZKA 4U6XA 4NHUB 5IG7A 4QOKA 4JR9L 4NPKA 5KVEE 4XTRC 2A73B 1OP4A 2ALWA 4AUJA 2R0LL 5IVXE 4TSBL 5C0DB 1FC2D 3H4FA 4UIMA 1VFUA 4XN9A 2F7QA 1DBML 1KIUA 4PD4J 3S5LA 4XNXH 1EEYA 1VPOL 1NCWL 4JW3A 2DQCL 2X4RB 1T7ZA 3HUJB 4WDIB 5AALA 3EO1A 2CDFB 5IHHA 3ABLB 3MXVH 2FX9L 3RDJA 2Y23A 2V5SA 2ZOUA 25C8L 1I4FA 3PIQB 4NIKB 5IESL 1UD6A 2AXJA 3O2DL 5I1LA 3MQIA 1D5IL 4NC1C 1EDYA 2GHZA 3N1QC 5AW6B 3SQOH 4C56E 5CHNA 1RJZA 3WNJA 5E2JA 1A6WH 3V0WL 4KGLA 4LGSB 3ARDD 2QPFA 3N55A 5IHWA 5E8PB 3FMGL 3GKZA 3OKYA 5D4JA 5E95B 3L4YA 5E6UB 4H88L 4C55A 2HRPL 3BZEA 2A9NH 3EOYG 3CQPA 3BH8B 5E56A 4U4BA 4HISA 5MENA 1YJDL 4ONGH 5DT1H 1RPUA 3BPNC 3RPBA 3D08A 5D5ME 1O0VA 3SKUD 3ZMRA 1NCUA 1DBBL 2DQEL 4QRPE 4QY8B 4TQEH 4OIBA 2J1ZA 1D5ZB 2IAMD 4ALAC 4WZ9A 2XVLA 4FE9A 1MAMH 3UDWC 3QQ9C 3ZZSA 1S7WA 4RNRB 1XL4A 3NH7L 3UC2A 1F42A 2RD0A 4R2GB 1FNGB 3UABA 3H9SA 4N0UE 1HX0A 1Q72H 3AUVA 1F11A 2FUTA 3Q6GL 4OJYA 2XXFA 1Q94B 1C16B 4MD0B 4QRRA 2GC4C 3WIFB 1VKXA 2CLVA 1RV6X 4OLYL 3V0EA 4DN4H 2YD3A 3JWDL 4H8QA 4LPXA 3BUPA 3GIVB 4LU5L 1LJMA 5ENWB 1FSKC 1O9WA 1GR7A 4WLCA 5EU4B 3UZEC 3WJLA 5D7JD 1Z9NA 2JB5H 2ORBH 3PV7A 3DMMC 3C6SA 3GNML 2FH6A 4HT1H 1BZOA 3DX4A 3P2DA 1ZV5A 4WGVB 3QNYA 5JDJA 2XWXA 4O51B 4PD4K 4RGNB 4LL1A 1N10A 4PRHA 4C56D 5EEVA 1PZBA 1PZAA 4NS0A 4X6CE 4XP5L 1W0VB 1GCFA 3OF6D 5HTSA 1AQMA 4NGHL 1LO2L 5GISH 1RIUL 3Q01A 4EAEA 4F5CA 4HJTA 5TDNA 1E6JL 1VCBC 2XWTB 5KWYC 4GUOA 4G6ML 1MJJA 1BMZA 3CU7A 3MXWH 2YEZA 4CNIA 1R4XA 2HTLC 3BZFB 4F7TA 4AJWA 2X28A 2XXCB 3DHUA 3KPTA 2XETA 1HHHA 4M9OA 3S3SA 3IFLL 1ILUA 2H6PB 4K71B 2YS4A 1OK8A 3DVGA 1BIIA 1A1MA 2G4EA 2WIIB 3ECVA 2H1PH 1ACZA 3AU1A 2NY5L 1S7QB 4IRSC 1KELL 2VDLL 4DUXA 5I8OH 1UUNA 3MTRA 4C8XA 1PNCA 4FFYH 3QC6X 5FDWB 1SM3L 5CSGA 3QS3A 2Q20A 3HHSA 2Y1ZA 2C1PA 3NIFF 2JWYA 3FQYA 5IQMA 2RTTA 4XWGL 4Q97A 4QRQB 5HYJB 4IRZA 1EXUB 1QSEE 3L1GA 4KXZI 5LDSA 4UILH 1U41A 3K2MC 5G4OA 2P5WB 2YJQA 4X8JB 4NBXB 1P2CA 4Y9BA 5CSBA 5PCYA 3MUGB 3U79A 4ZMVA 4L0YA 1DE4A 4GIPD 4PV8B 3MLXL 5C71A 5E2UH 4XVSL 3E1F1 3PE9A 1YUKB 1USZA 4PGCB 4OLVH 5DSCB 3ZL2A 4FHJA 3OKEB 3AC0A 4PRIB 5I1JH 4I9XA 3HZYA 3JWNH 2WM0A 4EN2A 3KWTA 1NINA 1P1ZB 1G7JB 2P26A 4XN7A 2QKSA 3S8WA 4RMVA 2DQDL 5C0IB 3HE6C 1GGBH 2BW4A 5C3TA 2FYYA 1NAML 4U6HB 3DYOA 5I0YA 1KB9J 2C3VA 3PHOA 5BVJA 3QXDA 2BHYA 4KRNA 1YEDB 4FG2A 1TVBB 2D4FA 5T3ZL 2HTKC 2LTQB 2OCJA 3KS0H 4AM0A 4MWFB 4K23L 1TZGL 4L0ZA 1CCZA 4NNXB 4JFYA 4P9HL 2V6HA 1K8DB 3MOAL 4POZD 5FGSA 4GO9A 4GAGL 4JRXB 1RUQH 1FNAA 4PP1C 1E4XH 4LBEB 1MLCB 4L8SA 4WU7B 5BQ7B 4HS8H 1HESA 4YSUA 2VXUH 3NRQA 5I1IL 5HJBA 5GS1B 1A9EB 2G2RA 5D7IB 5LGJA 1T4KA 4JFSA 3O6KH 3QZWG 4TUKH 1NTDA 1GGCL 3HI5L 4UAOC 2CO4A 3D2UD 4NJAH 1RP8A 2OK0L 3LVTA 4XBPA 3RGVB 1SBSH 2IDUA 1CI5A 2EUVA 3L3OC 2YSSB 4OCYL 1AD9A 3BKML 3GMRB 4MA3A 3KPSE 1FL6B 1YYMH 2FO4A 5D1XB 2AV7B 4OLUL 4PWFA 1X6NA 5HVHB 3ULVL 3VE0B 3L81A 4F8PA 4HS6B 1KBGL 2A99A 3Q5TA 1DN0B 2MIZA 1LHZA 3D0VA 4IIQC 5BZXA 3ILQC 5INDA 5GS1C 4X83A 3DO3A 1GYAA 4KAQH 4N9GA 3WELA 2WBJC 2MQ0A 1XGZA 5KVEH 4OD1L 4WNQA 4JVPA 1MCSA 5CGTA 1QPXA 4FNSA 4R26H 2B59B 2F74B 2MH4A 1XSOA 1XX9C 3D05A 1CLYH 1MHHB 3G5XA 4JDVB 3LQAL 5EA0L 4P5SA 4M7JL 3O6ML 4NENA 3NSDA 3FCSB 3K1DA 1X5LA 5DJAB 3HPLB 4O5LH 1BV8A 1L3NA 2IAMA 4ORGB 3WL9B 2H3NA 3ZZ1A 1RZPA 1E8YA 1T80A 2OXGA 1WITA 3ZSTA 4AQ1A 3NCFB 5IOPA 3L4VA 4QXTA 1CICA 3LS5H 5K9QI 3ETBJ 3GLZA 1GSKA 1CE1H 2OL3H 2VLRE 1H8SA 4TSAL 1FZMB 3QIBB 2UZXB 3S3DB 3AY4A 1B4JL 4OF8A 1Y6KR 3EW3B 1OSEA 3LS4L 3O0RH 5ELIA 1HHKA 3IJYA 1MRDH 3AW5A 5DRNB 1HCZA 1PQZB 3CQQA 5C7ZA 1KB9K 3WAJA 4DWHA 3RDTD 4FL4C 3KYAA 5LAPA 4A6YL 4YDNA 2D7MA 3RPKA 3T3MB 2NXZB 3D52A 5C0NC 1R3KA 1H3VA 4XMUA 3JZYA 5D7JA 2B4CH 3LEVH 2BVPB 4JO3L 1TKWA 1VZHA 4ZTOL 4XMLL 1ZVSA 1U8LA 3KPSD 3O6FC 1U3NA 5SWSE 1Q9WB 4P23B 2ADGA 5AZEL 3FT0A 3UBFA 3SGDH 2DDQL 3GSXB 1F56A 3KXFB 3P0YH 3PWPE 5D5MF 4FKHA 4R3SA 4N5ED 4C56A 1CMOA 2E7BA 1INDH 1PU0A 5DD1H 3OF6A 4IW4C 3JV0A 3MLUH 3U36A 4JGNA 5GGQH 3UJTH 1BM3L 2GIYA 1JPGB 4HPYH 4HCRA 3SE9L 2YXMA 2ZUSA 4L3EE 5TF1H 1KDJA 2XBTA 1CDGA 4GIOA 4N86A 5D1QD 3VXNA 3VXQA 1RFDH 