2JDNA

Mutant (s22a) of pseudomonas aeruginosa lectin ii (pa-iil) complexed with methyl-a-l-mannopyranoside
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
114
structure length
114
Chain Sequence
ATQGVFTLPANTRFGVTAFANASGTQTVNVLVNNETAATFSGQSTNNAVIGTQVLNSGSSGKVQVQVSVNGRPSDLVSAQVILTNELNFALVGSEDGTDNDYNDAVVVINWPLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Engineering of Pa-Iil Lectin from Pseudomonas Aeruginosa - Unravelling the Role of the Specificity Loop for Sugar Preference.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Lectin
molecule keywords FUCOSE-BINDING LECTIN PA-IIL
total genus 20
structure length 114
sequence length 114
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07472 PA-IIL Fucose-binding lectin II (PA-IIL)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.400 Mainly Beta Sandwich Jelly Rolls Calcium-mediated lectin 2jdnA00
1UQXA 2VNVA 2JDMA 2JDKA 5A6YA 1OVSA 4UT5A 2BP6A 5HCHA 1W8FA 2BOIA 2WR9A 4CE8A 2BV4A 5A6ZA 1UZVA 2JDPA 5A6QA 1GZTA 1OUXA 2VUDA 4AOCA 5A3OA 3ZDVA 5D2AA 1OXCA 5A70A 1OVPA 2VUCA 2JDHA 5A6XA 2BOJA 1OURA 1OUSA 2CHHA 2JDNA 3DCQA 2JDUA 2XR4A 1W8HA 2WRAA 2JDYA
chains in the Genus database with same CATH superfamily
2VE1A 3HQXA 4XMAA 2EICA 1AXZA 1QOTA 2WZEA 5C8CB 5GLUA 1NZCA 2G9GA 3LE0A 1KS5A 2VNRA 1CJDA 3H7JA 2ZMNA 1ULDA 2HWD3 1I5ZA 5FZLA 5A3WA 4AVTA 5F9TA 5HI0A 4LQRA 5F3CA 5F3GA 3LOIA 3POBA 1XU1A 1BK0A 3DKWA 3RZHA 5DDJ2 1RL3A 2FCTA 2GNMA 3ZSKA 2J1AA 4Z92B 1GOGA 1SCRA 3ZIXA 1ZRRA 1CIWA 4FQZA 5EYYA 4Y4RA 1AR91 1QXRA 3I2FA 4YW4A 1IG3A 1GKBA 1QH6A 3BOPA 2J1SA 3L9JT 4LUKA 3OGJA 1YLLA 3PDQA 1FATA 4NJ4A 4MGTA 4O7XA 3VDDA 3AP4A 1CIYA 1W6OA 3WNNA 1FPN3 1YWKA 5KHIA 2ZCWA 1J84A 3I2HA 3PUHA 3FLPA 1QJU3 2VZTA 1HQWA 1W3VA 4DUWA 4FT8A 1TME3 1UZVA 5FY9A 2DBIA 1G9DA 4FSJA 4Z8BA 1J1TA 4A42A 2PA7A 2R043 1L7RA 3AYEA 4A2UA 1RUJ1 4R9DA 3RYRA 3H8UA 4GKYA 5IATA 2BU9A 3FHQA 4I2OA 2RV9A 2XQXA 4KWKA 4NIHA 2GN7A 1C1LA 2C5DA 2ZEZA 4DY5A 1I5PA 3CZJA 1WW6A 4INDA 3BUCA 2XLAA 2ZGRA 4G3YC 4AVVA 1YHFA 5EZWA 3I3BA 3BB6A 5LCWL 3FFQA 1PO11 4BE3A 3HWJA 1RUE3 2JENA 4KU8A 1RJ7A 4DIQA 4K7JA 2VW1A 1W2OA 4CP9B 1F4HA 3OCPA 4EWDA 4QQPA 1Q5OA 3R6SA 1SLBA 2XBO3 1LOEA 4M01A 1NE4A 1L7LA 2QZ3A 2XKPA 1HRV1 3AZZA 5F5AA 5A32B 3VB9A 5H9RA 5I0RA 3TN92 2P6CA 5L7OC 2GAUA 4QX3A 5BNOC 5FPXA 4L92A 2ZAAA 3ZYJB 1RUC3 3AYCA 1CZTA 4PF5A 1LGBA 4FAGA 2W0XA 1UX7A 2VQUA 1A78A 2VECA 3N7KA 1MZ6A 3PTRB 1BEV3 3NNFA 3WXPA 3TEYA 2AYHA 2ADEA 2ILMA 1MEC3 2OZ6A 4QAWA 1CPNA 2W2IA 3QBQA 1MEC1 4GWIA 1EAH1 3T0BA 1OF3A 3NMBA 4P9GA 1GBGA 2CWSA 1N3PA 1ENQA 2RG4A 4TLGA 2FDFA 4Q4Y3 3WQBA 1FOD2 2VTXJ 4IEQA 4B1MA 1ULEA 1C5HA 4E4HA 5FZHA 3I3QA 4XCAA 3UKVA 3GNEA 3NKGA 3INAA 3ZXAC 4FTBA 1AXKA 2HLEA 2Q4SA 3R4UA 4EWEA 1NX9A 3CJIB 1I3HA 2X10A 5ACA1 1JBCA 4GD4A 1A3KA 4NPRA 4HVQA 4OQ9A 4CDUB 3MPBA 5FZMA 3VV1A 2PTMA 2IZWA 2QQJA 1XRUA 2WL1A 4GMP3 2BNNA 3WOGA 2Y6HA 2GC1A 3SEPA 5C4WC 2BVVA 4XHXA 4UAPA 2Q0AA 4UWDA 5A7QA 1ND3C 1V6KA 3VBUB 2X53S 2ZKNA 3DPRB 1R1A2 1UYZA 3I7DA 2E32A 2D97A 1WCDJ 3KS7A 4RGKA 4P9LA 2Z42A 3WDWA 2R073 1GYKA 3POIA 4M3CF 5C4WA 1WCKA 2WLQA 2MEV2 4PQ9A 1GQGA 3B02A 2NLRA 3LPFA 1GQHA 1NCQA 3OPWA 4ZY9A 2GN3A 2YUEA 3ZYHA 1WMDA 5FUNA 2X5IC 4AZZA 2A71A 2G4IA 2YY1A 3L2HA 4GKXA 3N9NA 4D7SA 2H6CA 3B00A 4GA9A 4L99A 4TXWA 1W6MA 1ULCA 1JYWA 1WBLA 3DN7A 4SLIA 1DHKB 1NCQC 4N53C 5GJ6A 4AEKA 4AGVA 4LK7A 3OYWA 3NJVA 4EZ4A 1UY4A 4CE8A 1W8TA 4QDRA 4QXHA 2X8KA 2WABA 5FZ3A 1WW5A 1IS4A 3MIHA 3I4IA 1HN0A 3WNLA 1GZ9A 4CUCA 1JZ2A 3VBRC 4LBQD 5F3IA 1S2EA 4YVSC 4Q4W2 1O5LA 2DCJA 3KHBA 5IK7A 1NUKA 2WQ4A 3AYDA 1S0IA 3LEIA 1UXXX 2QQWA 2WNUB 1QHDA 1W6NA 4OVEA 5K0UB 2CDOA 3ALQA 5A7WA 4BB3A 5CADA 3AZYA 3KSCA 1ULOA 1AHSA 1DP0A 4C0HA 4AI1A 4MOAA 1O3QA 1SDDB 3PMSA 2Y6LA 3PVBB 3K4DA 3SCHA 5C3QA 3RWKX 2KM2A 2G1MA 2Q8DA 3POJA 4IUGA 5LWBA 3ACHA 3I59A 4NR1A 4AHWA 4OHXA 1R081 3KF5A 4P9YA 4B7KA 1DDLA 1VAMA 5C71A 3BN6A 3HAGA 2VOTA 5FUPA 2MEV1 3AXDA 3TEWA 2JDAA 1T2XA 1DQ6A 3KQRA 2Q8OA 3ZMOA 1LECA 2YC2A 2VMIA 3ZN4A 2A1XA 2H0VA 4CP2A 4MX3A 4DXSA 5AFEA 2V72A 4Y5TA 3TRSB 4XJAA 1NT0A 2DF7A 1U0AA 1WCUA 1QJEA 4AQTA 1QJY3 1C57A 5DZEA 4BLIA 5BNPB 5LZ6A 1F9KA 1R091 3MICA 4XILA 4E4ZA 2N7GA 2VCAA 2ZGNA 3BU7A 4FAHA 3BPZA 4IV1B 3T2OA 4CEWA 2FZ2A 3J9SA 1W0OA 2VMCA 4LBJA 1IQDC 2C26A 2PYTA 1H2KA 2YROA 2D6NA 4HK9A 2A6XA 5F2WA 4BQ2A 4DB5A 4XEZA 1RVF1 2DUPA 3U78A 2YBKA 3EYPA 5J98B 1HV1A 1NXMA 3U75A 1C8M2 4CEWC 3WUCA 3DV8A 3CIHA 3Q8BA 1UMIA 1QH7A 1NQJA 4HSLA 4Q4X2 1ZZCA 3WUDA 4QX8A 1EPWA 2WDBA 3A21A 4DUXA 4DQAA 2XHKA 1ND2A 1UXZA 1S0CA 1VMHA 5E6HA 2C6SA 3IDAA 3J8F3 5I91A 5FZGA 5FZ0A 1J3RA 1XYPA 2Y6GA 3KLSA 4MXVA 4AFAA 1R082 4RFRB 3SISA 3ZXLA 5A3LA 4M3CE 1JOBA 2WQ8A 1ND2C 4Q8LA 1IKQA 1RB8G 2D3PA 2Y33A 1PO21 1G6NA 3OGVA 1RUG2 1PGL2 2GC0A 4XXAA 1DGLA 1RUH2 3OY8B 5FY7A 3D8CA 3JU9A 5CISA 2MNGA 5CFDA 2CTVA 2VUCA 2W08A 3NV3A 2A3WA 3F95A 3OEBA 3TN93 3KD4A 2H6BA 1UF2C 1VRH2 1ZA4A 1WLCA 3Q8CA 1JYXA 3JBG1 2V09A 3CU7A 2JD9A 4P9JA 4HK8A 4NN0A 3UKTA 4AFBA 2CGOA 5CFDC 1GQPA 5B2GB 3R4DB 4GMP1 5JIUA 1W6NB 3DUIA 1OA2A 2MPFA 5EQUA 1O3RA 3OBAA 2ARAA 2V5DA 4QPYA 3A4UA 1WMFA 2YC4A 2EA7A 2LUWA 5FKCA 3T4HB 2QTWB 3WQ7A 2VW0A 4CCDA 1RVF2 2YC0A 4XACA 3C7GA 4BISA 3AK0A 3K51A 4FPKA 4O65A 4Q0UA 4UW4A 3ZXDA 3AMHA 4LEJA 4ES9A 3GBWA 5HXMA 4NE9A 3FHAA 1IQAA 2RM22 3J26N 3O7OA 1PIV3 4W8JA 3GJBA 5EXOA 2JIJA 1NA1C 3IM0A 3OUHA 4QB2A 5BNQA 1UOBA 5LRRA 3AC0A 2WWUA 2R1DA 5C9AA 4FOVA 2RR11 1SQ4A 2YDEA 3ETPA 3VKLA 4YZ2A 2PAEA 3A0NA 3NJXA 1FYUA 4AVSA 1VBB3 1S2BA 4IEWA 3OGGA 4J1XA 1GUIA 5CIRA 4MZUA 5GALA 5EJZB 2EALA 4KWUA 5DUVA 1NE6A 4Q4V1 5JZGC 5C9AC 4PDWB 5C4WB 3AKRA 5EJ3A 1H2NA 4QM9A 2YU2A 4PHZA 2VZVA 4CCNA 5JOWA 4FPOB 2VU9A 4IEPA 1RUH1 3K48A 1OD3A 5T3NA 3DPRA 2CAUA 2CYFA 4KH9A 2YU1A 4M3CA 4M3CB 4BH9A 1W03A 2VY0A 3HN1A 5GLVA 3NWKA 5J48A 4FFGA 2Y60A 2QCSB 1QOSA 3LDKA 2QE3A 1R093 2WO2A 4HVOA 5FBJA 2KXLA 4B7EA 1POV3 1AYN2 3DPRC 3OSDA 3WP4A 1N1VA 1VRH3 1X8MA 5D8AC 3MIEA 4D6RA 5HV4A 3I3MA 1JUIA 4OFGA 2I45A 1J83A 4HLTA 5C8CC 5JPNB 2HWE2 4KI5M 4H7LA 1LNSA 5E88A 5FOJB 5IHRA 2R062 1C1FA 2IXCA 3ST7A 2AGSA 1AR83 2WFF2 4XCBA 3E5UA 3RJ2X 3B94A 3VN4A 2VPVA 2F17A 5FXZA 2IFRA 5BYNA 2HH9A 5FZ1A 2FMYA 4Q4W3 4BZ4A 3IN9A 4QHBA 3S57A 1X8EA 1HJFA 3WZ1A 3P3NA 2GH2A 5FPVA 3GBFA 3TNPB 3U0ZA 5C5UA 1ND3B 4ISQA 1PO13 1DQ4A 5JSOA 4L2NA 3AKTA 4W6XA 1BCXA 4K9SA 1ZRCA 2XVGA 2HYXA 3FWEA 4AQ6A 3Q9OA 3K3OA 4QX7A 2IXIA 5CZKA 1V0AA 2ORXA 2R7EB 2WFF3 1SFNA 2UY8A 2X09A 2D5HA 3U14A 4IV3C 4FTEA 3BOWA 2WINB 4YW5A 5FXXA 3WF1A 3NJYA 2B42B 2W94A 5FYIA 4J6GA 3ZPYA 2A3YA 1NLSA 1XOYA 1UOFA 3ZDVA 2PHUA 1UW8A 3HVDA 1V9U2 1BYHA 4BCUA 4RGGA 2BWAA 1APNA 5FY8A 4O61A 3FBYA 3RZJA 1VJ2A 2MEV3 2ZJCA 4NRPA 5FYUA 2Y6FA 3VGIA 2FCUA 3C7FA 2W9XA 4FCAA 4HFSA 4WZFA 5FK7A 4FBFA 3LOBA 1FV2A 3AZVA 2DYCA 4QT6A 5FK8A 1MQTB 3POYA 1TMF3 2DFCA 1JI6A 1VBC1 3ACGA 3OJBA 4LHKA 4CCMA 2R061 4E4DX 2JECA 2JICA 2XDVA 4LKFA 1XNKA 1MACA 3LGRA 1BXHA 1XBFA 1NZIA 3CNAA 2E6VA 1W8FA 5I8SA 1U5IA 1YO8A 1PIV1 1UZWA 4NRMA 1XE8A 4NHXA 4TSVA 4XW3A 5GLWA 1V70A 1S55A 3MFAA 5EYXA 4D6SA 4DEQA 3TAYA 2JG9C 2BUKA 3ILNA 3KQ4B 3ROUA 2FDJA 5KHKA 2WNVB 1BBT3 5ABJB 5I0UA 4CEWB 2J22A 1HJGA 3THCA 1RUC1 5DUWA 1G9CA 4SBVA 4ARXA 1PO12 5FMBA 2VGDA 4AG4A 1DFQA 1RUH3 3FUOA 2GALA 4PLNA 3IMNA 4LXLA 3RQ0A 5HCFA 1GICA 3D0JA 5CB7A 2ZHMA 1PZ7A 3VKOA 5JXHA 3KV4A 1D0GA 3DKQA 5LY2A 1F2NA 5LEJA 1D4M3 1DGRA 5ANQA 1RYYA 4EQVA 4AI0A 3M4FA 1VBD3 2XJSA 5FMOL 1QDCA 1PK6A 1ULPA 2WLPA 2WSUA 1CAWA 4PT6A 4FP2A 1MS9A 1PK6B 4I02A 4QHOA 1TG7A 4V1PA 5DAVA 3OD4A 1XE0A 3V65A 2D40A 1PIV2 3B3QE 2YFUA 5DAWA 4GB33 3MO4A 3NVCA 3PIGA 4YZ4A 5CYYA 3ZXGA 4B1LA 1ZRFA 3AP9A 4R9AA 1HKDA 2RMU3 3ZYFA 2VJXA 1N3OA 5FCCA 1RUD3 2EAAA 1BMV1 3H1YA 2I2SA 3NNLA 2WNEA 1ZBE1 2C9AA 1VBE1 1W8NA 3CL1A 1H8VA 4IQPA 2B7YA 5IWFA 2ZKLA 2BTVC 3AP6A 2C4XA 1D2QA 4Y1YA 5F5IA 5FR3A 2VCMA 3IPVB 3VBHC 3FUQA 4XQ4A 1QJX1 2ETEA 5FLJA 3N7LA 1C4RA 1WMEA 3BKZA 2W3JA 2YGMA 5LBCA 2DBNA 2WZR1 3H50A 1NCQB 3VBHA 4HXCA 2VR4A 3ZSMA 2E53A 4N43B 1W05A 3OUIA 2ZX4A 3VUOA 4ZS3A 1AYN3 3WDXA 1WW4A 5LA1A 2FDKA 5T52A 4I0BA 5A3PA 1OUXA 3KT4A 5LBEA 1MQTA 1S0FA 2VUDA 3MFCA 4IEUA 2WA3A 4WZCA 2HWB2 2QZ2A 1UU4A 3LEGA 5C3OA 4BYYA 3N9LA 2QQOA 3H3LA 1Q8SA 1QKQA 1ZYBA 2XMLA 1YI7A 2QQNA 2UU8A 3FL7A 3V64A 1F35A 2JDUA 3HN3A 4JGYB 5FZ7A 2EIDA 4CCEA 1QXPA 5F8PA 4E8CA 2IC1A 4XURA 4R9BA 2HWF3 2DCYA 1B35B 4OCTA 1YC61 1WGPA 4OMDA 4R4XA 1GWLA 3C3VA 2BFUS 1WWYA 1UPSA 4GALA 1DYOA 4YVWB 2DVBA 3EQEA 4YZ3A 1PZ8A 3SKVA 3T1MA 4ARYA 4AE2A 5LEKA 3NSTA 1LAJA 2RVAA 2ZEYA 4GH4C 4HL0A 4XQDA 5F6LB 2WT1A 1RINA 4WVVA 2A6WA 3PL0A 2I07B 2UYAA 5GZDA 4AOCA 4LBMA 4XC9A 4GWNA 2VMHA 1MS1A 4I3PA 4C91A 2PHDA 4CP0A 4DXZA 1OURA 1QJX2 2ZX0A 3EBRA 5EFUA 5KHHA 1CPMA 3IDEA 3MEPA 4JKMA 1XYOA 1RHI2 2NYYA 3WCRA 3SLIA 3UESA 5FXWA 1CN1A 2EXKA 2EIGA 1K45A 1UYXA 2NZ9A 3C7OA 3E6DA 4QXKA 5A33B 3ETQA 4AEMA 1MZFA 1AXYA 4CU7A 3H8RA 2BGPA 3WSOA 3BTZA 2ARBA 4GB32 4HPKB 1VBD1 4KMQA 3W5NA 2AR6A 3W5MA 4Q4Y1 1B35A 1HB2A 1XSRA 1GOHA 2SLIA 2HWB1 2LS6A 4AEDB 3CDZB 1CVNA 2E63A 4BQ4A 4P08A 3RYPA 4IDZA 3THPA 2XKOA 2ZAHA 3ZVXA 1YQ6A 5JAXA 4Y22A 3BTYA 1W2UA 3ABZA 2VBPA 4CXWA 4Y5Z0 1R092 4YGBA 3SNMA 5C3SA 2D6KA 4KL1A 3WP5A 2E7QA 3ZM8A 5FXVA 3GDBA 1VMJA 4JDNA 1RITA 3LD8A 5JVVA 4Q1PA 4Y20A 1A8DA 2PHRA 2OUHA 4BIOA 2K9ZA 1OVSA 2DFBA 2Q1MA 5JSPA 3EJKA 2BGOA 1DG6A 2CNAA 1BVVA 2ZGSA 1MPXA 3ITQA 1N47A 5FPZA 1SBFA 5FY4A 5JMOA 2AREA 4JQTA 3WNPA 5FP9A 3PUQA 2XL7A 1XXNA 1NYWA 5IW0A 1JYTA 1IOAA 1F31A 2JWPA 4QX5A 4XUOA 1UPIA 2J7MA 3MDPA 4FPYA 3JQWA 1K5MC 1UZZA 3N9QA 1RHI1 4Q1RA 3RSJA 4EN9B 5CFCC 3ZN5A 1YQ5A 2HEWF 4RR3C 2RS11 3W59A 2J1VA 4TZDA 2XR4A 2QQVA 1OC1A 1RMU1 4LO6B 3QCWA 4M4RA 4QU1A 1LHNA 1JYVA 1G9AA 4B8EA 2WA4A 1BLZA 2XBO2 1O91A 4HT1T 1GMMA 4GB31 3IAQA 4W6YA 2R072 1VBD2 4UI9L 5CFCA 5AC91 4RFT0 4CDQC 2RMU1 5FY5A 3S7IA 2BOIA 3ILRA 3PIJA 1Q43A 1MZEA 1FAYA 4UFKA 1JUHA 4X6QB 4W65A 1RTVA 5IVYA 1VRH1 3WW3A 4CDXA 1US2A 2BBAA 3WD5A 5C5TA 2FDHA 4ES8A 3VBOB 4X8PA 2YBSA 2ZX2A 3I54A 1AR72 1O4ZA 3HOBA 1U5ZA 3NAPA 1CAWB 1S0GA 1H9PA 1HN1A 3B9IA 3USUB 2VAUA 1OH4A 3KT1A 5DDJ1 3NQHA 1AR61 3AL5A 1PVC3 2F4LA 2ENRA 4Y5SA 4HANA 1H30A 4N7UA 3WW1A 5K7PA 1AYM1 4A7ZA 1ALYA 5I0DA 2LRPA 3S7EA 3TWIA 2EAKA 3DF0A 4R52A 1VAKA 5CBLA 1OOPB 2P3YA 4RS5B 5A7SA 2Z2SB 3LFMA 3T3YA 4K3UA 4F83A 3WT3A 4QD2A 1RXFA 1MZ5A 3HNMA 4FFHA 2W5FA 3VLBB 1QY4A 3LSDA 2V4AA 4YW3A 4EYUA 4DNYA 1HRI1 3LWCA 5FAXA 2RS12 2DV9A 1RVF3 1KD7A 1LEMA 1QJZA 2XBO1 3AFGA 3BALA 1GR3A 4DFSA 2Y34A 5A3TA 3M8LA 2UY9A 4FPJA 4UFJA 4LNVA 1XNBA 3WNMA 4ONUA 4ZXKA 5JI7A 1V9U3 1PMJX 3UYJA 4N8MA 2WS92 2BNMA 4PIZA 3WG4A 4BA6A 1SLLA 4K1YA 1OKOA 1LHVA 3FZ3A 5FYTA 4Q0VA 5JOYA 4UF0A 2JDPA 1KEXA 1UU5A 5IAVA 4JQRA 1AYN1 1HDKA 5LK7B 4JTOA 4LBLA 1Z0HA 1VBC3 3ZR5A 3K77A 3LSEA 4WM8B 2VZ1A 4AFMA 4A41A 3O1MA 1YIPA 2VBBA 1Y9GA 1VR3A 3JUUA 4FXKB 4AHYA 2QJVA 3N3HA 4RL7A 2W1SA 4FP3A 2BQPA 3KMHA 2DU0A 1OQ1A 4Y24A 4YM0A 3VHRA 1HRV2 3BTXA 5CG8A 1BVP1 1JYIA 4ASKA 3DXUA 2ZABA 3I59B 4CCLA 1YFUA 5H9PA 3WDVA 2W95A 4C1XA 2NQYA 1W8UA 2WNUC 1JW6A 3LA2A 3WV6A 1BZWA 2MHFA 1OHFA 4PF1A 4H14A 4FPCA 4A45A 3CMGA 5AFBA 4MXWB 2XJVA 3RZKA 3P3PA 1GZTA 3S5QA 2QUOA 4CDWA 2WNUA 3WQ1A 1UIKA 3LB9A 4CU6A 1LOGA 1VALA 1EYBA 4XAAA 4MV2A 1MEC2 4H3WA 1EAH2 5ISLA 2A75A 5DUXA 3LIHA 4LBOA 2VVDA 4BMEA 4W50A 2HKXA 1B09A 1RUG3 2PN5A 3THDA 4C8DA 1GWKA 3AXEA 5KR7A 2WS91 4AAPA 5L19A 2E31A 1WA6X 2O8QA 1O4YA 2HWC3 3HQUA 1H8TC 2HWC2 3R0RA 3PUAA 3R4SA 4MHRA 3VKNA 2ZHLA 3J7HA 1AJKA 3DYMA 2GNDA 1UMHA 2GNBA 3MGUA 4BJ0A 2Q8CA 4QU2A 4NO4A 4AHXA 5C8WA 1VB2A 4IESA 4PI2A 2HBUA 2Y0OA 5EHDA 5KHJA 2OYZA 1EUTA 1YYNA 3ATGA 1WMXA 3UGGA 1S2KA 3JB4C 1VIWB 3OD0A 1SLAA 2Z69A 1R1A1 3N35A 3O0WA 4TYSA 4OHVA 4CU8A 1NLQA 3HT2A 1R1A3 5T50A 5FMDA 5JLVA 2JE9A 1VBA3 4I0AA 5GM0A 5JOZA 1RUI2 3FBMA 3NO8A 4JCKA 2OQ7A 4YVSB 2ZGOA 2BBVA 1YEWA 1Y3TA 3HIFA 3NNGA 4UFIA 4JHTA 3WHTA 3MIBA 1DF0A 3V56A 5BY5A 4D3WA 4CDUA 4M0HA 1ASJ1 2O8OA 2B9VA 3FE5A 4XXPA 1YFYA 1OBNA 4FFFA 3O0VA 1CJPA 1UIJA 1WA4A 4W4ZA 1FMD1 1GP5A 4LIVA 4MGYE 4BQXA 1GNHA 4BMBA 4LKSA 5FQ0B 2XJRA 5K0UC 2UWAA 2XVKA 3NKTA 5CEHA 2VZSA 4HG6B 4OI1A 2OQ6A 4NAMA 4GAZA 2VCBA 1IKPA 2L9LA 3MV11 4PCRA 1L7QA 1XU2A 2WRAA 3I2KA 5C7GA 4CEYA 1WKYA 4L9BA 4Q4W1 2YHJA 3URFA 2WYSA 1GP4A 1AR93 5JOXA 4AXOA 3VDAA 1Q8OA 5A7PA 4LORA 4XFFA 5FLIA 2WKKA 4YNIA 3WF0A 2K46A 1RUF1 4HOOA 1ZZ9A 1WZXA 4XQWA 1JU3A 4CEYC 4AK3A 4MGZE 1UN1A 1W6QB 3NW4A 1OF4A 2VOWA 3LIGA 5T5LA 3I2GA 3ENRA 5LK5A 3UNPA 3V0AA 5IVVA 4PLOA 2HWF1 1OKQA 1QJX3 2VO5A 1TME1 3ZYPA 1W06A 1F15A 2W52A 3KCCA 3OY8A 3BGAA 3WF3A 1V6MA 5J37A 1JODA 5J1XA 2E33A 2BEOA 3NNJA 3GZAA 4P9WA 4P9XA 4DINB 1D4VB 3A7QA 5IK4A 4JDOA 5L7OA 1BMV2 4XMIA 1XNCA 2IUWA 2AUYA 3ZKYA 2CDPA 4DZGA 1NG0A 1ASJ2 1TQ5A 2SBAA 2CU5A 3VHPA 2VD7A 2RS32 4YGCA 5B4NA 4DRVA 1ZBA2 4BWOA 5KC6A 3BI3A 3IDCB 1QU0A 4L97A 4UF0B 1U5YA 3T2PA 2Q1ZB 3J8F2 2VQTA 1RIRA 4NPMA 4NIGA 2RDNA 1G7YA 1DQ2A 3ACIA 2W46A 4QPIA 4AQSA 5FP3A 2ZMKA 4GXLA 4Q5OA 4WM7A 1TEIA 3J4UH 1PMIA 2KR2A 4QX2A 2HBTA 1JYCA 2HEVF 5EJ1B 3UV9A 5GZGA 1C8M3 2JDMA 1LULA 5F39A 4G9SB 2EIBA 4QPIC 1Q8PA 3CJXA 4CYDA 5F1RA 1I1EA 3HBZA 1HIXA 4AYUA 4IV1A 4XZPA 3CKHA 4ET7A 1ZZ7A 4FPGA 4E2SA 1PM4A 3VD9A 2VH9A 3RWNA 4RQPA 1VRBA 1ZBA3 3VDDB 1YNAA 4YW2A 2AEZA 1BEV1 3SH4A 1T6GC 2VZPA 2WUHA 1BK1A 3DGTA 3Q8EA 4XDOA 3H9AA 2CSGA 2JDZA 3FLRA 4NRQA 4K21A 3SCGA 3B5LB 4RQPC 1V6OA 3DCQA 4N7IA 4DXRA 1PGL1 3HPNA 3OF1A 3S5AA 4IEVA 3WDUA 1JYNA 2WFPA 1UKRA 1COV2 3VBOC 2JDYA 1UMZA 3N7JA 2RS51 4XZUG 3I2IA 4YW6A 3ZDSA 1Q8VA 5C33A 2PHWA 4RA0A 4NMIA 2EIEA 5F5CA 5DUUA 3VBOA 2XGXA 4RHV2 1ST8A 1V6LA 3SQOA 5JCTA 5FYBA 2WAAA 1W6QA 2BYVE 3POSA 4OUMA 4LBQA 4QM8A 1H6YA 1N1YA 3B7MA 4XPVA 1AR82 3KGLA 4GZ9A 5F32A 3I49A 4DOUA 1G8WA 4KBZA 4E27A 4ZXEA 3VKFC 4O9EA 2XL9A 2R1BA 2KA3A 3FJSA 3CBNA 5FYHA 2DU1A 2QQLA 2ZGMA 3WDYA 3IDBB 5FO9B 1FPN2 3VBSC 2XHNA 1AR73 3HNBM 3H8OA 1J3QA 1S0JA 4YFZA 2RR12 2RR13 4KWLA 3AFKA 2PMWB 2TUNA 2W87A 1AF9A 3WNOA 2BVBA 5FP8A 1W6MB 1NQDA 1TZOA 4JC1A 4QQLA 5J3UA 3OG2A 4OHZA 3EO6A 3VBSA 1AR63 1HW5A 1ENSA 1MS8A 5LB6A 1NKGA 3RMXA 5A1AA 2BW8A 2PAKA 2E51A 3R05A 2A7AA 3J7LA 3ZSEA 4E9KA 4Q4X3 3OBRA 1COV1 4WVMA 5HV0A 3ME2A 2Q30A 4Y20B 2RS52 1NAEA 3NRUA 2J1EA 3PHMA 5FY0A 5IUQA 3VBUA 5FLHA 5AC93 1PMHX 3TOJA 4BQ1A 4ITCA 1AL22 1Y4WA 1HV0A 4COYA 3H1MA 4NHMA 2VZUA 5FRAA 2OT7A 1NCRA 2GU9A 4D0QA 3RGBA 1SFYA 2F6BA 4QDQA 4M00A 1H4HA 1H0BA 3VBUC 3AVSA 4NAOA 2B39A 3N36A 4YG3A 1SACA 4EN8B 4AEDA 1V6NA 1LOCA 1AR81 1NCRC 3GXUA 2VQ0A 1YRZA 5A6XA 1QOOA 1TVGA 2KD7A 4KQ7A 1DU3D 1Q8QA 3ZFFA 1DCSA 5C6CA 5KBFA 3RG0A 2DCZA 4AEDC 4BDVB 4E2QA 5FZ4A 3ES1A 4K6BA 3UJOA 3W20A 5FPBA 2D7FA 4BOWA 5FOBB 1PGSA 2Z4FA 3GYDA 2HWD2 4G4FA 3WEZA 2JJ6A 2RE9A 3FMGA 4XFIA 1KJRA 2OW4A 4QQ2A 1CZSA 1JXNA 1O3TA 2IVIB 3IAPA 4D8MA 5J7MA 1UL9A 5FO7B 4CZSA 2J42A 4Q8KA 3D0SA 4R9CA 1YI9A 1JZ4A 4LE4A 2VL4A 4OMCA 4Z2AA 4J25A 3JD71 1GV9A 3ZFFB 4I3GA 4CCCA 4PLMA 4LLOA 3MUZ1 3EB7A 3N9OA 4X8NA 3TN91 4QPGC 1XQNA 3IIAA 1RUD2 5L9BA 4TTGA 1AL21 4KG0A 3UL2A 5A1FA 3FLTA 3F2ZA 1U12A 2VG9A 4RN5A 3ZMNA 1ZREA 4PJYA 2HWB3 1FV3A 4NWWA 1XE7A 4OHYA 2JG8A 2B5HA 1EY2A 1QJU2 2QQUA 1W2AX 4J1WA 4N43C 4QPGA 5FYVA 1RJ8A 1JN2P 3LZZA 4AF9A 1LRHA 2ZMLA 4DS0A 1JZ6A 2PLV3 1ZVFA 1UNBA 5KXDA 2JG8C 3H1WA 4CDQB 2UYBA 2PLV1 4N43A 3KV6A 4NVPA 5DZFA 4CP1A 1NY71 1D0HA 3OTFA 3A0KA 4IE4A 4UYBA 3VD5A 4YPJA 1FOD1 4GWMA 1K3IA 3IBMA 3H42B 2XJQA 4NHKA 4X6RB 3I97A 3VBSB 3AMMA 4CPBD 2XH6A 2Y26A 4MUVA 2RS13 2VMGA 3VDCA 4BXFA 3ZSLA 3MZHA 3AMNA 4JX0A 3TBDA 4LE3A 4K20A 4GIQA 4I01A 1MS0A 4N90A 3I8TA 5D8AB 3WF4A 1IG0A 3JD72 1KRIA 1QWRA 4K8FA 4FXGB 4XVHA 5D2AA 4RS5A 3A23A 3MPPG 3E6BA 2JDNA 1O8PA 2Y8KA 3POWA 3SH3A 5E8AA 3RPQA 1SFPA 1UD1A 1O4TA 4RS5C 5KWRA 3M3IA 3D6EA 1YJKA 2DVGA 3C2UA 3LEMA 1C3HA 4K8RB 4QXCA 1CX1A 4JZRA 4QDSA 4COUA 1QJU1 1W8OA 2K2SA 2W1QA 2WO3A 5JSRA 5I0TA 4LO4B 4CUAA 1H2LA 1TNFA 4LHLA 5L73A 4CVUA 3UT0A 1WW7A 1OPOA 4FPHA 1O59A 3PUIA 3ZFGB 3SH5A 5A6QA 5C8CA 5LRSA 1QXJA 3RS6A 4KGQA 5FZIA 5IK5A 4QGLA 2JX9A 3U4SA 5GZFA 4LHNA 1EP0A 2A5ZA 1GNYA 4L8QA 3UGFA 2LW8A 4CA9A 2GZWA 1VBA1 4QKDA 4BQ3A 1RUF3 2WNVC 1MVQA 1UU6A 5FZBA 5LY1A 2IXJA 4RQPB 2C0ZA 1LHUA 4YFWA 2CY6A 4XUQA 1DQ5A 1JTZX 2HEYF 2LTNA 5BXXA 3T1LA 4I30A 1CAXB 5KC5A 5A3NA 5CU1A 4OI2A 2A6ZA 1RUE2 2WNVA 3NV4A 5FYSA 5IK8A 4MHUA 1Y43B 2WSVA 4QX1A 3MLJA 1HRV3 3T0AA 4S2HA 1O7FA 2PHXA 2Z5WA 4Y1ZA 1XNAA 3THTA 2D5FA 4QPIB 3WF2A 1X36A 2ZX1A 3AJZA 1O3SA 3AYAA 4IV3A 4JGZA 5SV8A 1OUSA 4Z82A 1EUUA 2ZHKA 3M1HA 3E97A 4P02B 4UFMA 1HQLA 2ATFA 4XTMA 1M06G 2YFZA 1LOFC 5F7UA 