3ZDYE 2PW2B 3VG0H 2D0FA 3DHMA 2VB5A 5LAXB 1A3LL 1K4CA 1JE6A 5D5MA 4S0TD 5JW4R 3L5XH 5T1MA 4HV8A 3T8XA 5I6KA 5F7LB 1KGXA 3VXUB 3KG5A 3N42B 5DHVB 1HNGA 3GMMA 5ESQA 2LR4A 4FKKA 4XNXL 2DEYX 2W65B 3MRJB 3IJSB 2L0DA 5KUMA 1XF4A 3MFFA 4LLUA 3O4LE 1G6RA 4LVNB 2CO6B 4GSRA 4Q2ZA 1OOAA 2VLRD 4R7DA 1FV1B 1ECZA 2YD8A 4L37B 1P4LB 5EBMA 5J3HD 1CDHA 1UXMA 2BVQB 2VH5H 3GSWB 3OGCA 4JDZB 4N0UA 5DFVD 5DMIL 4UTCA 4KHXH 1UWGL 4ODHL 5LCVA 5I1DA 3ILEA 4OFIA 2XKSA 5I9QC 5AVVB 5KVDE 4HUMB 3SQOL 5A2JH 3SPHA 1TLKA 1J1PL 4OCWH 4GKSA 4FI7A 4LT7A 1A6WL 1G7PB 1IX2A 1NFAA 4M1CD 5DRXA 4GW4B 5BZWB 4P05A 5GZNC 5FM5M 1Q4NX 5DFWH 4UQ9A 4OLWH 4N0CC 2H9GB 5HYQB 5EG6C 1MREH 2CMRH 1XGTA 2A9NL 1A7PH 5BRZD 4EVNB 3WGVB 1DQDH 1E9OA 4RAVB 4RFNB 3MMEA 5TE7L 5D2NA 5SWSD 1J5CA 5BS0D 4KX9A 2VDQH 1KLGA 4L5FE 3DVNB 3WY4A 5IP4A 3PWPD 1LO4L 2LAAA 5KVFE 2DM4A 1JGUH 4LIQE 3RG1C 3GJEA 1IE4A 5TE4L 1E5YA 4IBQA 4TQEL 2QSTA 1HDMA 2MHAB 1D5MB 3W9EA 4HJ0D 1MAML 4OD3L 2VDNH 1XB8A 2EEXA 1WV7T 2H47C 4L3ED 1GSMA 1A6TA 3R1GH 1QX1A 4XPGH 3UO1L 4YO0B 4WI8A 4JFEB 4KKPA 1YNTB 1TPXB 5EU5B 2PXYB 4P3DA 2DLGA 2ZCZA 4KI5D 1L7TH 5MI0B 1BZ9B 3V4PB 4DN4L 4EZLA 3RL2B 4HC1L 1IGTB 5EDSA 4PWIA 3QQNA 3FCGA 3MBED 1DQLL 3HN5A 1I8IB 1XTLA 3D2UA 1YAIA 5CMAA 4I0CC 1CXLA 1ASOA 5H8DA 3OVUB 3Q9PA 3EJRA 3W81A 4M6NH 1W72A 2JB5L 2ORBL 3Q2LA 3ULUD 4CADB 4HT1L 1AS8A 1G7LB 2FT8A 3KJ4C 5EC2A 4BH8A 2IH8A 1R75A 1U91A 1DDHA 2Y1VA 3SBQA 1JYXA 4UT6H 4NN6B 2ED6A 1A7OH 3TU6A 3ZVVA 1JN6B 4JFQA 5B3JE 5F71A 2B08A 3TN0C 1XF3B 2DL2A 4JY6B 3X12B 3PQYB 1L9RA 5B3SB 1ZDQA 4XE5B 5M94B 2HT4C 3LEYH 4JFOB 4BA8A 1ZVNA 2JLLA 4OZGF 2RA1A 5IUCA 4NUPA 1MF2H 5ANME 4PM1A 4E9YA 2W91A 4F9LC 1IAMA 3UTTE 4PPTA 4C54A 1AE6H 2CPUA 3D12B 4PMFA 5GGUB 3VW3H 3MXWL 3BDYH 3WN6A 2W5PA 4Z8FL 3P2TA 1WCQA 5C2BH 1TJGH 4ANKA 5F7MC 4X6DF 4Y4FB 1NANI 3OXSB 2ZXQA 4POUB 2CDGA 4FXLA 5IBUB 2BERA 1S78D 4LAQL 3BXNA 4GQ9H 5DUBA 2XVGA 4Q14A 4L8BB 4OZGA 1ZT4A 2H1PL 2VOTA 5IVNA 2DM7A 3T65A 2LU7A 4M7ZB 3C9NA 5I8OL 2R69A 3UTZA 4LLDB 3J27A 1BQLL 1EFXD 4JFWA 3ZQWA 3EJSA 2CUAA 1KY7A 3BKCH 4K7FA 5T5NG 1ZWIA 1UD5A 3FU6A 4X6DA 3JTTB 4MD5B 3D2TA 3MU3A 2QTVA 2XA3A 3FH5A 4U1LB 2WHVA 3VQ1C 2YGPA 2EXWC 4CN4A 4UILL 1ZGLA 1A5FH 4HPOL 3RDTA 3N1GC 3BSZH 4P4KB 4Q9QH 1VFBA 3PDOB 3SBWC 1PF3A 4AV4A 3WEBA 3PCYA 1OTUC 5A2CA 5E2UL 4PSRA 1THAA 3GFUA 4OLVL 1PYWB 4ATTA 1NJ9B 5G5DB 4FQ2H 4GP4B 3NZ8B 2J6EH 3KPSA 3EJJX 3DX8B 4A04A 5GS0H 1XF2A 5I1JL 2HKHL 1AHKA 3D85B 2MKLC 2L7UA 2UY6A 1JYWA 4LSDA 2BNQE 3MUY1 5IROA 3LRMA 6FABH 4WSJA 2AKRA 4F57L 1JHKH 1VACA 2OW7A 4H0HB 1ZLUH 3Q1EA 1MFVA 1CFBA 4XPBH 4GG8B 5E8EA 4HCIA 2ZNXA 1ONQB 4G1EB 1TEFA 5D1QA 3FU8A 3MBXH 2VDMH 1CQYA 3KWXA 5DRWA 2ZP8A 4ZXBB 7FABL 1TQCC 5A43C 1YQ2A 2QADB 3SPGA 2RCSL 2EICA 5KSVB 1E4XL 1WIUA 2VE6A 4TVPD 2NY1D 1G87A 4L3CB 5FXCH 4LEXL 2VXUL 3GUTA 1PZ5A 4G6JH 3FQTA 5KSBB 1I3UA 3ESUF 12E8H 2J8OA 4NJAL 4LOUD 2DQIH 1YHPA 3VXRB 2OP4L 3B2PA 3SOTA 2VLRA 3NFPA 3PGFH 2KERA 4YZFE 2VUKA 5KYWB 1WS7A 1M6OA 3ZKQD 1GA2A 3HRZB 5AW3B 1YYML 3DRTB 5IJVB 1J9CT 3CNKA 3QFGA 1DLHA 4MXVF 3S35H 2VIRA 3BGMA 3S9DB 2HLFC 3QZWB 4ZMPA 4JL2A 3GSNA 2O72A 5FGBC 4ZUSB 3LXCA 2EDKA 3U0TA 3VMPA 1BG9A 3ARYA 3OR7A 1D7FA 4OUUA 2H41A 2HT2D 2VZ3A 2VMJA 1XGPA 4C59B 2EDXA 3NA9L 5BRZA 4R26L 1AZRA 5FO8A 3VNYA 1Z1WA 5FKPA 1G9NC 5DMYA 5KS9B 1CLYL 1JF5A 3P73A 3GPSA 5SWSA 3QFDB 5BS0A 1AGCA 1X4ZA 1HINH 4U1HB 2EEAA 2NQDA 2CDEB 4YIQB 5E1AA 3PWPA 4NI3A 2XYBA 4JZJC 2ZOLA 4AEFA 1ZLWH 5CLZA 3PL6C 4KI5F 4O5LL 4I1RA 4DP9X 2JI3A 2Z7ZA 4ZMAT 4KJQC 4Y4KC 2HFEA 4EF3A 4WNJA 1N8ZB 4N24A 3NP3A 5FS5A 2ZYHA 1NBVH 2IQAA 4LFHG 4L3EA 4JREB 1CE1L 4O02H 4YUEL 2D8KA 4AXWA 2DW5A 2ZUWA 4WCYL 3FTGA 1KOAA 1Q0XL 1QD0A 1T89A 2G9KA 2HG5A 1BFOB 4MSWA 2P8LA 4MS8D 4E42A 4K7PX 3KPPB 2PTVA 1XR9A 1IC7H 3O0RL 3QR2A 2IGFH 3UOAB 1T5XB 4EN3B 1LP9E 1RIHH 3RA7L 5F89A 1OARH 4N87A 3PUCA 3GXIA 3MBEA 1X5HA 2EDYA 2WQUA 3ISRA 4PV1C 2DTMH 2EDEA 2KS0A 3O4LA 4IJ3C 2ENJA 2FX7H 3BQVA 5FUZH 4X6EA 3RWDA 2B4CL 4J3OG 3LEVL 4TQIA 1IGML 5KVFH 1KV7A 2AZUA 4LIQH 4BH7A 2NSMA 5CJBA 3L9EA 1KCSH 3P0YL 2BSTA 3WN5A 