1A8MA 4LK6A 4JVAA 1KGYA 4DMIA 3I3EA 3ZO0B 1TMF1 2D6LX 4JGZC 5H9SA 1BBT2 4IEXA 2IXHA 3LF7A 3U07A 4AI9A 2P6HA 2JG8B 1SLTA 5AVAA 1LEDA 2LALA 4Y22B 5FREA 1LOFA 2YZ4A 1DLCA 2W68A 3SEEA 2P34A 1F5JA 4OYUA 5D1IA 3UKNA 1OPMA 3GZEA 5FZKA 2GMEA 4AFDA 4FPEA 2WNOA 5T5PA 2YBPA 4CXXA 1C8M1 2ZHNA 4B4QA 4NWVA 2XLFA 5ACA2 2VZOA 3LCPA 3POFA 5EPAA 3UJQA 1QQP2 2JG9A 1RUF2 1UZ0A 3PLQA 4ISRA 3WW4A 4B3NA 3KHCA 5L36A 4IE6A 1DLLA 1REFA 4OI0A 1EV13 1CAUA 3BYWA 4UOJA 4META 2WJSA 5FJKA 1UAIA 4D94A 1CONA 1ZNPA 3BTAA 4JHZA 1W04A 3QD6A 1X82A 3MIDA 4ZU5A 3ZR6A 4ZS2A 4PIXA 4CEYB 3HBKA 2NMNA 1ZM1A 2Y64A 2ZXQA 4LBKA 1P8JA 1RUG1 2X29A 1W9SA 4Q0QA 1KJLA 2GSYA 3JZVA 4RGAA 2D6OX 4C1WA 3O14A 4D6QA 2G19A 3GF6A 3K3NA 3QH6A 1VLNA 1VBB1 2W92A 5K8SA 3T08A 3RRDA 5EIYB 2XUMA 1TMF2 4B4RA 3JBG2 2NP0A 3JQXA 4JGYA 3RI8A 2GH8A 2QBXA 2R30A 3PTYA 4LOTA 1AL23 1GANA 1US3A 2RJLA 4PIYA 2F4PA 4CSWA 2B4KA 1NCRB 1YJLA 4QKNA 1UY0A 1XC6A 4XOGA 4YW7A 5EV7A 4XTPA 1SPPA 2P37A 1JU4A 1F4AA 1LU2A 3IB3A 3K2OA 2Q8EA 3T2QA 2P1BA 1OQDA 1R1ZA 3AM2A 4JAAA 4XJWA 2QQPA 3B9CA 3E6CC 2Y6KA 5KHGA 4OLLA 1IPSA 1OSGA 5FKBA 4Y33A 1W9TA 2CHHA 1PNFA 1UWWA 1ZX5A 3VZLA 4P9IA 5A7OA 4KBBA 1DZRA 1G86A 4HZFA 2FHRA 1UY3A 2EF6A 4BK4A 1E5RA 1C5IA 5FZAA 4COVA 2JXAA 1DBNA 3EXUA 1WLWA 2FD8A 1TNRA 2YG0A 1HB3A 4JKKA 4Y26A 5GLZA 2XVLA 3MW4A 3KV9A 4UT5A 1DGRN 3N4MA 2R0FA 3CHXA 4UBGA 4DPNA 4Y1UA 4FO9A 4IGQA 4IE0A 4NUBA 1RHI3 1SEFA 2E9QA 1G9FA 2DUQA 1KFUL 2X5IB 3AB0A 1IS3A 2QQMA 1SHWB 5FZ6A 3GALA 3S30A 4YARA 5AC92 3IWZA 2W1WA 2C9KA 1RUI3 3VDDC 3WY6A 2VZ3A 2XLGA 2ZPXA 2LM3A 1SBEA 1XSQA 1OVPA 1E5SA 2AZ5A 3D5OA 4JRAA 4E8DA 3OBZA 1CAUB 2DURA 2VZQA 2WBKA 2YPDA 1GLHA 2QFEA 4P00B 5H9QA 5CAZA 3MF6A 4QKBA 5FZOA 1UX6A 4YRDA 2HWE3 2P3JA 4XUNA 2R6QA 2Y38A 4XIOA 3ZPOA 1DZTA 2ZA9A 3OUJA 2HWE1 4IEZA 4QMAA 4PI0A 5HCHA 1PVC1 5FDBA 3C8XA 1J3PA 5K9YA 5DG1A 4D7YA 2WFF1 3P5BA 3AZXA 2YXSA 4QPWA 1SZBA 2VNGA 3PU8A 1OD5A 2VM9A 1F8VA 5GKAC 3WINE 4ZPIA 4Q4X1 2D3RA 1VPHA 3VD7A 2Z79A 2XJUA 4ORFA 4C90A 1W28A 2OA2A 4GH4A 4BU2A 3CLPA 1I6XA 2VTFA 5BNNB 3NV2A 1H9WA 3WG2A 2DVAA 3AKPA 1DQ0A 4XUPA 2LROA 5J96B 2NN8A 2Y0IA 3JCIA 4Y3OA 1N1SA 3OPTA 5FIXA 1WCQA 4ZU4A 3GGLA 2DUOA 4PBPA 5JXJA 4HBNA 3HEIA 3SCFA 5C70A 3HT1A 1UZYA 3HR9A 4UW6A 2EXHA 1JOJA 4FPFA 5TSWA 3TEXA 1GWMA 2OPWA 5DZGA 1YXWA 4JDMA 1LR5A 1PHMA 5BNOA 4H2AA 4IEOA 1K5JA 1IHMA 3Q8AA 4URAA 4AGRA 3BIEA 4KU7A 3BCWA 4QB1A 2ZGTA 3M3OA 5IVJA 1B35C 2Q1FA 1V9U1 1W90A 2I74A 3MIGA 5CG9A 3POGA 5CKQA 4BHPA 3P1IA 3O1TA 4YG0A 5FO8B 3OOXA 3LAGA 3E5QA 3SITA 3O1UA 2HYKA 2WWJA 3T0DA 1JZ3A 5FBZA 1VBC2 2BFUL 4GH4B 2R49A 4Q2FA 4LUMA 1SMVA 2C24A 3VZNA 3VKMA 3MHZA 4WV8A 2DCTA 5CA6A 1L3JA 3LDBA 5L7OB 2BRTA 4EZHA 4WVZA 1KXGA 2BERA 2QDNA 3MV01 3U11A 4CU9A 1HXS1 2YGLA 4QGNA 5T5OA 3WCSA 4DRRA 3ZFGA 1OLMA 4FVVA 3K46A 4BIFA 5JZGB 4S2DA 3I2OA 3USUA 3RZMA 1E57A 2D98A 5L9VA 3MI8A 4IEYA 3TB0A 2HWD1 3KGZA 1REDA 3ZFGC 2IXKA 1H1IA 3AMQA 1V6JA 1ND3A 1CR7A 1K5MA 3J7MA 4ASMB 1AX1A 2XXZA 3ZSJA 4QX0A 4OI4A 4RR3A 3FC0A 5I8YA 4LLFA 4RSUA 5CFCB 2YMZA 1CWPA 4GJYA 2GP5A 2XWBB 4FOYA 2GNTA 2VOVA 4NHLA 4LIUA 4XF3A 4Q26A 3ACLA 4DXTA 4FOWA 2X5IA 2ZGUA 5LA0A 1BHGA 1CZVA 1JMUB 1RUD1 2ZGPA 4KWJA 3VBRB 2BOJA 4EE2A 1J1LA 4BPZA 4LR4A 5FQ0A 3GM8A 5KXCA 1X33A 3O5SA 4N53A 4YM1A 2PQQA 4V2VA 2IVJA 2ZEWA 3ELNA 1H1MA 4CDXC 5BPXA 5KXEA 1QJY2 3A22A 1NLRA 5DDJ3 3NAPC 5ERLA 2VNVA 5IVEA 4CCKA 3LA3A 1XNDA 3RI9A 2RDQA 1KDKA 1QGLA 4QQHA 3GJAA 4YVSA 5LATA 2A70A 3P6BA 1HXS2 2B45X 2BV4A 4U2AA 4NIDA 3MW3A 1NY72 1RUI1 1SPPB 2DWRA 2UWCA 5APAA 2O1QA 1KFXL 2NMOA 1QF3A 3O0XA 2BJSA 1LESA 1OXCA 1W0PA 1RGSA 3CJIC 2BZDA 3ZN6B 4AHZA 2VVEA 2WO7A 5A7NA 1ZBE2 5IFPA 1ZRIA 4CRQA 3S0MA 3SKJE 3G6JB 1YQ2A 1O6UA 2J1TA 1AJOA 1W8HA 2CWMA 4URTA 2VOXA 4A6OA 3AP5A 2VVFA 3CJIA 3GCWA 3BPSA 3WDTA 1DYPA 2AEYA 3EHKA 4XF4A 4TLFA 4TWTA 2QKDA 5FYYA 3SHRA 1LJ7A 5JWPA 4H7MA 2QNKA 4HPKA 5FZ8A 1GOFA 2WZR2 2E26A 2PHFA 4EWAA 3D4KA 4XDPA 3ZX7A 3OGRA 5L9RA 4XJ8A 2W39A 3V0BB 3AL6A 3WG1A 4KGGA 5DAQA 3LQCA 2P4EA 4EN6B 2RHPA 3VDBA 1LHOA 1J58A 4COZA 3GZTB 4LBNA 4UFHA 1ENRA 2QQKA 3EMRA 4CCJA 1NOVA 3OGSA 1M4WA 5DMYA 2XUEA 3KT7A 3DYPA 1JH5A 5DG2A 4AFCA 1KS4A 2B46X 1DGWA 3X29B 2HWF2 4MXWA 1IPJA 5FZEA 4A4AA 2PHTA 3C7EA 3ZIWA 1Z7S3 3V0BA 2YV8A 1YQ8A 4QHZA 3BU0A 5FZ9A 3WR0A 3RZLA 3RVHA 3HMYA 4GJZA 5DN2A 1LENA 3OB8A 3KZ4C 1QQP3 1OI6A 3PJQA 4A6SA 1AX0A 1PNGA 4UXAA 1RUOA 5LW9A 1VBA2 3Q8FA 2QVSB 3JBG3 4AQ2A 2R16A 1LU1A 4XJZA 2OX0A 3I2JA 3ZXEA 4IL7A 2G9FA 5J36A 2RS31 3VD3A 4UW3A 3QACA 4M4PA 1LODA 2NPIA 3MBWA 4YSFA 4CDWC 4H55A 1G9BA 3H3UA 1HX6A 1QJFA 4XFGA 2P3KA 1W2NA 1ACCA 4WVMB 1H1AA 2WYFA 2IXLA 3PMEA 5JDBA 1FOD3 1W0NA 2BDRA 4IV3B 2DVFA 4GMP0 2CAVA 3VBFC 2JE7A 4BM8A 4KG8A 1PVXA 3VZKA 4EN0A 3VL8A 3H0OA 5A3MA 2QDRA 3GHMA 3H7YA 1CESA 2WT0A 3RDIA 4V2WA 4P5HA 3CZUA 3RMYA 1CGPA 3VBFA 1S0DA 4N9IA 3TEZA 2D3SA 4XETA 1R64A 1S4CA 1CAXA 3RNSA 1ZRDA 1BBT1 1LGCA 1OQEA 1QDOA 3T4VA 5FMCA 2JB4A 4L0PA 3ZXFA 2ADDA 2EXJA 4R4ZA 4A7KA 1XPWA 2VW2A 3B93A 2ZEXA 5C3RA 2W1UA 4HETA 4XJUA 4PQQA 4MG2A 3KCYA 4GWJA 5FPAA 4RR3B 3B69A 1NA1A 3IKWA 4BXSV 4XAEA 1K5MB 1SDWA 4FI9A 1YFWA 4XBNA 3W9AA 1VBE2 1ZZ8A 3WX5A 4JTNA 3MIFA 4MGIE 5F3EA 3ACFA 5HCBA 4F3JA 5A70A 2V5YA 3DYOA 4YW1A 3ZYGA 2ZACA 4CDUC 1CX4A 1S1AA 3NAPB 5JZGA 4IGPA 3KF3A 3ECQA 5GZEA 1AYM3 1QEXA 1IGOA 1UY2A 2AH2A 2RDSA 2WN3A 2VMEA 4XBLA 4CDXB 4YM3A 2PXJA 3GZUC 1RMU2 1UQXA 5A7WB 4OZXA 5AVPA 4EN7B 3IT8A 1S0EA 3APBA 5K0UA 1NA1B 5T55A 3IIIA 4AWDA 4DO0A 5G04L 1XB9A 3OPZA 2TBVA 1MVEA 4LTAA 4XFCA 1JZ8A 4RD7A 1RC6A 5F37A 2WZPP 3ILFA 2RMU2 3K4ZA 4NROA 4A3ZA 4B4PA 2VUAA 1POV0 1YQCA 4U36A 5ABJC 1UO9A 5BUVA 3VD4A 5D8AA 2R32A 3N7MA 1LB2A 3HNYM 1VBB2 2DTYA 1OFSA 1RXGA 2DVDA 4ZONA 1LOBA 2DDUA 1EV12 3I2DA 4GULA 1BJQA 3T30A 3OYWB 1GFF2 1Z7S1 2NM1A 5ANNA 3T2TA 2FMDA 1AR71 4HSJA 5E16A 5ABJA 1HRI3 3M3CA 5DAPA 3VBFB 1GZWA 2D93A 2EVXA 2B9UA 4Z07A 1QMJA 1RUJ3 2WAOA 2ID4A 3W21A 2OUJA 4BQ5A 1AR62 2Q5TA 2RM23 2WO1A 1LKNA 3KVBA 2GMMA 1REEA 2FQPA 4HMZA 4OQ8A 1ODNA 2BPA2 4I09A 4F7ZA 2ARCA 2WZR3 5SV5A 4LO7A 2WWSA 4MGQA 4Q0PA 2ZGKA 3RJRA 1FT9A 1JS9A 2RJ2A 3K75B 4LT5A 5BNNA 1STMA 5FP4A 3ZXJA 1E5HA 4FFIA 2V4VA 4AW7A 1SLIA 1Y9MA 1FI2A 1HRI2 2ZS6B 4IE7A 1C8NA 1AL0G 1GU3A 4JRLA 1JHNA 4DY3A 5IYYA 5BNNC 3ZFEC 5GLTA 1NXD1 1W2TA 5JMCA 3M3QA 3WHUA 4KNCA 3ZYIB 1WLDA 4Z2WA 3UGHA 4Q4Y2 4IERA 2G9ZA 2TEPA 4HONA 1WBFA 2A3XA 3K4AA 1LTEA 4WM7C 4E2GA 3ZFEA 3V0AB 2VC9A 2YYOA 4FTSA 5FUIA 1MS4A 5A33A 1DIWA 2ZGQA 5JXGA 4XBQA 5FZOB 4UFLA 2Y6JA 5FJHA 1Z7S2 4CUBA 4IV1C 1PX4A 1Y7BA 2PELA 1OLRA 2ZX3A 1FNZA 4YVWC 3VHOA 4EJRA 5C3PA 5A80A 3ZYRA 3AP7A 2ZGLA 2XOMA 1PVC2 5FTTC 4B29A 3JD73 4HVRA 4QWNA 1AR92 3BODA 3D3AA 4AI2A 2RJKA 4XF9A 4LMFA 1URXA 3WG3A 3SXWA 4YVWA 1X50A 2ERFA 4MO3M 3I3DA 3DL3A 5LBFA 4LPLA 3HD8B 3TNQA 4YWAA 5A32A 5I8TA 1K42A 3DECA 4MSVA 5DQ0A 2TNFA 5HPOA 1ZZBA 4LHSA 4Q27A 4HN1A 4D69A 1S0BA 3HJRA 3SMHA 2PFWA 3NL1A 2XWJB 1OA4A 3ZYBA 5HXVA 2WC2A 3FFZA 2X05A 2OZJA 4K40A 5JR2A 5LBBA 2JIGA 1DGWX 3ZN6A 1UKGA 3CEWA 3AZWA 4Q4V2 3W58A 5IFTA 1RUJ2 2RS33 4ZZ5A 2A73B 4P5YA 4C0BA 3NJZA 2PLV2 3NNMA 2WT2A 2D44A 1IPKA 3G7DA 4BQYA 3KV5A 3BIWE 4AEJA 1IZ3A 1XYNA 5JR7B 1VB4A 5IVFA 1OA3A 4JV4A 1PK6C 3POEA 4A3XA 4LKDA 1HXS3 1JHJA 3AKSA 2HWC1 1IS6A 3PNAA 1UYYA 5FMOS 1EPZA 5LA9A 3N9MA 2D43A 2W47A 1YIFA 1WD3A 3ON7A 4MYEA 5FPLA 4AI8A 4ATFA 3VZJA 3PJYA 2VNOA 4AGGA 3GBGA 3WP6A 5C9AB 4N53B 3CQOA 5DXDA 1ZZ6A 2AC1A 3JB8A 3PURA 5FYMA 1KITA 1AUYA 3VBRA 4N9HA 1XNTA 3VL9A 2C1FA 4XF1A 4LO5B 1AYM2 1OMIA 3U1XA 1W6OB 4MADA 4OUSA 2VUJA 2VCCA 3QLQA 1X9TA 3S6PA 3IMMA 1ZA7A 4AR2A 3WW2A 2K0GA 1OFNA 2A6VA 2D6PA 1T6BX 1GP6A 1QIQA 3KCXA 2O14A 2WIIB 4LO8A 1CAVA 4CTEA 4LOSA 3O12A 1MR5A 2JG9B 4A44A 1D2SA 3FN9A 4AVAA 1YUDA 1WD4A 2CGPA 1W9FA 1ONAA 4K1ZA 4Y1XA 4XABA 1SCSA 4CXYA 2FDGA 1R083 1W9YA 4P14A 3MLLA 5JIAA 4XJ9A 4XDQA 5IVCA 1SLCA 3U37A 5K4LA 1W3XA 1SG3A 1H2MA 2VQAA 2R0HA 3D82A 5HCAA 1H8TB 5CKMA 2VMDA 4LA3A 1MQTC 4NIIA 3ZFFC 4E4SA 2YPJA 5FWJA 3M7AA 5FP7A 1H4GA 1HB1A 2XB6C 3O1OA 2OVUA 3T09A 2DTWA 2BNOA 1FX5A 2JD4A 2VBDA 4DUVA 4LKEA 2GC2A 4WVWA 1QJY1 5M0TA 1RUE1 1YFXA 2E7AA 3VHNA 3KB5A 5F2SA 2V73A 1TE1B 4JGZB 3ZOIA 4YYOA 1Z78A 3AJYA 4AVCA 4ZZ8A 1PX3A 5JPMB 1H6XA 1BQPA 4ATEA 3PU3A 1TME2 1W6PB 5BNOB 1V00A 3LFIA 3JXSA 1YCIA 3CF6E 1POQA 