5I1CL 2DI8A 3DUSA 3LQMA 4NLAA 1NCCH 2QGEA 1JDCA 1WFJA 4RX4D 1INDL 4Z7WB 5C0FA 1JF1A 1RJCA 3FT4B 5GGQL 2WZ5A 3QRGH 2HN7B 2BVUA 4YDKH 2ICEA 2F1EA 2EZ0C 2QBWA 3X1NA 4ISVA 2A6JB 1A6AB 2I60H 1FJ1B 2VXQL 1RFDL 4NCC2 4UF7C 1E40A 1DQKA 1PG7X 4K2UH 5FKAB 1SXZA 1A7RL 3CZFA 4PJ5D 5BOPA 1D7DA 1O75A 3GBLA 1B9ZA 1MEXH 5HJDA 3X13B 4N0RA 3Q6FB 3EG9B 4GIAA 3LN9A 1EZVY 4JQXA 4TUJB 3IVKA 1VFMA 4A67A 1T66C 2WYTA 4MHHI 1JGDA 3TCLB 2HVKA 1Y0LB 3WKPA 1YO4A 3RWFB 1J5OL 5CINH 3NFNB 1KWKA 4IKNA 4WUKH 4BE6A 1ZOXA 4LOFA 3ULSB 2C26A 1EFXA 2AJXL 1ZEAH 1LO0H 1N5AA 3W56A 4KKAD 3ZO9A 2YGQA 2FHCA 4FTDA 1QSFB 5C1MB 4AYMC 1K3IA 4HIQA 4NC2B 1HXMB 1E3XA 2O30A 1MHCB 3CC1A 5CUSL 5CEXB 3MRHB 5B3JF 5IB1A 4U3HA 4RSYA 2XQ0A 5L4JA 3NZHH 4G8EB 2WLMA 5HP5A 4KQ4H 2OZNA 3GI8H 4IDJL 4CGUB 1T0MA 1BDYA 1AD0B 1PGRB 2CMRL 4XC3H 2NT1A 1IC4H 3BP4B 4J27A 5H37G 5HDOA 1UHVA 3L9YA 3VFRB 1XGRA 5HHOD 5GZOD 1SVCP 2IANB 3PXLA 3HNSH 1TITA 3JBG7 4J4PD 2CE6A 1CD9B 2KQMA 2VDQL 1YAZA 3LZNA 4QGYA 3SKNB 4GS7C 3IXAA 1MWAA 1WEJH 5E03A 4M8RA 4HK3N 3UX9B 2W92A 4ZDHA 5BJTA 2NUTB 3NJHA 4U6TA 4HCGA 3QNXB 1LE5B 1KC5H 2LABA 4G5AA 5KJRH 1INEL 1YPZF 1XEDA 3MJGX 2VDNL 4PJGF 3V5KA 4AGLA 4IYKA 3T0EB 4NUGL 3CVDA 3MRGA 5ANMA 4ZG1A 2VDOB 5CJXA 3NCCB 4XTRD 3G08B 4XPGL 2GUOA 3HKFA 3MLSH 3VFNB 2FEDC 5FO9B 2Z7WA 2NY3B 5BO0D 4NO0B 3RJOA 4UUJB 2VDRB 3CFNA 4BSWB 4PIRF 1OAJA 4XB3A 4KRPC 5EB9A 1UVQB 2YHGA 4BZ2H 1L7TL 4OM1H 2YWZA 2C9UA 2DIBA 4TOYH 1T6WA 4HAKA 4L4VD 5B7MA 3RHWF 4OQTH 4PG2A 4S2SA 2KPNA 4PTTA 3U1SH 4B9GA 3L13A 4HKJA 2DLIA 3M7OA 4JZNA 1BBJA 4LCYB 4M6NL 2WUCH 4H44C 4NFBA 5LWYH 2GKIA 2D7OA 1AY1L 3HNTL 2EYTB 4NSKB 2BY3A 2UXGA 4ABWA 3HE7C 1PKOA 4G8AC 3FSZA 5E6ZA 1X5AA 4K3GA 4JFFD 1A7OL 1EHAA 3L2NA 4RAUB 1X5FA 2YD0A 4AE1A 2RAMA 3BYYA 4P04A 3ENEA 5FA3B 4E5XB 3QDJB 3OLEA 4OZIF 3LEYL 4DPAX 1KZQA 1YEJH 2WZ0A 3LKRA 1MF2L 1LMKA 2D31A 3RZCA 3QQ4B 3NJMA 2ICWI 4JJHA 2DJ4A 4LEOB 4J3BA 5K9JL 1CFMA 2CHNA 3LNHA 2X09A 1AE6L 1FVCA 1OXYA 3VW3L 3QUML 1L9MA 3US0A 3BDYL 1FIGH 2LW3A 3D0LA 2PCYA 1TJGL 3HBPA 3IFNL 1YY9C 4RGNE 1I85A 4U6YB 5C2BL 2BVOB 3KR3H 2J3SA 1HFUA 3GGWA 3NSYA 3AT9A 3SE3A 4OZIA 2VZSA 4GQ9L 2EIKB 3QQ9D 4GXVL 4WW2B 2ARJB 5AQ0A 1RZGA 4ODUB 2DQ6A 4R7VA 2R2EB 5F1SA 3M1CA 3TBSB 3A22A 1KEML 3U82B 2OR9H 3P9MA 3G5ZA 1ZGLP 3F00A 4HS3B 2ITFA 5IW3A 3BKCL 3L7FB 3OQRA 4IRJB 4TTDC 1OP3K 1QHPA 3TYFA 4FNLH 4FF9A 5IMKA 3V4LA 32C2B 1OF2B 3GDBA 1GZPA 1Q8MA 3DBSA 1RZKL 4HHAB 2PYFA 3V5HA 4S1SH 2ZYSA 4R96B 4KPHH 4UNUA 4X50A 5DVPA 3SDCB 4MDJA 4HJGA 3WY3A 5C8JB 4APQB 5FYLH 4WTXA 2DEXX 4I77H 3EUUA 1UA7A 3DMMD 3U46A 1WAPA 3VYPA 4FQ2L 4JPIA 2J6EL 1JF6A 4G43B 3QFJB 5GS0L 1A02N 4OKVA 4Z7VB 2HB0A 4U7KA 4DK5A 5HYJE 2C7FA 4F9PA 4RQQB 5AAWA 4QO1A 4V1DB 4RX4A 4MQSB 2P5WE 4YBHA 4XPBL 5DF0A 1ADQH 1G5AA 2P28B 3TA3C 4FI6A 1OD9A 4G7RB 4YSDA 5IF0A 3QJHA 3C2AH 5K9QG 4ZFGH 3MJ9H 2XC8A 3OKLA 2ILLA 2AFNA 4FQIH 4PJ5A 4PRIE 4FLQA 2HTLD 4L8DA 3PU7A 1F00I 1KB5H 2EKSA 4JHZA 4RGND 1QABA 1GZHC 1DVYA 1G9EA 1J5IA 4JUTA 5AUMB 4GRWH 1FN4B 1NCTA 2R23A 2WYZA 2UYLB 2OYLA 2HH0H 4TXVB 3DUUA 1QLFA 4P5MB 2J8UB 3W9DA 5MERA 4DKFH 3SDXF 4LCUA 1YNKH 3EHBC 1NMAH 4IRSD 3C08H 4NOFA 5IBLC 4LZKA 3FT2B 1CE6B 1QNIA 4PRAB 2UUDH 3PGFL 4DQAA 4G8FB 1J7VR 3BFQG 3GMLA 3MLYH 1BG1A 1KMGA 2BO0A 3I50H 3FFCE 2YAQA 2A6DB 2EDRA 3DX7A 2DY2A 2V2XA 3G04A 3S35L 3VWJC 4JRXE 3LZPA 3CFJB 2AQQA 4ZNCD 1HKFA 3X11B 3OB0H 1BJMA 4P2QB 3T2NH 1CGVA 1UJ3A 2XKNA 1KPVA 3GSOB 3HN8A 3I75B 5D7IE 3SDXA 2BK8A 4X7SH 3T0VA 3ABMB 5E08L 5BZDA 5FM5O 3G3LA 4DP4X 3LPWA 4KKNA 1MIEL 3SCMB 4EMZA 2IBBA 4WF7A 1S5HA 3RY4A 5HHOA 5GZOA 1IC5H 2I24N 5IW6B 2CHDA 5D1XE 2Q76B 1T2QH 3LV3B 4J4PA 3MJ6A 4MYWB 3ZIYA 2JKSA 3IMTA 1OSPH 5I6PA 2CH8A 3ES6A 1TZHB 2X7LB 2RB8A 3SE6A 2BIMA 2XG5B 3QHZH 1MLBA 3N41F 5ILTH 3NRPA 2VO8A 3HE6D 5FW7A 3U4BL 3MAWA 3V4UH 1TJHL 1BWWA 3VDAA 1O7VA 5EBLB 1QI3A 1KGWA 5BW7C 5HDQL 1UWEH 2WLZA 1UZ8A 2HTKD 4PWKA 1V05A 5I74B 1YDPB 4U1MA 4XN4A 2QZ5A 4OZFA 4F3FA 2VQUA 3VD3A 2QGDA 2Y24A 1IC7L 4HUWA 3C8HA 2F53D 2IGFL 1V7NH 3KH3A 3L95A 5DO8A 1RZQA 1JGEB 3EH5B 4L4VA 3ZT6A 5F88A 3BH9A 4FNRA 