1O5UA 4WM7B 3BVCA 3GCXA 2ET7A 1JZ5A 4LITA 5D21A 4ZU7A 2OS2A 1UOGA 2VTXA 4AVBA 2VOKA 2CL2A 1QNWA 1X9PA 3WNXA 3QOPA 4M0NA 4DEVA 1OT5A 1HLCA 3WVJA 3RFRA 1D7PM 4YZ1A 1RUC2 4EROA 2J1UA 2GDFA 1ZBA1 2OXBA 2XG3A 3MW2A 2ZZQA 3OBTA 4RYDA 4Y4YA 3UK9A 3SC7X 3J8F1 2WN2A 4XFBA 1PM7A 5CNAA 1W9WA 2ES3A 3KVAA 2RS53 3LKJA 4S2FA 5JXIA 2JB8A 3KM5A 3MYXA 5FY1A 5BV6A 2CV6A 1ENXA 1F5FA 4NOTA 5CKNA 1XJAA 3LDRA 3L2YA 4CPBA 2P17A 4LA2A 5A6YA 4NHYA 4JKLA 2PAMA 1Y9QA 2FCVA 1Q56A 1QQP1 1WLTA 1LGNA 2H0BA 3PVNA 4PBOA 5DABA 1CD3G 5J09A 1UYPA 4UW5A 4XYXA 5A3UA 1IS5A 3MLKA 1UY1A 4CCOA 4XHBA 3RYKA 2J1RA 2BGCA 5KXBA 1AX2A 1RMU3 2W91A 3IZOA 4IXLA 4OUEA 1SBDA 1CAVB 5FWEA 5JUVA 1BEV2 3DEMA 2GMPA 4O9GA 4CUGA 4IE5A 3H8XA 3ZLIA 3WP3A 4IETA 1ULFA 4YGEA 3FX3A 1J59A 4FPLA 2ZBJA 2A6YA 3N9PA 4QXBA 4UBHA 1VBE3 2ORZA 4OZOA 5T54A 3VZOA 4AL9A 3PVOA 1JZ7A 2WQZC 3RZZA 4QGMA 2IFWA 4W6WA 1VAVA 1FNYA 3QH7A 1D4M1 2WS93 2B8MA 2ZZJA 1ZBE3 5LASA 2P5BA 2DCKA 4YLZA 1VE0A 2EXIA 4RHV3 5T5JA 4Z1VA 1FMD2 1ODMA 4OULA 4YM2A 4MGSA 1AZDA 3FHIB 1K12A 4RHV1 2RDRA 1HB4A 4I0WB 1HQNA 4Q0SA 1PGW2 3AVRA 3KWVA 4GQ7A 5B4XA 1QNYA 2JKXA 3PVEA 1KQRA 4R8HA 5G05L 2OPKA 2AENA 4EV0A 4CDQA 4Q4V3 1OLME 1WCSA 3AMPA 3OEAA 4MH0E 1COV3 4XUTA 4YG6A 1E5IA 3H3ZA 5F5QA 2JKBA 2JDKA 4QKFA 1I9RA 2P3IA 1POV1 1V6IA 4QPGB 5F6KA 1OLQA 1ULGA 4PDWA 2AACA 2FBEA 1FPN1 1N1TA 3B01A 3E5XA 1ASJ3 3ORJA 3ZKUA 3O1VA 2FDIA 4XFHA 3WNKA 2WR9A 5FZDA 2YB7A 4OHWA 4IGOA 1FMD3 2FZ1A 2VMFA 4HKWA 4COWA 4PDWC 2XJPA 4Y1VA 1W8WA 5FYZA 2XQRA 4ASLA 2R041 3WLUA 1PO22 2D6MA 4NPLA 4XFAA 5E1RA 3AX4A 2O0OA 2PQSA 2XPJA 2ET1A 4HKLA 5IJRA 1D4M2 2ARXA 3DXTA 4AI3A 2QQIA 5I0SA 3ES4A 1LOAA 3NV1A 3MF9A 1W39A 5JI9A 4CDWB 3ZXKA 4AAXA 1GZCA 5FPUA 3CO2A 2GC3A 3C7HA 1UOJA 1LCLA 1W99A 1PGW1 1KDMA 1WUVA 2OKXA 2CGNA 2VZRA 4BK5A 4MLOA 3ZFEB 3M2MA 4WBBA 5FV3A 4BLJA 5GZCA 5I93A 4D7TA 4LULA 2VXJA 2E7TA 2JE8A 5CFDB 1AVBA 4IW3A 4YGDA 5ACA3 3HQRA 2RM21 4WM8C 5FYCA 1CQ9A 1A34A 1O8SA 5FFOC 4QB6A 5IAXA 4XIKA 5A1LA 4CP9A 3M70A 5IT6A 3LPGA 4HKOA 5DAXA 3AKQA 1DZQA 1GNZA 3GHNA 4Q29A 2BP6A 5HBAA 1RUNA 4WM8A 1PZ9A 1EV11 4LJHA 2HJIA 3O1RA 1BKZA 1N3QA 1ND2B 2XJTA 2UWBA 5DPNA 2R042 3TYJA 1VP6A 1U5XA 3E1F1 2OIIA 4FOQA 5CVRA 5A3OA 3U4XA 3LA7A 3UETA 2JDHA 2R063 4YZ5A 1C28A 1OH3A 5EWSA 1MS3A 1UCXA 1PO23 3VBHB 2BWCA 4XF0A 2UURA 5EP9A 2IWGB 5FZCA 2VXRA 1LHWA 1W8ZA 3LEKA 1FXZA 1DYKA 3PUSA 5FZFA 4MGKE 2GP3A 3ASIA 4NIAA 1W6PA 1GZWB 1Q3EA 1X7NA 2WZ8A 4FQ4A 3IPVA 3VZMA 4MVTA 2JEMA 2ZOEB 3WQ0A 3J7NA 2XONA 1OOPC 5LA2A 1JOPA 2P2KA 4QQOA 3O1PA 3U10A 4HN0A 5A6ZA 5BNPA 3M3EA 4JGYC 2ZTNA 4S2GA 4F8AA 4A7YA 4XE9A 4L11A 4ZHNA 3O1SA 2PHLA 1MS5A 1OOPA 2VULA 4TN7A 3USSA 4ZKTB 3RZGA 5E89A 1VMFA 1DQ1A 5BNPC 1A6CA 4BQWA 2R071 4LBQB 1EAH3 1H8TA 1GSLA 3MUY1 5IVBA
chains in the Genus database with same CATH topology
1UQXA 2VNVA 2JDMA 2JDKA 5A6YA 1OVSA 4UT5A 2BP6A 5HCHA 1W8FA 2BOIA 2WR9A 4CE8A 2BV4A 5A6ZA 1UZVA 2JDPA 5A6QA 1GZTA 1OUXA 2VUDA 4AOCA 5A3OA 3ZDVA 5D2AA 1OXCA 5A70A 1OVPA 2VUCA 2JDHA 5A6XA 2BOJA 1OURA 1OUSA 2CHHA 2JDNA 3DCQA 2JDUA 2XR4A 1W8HA 2WRAA 2JDYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UQX A;  2VNV A;  2JDM A;  2JDK A;  5A6Y A;  1OVS A;  4UT5 A;  2BP6 A;  5HCH A;  1W8F A;  2BOI A;  2WR9 A;  4CE8 A;  2BV4 A;  5A6Z A;  1UZV A;  2JDP A;  5A6Q A;  1GZT A;  1OUX A;  2VUD A;  4AOC A;  5A3O A;  3ZDV A;  5D2A A;  1OXC A;  5A70 A;  1OVP A;  2VUC A;  2JDH A;  5A6X A;  2BOJ A;  1OUR A;  1OUS A;  2CHH A;  2JDN A;  3DCQ A;  2JDU A;  2XR4 A;  1W8H A;  2WRA A;  2JDY A; 
#chains in the Genus database with same CATH topology
 2VE1 A;  3HQX A;  4XMA A;  2EIC A;  1AXZ A;  1QOT A;  2WZE A;  5C8C B;  5GLU A;  1NZC A;  2G9G A;  3LE0 A;  1KS5 A;  2VNR A;  1CJD A;  3H7J A;  2ZMN A;  1ULD A;  2HWD 3;  1I5Z A;  5FZL A;  5A3W A;  4AVT A;  5F9T A;  5HI0 A;  4LQR A;  5F3C A;  5F3G A;  3LOI A;  3POB A;  1XU1 A;  1BK0 A;  3DKW A;  3RZH A;  5DDJ 2;  1RL3 A;  2FCT A;  2GNM A;  3ZSK A;  2J1A A;  4Z92 B;  1GOG A;  1SCR A;  3ZIX A;  1ZRR A;  1CIW A;  4FQZ A;  5EYY A;  4Y4R A;  1AR9 1;  1QXR A;  3I2F A;  4YW4 A;  1IG3 A;  1GKB A;  1QH6 A;  3BOP A;  2J1S A;  3L9J T;  4LUK A;  3OGJ A;  1YLL A;  3PDQ A;  1FAT A;  4NJ4 A;  4MGT A;  4O7X A;  3VDD A;  3AP4 A;  1CIY A;  1W6O A;  3WNN A;  1FPN 3;  1YWK A;  5KHI A;  2ZCW A;  1J84 A;  3I2H A;  3PUH A;  3FLP A;  1QJU 3;  2VZT A;  1HQW A;  1W3V A;  4DUW A;  4FT8 A;  1TME 3;  1UZV A;  5FY9 A;  2DBI A;  1G9D A;  4FSJ A;  4Z8B A;  1J1T A;  4A42 A;  2PA7 A;  2R04 3;  1L7R A;  3AYE A;  4A2U A;  1RUJ 1;  4R9D A;  3RYR A;  3H8U A;  4GKY A;  5IAT A;  2BU9 A;  3FHQ A;  4I2O A;  2RV9 A;  2XQX A;  4KWK A;  4NIH A;  2GN7 A;  1C1L A;  2C5D A;  2ZEZ A;  4DY5 A;  1I5P A;  3CZJ A;  1WW6 A;  4IND A;  3BUC A;  2XLA A;  2ZGR A;  4G3Y C;  4AVV A;  1YHF A;  5EZW A;  3I3B A;  3BB6 A;  5LCW L;  3FFQ A;  1PO1 1;  4BE3 A;  3HWJ A;  1RUE 3;  2JEN A;  4KU8 A;  1RJ7 A;  4DIQ A;  4K7J A;  2VW1 A;  1W2O A;  4CP9 B;  1F4H A;  3OCP A;  4EWD A;  4QQP A;  1Q5O A;  3R6S A;  1SLB A;  2XBO 3;  1LOE A;  4M01 A;  1NE4 A;  1L7L A;  2QZ3 A;  2XKP A;  1HRV 1;  3AZZ A;  5F5A A;  5A32 B;  3VB9 A;  5H9R A;  5I0R A;  3TN9 2;  2P6C A;  5L7O C;  2GAU A;  4QX3 A;  5BNO C;  5FPX A;  4L92 A;  2ZAA A;  3ZYJ B;  1RUC 3;  3AYC A;  1CZT A;  4PF5 A;  1LGB A;  4FAG A;  2W0X A;  1UX7 A;  2VQU A;  1A78 A;  2VEC A;  3N7K A;  1MZ6 A;  3PTR B;  1BEV 3;  3NNF A;  3WXP A;  3TEY A;  2AYH A;  2ADE A;  2ILM A;  1MEC 3;  2OZ6 A;  4QAW A;  1CPN A;  2W2I A;  3QBQ A;  1MEC 1;  4GWI A;  1EAH 1;  3T0B A;  1OF3 A;  3NMB A;  4P9G A;  1GBG A;  2CWS A;  1N3P A;  1ENQ A;  2RG4 A;  4TLG A;  2FDF A;  4Q4Y 3;  3WQB A;  1FOD 2;  2VTX J;  4IEQ A;  4B1M A;  1ULE A;  1C5H A;  4E4H A;  5FZH A;  3I3Q A;  4XCA A;  3UKV A;  3GNE A;  3NKG A;  3INA A;  3ZXA C;  4FTB A;  1AXK A;  2HLE A;  2Q4S A;  3R4U A;  4EWE A;  1NX9 A;  3CJI B;  1I3H A;  2X10 A;  5ACA 1;  1JBC A;  4GD4 A;  1A3K A;  4NPR A;  4HVQ A;  4OQ9 A;  4CDU B;  3MPB A;  5FZM A;  3VV1 A;  2PTM A;  2IZW A;  2QQJ A;  1XRU A;  2WL1 A;  4GMP 3;  2BNN A;  3WOG A;  2Y6H A;  2GC1 A;  3SEP A;  5C4W C;  2BVV A;  4XHX A;  4UAP A;  2Q0A A;  4UWD A;  5A7Q A;  1ND3 C;  1V6K A;  3VBU B;  2X53 S;  2ZKN A;  3DPR B;  1R1A 2;  1UYZ A;  3I7D A;  2E32 A;  2D97 A;  1WCD J;  3KS7 A;  4RGK A;  4P9L A;  2Z42 A;  3WDW A;  2R07 3;  1GYK A;  3POI A;  4M3C F;  5C4W A;  1WCK A;  2WLQ A;  2MEV 2;  4PQ9 A;  1GQG A;  3B02 A;  2NLR A;  3LPF A;  1GQH A;  1NCQ A;  3OPW A;  4ZY9 A;  2GN3 A;  2YUE A;  3ZYH A;  1WMD A;  5FUN A;  2X5I C;  4AZZ A;  2A71 A;  2G4I A;  2YY1 A;  3L2H A;  4GKX A;  3N9N A;  4D7S A;  2H6C A;  3B00 A;  4GA9 A;  4L99 A;  4TXW A;  1W6M A;  1ULC A;  1JYW A;  1WBL A;  3DN7 A;  4SLI A;  1DHK B;  1NCQ C;  4N53 C;  5GJ6 A;  4AEK A;  4AGV A;  4LK7 A;  3OYW A;  3NJV A;  4EZ4 A;  1UY4 A;  4CE8 A;  1W8T A;  4QDR A;  4QXH A;  2X8K A;  2WAB A;  5FZ3 A;  1WW5 A;  1IS4 A;  3MIH A;  3I4I A;  1HN0 A;  3WNL A;  1GZ9 A;  4CUC A;  1JZ2 A;  3VBR C;  4LBQ D;  5F3I A;  1S2E A;  4YVS C;  4Q4W 2;  1O5L A;  2DCJ A;  3KHB A;  5IK7 A;  1NUK A;  2WQ4 A;  3AYD A;  1S0I A;  3LEI A;  1UXX X;  2QQW A;  2WNU B;  1QHD A;  1W6N A;  4OVE A;  5K0U B;  2CDO A;  3ALQ A;  5A7W A;  4BB3 A;  5CAD A;  3AZY A;  3KSC A;  1ULO A;  1AHS A;  1DP0 A;  4C0H A;  4AI1 A;  4MOA A;  1O3Q A;  1SDD B;  3PMS A;  2Y6L A;  3PVB B;  3K4D A;  3SCH A;  5C3Q A;  3RWK X;  2KM2 A;  2G1M A;  2Q8D A;  3POJ A;  4IUG A;  5LWB A;  3ACH A;  3I59 A;  4NR1 A;  4AHW A;  4OHX A;  1R08 1;  3KF5 A;  4P9Y A;  4B7K A;  1DDL A;  1VAM A;  5C71 A;  3BN6 A;  3HAG A;  2VOT A;  5FUP A;  2MEV 1;  3AXD A;  3TEW A;  2JDA A;  1T2X A;  1DQ6 A;  3KQR A;  2Q8O A;  3ZMO A;  1LEC A;  2YC2 A;  2VMI A;  3ZN4 A;  2A1X A;  2H0V A;  4CP2 A;  4MX3 A;  4DXS A;  5AFE A;  2V72 A;  4Y5T A;  3TRS B;  4XJA A;  1NT0 A;  2DF7 A;  1U0A A;  1WCU A;  1QJE A;  4AQT A;  1QJY 3;  1C57 A;  5DZE A;  4BLI A;  5BNP B;  5LZ6 A;  1F9K A;  1R09 1;  3MIC A;  4XIL A;  4E4Z A;  2N7G A;  2VCA A;  2ZGN A;  3BU7 A;  4FAH A;  3BPZ A;  4IV1 B;  3T2O A;  4CEW A;  2FZ2 A;  3J9S A;  1W0O A;  2VMC A;  4LBJ A;  1IQD C;  2C26 A;  2PYT A;  1H2K A;  2YRO A;  2D6N A;  4HK9 A;  2A6X A;  5F2W A;  