5I75C 1QWUA 4UTBA 1CFTA 2X70B 4ODVH 2FJHA 2HJFB 4HP5A 1AZCA 2FX7L 3G6DH 2WNWA 5K5YA 1ETJA 4YQXH 5ALBH 1U4EA 2A73A 1V7MH 3BLPX 3FFCD 4P48A 3KBPA 5KSAC 5CR8A 2BOBA 4KH9A 2FBOJ 2TRHA 3Q43A 5C0DA 1SNRA 1ACYL 1UB5A 3P4OB 4JFFA 4F27A 3NPSC 2FX8H 1NCCL 2VLKB 1NPNA 3ILQD 2Y7MA 4YE4L 1BVKB 3QJSB 4ZUUB 1LEIB 2Y3NA 2XZQH 1MAJA 3DXAB 3ZRCC 2WBJD 2O26U 5A16B 3QRGL 4LVEA 3RWHB 5INCB 2CDFA 2K0RA 4UI2A 1QHOA 5IREA 2DYPB 4HIXH 4UIKH 1MIMH 3QG7L 3TBBA 2NDFA 3T6ZA 4KTGA 5LN4A 1SJMA 3ISYA 3PIQA 1XH1A 4K2UL 1QLEL 4FFVC 1T03H 3KXFE 4HWNA 4ABQA 1BGXH 3QIWC 1IQWH 1U8PB 2EUZA 1CI3M 2WMPA 1K6QH 5I5JA 15C8L 1AZNA 4PJ7F 4WTWA 4G3YH 3UDWA 5E8PA 3N04A 1E27A 4J3OC 2PTUA 4LB8A 2CD0A 1MFBL 5CINL 1N9PA 3STZA 1D9KB 2HXAA 2RFXB 4PJIB 2D03H 1I82A 4WV1C 5EN3A 2XBDA 4G9DA 1WA2X 4R97B 1JGLL 3L7EA 2WWNA 4F15C 3R4RA 3S34H 2NNCA 3VXUE 3NFSH 4PJ7A 4FN0A 2D3VA 3V0IA 2XX1A 1XGUA 3UAFA 3WYRA 5EO1B 3BPCB 4Z3HA 4KQ4L 5C0ND 2FAUA 3GI8L 2BS9A 5C9KA 4RNRA 3UZEA 3EJUA 1IC4L 3VG9C 1J1XL 1YC8A 3DMMA 3UYPB 3O6FD 4ELMB 4XOEA 4TUOA 5C08B 1PY0A 4FABL 2ED7A 2LU4A 2FWLB 1Q94A 3UJJH 4L8CB 1FP5A 1W6LA 1JS4A 3FU0A 1H8LA 4G6FB 3LQZA 3WFHA 3WIFA 2EUXA 3VDBA 1WEJL 2CUIA 4KZEH 1QI5A 2H26B 4KO6A 5HHPB 5L8LB 1P6FA 1KC5L 4ZAKC 1S3KH 2IDTA 5ENWA 3SIKA 3TOPA 5KJRL 2IH9A 4KZDH 1IJNA 2OAAA 2XN9D 4XN8A 2P1YA 4AE0A 2YFOA 5K69A 1U3JA 1I9JL 3BVNB 3CUPB 3MLSL 1XAUA 2Z65C 1UWYA 3FN9A 4MNHA 4NRXB 1CG9B 3PF2A 2VR5A 1HE7A 3KXFD 4O51A 4ZK8A 3RILA 4F1SA 4E68A 1J9RA 5D7LD 4D9RE 4BZ2L 4YEFA 2IJ0C 4OM1L 1I7ZA 4TOYL 4OV5A 1WBYA 1WK0A 3II1A 2H45A 1KZYA 5D7KD 4IRSA 2DWSA 1HC1A 4UOQA 4KKZA 2KLRA 1PJ9A 5BMFL 3REVA 5E9DB 1HH6A 4H2CA 2WUCL 3RLSA 3LKOA 4F2EA 1R5IA 4JFEE 1RAMA 4MRCA 1OGPA 2YMOA 3BZFA 2DZEA 4NYLB 3TWCL 1UC6A 1WZ1H 1J1OH 1S8DB 3QZPA 3VXUD 3GZPA 4N3TA 3IAGC 4XT1C 2X9YA 5GZND 3O11B 1YEJL 4N0CD 1H19A 5KYXB 3ZKND 2YPLE 2EDDA 3CU1A 1JTOA 4BKTC 2BRQA 5I1AB 1OPGH 1A4BA 1MKFA 1AR2A 1NOAA 4OCMC 3IMSA 4MNQB 2E7CA 2F8XC 4XNYL 2AEPH 1FIGL 2B15A 3LPPA 3QQXA 4F8TA 2HJKA 3DJTA 1HCVA 3CX5K 4OI9A 3DVFA 4QRQA 2CA3A 3QEQB 4AT6A 2J43A 1JXJA 3C5JB 5AOKA 3NCMA 3HE6A 3BP7B 2P5WA 2ALAA 3ZLQC 1JGIA 3SPCA 4BWUA 4DGUA 3PQYE 3C5SA 3MNDA 1E5AA 4QAWA 4FERA 4PV8A 3T6QC 5E24E 2V2WB 1X5KA 1FNHA 4F20A 4F92B 4PJ6A 2DQGL 3OHMB 3UXFA 2NZ9C 1KYFA 3EF7A 5DSCA 3T0AA 2OR9L 2YQBA 1UASA 3ME0B 3NABH 2VXVL 4D0DB 4PRIA 5C0GA 4YHYB 4PGZA 4N2KA 1M56B 2F53A 4FNLL 5GGVH 2ADYA 4PLNC 4PRPB 1EIBA 4D9RD 4N9OB 4EDWH 1JZEA 4Y5XC 5D9SA 2LVEA 4JY4A 4H25B 1ZSHA 2E59A 3B5HA 1Z9OA 1G7MB 3UAEA 3F12B 3K2UH 4CW1B 3HG2A 4WW1A 5BUGA 5LBGA 5FYLL 3L3OA 2HVBA 4I77L 3L9RB 3W11C 3FFCA 3RJQB 1MFAL 3DIVA 1QVOA 1K8DA 4XVTL 1NEZB 5BPPA 4U0RC 1IZJA 2Q0ZX 4LBEA 3WKML 4H8HA 1H6UA 1XXFC 5GS1A 1A9EA 1KIQB 4JUSA 4GKNB 1NC4D 4ZD3L 3TN0D 4B6ZA 4Y0GA 1ZLSL 2HT4D 2A6KA 5JW3H 1L9NA 3BAIA 1ADQL 4O2CB 4PGEB 1KPRB 1N59A 3DHJA 4YL4A 2YPLD 1WIPA 1MI5B 4PJFF 5HDRA 3MJ9L 3GJFA 5DQDH 4I7ZC 3UMNA 2BFVL 4I88A 1O6TA 4ZYKA 3O41B 1JCKA 4FQIL 2WSKA 2UVEA 1RJLB 1PSKL 3BVXA 4NKDB 3TC9A 4HS6A 1KB5L 3RNKB 1RK0B 3FB5B 1PJWA 1TVDA 2VUOA 3QDMD 3NK3A 4GFTB 4ZTEA 2E6PA 4HBCH 2HH0L 5D55A 1LDSA 3VXOB 4OIIL 4DKFL 2MCPH 3ZRSA 2IDFA 1BX2B 5TDPA 1BJ1H 1YNKL 4MA1C 1NMAL 3NIDB 2CM5A 4PJFA 3QI9B 4H1LB 4UTAA 1T21B 3FUIA 3EYFB 1CF8L 5H35B 1W91A 3RKPA 1LVEA 3MLYL 2RBLA 2IFGA 4LESA 1CLVA 1EGJH 1BFVL 1KPUB 3C09C 3I50L 3OZKA 4R8WH 1KBWA 1MHHA 4JPKH 5DLMH 4EKXA 5ID1B 1YN7B 3TCTA 4ZSOA 4WRLA 4QRBA 1I1RA 5KYUA 3OJDB 3BAEH 1GOGA 3MRNB 3SKMB 1ODAA 4EDXB 2EXWD 4DVBB 4X7SL 5DHEA 4UQ3A 5KSBE 1JL8A 3UPRA 1PX4A 3K6IA 2BPBA 4NNPL 3VXRE 1OTUD 2P5PA 1FFQA 3TVMC 4AV0A 1FZMA 2VDKH 1IIIA 2UZXA 2ZCLL 5A2KH 3QXWA 4JM0A 4YSCA 3O6FA 3MBWA 1IC5L 1T2QL 1WAAE 3D39E 3QCTL 4Z7AA 1CTMA 4YE0A 4KHTH 1G94A 2C3GA 4GXFA 1FO0A 3FAXA 5IQ9B 5DRNA 1OSPL 1K5NA 1U58A 3CDZA 3H2QA 4K94C 2CKBA 4OTXH 2DWDB 4NT6B 5FYKD 1IAIH 4IRZH 2MNJB 2CNYA 2KQNA 2ZWKA 2VLME 3V4UL 4UM9B 4QXGH 4MHHG 4P2CG 4ZOCA 3MZTA 2XN9A 4WJ5B 2W0FB 3TTYA 3DO7B 3W38A 2J73A 1ZTXH 2WTOA 1NBYB 2JIXD 1FGVH 5KS9E 1OSZA 3ROOA 2ZONA 3BOVA 1AZUA 3HI1B 1EMTL 