4BQ2 A;  4DB5 A;  4XEZ A;  1RVF 1;  2DUP A;  3U78 A;  2YBK A;  3EYP A;  5J98 B;  1HV1 A;  1NXM A;  3U75 A;  1C8M 2;  4CEW C;  3WUC A;  3DV8 A;  3CIH A;  3Q8B A;  1UMI A;  1QH7 A;  1NQJ A;  4HSL A;  4Q4X 2;  1ZZC A;  3WUD A;  4QX8 A;  1EPW A;  2WDB A;  3A21 A;  4DUX A;  4DQA A;  2XHK A;  1ND2 A;  1UXZ A;  1S0C A;  1VMH A;  5E6H A;  2C6S A;  3IDA A;  3J8F 3;  5I91 A;  5FZG A;  5FZ0 A;  1J3R A;  1XYP A;  2Y6G A;  3KLS A;  4MXV A;  4AFA A;  1R08 2;  4RFR B;  3SIS A;  3ZXL A;  5A3L A;  4M3C E;  1JOB A;  2WQ8 A;  1ND2 C;  4Q8L A;  1IKQ A;  1RB8 G;  2D3P A;  2Y33 A;  1PO2 1;  1G6N A;  3OGV A;  1RUG 2;  1PGL 2;  2GC0 A;  4XXA A;  1DGL A;  1RUH 2;  3OY8 B;  5FY7 A;  3D8C A;  3JU9 A;  5CIS A;  2MNG A;  5CFD A;  2CTV A;  2VUC A;  2W08 A;  3NV3 A;  2A3W A;  3F95 A;  3OEB A;  3TN9 3;  3KD4 A;  2H6B A;  1UF2 C;  1VRH 2;  1ZA4 A;  1WLC A;  3Q8C A;  1JYX A;  3JBG 1;  2V09 A;  3CU7 A;  2JD9 A;  4P9J A;  4HK8 A;  4NN0 A;  3UKT A;  4AFB A;  2CGO A;  5CFD C;  1GQP A;  5B2G B;  3R4D B;  4GMP 1;  5JIU A;  1W6N B;  3DUI A;  1OA2 A;  2MPF A;  5EQU A;  1O3R A;  3OBA A;  2ARA A;  2V5D A;  4QPY A;  3A4U A;  1WMF A;  2YC4 A;  2EA7 A;  2LUW A;  5FKC A;  3T4H B;  2QTW B;  3WQ7 A;  2VW0 A;  4CCD A;  1RVF 2;  2YC0 A;  4XAC A;  3C7G A;  4BIS A;  3AK0 A;  3K51 A;  4FPK A;  4O65 A;  4Q0U A;  4UW4 A;  3ZXD A;  3AMH A;  4LEJ A;  4ES9 A;  3GBW A;  5HXM A;  4NE9 A;  3FHA A;  1IQA A;  2RM2 2;  3J26 N;  3O7O A;  1PIV 3;  4W8J A;  3GJB A;  5EXO A;  2JIJ A;  1NA1 C;  3IM0 A;  3OUH A;  4QB2 A;  5BNQ A;  1UOB A;  5LRR A;  3AC0 A;  2WWU A;  2R1D A;  5C9A A;  4FOV A;  2RR1 1;  1SQ4 A;  2YDE A;  3ETP A;  3VKL A;  4YZ2 A;  2PAE A;  3A0N A;  3NJX A;  1FYU A;  4AVS A;  1VBB 3;  1S2B A;  4IEW A;  3OGG A;  4J1X A;  1GUI A;  5CIR A;  4MZU A;  5GAL A;  5EJZ B;  2EAL A;  4KWU A;  5DUV A;  1NE6 A;  4Q4V 1;  5JZG C;  5C9A C;  4PDW B;  5C4W B;  3AKR A;  5EJ3 A;  1H2N A;  4QM9 A;  2YU2 A;  4PHZ A;  2VZV A;  4CCN A;  5JOW A;  4FPO B;  2VU9 A;  4IEP A;  1RUH 1;  3K48 A;  1OD3 A;  5T3N A;  3DPR A;  2CAU A;  2CYF A;  4KH9 A;  2YU1 A;  4M3C A;  4M3C B;  4BH9 A;  1W03 A;  2VY0 A;  3HN1 A;  5GLV A;  3NWK A;  5J48 A;  4FFG A;  2Y60 A;  2QCS B;  1QOS A;  3LDK A;  2QE3 A;  1R09 3;  2WO2 A;  4HVO A;  5FBJ A;  2KXL A;  4B7E A;  1POV 3;  1AYN 2;  3DPR C;  3OSD A;  3WP4 A;  1N1V A;  1VRH 3;  1X8M A;  5D8A C;  3MIE A;  4D6R A;  5HV4 A;  3I3M A;  1JUI A;  4OFG A;  2I45 A;  1J83 A;  4HLT A;  5C8C C;  5JPN B;  2HWE 2;  4KI5 M;  4H7L A;  1LNS A;  5E88 A;  5FOJ B;  5IHR A;  2R06 2;  1C1F A;  2IXC A;  3ST7 A;  2AGS A;  1AR8 3;  2WFF 2;  4XCB A;  3E5U A;  3RJ2 X;  3B94 A;  3VN4 A;  2VPV A;  2F17 A;  5FXZ A;  2IFR A;  5BYN A;  2HH9 A;  5FZ1 A;  2FMY A;  4Q4W 3;  4BZ4 A;  3IN9 A;  4QHB A;  3S57 A;  1X8E A;  1HJF A;  3WZ1 A;  3P3N A;  2GH2 A;  5FPV A;  3GBF A;  3TNP B;  3U0Z A;  5C5U A;  1ND3 B;  4ISQ A;  1PO1 3;  1DQ4 A;  5JSO A;  4L2N A;  3AKT A;  4W6X A;  1BCX A;  4K9S A;  1ZRC A;  2XVG A;  2HYX A;  3FWE A;  4AQ6 A;  3Q9O A;  3K3O A;  4QX7 A;  2IXI A;  5CZK A;  1V0A A;  2ORX A;  2R7E B;  2WFF 3;  1SFN A;  2UY8 A;  2X09 A;  2D5H A;  3U14 A;  4IV3 C;  4FTE A;  3BOW A;  2WIN B;  4YW5 A;  5FXX A;  3WF1 A;  3NJY A;  2B42 B;  2W94 A;  5FYI A;  4J6G A;  3ZPY A;  2A3Y A;  1NLS A;  1XOY A;  1UOF A;  3ZDV A;  2PHU A;  1UW8 A;  3HVD A;  1V9U 2;  1BYH A;  4BCU A;  4RGG A;  2BWA A;  1APN A;  5FY8 A;  4O61 A;  3FBY A;  3RZJ A;  1VJ2 A;  2MEV 3;  2ZJC A;  4NRP A;  5FYU A;  2Y6F A;  3VGI A;  2FCU A;  3C7F A;  2W9X A;  4FCA A;  4HFS A;  4WZF A;  5FK7 A;  4FBF A;  3LOB A;  1FV2 A;  3AZV A;  2DYC A;  4QT6 A;  5FK8 A;  1MQT B;  3POY A;  1TMF 3;  2DFC A;  1JI6 A;  1VBC 1;  3ACG A;  3OJB A;  4LHK A;  4CCM A;  2R06 1;  4E4D X;  2JEC A;  2JIC A;  2XDV A;  4LKF A;  1XNK A;  1MAC A;  3LGR A;  1BXH A;  1XBF A;  1NZI A;  3CNA A;  2E6V A;  1W8F A;  5I8S A;  1U5I A;  1YO8 A;  1PIV 1;  1UZW A;  4NRM A;  1XE8 A;  4NHX A;  4TSV A;  4XW3 A;  5GLW A;  1V70 A;  1S55 A;  3MFA A;  5EYX A;  4D6S A;  4DEQ A;  3TAY A;  2JG9 C;  2BUK A;  3ILN A;  3KQ4 B;  3ROU A;  2FDJ A;  5KHK A;  2WNV B;  1BBT 3;  5ABJ B;  5I0U A;  4CEW B;  2J22 A;  1HJG A;  3THC A;  1RUC 1;  5DUW A;  1G9C A;  4SBV A;  4ARX A;  1PO1 2;  5FMB A;  2VGD A;  4AG4 A;  1DFQ A;  1RUH 3;  3FUO A;  2GAL A;  4PLN A;  3IMN A;  4LXL A;  3RQ0 A;  5HCF A;  1GIC A;  3D0J A;  5CB7 A;  2ZHM A;  1PZ7 A;  3VKO A;  5JXH A;  3KV4 A;  1D0G A;  3DKQ A;  5LY2 A;  1F2N A;  5LEJ A;  1D4M 3;  1DGR A;  5ANQ A;  1RYY A;  4EQV A;  4AI0 A;  3M4F A;  1VBD 3;  2XJS A;  5FMO L;  1QDC A;  1PK6 A;  1ULP A;  2WLP A;  2WSU A;  1CAW A;  4PT6 A;  4FP2 A;  1MS9 A;  1PK6 B;  4I02 A;  4QHO A;  1TG7 A;  4V1P A;  5DAV A;  3OD4 A;  1XE0 A;  3V65 A;  2D40 A;  1PIV 2;  3B3Q E;  2YFU A;  5DAW A;  4GB3 3;  3MO4 A;  3NVC A;  3PIG A;  4YZ4 A;  5CYY A;  3ZXG A;  4B1L A;  1ZRF A;  3AP9 A;  4R9A A;  1HKD A;  2RMU 3;  3ZYF A;  2VJX A;  1N3O A;  5FCC A;  1RUD 3;  2EAA A;  1BMV 1;  3H1Y A;  2I2S A;  3NNL A;  2WNE A;  1ZBE 1;  2C9A A;  1VBE 1;  1W8N A;  3CL1 A;  1H8V A;  4IQP A;  2B7Y A;  5IWF A;  2ZKL A;  2BTV C;  3AP6 A;  2C4X A;  1D2Q A;  4Y1Y A;  5F5I A;  5FR3 A;  2VCM A;  3IPV B;  3VBH C;  3FUQ A;  4XQ4 A;  1QJX 1;  2ETE A;  5FLJ A;  3N7L A;  1C4R A;  1WME A;  3BKZ A;  2W3J A;  2YGM A;  5LBC A;  2DBN A;  2WZR 1;  3H50 A;  1NCQ B;  3VBH A;  4HXC A;  2VR4 A;  3ZSM A;  2E53 A;  4N43 B;  1W05 A;  3OUI A;  2ZX4 A;  3VUO A;  4ZS3 A;  1AYN 3;  3WDX A;  1WW4 A;  5LA1 A;  2FDK A;  5T52 A;  4I0B A;  5A3P A;  1OUX A;  3KT4 A;  5LBE A;  1MQT A;  1S0F A;  2VUD A;  3MFC A;  4IEU A;  2WA3 A;  4WZC A;  2HWB 2;  2QZ2 A;  1UU4 A;  3LEG A;  5C3O A;  4BYY A;  3N9L A;  2QQO A;  3H3L A;  1Q8S A;  1QKQ A;  1ZYB A;  2XML A;  1YI7 A;  2QQN A;  2UU8 A;  3FL7 A;  3V64 A;  1F35 A;  2JDU A;  3HN3 A;  4JGY B;  5FZ7 A;  2EID A;  4CCE A;  1QXP A;  5F8P A;  4E8C A;  2IC1 A;  4XUR A;  4R9B A;  2HWF 3;  2DCY A;  1B35 B;  4OCT A;  1YC6 1;  1WGP A;  4OMD A;  4R4X A;  1GWL A;  3C3V A;  2BFU S;  1WWY A;  1UPS A;  4GAL A;  1DYO A;  4YVW B;  2DVB A;  3EQE A;  4YZ3 A;  1PZ8 A;  3SKV A;  3T1M A;  4ARY A;  4AE2 A;  5LEK A;  3NST A;  1LAJ A;  2RVA A;  2ZEY A;  4GH4 C;  4HL0 A;  4XQD A;  5F6L B;  2WT1 A;  1RIN A;  4WVV A;  2A6W A;  3PL0 A;  2I07 B;  2UYA A;  5GZD A;  4AOC A;  4LBM A;  4XC9 A;  4GWN A;  2VMH A;  1MS1 A;  4I3P A;  4C91 A;  2PHD A;  4CP0 A;  4DXZ A;  1OUR A;  1QJX 2;  2ZX0 A;  3EBR A;  5EFU A;  5KHH A;  1CPM A;  3IDE A;  3MEP A;  4JKM A;  1XYO A;  1RHI 2;  2NYY A;  3WCR A;  3SLI A;  3UES A;  5FXW A;  1CN1 A;  2EXK A;  2EIG A;  1K45 A;  1UYX A;  2NZ9 A;  3C7O A;  3E6D A;  4QXK A;  5A33 B;  3ETQ A;  4AEM A;  1MZF A;  1AXY A;  4CU7 A;  3H8R A;  2BGP A;  3WSO A;  3BTZ A;  2ARB A;  4GB3 2;  4HPK B;  1VBD 1;  4KMQ A;  3W5N A;  2AR6 A;  3W5M A;  4Q4Y 1;  1B35 A;  1HB2 A;  1XSR A;  1GOH A;  2SLI A;  2HWB 1;  2LS6 A;  4AED B;  3CDZ B;  1CVN A;  2E63 A;  4BQ4 A;  4P08 A;  3RYP A;  4IDZ A;  3THP A;  2XKO A;  2ZAH A;  3ZVX A;  1YQ6 A;  5JAX A;  4Y22 A;  3BTY A;  1W2U A;  3ABZ A;  2VBP A;  4CXW A;  4Y5Z 0;  1R09 2;  4YGB A;  3SNM A;  5C3S A;  2D6K A;  4KL1 A;  3WP5 A;  2E7Q A;  3ZM8 A;  5FXV A;  3GDB A;  1VMJ A;  4JDN A;  1RIT A;  3LD8 A;  5JVV A;  4Q1P A;  4Y20 A;  1A8D A;  2PHR A;  2OUH A;  4BIO A;  2K9Z A;  1OVS A;  2DFB A;  2Q1M A;  5JSP A;  3EJK A;  2BGO A;  1DG6 A;  2CNA A;  1BVV A;  2ZGS A;  1MPX A;  3ITQ A;  1N47 A;  5FPZ A;  1SBF A;  5FY4 A;  5JMO A;  2ARE A;  4JQT A;  3WNP A;  5FP9 A;  3PUQ A;  2XL7 A;  1XXN A;  1NYW A;  5IW0 A;  1JYT A;  1IOA A;  1F31 A;  2JWP A;  4QX5 A;  4XUO A;  1UPI A;  2J7M A;  3MDP A;  4FPY A;  3JQW A;  1K5M C;  1UZZ A;  3N9Q A;  1RHI 1;  4Q1R A;  3RSJ A;  4EN9 B;  5CFC C;  3ZN5 A;  1YQ5 A;  2HEW F;  4RR3 C;  2RS1 1;  3W59 A;  2J1V A;  4TZD A;  2XR4 A;  2QQV A;  1OC1 A;  1RMU 1;  4LO6 B;  3QCW A;  4M4R A;  4QU1 A;  1LHN A;  1JYV A;  1G9A A;  4B8E A;  2WA4 A;  1BLZ A;  2XBO 2;  1O91 A;  4HT1 T;  1GMM A;  4GB3 1;  3IAQ A;  4W6Y A;  2R07 2;  1VBD 2;  4UI9 L;  5CFC A;  5AC9 1;  4RFT 0;  4CDQ C;  2RMU 1;  5FY5 A;  3S7I A;  2BOI A;  3ILR A;  3PIJ A;  1Q43 A;  1MZE A;  1FAY A;  4UFK A;  1JUH A;  4X6Q B;  4W65 A;  1RTV A;  5IVY A;  1VRH 1;  3WW3 A;  4CDX A;  1US2 A;  2BBA A;  3WD5 A;  5C5T A;  2FDH A;  4ES8 A;  3VBO B;  4X8P A;  2YBS A;  2ZX2 A;  3I54 A;  1AR7 2;  1O4Z A;  3HOB A;  1U5Z A;  3NAP A;  1CAW B;  1S0G A;  1H9P A;  1HN1 A;  3B9I A;  3USU B;  2VAU A;  1OH4 A;  3KT1 A;  5DDJ 1;  3NQH A;  1AR6 1;  3AL5 A;  1PVC 3;  2F4L A;  2ENR A;  4Y5S A;  4HAN A;  1H30 A;  4N7U A;  3WW1 A;  5K7P A;  1AYM 1;  4A7Z A;  1ALY A;  5I0D A;  2LRP A;  3S7E A;  3TWI A;  2EAK A;  3DF0 A;  4R52 A;  1VAK A;  5CBL A;  1OOP B;  2P3Y A;  4RS5 B;  5A7S A;  2Z2S B;  3LFM A;  3T3Y A;  4K3U A;  4F83 A;  3WT3 A;  4QD2 A;  1RXF A;  1MZ5 A;  3HNM A;  4FFH A;  2W5F A;  3VLB B;  1QY4 A;  3LSD A;  2V4A A;  4YW3 A;  4EYU A;  4DNY A;  1HRI 1;  3LWC A;  5FAX A;  2RS1 2;  2DV9 A;  1RVF 3;  1KD7 A;  1LEM A;  1QJZ A;  2XBO 1;  3AFG A;  3BAL A;  1GR3 A;  4DFS A;  2Y34 A;  5A3T A;  3M8L A;  2UY9 A;  4FPJ A;  4UFJ A;  4LNV A;  1XNB A;  3WNM A;  4ONU A;  4ZXK A;  5JI7 A;  1V9U 3;  1PMJ X;  3UYJ A;  4N8M A;  2WS9 2;  2BNM A;  4PIZ A;  3WG4 A;  4BA6 A;  1SLL A;  4K1Y A;  1OKO A;  1LHV A;  3FZ3 A;  5FYT A;  4Q0V A;  5JOY A;  4UF0 A;  2JDP A;  1KEX A;  1UU5 A;  5IAV A;  4JQR A;  1AYN 1;  1HDK A;  5LK7 B;  4JTO A;  4LBL A;  1Z0H A;  1VBC 3;  3ZR5 A;  3K77 A;  3LSE A;  4WM8 B;  2VZ1 A;  4AFM A;  4A41 A;  3O1M A;  1YIP A;  2VBB A;  1Y9G A;  1VR3 A;  3JUU A;  4FXK B;  4AHY A;  2QJV A;  3N3H A;  4RL7 A;  2W1S A;  4FP3 A;  2BQP A;  3KMH A;  2DU0 A;  1OQ1 A;  4Y24 A;  4YM0 A;  3VHR A;  1HRV 2;  3BTX A;  5CG8 A;  1BVP 1;  1JYI A;  4ASK A;  3DXU A;  2ZAB A;  3I59 B;  4CCL A;  1YFU A;  5H9P A;  3WDV A;  2W95 A;  4C1X A;  2NQY A;  1W8U A;  2WNU C;  1JW6 A;  3LA2 A;  3WV6 A;  1BZW A;  2MHF A;  1OHF A;  4PF1 A;  4H14 A;  4FPC A;  4A45 A;  3CMG A;  5AFB A;  4MXW B;  2XJV A;  3RZK A;  3P3P A;  1GZT A;  3S5Q A;  2QUO A;  4CDW A;  2WNU A;  3WQ1 A;  1UIK A;  3LB9 A;  4CU6 A;  1LOG A;  1VAL A;  1EYB A;  4XAA A;  4MV2 A;  1MEC 2;  4H3W A;  1EAH 2;  5ISL A;  2A75 A;  5DUX A;  3LIH A;  4LBO A;  2VVD A;  4BME A;  4W50 A;  2HKX A;  1B09 A;  1RUG 3;  2PN5 A;  3THD A;  4C8D A;  1GWK A;  3AXE A;  5KR7 A;  2WS9 1;  4AAP A;  5L19 A;  2E31 A;  1WA6 X;  2O8Q A;  1O4Y A;  2HWC 3;  3HQU A;  1H8T C;  2HWC 2;  3R0R A;  3PUA A;  3R4S A;  4MHR A;  3VKN A;  2ZHL A;  3J7H A;  1AJK A;  3DYM A;  2GND A;  1UMH A;  2GNB A;  3MGU A;  4BJ0 A;  2Q8C A;  4QU2 A;  4NO4 A;  4AHX A;  5C8W A;  1VB2 A;  4IES A;  4PI2 A;  2HBU A;  2Y0O A;  5EHD A;  5KHJ A;  2OYZ A;  1EUT A;  1YYN A;  3ATG A;  1WMX A;  3UGG A;  1S2K A;  3JB4 C;  1VIW B;  3OD0 A;  1SLA A;  2Z69 A;  1R1A 1;  3N35 A;  3O0W A;  4TYS A;  4OHV A;  4CU8 A;  1NLQ A;  3HT2 A;  1R1A 3;  5T50 A;  5FMD A;  5JLV A;  2JE9 A;  1VBA 3;  4I0A A;  5GM0 A;  5JOZ A;  1RUI 2;  3FBM A;  3NO8 A;  4JCK A;  2OQ7 A;  4YVS B;  2ZGO A;  2BBV A;  1YEW A;  1Y3T A;  3HIF A;  3NNG A;  4UFI A;  4JHT A;  3WHT A;  3MIB A;  1DF0 A;  3V56 A;  5BY5 A;  4D3W A;  4CDU A;  4M0H A;  1ASJ 1;  2O8O A;  2B9V A;  3FE5 A;  4XXP A;  1YFY A;  1OBN A;  4FFF A;  3O0V A;  1CJP A;  1UIJ A;  1WA4 A;  4W4Z A;  1FMD 1;  1GP5 A;  4LIV A;  4MGY E;  4BQX A;  1GNH A;  4BMB A;  4LKS A;  5FQ0 B;  2XJR A;  5K0U C;  2UWA A;  2XVK A;  3NKT A;  5CEH A;  2VZS A;  4HG6 B;  4OI1 A;  2OQ6 A;  4NAM A;  4GAZ A;  2VCB A;  1IKP A;  2L9L A;  3MV1 1;  4PCR A;  1L7Q A;  1XU2 A;  2WRA A;  3I2K A;  5C7G A;  4CEY A;  1WKY A;  4L9B A;  4Q4W 1;  2YHJ A;  3URF A;  2WYS A;  1GP4 A;  1AR9 3;  5JOX A;  4AXO A;  3VDA A;  1Q8O A;  5A7P A;  4LOR A;  4XFF A;  5FLI A;  2WKK A;  4YNI A;  3WF0 A;  2K46 A;  1RUF 1;  4HOO A;  1ZZ9 A;  1WZX A;  4XQW A;  1JU3 A;  4CEY C;  4AK3 A;  4MGZ E;  1UN1 A;  1W6Q B;  3NW4 A;  1OF4 A;  2VOW A;  3LIG A;  5T5L A;  3I2G A;  3ENR A;  5LK5 A;  3UNP A;  3V0A A;  5IVV A;  4PLO A;  2HWF 1;  1OKQ A;  1QJX 3;  2VO5 A;  1TME 1;  3ZYP A;  1W06 A;  1F15 A;  2W52 A;  3KCC A;  3OY8 A;  3BGA A;  3WF3 A;  1V6M A;  5J37 A;  1JOD A;  5J1X A;  2E33 A;  2BEO A;  3NNJ A;  3GZA A;  4P9W A;  4P9X A;  4DIN B;  1D4V B;  3A7Q A;  5IK4 A;  4JDO A;  5L7O A;  1BMV 2;  4XMI A;  1XNC A;  2IUW A;  2AUY A;  3ZKY A;  2CDP A;  4DZG A;  1NG0 A;  1ASJ 2;  1TQ5 A;  2SBA A;  2CU5 A;  3VHP A;  2VD7 A;  2RS3 2;  4YGC A;  5B4N A;  4DRV A;  1ZBA 2;  4BWO A;  5KC6 A;  3BI3 A;  3IDC B;  1QU0 A;  4L97 A;  4UF0 B;  1U5Y A;  3T2P A;  2Q1Z B;  3J8F 2;  2VQT A;  1RIR A;  4NPM A;  4NIG A;  2RDN A;  1G7Y A;  1DQ2 A;  3ACI A;  2W46 A;  4QPI A;  4AQS A;  5FP3 A;  2ZMK A;  4GXL A;  4Q5O A;  4WM7 A;  1TEI A;  3J4U H;  1PMI A;  2KR2 A;  4QX2 A;  2HBT A;  1JYC A;  2HEV F;  5EJ1 B;  3UV9 A;  5GZG A;  1C8M 3;  2JDM A;  1LUL A;  5F39 A;  4G9S B;  2EIB A;  4QPI C;  1Q8P A;  3CJX A;  4CYD A;  5F1R A;  1I1E A;  3HBZ A;  1HIX A;  4AYU A;  4IV1 A;  4XZP A;  3CKH A;  4ET7 A;  1ZZ7 A;  4FPG A;  4E2S A;  1PM4 A;  3VD9 A;  2VH9 A;  3RWN A;  4RQP A;  1VRB A;  1ZBA 3;  3VDD B;  1YNA A;  4YW2 A;  2AEZ A;  1BEV 1;  3SH4 A;  1T6G C;  2VZP A;  2WUH A;  1BK1 A;  3DGT A;  3Q8E A;  4XDO A;  3H9A A;  2CSG A;  2JDZ A;  3FLR A;  4NRQ A;  4K21 A;  3SCG A;  3B5L B;  4RQP C;  1V6O A;  3DCQ A;  4N7I A;  4DXR A;  1PGL 1;  3HPN A;  3OF1 A;  3S5A A;  4IEV A;  3WDU A;  1JYN A;  2WFP A;  1UKR A;  1COV 2;  3VBO C;  2JDY A;  1UMZ A;  3N7J A;  2RS5 1;  4XZU G;  3I2I A;  4YW6 A;  3ZDS A;  1Q8V A;  5C33 A;  2PHW A;  4RA0 A;  4NMI A;  2EIE A;  5F5C A;  5DUU A;  3VBO A;  2XGX A;  4RHV 2;  1ST8 A;  1V6L A;  3SQO A;  5JCT A;  5FYB A;  2WAA A;  1W6Q A;  2BYV E;  3POS A;  4OUM A;  4LBQ A;  4QM8 A;  1H6Y A;  1N1Y A;  3B7M A;  4XPV A;  1AR8 2;  3KGL A;  4GZ9 A;  5F32 A;  3I49 A;  4DOU A;  1G8W A;  4KBZ A;  4E27 A;  4ZXE A;  3VKF C;  4O9E A;  2XL9 A;  2R1B A;  2KA3 A;  3FJS A;  3CBN A;  5FYH A;  2DU1 A;  2QQL A;  2ZGM A;  3WDY A;  3IDB B;  5FO9 B;  1FPN 2;  3VBS C;  2XHN A;  1AR7 3;  3HNB M;  3H8O A;  1J3Q A;  1S0J A;  4YFZ A;  2RR1 2;  2RR1 3;  4KWL A;  3AFK A;  2PMW B;  2TUN A;  2W87 A;  1AF9 A;  3WNO A;  2BVB A;  5FP8 A;  1W6M B;  1NQD A;  1TZO A;  4JC1 A;  4QQL A;  5J3U A;  3OG2 A;  4OHZ A;  3EO6 A;  3VBS A;  1AR6 3;  1HW5 A;  1ENS A;  1MS8 A;  5LB6 A;  1NKG A;  3RMX A;  5A1A A;  2BW8 A;  2PAK A;  2E51 A;  3R05 A;  2A7A A;  3J7L A;  3ZSE A;  4E9K A;  4Q4X 3;  3OBR A;  1COV 1;  4WVM A;  5HV0 A;  3ME2 A;  2Q30 A;  4Y20 B;  2RS5 2;  1NAE A;  3NRU A;  2J1E A;  3PHM A;  5FY0 A;  5IUQ A;  3VBU A;  5FLH A;  5AC9 3;  1PMH X;  3TOJ A;  4BQ1 A;  4ITC A;  1AL2 2;  1Y4W A;  1HV0 A;  4COY A;  3H1M A;  4NHM A;  2VZU A;  5FRA A;  2OT7 A;  1NCR A;  2GU9 A;  4D0Q A;  3RGB A;  1SFY A;  2F6B A;  4QDQ A;  4M00 A;  1H4H A;  1H0B A;  3VBU C;  3AVS A;  4NAO A;  2B39 A;  3N36 A;  4YG3 A;  1SAC A;  4EN8 B;  4AED A;  1V6N A;  1LOC A;  1AR8 1;  1NCR C;  3GXU A;  2VQ0 A;  1YRZ A;  5A6X A;  1QOO A;  1TVG A;  2KD7 A;  4KQ7 A;  1DU3 D;  1Q8Q A;  3ZFF A;  1DCS A;  5C6C A;  5KBF A;  3RG0 A;  2DCZ A;  4AED C;  4BDV B;  4E2Q A;  5FZ4 A;  3ES1 A;  4K6B A;  3UJO A;  3W20 A;  5FPB A;  2D7F A;  4BOW A;  5FOB B;  1PGS A;  2Z4F A;  3GYD A;  2HWD 2;  4G4F A;  3WEZ A;  2JJ6 A;  2RE9 A;  3FMG A;  4XFI A;  1KJR A;  2OW4 A;  4QQ2 A;  1CZS A;  1JXN A;  1O3T A;  2IVI B;  3IAP A;  4D8M A;  5J7M A;  1UL9 A;  5FO7 B;  4CZS A;  2J42 A;  4Q8K A;  3D0S A;  4R9C A;  1YI9 A;  1JZ4 A;  4LE4 A;  2VL4 A;  4OMC A;  4Z2A A;  4J25 A;  3JD7 1;  1GV9 A;  3ZFF B;  4I3G A;  4CCC A;  4PLM A;  4LLO A;  3MUZ 1;  3EB7 A;  3N9O A;  4X8N A;  3TN9 1;  4QPG C;  1XQN A;  3IIA A;  1RUD 2;  5L9B A;  4TTG A;  1AL2 1;  4KG0 A;  3UL2 A;  5A1F A;  3FLT A;  3F2Z A;  1U12 A;  2VG9 A;  4RN5 A;  3ZMN A;  1ZRE A;  4PJY A;  2HWB 3;  1FV3 A;  4NWW A;  1XE7 A;  4OHY A;  2JG8 A;  2B5H A;  1EY2 A;  1QJU 2;  2QQU A;  1W2A X;  4J1W A;  4N43 C;  4QPG A;  5FYV A;  1RJ8 A;  1JN2 P;  3LZZ A;  4AF9 A;  1LRH A;  2ZML A;  4DS0 A;  1JZ6 A;  2PLV 3;  1ZVF A;  1UNB A;  5KXD A;  2JG8 C;  3H1W A;  4CDQ B;  2UYB A;  2PLV 1;  4N43 A;  3KV6 A;  4NVP A;  5DZF A;  4CP1 A;  1NY7 1;  1D0H A;  3OTF A;  3A0K A;  4IE4 A;  4UYB A;  3VD5 A;  4YPJ A;  1FOD 1;  4GWM A;  1K3I A;  3IBM A;  3H42 B;  2XJQ A;  4NHK A;  