4NKOB 4PEEA 3U7WL 4KDVA 2AV1B 4AJYV 3KXFA 5EZLA 3UH8A 2F19L 3MLTB 4WI0B 4YFLI 4WTZA 1FCGA 4NRZB 1KCUH 3UG3A 4NUMA 1SOQA 1E7UA 3F05A 4ODVL 2AQTA 1A7NH 1ZSDB 4NN7B 5CO1A 4YFEA 3ULUC 2H7WA 3G6DL 3P4LA 4J8RB 2AGJH 2CJSA 1KUMA 2FL5A 2MQGA 3IBEA 5DZPA 3O8XB 2FCBA 5ALBL 3SYPA 1NCBH 4YQXL 2X44D 3Q48A 3G6JB 1U8KB 5DDHA 1P6WA 3O3EA 5LAXA 4PJDB 4YSPA 2HLFD 3WY2A 5TD4A 3E0GA 1XZWA 5DMGC 3VXUA 4U2ZA 1YMMB 5DHVA 1SYVB 3GBMH 1E8ZA 3TIDB 5L8JB 1E6OH 2QLVB 3TT1H 2XZQL 4B3EA 4XVUC 2W65A 3GLAA 3M8OH 1BF2A 1G7QB 5GZNA 1CT8B 5K9OA 4RMBA 4NZTH 3WNIA 3NDYE 4BFRA 1COBA 2A9MH 4HF5L 3DTXB 3FFDB 3IYLW 1MIML 4V33A 3B2MA 4NQXB 2JLPA 1ZA6A 4BUQA 1LYQA 1DQML 1OHZA 3D39D 1YEHH 2EE0A 2YUVA 4MAUH 4DW2H 1K6QL 2I5YH 1PLGL 3PL6D 1BEYH 3F7PC 2DM3A 4KJQD 1XB6A 4Y4KD 5CKGA 4Z7WE 4BD4A 4G3YL 4NDMB 1YSOA 4FXKB 4GW4A 2DLTA 5HJ3A 2H9GA 5HYQA 4AH2B 1P4BH 1OW0C 3FCUB 1N68A 2VZ1A 5LNDA 1UYWL 1JP5A 2FK9A 4B97A 3FQNA 2D03L 3P40A 5C0BD 3E8UH 4F8OA 3WMSA 5JW4N 4NPJA 1LTXA 2HG0A 3B6SA 5FYJD 3S34L 2DEWX 1JIBA 4WHTB 4B53A 3P02A 5IVOA 4LL9A 1DYZA 1MFNA 2ODHA 1ILSA 1QEWB 5JHDB 4Y19B 2LU5A 3S37H 2Y7SA 3OKKA 1BVNP 2RQ8A 3S5ZA 1KSRA 3LAFA 4E41B 4U1GC 1DVFB 1CL7L 4PG9B 1HOCB 4AIOA 4LAJH 2E6QA 2VSDA 3KYMA 5F7FA 5JIDA 5DJYB 4JFEA 3UJJL 2ERJC 5EU5A 4XCNB 2YN5A 2GITB 2MCG1 1Y7VA 4JHAH 1TIUA 4LASH 3KVPA 1CPUA 4ZO6A 4KZEL 3V4PA 5C9JA 1A9VA 1IGTA 2LGNA 3TN0A 1NC4A 5ICUA 1S3KL 2X6MA 1HWHB 1XZ0A 4HW6A 5DD0L 2PO6C 1I8IA 4CVXB 3WEMA 3EOBA 5ETUA 1KTLB 3R18A 3KD4A 2EZ0D 5KYYA 3V9FA 2YPLA 3L2MA 4IK7A 5C0JA 4PBVC 1HHIB 2OTWB 1F1GA 1S9XA 3WOVA 1DVFC 4MXWH 4A2MA 4DOHE 4F9LA 4YSTA 4XCEB 2IANE 4JFHE 3WEOA 1J0HA 3SYAA 4BCYA 1DJXA 1HZHH 1ZLEA 2JCCB 4CADA 4MMXB 3WGUB 1P9MC 1LLAA 3HB3B 2X4PB 3S6CA 1CFSA 1Z66A 4F7PB 4WEBH 2VDPH 2X4QB 3A47A 1SLWA 3QDMA 2R4SH 4PTUB 4XXDB 1T66D 5EZPA 2IO5A 5CLYA 1QFWH 4JY6A 3U2IA 4W9HC 1X9RA 4ANVA 2B1HL 5DJ8B 2FSEA 3X12A 4R84A 5EZOL 3HLAB 4DH2A 1NFDE 4JFOA 4XCFL 3VYNA 1PEZA 2J57A 5C09B 3T0EE 5H4YA 4YXKH 2ZXGA 1ZIBA 5CEYB 1CLOH 2VUYA 3V9CA 4HXBH 3QUHA 2N01B 2PCXA 4PRBA 3CDYA 1J0YA 4GG6F 4KKQA 4P3CH 3FQXA 4N8UA 2NXYC 3U9PL 4H0IA 4OBSA 3QJXA 1WZ1L 2G5UA 1J1OL 3BWZA 2ZIDA 3OXSA 3U83A 1R33A 3PGCB 3F8UB 1CURA 1PDKA 1OO2A 4GP8B 5F6HJ 3AGVA 3STBA 4L8BA 1I9IH 2WSDA 2FIRT 4I1NB 3SBWA 1Q9KB 3O3DB 2QGCA 3ZQXA 3MLRH 3HRPA 3UZQA 4B9YA 4NQSA 4Y4HC 5F0PB 4ORZC 4DQOL 1R3IH 1ZD6A 4MAYB 2RH0A 1AIFA 4PCKA 3UAJD 4AGQA 8PAZA 3HMXH 1AP2A 4U1KB 5MHSE 1NCJA 5GRUL 1CD0A 1J8HD 2BXYA 4U1LA 1PLAA 3EDFA 2EC9T 1MZZA 3QDJE 1MRCH 4OVUA 1MJ7H 3FF8A 2Z7UA 3APMA 2IDCA 4ODTL 3PV6A 4BHUA 4CMHC 1H6FA 2QVIA 2ESVB 3NIGF 5ITFA 1AXSA 2XLLA 4MCMA 2JIXA 3DOSB 1L9SA 5G5DA 2FEDD 1D6EA 4XAKE 3FN3A 3DX8A 1ICTA 1H3GA 1NZRA 4D0CB 5GGVL 2MNWA 1BFSA 3OL2A 4KRPD 5HYSB 4LKXB 2IPUK 5C07D 2FWOA 3BAWA 2K3HA 3VI3F 4EDWL 4Z3EA 2WBXA 1D5XB 1UUSA 2JCWA 2ROXA 1SUHA 4NOBA 2DMGA 4KJWC 3LH2H 4GSDL 1OPOA 4Y88A 5JXEC 5IHBA 3HBQA 4GG8A 3QEHA 4PFEA 4LARL 3UC0L 2E76C 4ELKB 4P9MH 2CKNA 2PP7A 1QFPA 1VCAA 4KTYA 3TA4D 4FHKA 3MROA 3CHOA 4H0LC 5DUJA 1TZIB 3PFUA 2WVVB 1CYXA 5I76B 4NO0D 3HE7D 4FOMA 5IEHB 1WAAF 4NO2A 1J11A 5T3XD 1UFGA 3V4VA 2ADJB 3QJVB 3KPLA 3HVDA 1KACB 1JPST 4HLJA 5FGBA 4L3CA 2CBQA 2IV8A 2NNXA 4R4BA 5E4AA 3FTVA 5D1ZB 3F83A 3PREA 5EU3A 2R59A 5JW3L 3VXRA 5HHXH 3OX8A 1XSKA 3I6SA 3UBXI 5I8EB 5KYWA 4S10A 4WKXA 1M9SA 2VZUA 2P45B 1JMXA 2X53A 1W72H 3EZJB 4CU7A 4ZFOB 1MRFL 3DX6A 4Y2NA 1WAAA 3D39A 4Z77B 5KS9F 3TF7C 1JNLH 4XPFL 1KN4L 3J2PA 3QZWA 4Z7VE 4AGMA 1LD9B 5CBEA 1NDTA 1U3ZA 4JZJA 4ZUSA 5DGQA 4J3TA 3EYOB 4V1DE 1U8NA 4H2AA 3II3A 1IQDB 2VC2B 5B1CA 1V27A 3QDJD 5PAZA 2MCPL 3BW9A 3ZTJG 4DZ8B 5EOQL 2Q6WA 3O4OC 1I1YB 2Y72A 1JZ8A 4NZRH 4DKAA 5F1OB 5KS9A 1AO7B 4R8WL 1DDTA 4JPKL 1NGZB 2K6YA 3QFDA 4TTDD 2OR7A 5DXWA 4U1HA 3ZYOA 2Y06L 1WQVT 4H26B 3WTXA 2NSXA 1BVNT 1FAIL 2UWEE 5E5LA 1B6DA 2VN6A 1FFPB 4NKIL 3TO4C 3MGTA 2WKGA 2HSIA 3Q0HA 2J8UE 1ZLWK 4HIEB 3EYVB 1N8ZA 3L3KB 5JLZA 1AGBB 4C4KO 4AQOA 1F18A 3PS6A 3IEAA 5I66A 3QP3A 2VDKL 1NMCC 2VLLA 4KRMB 1U8JA 3HS0B 4CSTA 1WC7B 3ARBC 3KPPA 1GW6A 1OANA 4KHTL 2PCFA 4MJIE 