4X6R B;  3I97 A;  3VBS B;  3AMM A;  4CPB D;  2XH6 A;  2Y26 A;  4MUV A;  2RS1 3;  2VMG A;  3VDC A;  4BXF A;  3ZSL A;  3MZH A;  3AMN A;  4JX0 A;  3TBD A;  4LE3 A;  4K20 A;  4GIQ A;  4I01 A;  1MS0 A;  4N90 A;  3I8T A;  5D8A B;  3WF4 A;  1IG0 A;  3JD7 2;  1KRI A;  1QWR A;  4K8F A;  4FXG B;  4XVH A;  5D2A A;  4RS5 A;  3A23 A;  3MPP G;  3E6B A;  2JDN A;  1O8P A;  2Y8K A;  3POW A;  3SH3 A;  5E8A A;  3RPQ A;  1SFP A;  1UD1 A;  1O4T A;  4RS5 C;  5KWR A;  3M3I A;  3D6E A;  1YJK A;  2DVG A;  3C2U A;  3LEM A;  1C3H A;  4K8R B;  4QXC A;  1CX1 A;  4JZR A;  4QDS A;  4COU A;  1QJU 1;  1W8O A;  2K2S A;  2W1Q A;  2WO3 A;  5JSR A;  5I0T A;  4LO4 B;  4CUA A;  1H2L A;  1TNF A;  4LHL A;  5L73 A;  4CVU A;  3UT0 A;  1WW7 A;  1OPO A;  4FPH A;  1O59 A;  3PUI A;  3ZFG B;  3SH5 A;  5A6Q A;  5C8C A;  5LRS A;  1QXJ A;  3RS6 A;  4KGQ A;  5FZI A;  5IK5 A;  4QGL A;  2JX9 A;  3U4S A;  5GZF A;  4LHN A;  1EP0 A;  2A5Z A;  1GNY A;  4L8Q A;  3UGF A;  2LW8 A;  4CA9 A;  2GZW A;  1VBA 1;  4QKD A;  4BQ3 A;  1RUF 3;  2WNV C;  1MVQ A;  1UU6 A;  5FZB A;  5LY1 A;  2IXJ A;  4RQP B;  2C0Z A;  1LHU A;  4YFW A;  2CY6 A;  4XUQ A;  1DQ5 A;  1JTZ X;  2HEY F;  2LTN A;  5BXX A;  3T1L A;  4I30 A;  1CAX B;  5KC5 A;  5A3N A;  5CU1 A;  4OI2 A;  2A6Z A;  1RUE 2;  2WNV A;  3NV4 A;  5FYS A;  5IK8 A;  4MHU A;  1Y43 B;  2WSV A;  4QX1 A;  3MLJ A;  1HRV 3;  3T0A A;  4S2H A;  1O7F A;  2PHX A;  2Z5W A;  4Y1Z A;  1XNA A;  3THT A;  2D5F A;  4QPI B;  3WF2 A;  1X36 A;  2ZX1 A;  3AJZ A;  1O3S A;  3AYA A;  4IV3 A;  4JGZ A;  5SV8 A;  1OUS A;  4Z82 A;  1EUU A;  2ZHK A;  3M1H A;  3E97 A;  4P02 B;  4UFM A;  1HQL A;  2ATF A;  4XTM A;  1M06 G;  2YFZ A;  1LOF C;  5F7U A;  1A8M A;  4LK6 A;  4JVA A;  1KGY A;  4DMI A;  3I3E A;  3ZO0 B;  1TMF 1;  2D6L X;  4JGZ C;  5H9S A;  1BBT 2;  4IEX A;  2IXH A;  3LF7 A;  3U07 A;  4AI9 A;  2P6H A;  2JG8 B;  1SLT A;  5AVA A;  1LED A;  2LAL A;  4Y22 B;  5FRE A;  1LOF A;  2YZ4 A;  1DLC A;  2W68 A;  3SEE A;  2P34 A;  1F5J A;  4OYU A;  5D1I A;  3UKN A;  1OPM A;  3GZE A;  5FZK A;  2GME A;  4AFD A;  4FPE A;  2WNO A;  5T5P A;  2YBP A;  4CXX A;  1C8M 1;  2ZHN A;  4B4Q A;  4NWV A;  2XLF A;  5ACA 2;  2VZO A;  3LCP A;  3POF A;  5EPA A;  3UJQ A;  1QQP 2;  2JG9 A;  1RUF 2;  1UZ0 A;  3PLQ A;  4ISR A;  3WW4 A;  4B3N A;  3KHC A;  5L36 A;  4IE6 A;  1DLL A;  1REF A;  4OI0 A;  1EV1 3;  1CAU A;  3BYW A;  4UOJ A;  4MET A;  2WJS A;  5FJK A;  1UAI A;  4D94 A;  1CON A;  1ZNP A;  3BTA A;  4JHZ A;  1W04 A;  3QD6 A;  1X82 A;  3MID A;  4ZU5 A;  3ZR6 A;  4ZS2 A;  4PIX A;  4CEY B;  3HBK A;  2NMN A;  1ZM1 A;  2Y64 A;  2ZXQ A;  4LBK A;  1P8J A;  1RUG 1;  2X29 A;  1W9S A;  4Q0Q A;  1KJL A;  2GSY A;  3JZV A;  4RGA A;  2D6O X;  4C1W A;  3O14 A;  4D6Q A;  2G19 A;  3GF6 A;  3K3N A;  3QH6 A;  1VLN A;  1VBB 1;  2W92 A;  5K8S A;  3T08 A;  3RRD A;  5EIY B;  2XUM A;  1TMF 2;  4B4R A;  3JBG 2;  2NP0 A;  3JQX A;  4JGY A;  3RI8 A;  2GH8 A;  2QBX A;  2R30 A;  3PTY A;  4LOT A;  1AL2 3;  1GAN A;  1US3 A;  2RJL A;  4PIY A;  2F4P A;  4CSW A;  2B4K A;  1NCR B;  1YJL A;  4QKN A;  1UY0 A;  1XC6 A;  4XOG A;  4YW7 A;  5EV7 A;  4XTP A;  1SPP A;  2P37 A;  1JU4 A;  1F4A A;  1LU2 A;  3IB3 A;  3K2O A;  2Q8E A;  3T2Q A;  2P1B A;  1OQD A;  1R1Z A;  3AM2 A;  4JAA A;  4XJW A;  2QQP A;  3B9C A;  3E6C C;  2Y6K A;  5KHG A;  4OLL A;  1IPS A;  1OSG A;  5FKB A;  4Y33 A;  1W9T A;  2CHH A;  1PNF A;  1UWW A;  1ZX5 A;  3VZL A;  4P9I A;  5A7O A;  4KBB A;  1DZR A;  1G86 A;  4HZF A;  2FHR A;  1UY3 A;  2EF6 A;  4BK4 A;  1E5R A;  1C5I A;  5FZA A;  4COV A;  2JXA A;  1DBN A;  3EXU A;  1WLW A;  2FD8 A;  1TNR A;  2YG0 A;  1HB3 A;  4JKK A;  4Y26 A;  5GLZ A;  2XVL A;  3MW4 A;  3KV9 A;  4UT5 A;  1DGR N;  3N4M A;  2R0F A;  3CHX A;  4UBG A;  4DPN A;  4Y1U A;  4FO9 A;  4IGQ A;  4IE0 A;  4NUB A;  1RHI 3;  1SEF A;  2E9Q A;  1G9F A;  2DUQ A;  1KFU L;  2X5I B;  3AB0 A;  1IS3 A;  2QQM A;  1SHW B;  5FZ6 A;  3GAL A;  3S30 A;  4YAR A;  5AC9 2;  3IWZ A;  2W1W A;  2C9K A;  1RUI 3;  3VDD C;  3WY6 A;  2VZ3 A;  2XLG A;  2ZPX A;  2LM3 A;  1SBE A;  1XSQ A;  1OVP A;  1E5S A;  2AZ5 A;  3D5O A;  4JRA A;  4E8D A;  3OBZ A;  1CAU B;  2DUR A;  2VZQ A;  2WBK A;  2YPD A;  1GLH A;  2QFE A;  4P00 B;  5H9Q A;  5CAZ A;  3MF6 A;  4QKB A;  5FZO A;  1UX6 A;  4YRD A;  2HWE 3;  2P3J A;  4XUN A;  2R6Q A;  2Y38 A;  4XIO A;  3ZPO A;  1DZT A;  2ZA9 A;  3OUJ A;  2HWE 1;  4IEZ A;  4QMA A;  4PI0 A;  5HCH A;  1PVC 1;  5FDB A;  3C8X A;  1J3P A;  5K9Y A;  5DG1 A;  4D7Y A;  2WFF 1;  3P5B A;  3AZX A;  2YXS A;  4QPW A;  1SZB A;  2VNG A;  3PU8 A;  1OD5 A;  2VM9 A;  1F8V A;  5GKA C;  3WIN E;  4ZPI A;  4Q4X 1;  2D3R A;  1VPH A;  3VD7 A;  2Z79 A;  2XJU A;  4ORF A;  4C90 A;  1W28 A;  2OA2 A;  4GH4 A;  4BU2 A;  3CLP A;  1I6X A;  2VTF A;  5BNN B;  3NV2 A;  1H9W A;  3WG2 A;  2DVA A;  3AKP A;  1DQ0 A;  4XUP A;  2LRO A;  5J96 B;  2NN8 A;  2Y0I A;  3JCI A;  4Y3O A;  1N1S A;  3OPT A;  5FIX A;  1WCQ A;  4ZU4 A;  3GGL A;  2DUO A;  4PBP A;  5JXJ A;  4HBN A;  3HEI A;  3SCF A;  5C70 A;  3HT1 A;  1UZY A;  3HR9 A;  4UW6 A;  2EXH A;  1JOJ A;  4FPF A;  5TSW A;  3TEX A;  1GWM A;  2OPW A;  5DZG A;  1YXW A;  4JDM A;  1LR5 A;  1PHM A;  5BNO A;  4H2A A;  4IEO A;  1K5J A;  1IHM A;  3Q8A A;  4URA A;  4AGR A;  3BIE A;  4KU7 A;  3BCW A;  4QB1 A;  2ZGT A;  3M3O A;  5IVJ A;  1B35 C;  2Q1F A;  1V9U 1;  1W90 A;  2I74 A;  3MIG A;  5CG9 A;  3POG A;  5CKQ A;  4BHP A;  3P1I A;  3O1T A;  4YG0 A;  5FO8 B;  3OOX A;  3LAG A;  3E5Q A;  3SIT A;  3O1U A;  2HYK A;  2WWJ A;  3T0D A;  1JZ3 A;  5FBZ A;  1VBC 2;  2BFU L;  4GH4 B;  2R49 A;  4Q2F A;  4LUM A;  1SMV A;  2C24 A;  3VZN A;  3VKM A;  3MHZ A;  4WV8 A;  2DCT A;  5CA6 A;  1L3J A;  3LDB A;  5L7O B;  2BRT A;  4EZH A;  4WVZ A;  1KXG A;  2BER A;  2QDN A;  3MV0 1;  3U11 A;  4CU9 A;  1HXS 1;  2YGL A;  4QGN A;  5T5O A;  3WCS A;  4DRR A;  3ZFG A;  1OLM A;  4FVV A;  3K46 A;  4BIF A;  5JZG B;  4S2D A;  3I2O A;  3USU A;  3RZM A;  1E57 A;  2D98 A;  5L9V A;  3MI8 A;  4IEY A;  3TB0 A;  2HWD 1;  3KGZ A;  1RED A;  3ZFG C;  2IXK A;  1H1I A;  3AMQ A;  1V6J A;  1ND3 A;  1CR7 A;  1K5M A;  3J7M A;  4ASM B;  1AX1 A;  2XXZ A;  3ZSJ A;  4QX0 A;  4OI4 A;  4RR3 A;  3FC0 A;  5I8Y A;  4LLF A;  4RSU A;  5CFC B;  2YMZ A;  1CWP A;  4GJY A;  2GP5 A;  2XWB B;  4FOY A;  2GNT A;  2VOV A;  4NHL A;  4LIU A;  4XF3 A;  4Q26 A;  3ACL A;  4DXT A;  4FOW A;  2X5I A;  2ZGU A;  5LA0 A;  1BHG A;  1CZV A;  1JMU B;  1RUD 1;  2ZGP A;  4KWJ A;  3VBR B;  2BOJ A;  4EE2 A;  1J1L A;  4BPZ A;  4LR4 A;  5FQ0 A;  3GM8 A;  5KXC A;  1X33 A;  3O5S A;  4N53 A;  4YM1 A;  2PQQ A;  4V2V A;  2IVJ A;  2ZEW A;  3ELN A;  1H1M A;  4CDX C;  5BPX A;  5KXE A;  1QJY 2;  3A22 A;  1NLR A;  5DDJ 3;  3NAP C;  5ERL A;  2VNV A;  5IVE A;  4CCK A;  3LA3 A;  1XND A;  3RI9 A;  2RDQ A;  1KDK A;  1QGL A;  4QQH A;  3GJA A;  4YVS A;  5LAT A;  2A70 A;  3P6B A;  1HXS 2;  2B45 X;  2BV4 A;  4U2A A;  4NID A;  3MW3 A;  1NY7 2;  1RUI 1;  1SPP B;  2DWR A;  2UWC A;  5APA A;  2O1Q A;  1KFX L;  2NMO A;  1QF3 A;  3O0X A;  2BJS A;  1LES A;  1OXC A;  1W0P A;  1RGS A;  3CJI C;  2BZD A;  3ZN6 B;  4AHZ A;  2VVE A;  2WO7 A;  5A7N A;  1ZBE 2;  5IFP A;  1ZRI A;  4CRQ A;  3S0M A;  3SKJ E;  3G6J B;  1YQ2 A;  1O6U A;  2J1T A;  1AJO A;  1W8H A;  2CWM A;  4URT A;  2VOX A;  4A6O A;  3AP5 A;  2VVF A;  3CJI A;  3GCW A;  3BPS A;  3WDT A;  1DYP A;  2AEY A;  3EHK A;  4XF4 A;  4TLF A;  4TWT A;  2QKD A;  5FYY A;  3SHR A;  1LJ7 A;  5JWP A;  4H7M A;  2QNK A;  4HPK A;  5FZ8 A;  1GOF A;  2WZR 2;  2E26 A;  2PHF A;  4EWA A;  3D4K A;  4XDP A;  3ZX7 A;  3OGR A;  5L9R A;  4XJ8 A;  2W39 A;  3V0B B;  3AL6 A;  3WG1 A;  4KGG A;  5DAQ A;  3LQC A;  2P4E A;  4EN6 B;  2RHP A;  3VDB A;  1LHO A;  1J58 A;  4COZ A;  3GZT B;  4LBN A;  4UFH A;  1ENR A;  2QQK A;  3EMR A;  4CCJ A;  1NOV A;  3OGS A;  1M4W A;  5DMY A;  2XUE A;  3KT7 A;  3DYP A;  1JH5 A;  5DG2 A;  4AFC A;  1KS4 A;  2B46 X;  1DGW A;  3X29 B;  2HWF 2;  4MXW A;  1IPJ A;  5FZE A;  4A4A A;  2PHT A;  3C7E A;  3ZIW A;  1Z7S 3;  3V0B A;  2YV8 A;  1YQ8 A;  4QHZ A;  3BU0 A;  5FZ9 A;  3WR0 A;  3RZL A;  3RVH A;  3HMY A;  4GJZ A;  5DN2 A;  1LEN A;  3OB8 A;  3KZ4 C;  1QQP 3;  1OI6 A;  3PJQ A;  4A6S A;  1AX0 A;  