3CBJB 1IV8A 1A4JB 3E6HB 5C0RH 3NK4A 2YIHA 3QVAA 3LKPB 4P2QE 1T5XA 1IAIL 4IRZL 1GC1C 4KNQA 5I6MA 1MCWW 3NQIA 4YDJA 3TA3D 2KZBA 4WKZA 2APXA 3AQDA 1Q0YH 1ZTXL 4ADIA 2CRYA 2E9JA 1IGIL 3STLA 4F7EA 2CRZA 4U1SB 5FLVA 3WKQA 3WO4C 3Q3GB 4C4BA 1YNLH 4H8WC 1DBAL 4ZW6A 3PXJA 3F7LA 1RL1A 4PJBB 4UT7L 4X9FA 2K4AA 2ZYIA 1KCUL 3WFZA 1PTZA 4ONHA 1KCVH 5AYUH 2YC1A 3EHBD 1XCQB 2HN7A 3F7VA 4JANA 5IBLD 2APTA 1OGTA 2KLTA 4ZMOA 1A7NL 1MCFA 3QDHA 5LO7A 4BYHA 1NCBL 3QUKA 3RFZB 1U30A 3DWTA 3RIFF 1ZHKB 2Z8VC 5FKAA 3DC0A 1RQ5A 4PHZA 1N0XH 3VSUA 3VWJD 1Y18B 2ENPA 3WXWL 3X13A 3EG9A 4NFDA 4LPWA 4Z7NF 4WGWB 2BRRL 5JIKA 4TUJA 1NGYB 1U3HC 1P4UA 4JO1L 4XO5A 1XL6A 4ZFZA 3TCLA 3TT1L 1RUMH 5I26A 1AGEA 3IDXH 4XNQB 4YBLB 4UT9A 4MNGE 3AT8A 4QT5B 2Q7AA 4M03A 1RZIB 4IBYA 4I0PC 2ZAGA 2OSYA 3L5HA 3QYCA 2ITDB 2A9ML 5IV2A 1EEUA 4PCTA 3FT3B 3ULSA 4AZ8B 1L9QA 1JI2A 5I19L 1HI6A 3FOMA 5D4HA 2DL9A 3UAJA 4DZBA 4MJID 4GKOA 2PF6A 3QQ3B 2F0CA 1TFHA 4MAUL 1HXMA 4HEMA 2I5YL 4Q6YA 2VLKE 2GSGA 5AB0A 1SJVA 1XBDA 4PJCF 5AW1B 1Q9LB 4EZJA 3DXAE 2C1OA 3KAAA 3EZ8A 2VDOH 2PWDA 4YX2H 5FAAA 1V55B 1NFDF 5IVZA 4FADA 1NGWA 1P4BL 3SCMD 4NZDA 2B9AA 3L48A 4X2UA 4A68A 2VDRH 1Z5LA 4IKLA 1FPTH 3FQWB 2IQ9L 1JNNH 4PJ9B 3VCLB 4IBUA 3ZDXF 1AI1H 2B3RA 4YSSA 1GVIA 4D9LH 2O5ZH 2ZX7A 1JZFA 3TO2B 5C07A 2NZIA 1U0QA 3SBPA 3IS1X 1NCIA 2NUTA 4PJCA 1J0IA 2QKIB 4Q56A 3KVDD 5DEGA 4QHKI 3MGAA 1JTPA 1NFDA 5E4EB 4OI7A 2YMTA 4UU9A 4X5WA 1JZ5A 1CR9H 3A6CH 1JTTA 3HC3L 4JRYB 4L1BA 5IKCA 4P46C 4UOJA 3VTMA 3V6ZB 1SLXA 2J6WA 1JZ2A 5AB2A 1ZT1A 1F4XL 3VFNA 1P7BA 1OF0A 2CK0H 3OJMB 4JX0A 3HE7A 4NO0A 4GPVA 4UUJA 5EC1A 5DA0B 4YAQB 3FTXA 1XHHA 4LASL 1VIWA 5DEFB 1E5UI 4LFHD 3GS7A 4NNYA 4L9LC 2EDOA 3MCYA 3BT2L 5F9OL 4AEHH 5EMYA 3QCVH 1ZVHA 5LNGA 3VGFA 2E27H 4N90D 1ZS8B 3RTQB 2NCEA 1RZ7L 2DH3A 3CJJA 1UOLA 4KO7A 3VJ6B 4A66A 3CLFL 2APSA 1LNUB 3Q06A 1BQHB 2NZ1A 5EIIB 3U6XA 1UOKA 4JO8A 2ATPB 3MODH 2P52A 4AZUA 4ELME 5C08E 3D06A 1HZHL 4NSKA 2K9FB 4V11A 4FFVD 5IGXH 3V0HA 2YA2A 4NQCD 4RAUA 5F3BB 1F4YH 2VDPL 1OQOA 2ZWZA 1J9QA 1T7VA 1GZQB 2R4SL 4TNEA 2D0HA 1KCLA 2KC0A 1JZJA 1QFWL 4UM8B 3LRLA 5CCKL 3QDJA 4ZQTA 1HJCA 3DXAD 4J3OD 1AXTH 4JGMA 2VDLB 3DJZA 4YXKL 2XG4B 2P4AB 3QQ4A 4LEOA 4AW7A 4ODXB 3MX0B 4HXBL 1NCOA 4HU2A 3GINA 1GW0A 5AVTB 4ZTPH 2ZWYA 3THMH 1IEAA 3OWRA 4P3CL 3EFFA 2WLIB 5HGBB 3AWGA 3JWNG 5E2VL 5AVYB 3NTCH 3TBVA 4R0LC 4WWKC 3K4DA 2AQ2A 3F7KA 1I9IL 2WKOF 3N1MC 2FEJA 4OJEH 3QISA 2ARJA 1ZKAA 4ODUA 5CILL 3OLDA 3OKMB 3HC4L 5C6TH 3MV9E 1G6RL 1NC2B 1BD2B 1D9KD 1TEYA 2YA1A 1BZ7B 3D18A 3AREC 4NZFA 1R3IL 3ARPA 5E9DE 5T5NF 5H4ZA 4N4YB 4OR1A 4HS3A 3RUGF 3D4GA 3L5IA 4XP4H 1NPUA 4QDGA 4D8PA 3GEWB 4BFJA 2NTFA 5LCVL 4XAWH 3HMXL 2NY0C 5TK4A 5L88H 3DARA 5JO5B 1DBKH 3FQUB 3E6FB 1NAMB 4ZAKD 1NCAH 3KLQA 2WKOA 3FCTB 4R96A 4OF3A 1XEUA 1VZIA 4GBXB 3NSCA 3PRZA 4PRDA 1DJGA 2W60A 3FO2A 4HIHB 4U1JB 4AY0A 4B96A 2HFGH 3T1FA 3FU7A 1KBBA 4IEFB 3S3BB 3S4SG 5MEOB 4MNQE 2X12A 5C08D 4MCZA 1PFOA 4G43A 4JG1H 3OKDB 3WE1A 4FG6C 5FLUA 2DQTH 1GZHA 2FECI 3ZUNC 1M3JA 4J6RH 3OD3A 3SKOA 4UQBA 3EYSH 2W38A 4RQQA 1MFCH 1KJVA 1TYEB 2OQJB 1A3QA 1XBRA 4ANUA 2UWEF 5KJ4A 5EIQA 1G7IB 4DAGH 4GT7A 4M6OH 3LH2L 5J11B 5GGTH 2B9BA 2K6WA 2X1XR 2CA4A 4XBGA 3VVWA 4F2MA 3D6GA 4JFDB 1DUYB 5EEYA 4LDOB 4P9ML 4FQLH 3WFCL 2N3JA 4FXGB 3PPEA 1R1CA 1VB9A 3VWJA 4YWGL 1Y1DA 1U2HA 4EIZC 5A2BA 4JMXA 1BHGA 4PRPE 1M71B 5ACMA 4TVPH 2C9QA 1H5BC 2UWEA 3N91A 5AUMA 4NEHB 1I7UA 5J12C 5C2UB 5LQBL 4MXQC 4P5MA 2N59A 2QSCH 3QO0A 2Y22A 3TZVC 4AVKA 5HHXL 3RYMA 3FT2A 1CE6A 2R83A 1F8TL 3A0OA 3H6JA 2ZSVB 3MV9D 4LEBA 2E86A 3OPUA 1MCNA 4HIJB 4N2HA 4L4TD 3TS8A 5MEPB 3MRBA 1W72L 4LNRB 4AYDC 2EDWA 4YHPB 3MRKB 4HUXB 1G7HB 1NGPL 4UV7H 4U33A 1DN2A 4MJIA 4NQEB 1XIWC 3D3VB 1OV8A 5IJKC 4AL8H 1TENA 3X11A 2VMDA 3IRPX 5JDSB 5D7HA 1AYOA 4A2FA 5MP6H 3SQBB 3HA0A 4JKPH 3RX8A 5BW7A 3IFOA 2BP0A 3SCMA 1PKQE 5J6GA 3EOTL 2NZ9D 5IFHH 1U92A 1FWXA 1CXEA 4YEEA 5IW6A 1OWRM 4JKLA 4W4OA 2CHZA 4HETA 2KKQA 4W4NA 4HD9A 4A63A 1YEEL 2XG5A 3QUZC 3CXHJ 2B1AL 5DQ9A 1JNHA 4A6YB 5AOJA 4MLSA 5DJDA 4DPRA 2D3NA 3NIDE 5D93B 2Z8RA 4WUUB 4XNAA 1TJIH 1TVHA 5AVWB 3S96A 3UGXA 2PCPB 3W11D 1E9PA 2YK1H 5K39A 2R69L 3R8BB 4QRTB 1AOZA 2AMGA 4F1ZA 4WO4B 4JRLA 3U7YL 4CSPA 1OZUA 3N2JA 5IB5B 5C0RL 2HVJB 2YD6A 1G1YA 3CIAA 1J5DA 4LOVA 3BKYH 2PTTB 4IBZA 1JJUA 1RSFA 4JN2B 2DI9A 1I1AC 1E67A 4MKMA 4K8RC 3T0XA 4MNGA 4X99B 2X70A 2VXSH 4J3OF 1HXYA 5D93C 3KGSA 3WD5L 2HJFA 2QFPA 3Q7JA 2WP3O 1YY8B 3GMQB 1R9FA 5I6XB 3ARFB 4PW4A 3LN5B 2VTFA 1H9VA 4FULA 4L3AA 1BZEA 2N1TE 1Q9OA 1MQKH 4H8VA 4JM2C 2PWFA 3HIZA 4M1DH 1YNLL 3GHBH 4E9SA 1RSYA 3NJXA 3A67L 3E3QE 3PWVB 4OGYH 4N6QA 2VLKA 3O2VH 3B9VA 2YRPA 3KLAB 4GEJA 2X42A 3S35X 2IC2A 4XMTA 2WO4A 3DXAA 5CEZE 3A24A 4TMPA 4BFIB 4NQQA 1DUZB 3B2VH 3IDNA 4LLQB 3QYNA 3FO9A 3GIZH 3LCYA 2EACA 5ICXA 5INCA 3RWHA 1PZUB 1P0SE 2BSCA 4LDCA 1JVLA 4XPHH 2YD4A 1T0PB 5A2FA 5CCGE 1AQKH 5JMRA 2GAZA 4AVJA 4Q74A 1M3IA 2A5UA 1LO5A 5EO0B 5F2FA 4N8CL 1FGNH 3GB7B 1F3DJ 1N0XL 1ND0A 4X0NA 1JV5B 1U8PA 4FNQA 4JFZH 4P5KB 5IB4B 3D33A 1RHFA 3T0DA 2F54D 1EK3A 3WFEH 3FO1A 2DRUA 3IDXL 4GOSA 4PGJA 3IMRA 1YQVH 3KYNB 3TVMD 3WV0A 1M2OA 4XC1L 5F7DB 1D9KA 2EILB 2X9WA 1ERNA 1R3LB 3WMPA 2RFXA 1OCWH 1UQSB 2EDHA 1T7WA 1N0LB 3G6JE 1PZ2A 3M6DA 3IXTA 3UIZA 3C87A 4PJDE 1FDLL 2AI0H 1JERA 1OTSC 1OZTG 5GQBA 3CDGB 3SDDB 4X9HA 3SD2A 3AG4B 1WFTA 3BUTA 4FZEL 2B39A 1Z0MA 1UXWB 1YMME 5IB2A 2E7MA 3M45A 1KY6A 4OJCA 1Z0NA 1VA9A 1FNEA 1O7DC 3BPCA 3ZDZF 4PI0A 4ZFFB 4YX2L 4XMKH 1CDIA 5F96L 3RL1B 4QJ3B 3F5WB 1BAWA 2IBZY 1ORQB 2W1NA 3MRFB 3EXLA 5GS2H 3ARXA 3L3HB 4KDTC 3UYPA 1OAZH 1R5VB 2B2XH 2M2DA 5C08A 4BSVB 5ITBL 2A9DA 1A1OB 5HI3C 4D9LL 2O5ZL 3RWEA 1R46A 4MFHA 3D69A 2H26A 5A6IA 3WJLC 1LK2B 3AB0C 3SJVD 5ADOH 1ID2A 4B9KC 3VRIB 2CGRH 2XV2A 5IB3A 5CEZD 4KXCA 1WBZB 4V2BA 4FS0A 1H3PL 2R9HC 5CD3A 1RZFH 3A6BL 1CR9L 2K8QA 1XCTA 3A6CL 4Y2DB 1C5DB 2YD1A 3TWYA 1AYRA 1EEQA 1P84J 3I02A 5C0EA 3WFDH 5HYFA 5IFJB 3T9WA 3BVNA 3CUPA 4HWBH 3VDCA 5JQHC 4OZFH 2CK0L 4KROB 4YPGB 5DK0A 1CG9A 3EADA 3K2KA 4RBPH 1C8QA 2CJUL 2NNAA 2VLJD 4DTGL 1EHKB 3B9EA 2AK4B 5CIPA 1CGYA 3RNQB 5DMGD 3VD1A 3EDJA 5DJCB 1JXKA 3ASNB 5HPMB 2ZKHH 2A74B 3QCVL 2WINA 2E27L 1A9BA 1VENA 3QEUB 4XRCA 3U1QA 1C12B 3IDJB 4LLVA 3UTOA 4Y19E 2NX5B 3C6EA 3MV9A 2DN7A 5E9DA 4L4TA 3MODL 2GJ6D 4RH4A 3KBHE 1N26A 2A1WH 4KROC 2AXGB 1KB3A 4F8QA 3FUHA 5T33L 4XZUA 1B4LA 1A3RH 1JPTL 5IHZB 4NYLA 5GJSH 1S8DA 4RIRB 4BE5A 5IGXL 3DSFH 1KNOA 1F4YL 1WGOA 1WUNT 4HWEL 1EAPB 3OV6A 4DEPB 3CN4A 2P44B 5GXBB 2YXFA 2NY6C 4PJ8C 5JPNB 5DJXA 4QTIH 3O11A 5ANHA 4AX3A 3LRGA 5EU6B 5KYXA 2Z1PA 2YAOA 3V52L 5I1AA 1KCBA 3N6YA 1ZJAA 1NUDA 2Z35B 4Y2LA 3BC9A 3FU5A 4DK3A 4ZTPL 2JCCE 4TVUA 1SY6A 5D2LF 4UQCA 3THML 4G6AC 5EN2A 4K7PH 4HKXB 2IPUG 1FRGH 2BIOA 2E8YA 3MVSA 3C5ZC 3NTCL 4Y5XA 4TNFA 5EZJB 2OS7A 4OB5H 3LH9A 2GB2A 3FKUS 3ZT7A 1EVUA 5C09E 4BA0A 2VO5A 2V2WA 3LIZA 2V3EA 2OI9C 2NY4B 2CRMA 2VSMB 3DPBB 4KJPD 3UBXG 5JHLH 1JWMB 5ESAB 4D0DA 4Z23A 2C5DC 1H15A 4XP4L 2Z31C 5AAMC 4XP1H 4JDTH 4XAWL 2MWCA 3WLWC 5L88L 5IQLA 3D09A 1DBKL 3MNZB 3GSUB 4LLYB 8CGTA 4IMLB 4AMKL 5L0QB 2DIEA 3MV8B 2MEJB 1AHWC 3HG3A 3PWNA 2PO6D 3FCBA 2CHWA 5DWUL 3FYIB 2ZSWA 3AQXA 3H9HB 1YN6B 1VSCA 3GJFK 3SDAB 1QW9A 8FABB 2V7HB 2JKWA 2JSFA 1DVFD 2RMNA 4G70B 2J2ZB 1CXIA 3WNPA 4XXCC 4FQ1H 3BE1H 4F37F 2NQ3A 2DQTL 1ROCA 2O6EA 3HTLX 1PG7H 1D6VL 3RWGA 3QIUC 1MWAL 4TUUA 3TBCA 4NBYB 1W8NA 4DAGL 4M6OL 3IRCA 1C1EL 4PQXA 1T2JA 2EYSA 1TSRA 4O2CA 4N1EA 5T5FH 1S5IL 2GJZA 4GRLC 3UTSB 1PKQA 2ESVE 2VITB 2FVNA 1IFHH 5FOBA 2W0KA 3N43B 4RAHA 3NCJL 4Q6KA 2MPAH 1DFXA 3O41A 4J3XA 1F3JB 1RCYA 4NKDA 2NXYD 2YBRB 3RNKA 1M7UA 4ETQA 4YXHH 4EOWH 3BZDA 2XA8H 2ZUYA 3WIHA 2KDGA 4TVPL 4EUPH 2GJJA 4LVOC 3JQOB 1N4XH 2F54A 5C7XH 3VXOA 1FFNB 4JE0A 1ZE3H 2GBTA 2A83B 3W1ZA 1KYOK 3AY2A 4GAYA 4H1LA 3TVMA 3CZUB 3H1ZA 2E47A 4WU5B 2ITCB 3JYCA 3IGUA 4F7CB 1JHLH 1KPUA 4QI3A 5FK9A 2O6DA 5I30H 1RUPH 4NI6A 5F0JB 3KWWA 1OGSA 3W82A 4Y16B 1RVFH 2GFBA 5KVGH 1CICC 3SKMA 4M48H 2OJZH 4X0KA 2IG2H 4EDXA 5CXPA 4ODBD 5E6IB 1JPEA 4RLDA 3UJIH 2LT9A 4F58H 5IQ7L 1X9UA 5FGCB 1DVZA 2XNAA 3O3BB 3ULUF 1JRHH 4JFUA 3ARGC 4JCMA 2DQUL 2ZCHH 3FB8A 4MAYD 4KMTL 3KPNB 5I8KL 3VUAA 5DQJA 1BFTA 4C47A 3FYEB 4X4ZA 5IQ9A 43CAA 3VH8G 3P3RA 2XJLA 3S88H 1E8WA 2QPEB 4TNWF 2BSSA 4TRPH 1AIZA 5EOTA 3QG6A 2IIJA 3SJVA 5TGBA 2QQLL 3DSNB 4KJWD 5I15L 5JXED 1MUJA 3P0GB 4OLZH 3BP6B 3MYJB 1SOKA 1D3CA 1SUJA 4OKDA 2YK1L 2BWDA 1NBYA 3OBAA 4K55A 4PWEA 3P4MB 1AO7E 5CZRA 1CGWA 3HI1A 3VFPA 4BIKA 1TQVA 3C60B 2VLJA 2CLZB 4LCIH 3EJTA 3MLTA 5JPMC 3VFTB 1JZ6A 4A7SA 2ZOKB 43C9B 2IADB 2KL6A 4NRZA 3KNBB 3RY6A 3CG8A 5SX5H 2HFTA 5AVXB 4G8GE 3NJKA 3SDYL 5CFHA 3AG2B 4KK6C 2H2PD 4WEMB 1OHQA 2G3NA 2YPVA 4OD2B 4B27A 3B1TA 4AQEB 4KVCH 35C8L 3U0PB 2R8SH 3UYOD 4XMWA 4M5ZL 3LYRA 4LP8A 4E9LA 4OGQC 4F8LA 4W9CC 2GJ6A 3FULA 2X4SA 3AWFA 5JQ6L 4M1DL 2FWSA 2FGZA 1BWMA 1E90A 3US1A 2PABA 2WXJA 1NBZB 4ZT1A 1SYVA 3TIDA 4E9RA 5D6CB 5D71L 2J5WA 2F68X 4U05A 4O00A 1M1XB 3PYCA 2VYRE 3GIZL 1J05A 1O6SB 1ZV2A 5FHBH 4YDLB 1OW0A 3MNWB 3MLZH 2JJTC 3DTXA 4XPHL 1AQKL 2H8PB 3BP5A 2AJSH 3QR1A 1QFUH 1UJTA 3OQ3B 4HJJH 4P2OB 3QULB 2RGSA 1R34A 3DBXB 3QRBA 4HG4J 4RGMC 2V17H 3DIDA 4R6UA 4PJBE 3G7TA 3UCQA 3TO4D 3AG3B 1B2YA 3WFEL 3CFBB 4TKWA 1WO2A 4FXKA 4XPAH 4W9JC 1YQVL 3M1BB 2R29A 4Z7UB 4AH2A 2GK0A 1OSYA 1ZXQA 2HRLA 2K7PA 3IJ7A 4KMQA 4K3EL 3D34A 4PJAB 5J89A 1U8MA 2DQFB 3DV6A 1S9YA 1OCWL 2BSRB 3TYGL 3VX1A 2VDQB 3ARBD 1JWSA 3ZTNH 3VWKB 2FBJL 2IH3B 4M43L 2R0WH 4NM4L 2AI0L 1HSAB 3C2SA 1EJ8A 1JK8A 4KNUA 1UA6H 2FATH 1A1NA 1JNJA 2XPGB 2UXVA 2YBGA 5BV7C 4Z7QB 4S1DC 3ARWA 3L3DA 1KCRL 4WHTA 4ZUWB 2VDNB 4BCXA 4G8GD 1F02I 1E4WH 4NWTL 4GQQA 2PO6A 2QJDA 1F90H 2VMCA 4MZ3A 3AT0A 5IIEA 1Q90A 4QXWA 4XMKL 1BPVA 4AEIH 3DROB 1FFTB 2FNWA 1QR1B 1F58H 4LCCC 1DVFA 4P5TC 1SYSB 1ETZA 5HJGA 5D8JL 4GNKB 1WHOA 5DJYA 1P9MA 2JCCF 3IKCB 3VD9A 1JMZA 1DEDA 3FPYA 2PR9A 3QCUH 4X7TA 1B0RB 1HIMH 2E9BA 1RUAL 2FQDA 4QPEA 5ADOL 1DQQB 2R56H 3JZ7A 4LHUB 4DP2X 4CVXA 5ISZB 3MRRB 1TOXA 3BHBB 5HI4D 3WNKA 1F4AA 2AAVA 1UENA 3N40F 4TSCL 2ZKYA 4IU2B 4WI6A 2JCCA 4MMXA 1FBIH 2EO7A 3N44B 4ZUVB 3FTUA 3SO3B 4CC1A 2X4PA 1WIOA 3BI9X 4CVUA 5CD5C 1CXFA 4F7PA 1M05B 1C9SA 3C12A 4XXDA 4JMNA 4PTUA 1U3HD 1N5YL 1OP9A 3U2JA 5DJ8A 1KFAH 2AJYH 5C09A 3HPJB 3MC0A 5KVMC 4I0PD 4UTBL 4WFEE 5DC9B 1C5CH 3QXAB 4JRYE 1I8MB 4P49A 3QUMB 2HLEB 4TVSa 4ANWA 2Q9OA 5DUPH 5LGHH 4LLWB 2A1WL 4DT2A 3FZUC 4XNBA 4HOWA 1A3RL 1TDQA 3QNZA 2P24B 2XTJB 1JHTB 5AAPA 4GSXA 1ZRUA 3DSFL 5CGBA 3WFBH 4BFBD 1EJOL 1QFWI 3H55A 1MJUH 2PN5A 4G1MB 1CYGA 5T1LB 4YDVB 5I17B 1T22A 2OMUB 1VZGA 3O3DA 5FUCE 2FE0A 3ZYZA 2XXGA 1GAFL 2X3CA 2ZKMX 5IT2H 1LO3L 1UCTA 2WBWB 4A7TA 5HBBA 3H3KA 4MAYA 4UYPA 2V2TB 4UDUB 3NEEA 2GI7A 1LXMA 3ATDA 3D4ZA 5E1HB 3EJCA 1AJ7H 1MNUH 4I4WA 1H0DA 3KYKH 2ZUXA 4R5VA 4K7PL 3T4AB 1FRGL 4UQIM 2P47B 3S0PA 5A6MA 4ALAL 4BKLB 3AU0A 5JXEA 3ZTDC 1F13A 3GMPB 1YZZA 3ZE0E 4YLQT 3QS2A 1OAYH 1GPOH 3QUYC 4FMKA 4P46D 2WN3A 2Y2WA 3CFIC 2OMWB 3FQ2A 5F7YC 2Q87A 3C6LC 2E7DA 3DIFA 5IROC 5JHLL 1OAUH 1RU9L 4FYRA 2Y7QB 4U3SB 4Q6IB 3LZFH 3R19A 1TNNA 4JDTL 4XCYB 4GKZA 3T1WA 3MR9A 1YUHB 2NY2C 1KIRB 4LKXA 4KO5A 5F0LB 1DCEA 1QBMH 1H3UA 3V10A 1XVSA 5AW5B 4TL5A 1KLUB 3RWIA 2WYHA 3FXIC 3NP4A 1MFEH 3OPZL 5LBSA 3WSQH 1SXBA 2HT3C 1IGJB 1YCSA 4X4XB 5FFLA 3L3JB 4JRYD 1TQTA 3KJ6H 1II4E 3NRFA 5FCUL 3TBYB 4GY4A 3U4EA 2WVVA 2XIBA 3H9YA 3QEGL 3MO1B 5F44A 3MA7A 3LTVA 2VC2H 3LHPH 2Q7YA 1PG7L 2NY7H 2APBA 1WTLA 3U48A 4DN3L 2PNDA 1J8SA 3INUH 5D1ZA 3FUDA 2FBRA 2WP3T 4H5SB 5JORA 5KTEH 2CO7A 2CXGA 2FD6H 3QWRD 4RMWA 4X7CC 1SDDB 5E8DH 3JV5A 5T3ZE 1DVXA 5IR1B 1QR4A 1OE2A 5T5FL 4BGDA 1N2RB 4UBDC 1SXSA 2OSLB 1UZ6F 4R7NB 5I8EA 3WIIH 3POHA 4RFOH 5HHQB 1I3RA 3S98A 3OXRA 4C83A 1VGEH 2LLNA 3MDJA 2MPAL 2XV0A 2WK2A 4Q58C 4Z77A 2J71A 1RULH 3DURA 1CFVL 4FQPA 1LD9A 3EGXB 3T71A 4MMZB 5SV3A 3ZN6A 3H42L 5DI8B 1IBFA 1XH3B 4WWKD 3TO4A 5C7XL 1AKJD 1AGDB 3VD2A 1TQBC 2Z92B 3MNVB 4OZHF 4Z3IA 3VQMA 4JFDE 4FFZA 1MAKA 1HL4A 1MQ8A 3ULVE 3GSQB 4CVZA 5J9PB 1E9QB 1AO7A 1JHLL 4AQZA 1AANA 4P2RB 3ARBA 4JDEA 4FZ8L 4Y5YC 1KTDB 1NGZA 1RUPL 1R5WA 4HJ0C 3TURA 4MA8H 3ILDA 5FHAH 2NY0D 3PWLB 5KVGL 1M7DB 3PJSA 1A6UH 4M48L 4WWID 2OMZA 3F7YA 3DJRA 5HDWA 3KPRB 4PJHE 5DTFA 1I9EA 4G8GA 4JR9H 1T89C 3EYVA 4M8VA