1PNG A;  4UXA A;  1RUO A;  5LW9 A;  1VBA 2;  3Q8F A;  2QVS B;  3JBG 3;  4AQ2 A;  2R16 A;  1LU1 A;  4XJZ A;  2OX0 A;  3I2J A;  3ZXE A;  4IL7 A;  2G9F A;  5J36 A;  2RS3 1;  3VD3 A;  4UW3 A;  3QAC A;  4M4P A;  1LOD A;  2NPI A;  3MBW A;  4YSF A;  4CDW C;  4H55 A;  1G9B A;  3H3U A;  1HX6 A;  1QJF A;  4XFG A;  2P3K A;  1W2N A;  1ACC A;  4WVM B;  1H1A A;  2WYF A;  2IXL A;  3PME A;  5JDB A;  1FOD 3;  1W0N A;  2BDR A;  4IV3 B;  2DVF A;  4GMP 0;  2CAV A;  3VBF C;  2JE7 A;  4BM8 A;  4KG8 A;  1PVX A;  3VZK A;  4EN0 A;  3VL8 A;  3H0O A;  5A3M A;  2QDR A;  3GHM A;  3H7Y A;  1CES A;  2WT0 A;  3RDI A;  4V2W A;  4P5H A;  3CZU A;  3RMY A;  1CGP A;  3VBF A;  1S0D A;  4N9I A;  3TEZ A;  2D3S A;  4XET A;  1R64 A;  1S4C A;  1CAX A;  3RNS A;  1ZRD A;  1BBT 1;  1LGC A;  1OQE A;  1QDO A;  3T4V A;  5FMC A;  2JB4 A;  4L0P A;  3ZXF A;  2ADD A;  2EXJ A;  4R4Z A;  4A7K A;  1XPW A;  2VW2 A;  3B93 A;  2ZEX A;  5C3R A;  2W1U A;  4HET A;  4XJU A;  4PQQ A;  4MG2 A;  3KCY A;  4GWJ A;  5FPA A;  4RR3 B;  3B69 A;  1NA1 A;  3IKW A;  4BXS V;  4XAE A;  1K5M B;  1SDW A;  4FI9 A;  1YFW A;  4XBN A;  3W9A A;  1VBE 2;  1ZZ8 A;  3WX5 A;  4JTN A;  3MIF A;  4MGI E;  5F3E A;  3ACF A;  5HCB A;  4F3J A;  5A70 A;  2V5Y A;  3DYO A;  4YW1 A;  3ZYG A;  2ZAC A;  4CDU C;  1CX4 A;  1S1A A;  3NAP B;  5JZG A;  4IGP A;  3KF3 A;  3ECQ A;  5GZE A;  1AYM 3;  1QEX A;  1IGO A;  1UY2 A;  2AH2 A;  2RDS A;  2WN3 A;  2VME A;  4XBL A;  4CDX B;  4YM3 A;  2PXJ A;  3GZU C;  1RMU 2;  1UQX A;  5A7W B;  4OZX A;  5AVP A;  4EN7 B;  3IT8 A;  1S0E A;  3APB A;  5K0U A;  1NA1 B;  5T55 A;  3III A;  4AWD A;  4DO0 A;  5G04 L;  1XB9 A;  3OPZ A;  2TBV A;  1MVE A;  4LTA A;  4XFC A;  1JZ8 A;  4RD7 A;  1RC6 A;  5F37 A;  2WZP P;  3ILF A;  2RMU 2;  3K4Z A;  4NRO A;  4A3Z A;  4B4P A;  2VUA A;  1POV 0;  1YQC A;  4U36 A;  5ABJ C;  1UO9 A;  5BUV A;  3VD4 A;  5D8A A;  2R32 A;  3N7M A;  1LB2 A;  3HNY M;  1VBB 2;  2DTY A;  1OFS A;  1RXG A;  2DVD A;  4ZON A;  1LOB A;  2DDU A;  1EV1 2;  3I2D A;  4GUL A;  1BJQ A;  3T30 A;  3OYW B;  1GFF 2;  1Z7S 1;  2NM1 A;  5ANN A;  3T2T A;  2FMD A;  1AR7 1;  4HSJ A;  5E16 A;  5ABJ A;  1HRI 3;  3M3C A;  5DAP A;  3VBF B;  1GZW A;  2D93 A;  2EVX A;  2B9U A;  4Z07 A;  1QMJ A;  1RUJ 3;  2WAO A;  2ID4 A;  3W21 A;  2OUJ A;  4BQ5 A;  1AR6 2;  2Q5T A;  2RM2 3;  2WO1 A;  1LKN A;  3KVB A;  2GMM A;  1REE A;  2FQP A;  4HMZ A;  4OQ8 A;  1ODN A;  2BPA 2;  4I09 A;  4F7Z A;  2ARC A;  2WZR 3;  5SV5 A;  4LO7 A;  2WWS A;  4MGQ A;  4Q0P A;  2ZGK A;  3RJR A;  1FT9 A;  1JS9 A;  2RJ2 A;  3K75 B;  4LT5 A;  5BNN A;  1STM A;  5FP4 A;  3ZXJ A;  1E5H A;  4FFI A;  2V4V A;  4AW7 A;  1SLI A;  1Y9M A;  1FI2 A;  1HRI 2;  2ZS6 B;  4IE7 A;  1C8N A;  1AL0 G;  1GU3 A;  4JRL A;  1JHN A;  4DY3 A;  5IYY A;  5BNN C;  3ZFE C;  5GLT A;  1NXD 1;  1W2T A;  5JMC A;  3M3Q A;  3WHU A;  4KNC A;  3ZYI B;  1WLD A;  4Z2W A;  3UGH A;  4Q4Y 2;  4IER A;  2G9Z A;  2TEP A;  4HON A;  1WBF A;  2A3X A;  3K4A A;  1LTE A;  4WM7 C;  4E2G A;  3ZFE A;  3V0A B;  2VC9 A;  2YYO A;  4FTS A;  5FUI A;  1MS4 A;  5A33 A;  1DIW A;  2ZGQ A;  5JXG A;  4XBQ A;  5FZO B;  4UFL A;  2Y6J A;  5FJH A;  1Z7S 2;  4CUB A;  4IV1 C;  1PX4 A;  1Y7B A;  2PEL A;  1OLR A;  2ZX3 A;  1FNZ A;  4YVW C;  3VHO A;  4EJR A;  5C3P A;  5A80 A;  3ZYR A;  3AP7 A;  2ZGL A;  2XOM A;  1PVC 2;  5FTT C;  4B29 A;  3JD7 3;  4HVR A;  4QWN A;  1AR9 2;  3BOD A;  3D3A A;  4AI2 A;  2RJK A;  4XF9 A;  4LMF A;  1URX A;  3WG3 A;  3SXW A;  4YVW A;  1X50 A;  2ERF A;  4MO3 M;  3I3D A;  3DL3 A;  5LBF A;  4LPL A;  3HD8 B;  3TNQ A;  4YWA A;  5A32 A;  5I8T A;  1K42 A;  3DEC A;  4MSV A;  5DQ0 A;  2TNF A;  5HPO A;  1ZZB A;  4LHS A;  4Q27 A;  4HN1 A;  4D69 A;  1S0B A;  3HJR A;  3SMH A;  2PFW A;  3NL1 A;  2XWJ B;  1OA4 A;  3ZYB A;  5HXV A;  2WC2 A;  3FFZ A;  2X05 A;  2OZJ A;  4K40 A;  5JR2 A;  5LBB A;  2JIG A;  1DGW X;  3ZN6 A;  1UKG A;  3CEW A;  3AZW A;  4Q4V 2;  3W58 A;  5IFT A;  1RUJ 2;  2RS3 3;  4ZZ5 A;  2A73 B;  4P5Y A;  4C0B A;  3NJZ A;  2PLV 2;  3NNM A;  2WT2 A;  2D44 A;  1IPK A;  3G7D A;  4BQY A;  3KV5 A;  3BIW E;  4AEJ A;  1IZ3 A;  1XYN A;  5JR7 B;  1VB4 A;  5IVF A;  1OA3 A;  4JV4 A;  1PK6 C;  3POE A;  4A3X A;  4LKD A;  1HXS 3;  1JHJ A;  3AKS A;  2HWC 1;  1IS6 A;  3PNA A;  1UYY A;  5FMO S;  1EPZ A;  5LA9 A;  3N9M A;  2D43 A;  2W47 A;  1YIF A;  1WD3 A;  3ON7 A;  4MYE A;  5FPL A;  4AI8 A;  4ATF A;  3VZJ A;  3PJY A;  2VNO A;  4AGG A;  3GBG A;  3WP6 A;  5C9A B;  4N53 B;  3CQO A;  5DXD A;  1ZZ6 A;  2AC1 A;  3JB8 A;  3PUR A;  5FYM A;  1KIT A;  1AUY A;  3VBR A;  4N9H A;  1XNT A;  3VL9 A;  2C1F A;  4XF1 A;  4LO5 B;  1AYM 2;  1OMI A;  3U1X A;  1W6O B;  4MAD A;  4OUS A;  2VUJ A;  2VCC A;  3QLQ A;  1X9T A;  3S6P A;  3IMM A;  1ZA7 A;  4AR2 A;  3WW2 A;  2K0G A;  1OFN A;  2A6V A;  2D6P A;  1T6B X;  1GP6 A;  1QIQ A;  3KCX A;  2O14 A;  2WII B;  4LO8 A;  1CAV A;  4CTE A;  4LOS A;  3O12 A;  1MR5 A;  2JG9 B;  4A44 A;  1D2S A;  3FN9 A;  4AVA A;  1YUD A;  1WD4 A;  2CGP A;  1W9F A;  1ONA A;  4K1Z A;  4Y1X A;  4XAB A;  1SCS A;  4CXY A;  2FDG A;  1R08 3;  1W9Y A;  4P14 A;  3MLL A;  5JIA A;  4XJ9 A;  4XDQ A;  5IVC A;  1SLC A;  3U37 A;  5K4L A;  1W3X A;  1SG3 A;  1H2M A;  2VQA A;  2R0H A;  3D82 A;  5HCA A;  1H8T B;  5CKM A;  2VMD A;  4LA3 A;  1MQT C;  4NII A;  3ZFF C;  4E4S A;  2YPJ A;  5FWJ A;  3M7A A;  5FP7 A;  1H4G A;  1HB1 A;  2XB6 C;  3O1O A;  2OVU A;  3T09 A;  2DTW A;  2BNO A;  1FX5 A;  2JD4 A;  2VBD A;  4DUV A;  4LKE A;  2GC2 A;  4WVW A;  1QJY 1;  5M0T A;  1RUE 1;  1YFX A;  2E7A A;  3VHN A;  3KB5 A;  5F2S A;  2V73 A;  1TE1 B;  4JGZ B;  3ZOI A;  4YYO A;  1Z78 A;  3AJY A;  4AVC A;  4ZZ8 A;  1PX3 A;  5JPM B;  1H6X A;  1BQP A;  4ATE A;  3PU3 A;  1TME 2;  1W6P B;  5BNO B;  1V00 A;  3LFI A;  3JXS A;  1YCI A;  3CF6 E;  1POQ A;  1O5U A;  4WM7 B;  3BVC A;  3GCX A;  2ET7 A;  1JZ5 A;  4LIT A;  5D21 A;  4ZU7 A;  2OS2 A;  1UOG A;  2VTX A;  4AVB A;  2VOK A;  2CL2 A;  1QNW A;  1X9P A;  3WNX A;  3QOP A;  4M0N A;  4DEV A;  1OT5 A;  1HLC A;  3WVJ A;  3RFR A;  1D7P M;  4YZ1 A;  1RUC 2;  4ERO A;  2J1U A;  2GDF A;  1ZBA 1;  2OXB A;  2XG3 A;  3MW2 A;  2ZZQ A;  3OBT A;  4RYD A;  4Y4Y A;  3UK9 A;  3SC7 X;  3J8F 1;  2WN2 A;  4XFB A;  1PM7 A;  5CNA A;  1W9W A;  2ES3 A;  3KVA A;  2RS5 3;  3LKJ A;  4S2F A;  5JXI A;  2JB8 A;  3KM5 A;  3MYX A;  5FY1 A;  5BV6 A;  2CV6 A;  1ENX A;  1F5F A;  4NOT A;  5CKN A;  1XJA A;  3LDR A;  3L2Y A;  4CPB A;  2P17 A;  4LA2 A;  5A6Y A;  4NHY A;  4JKL A;  2PAM A;  1Y9Q A;  2FCV A;  1Q56 A;  1QQP 1;  1WLT A;  1LGN A;  2H0B A;  3PVN A;  4PBO A;  5DAB A;  1CD3 G;  5J09 A;  1UYP A;  4UW5 A;  4XYX A;  5A3U A;  1IS5 A;  3MLK A;  1UY1 A;  4CCO A;  4XHB A;  3RYK A;  2J1R A;  2BGC A;  5KXB A;  1AX2 A;  1RMU 3;  2W91 A;  3IZO A;  4IXL A;  4OUE A;  1SBD A;  1CAV B;  5FWE A;  5JUV A;  1BEV 2;  3DEM A;  2GMP A;  4O9G A;  4CUG A;  4IE5 A;  3H8X A;  3ZLI A;  3WP3 A;  4IET A;  1ULF A;  4YGE A;  3FX3 A;  1J59 A;  4FPL A;  2ZBJ A;  2A6Y A;  3N9P A;  4QXB A;  4UBH A;  1VBE 3;  2ORZ A;  4OZO A;  5T54 A;  3VZO A;  4AL9 A;  3PVO A;  1JZ7 A;  2WQZ C;  3RZZ A;  4QGM A;  2IFW A;  4W6W A;  1VAV A;  1FNY A;  3QH7 A;  1D4M 1;  2WS9 3;  2B8M A;  2ZZJ A;  1ZBE 3;  5LAS A;  2P5B A;  2DCK A;  4YLZ A;  1VE0 A;  2EXI A;  4RHV 3;  5T5J A;  4Z1V A;  1FMD 2;  1ODM A;  4OUL A;  4YM2 A;  4MGS A;  1AZD A;  3FHI B;  1K12 A;  4RHV 1;  2RDR A;  1HB4 A;  4I0W B;  1HQN A;  4Q0S A;  1PGW 2;  3AVR A;  3KWV A;  4GQ7 A;  5B4X A;  1QNY A;  2JKX A;  3PVE A;  1KQR A;  4R8H A;  5G05 L;  2OPK A;  2AEN A;  4EV0 A;  4CDQ A;  4Q4V 3;  1OLM E;  1WCS A;  3AMP A;  3OEA A;  4MH0 E;  1COV 3;  4XUT A;  4YG6 A;  1E5I A;  3H3Z A;  5F5Q A;  2JKB A;  2JDK A;  4QKF A;  1I9R A;  2P3I A;  1POV 1;  1V6I A;  4QPG B;  5F6K A;  1OLQ A;  1ULG A;  4PDW A;  2AAC A;  2FBE A;  1FPN 1;  1N1T A;  3B01 A;  3E5X A;  1ASJ 3;  3ORJ A;  3ZKU A;  3O1V A;  2FDI A;  4XFH A;  3WNK A;  2WR9 A;  5FZD A;  2YB7 A;  4OHW A;  4IGO A;  1FMD 3;  2FZ1 A;  2VMF A;  4HKW A;  4COW A;  4PDW C;  2XJP A;  4Y1V A;  1W8W A;  5FYZ A;  2XQR A;  4ASL A;  2R04 1;  3WLU A;  1PO2 2;  2D6M A;  4NPL A;  4XFA A;  5E1R A;  3AX4 A;  2O0O A;  2PQS A;  2XPJ A;  2ET1 A;  4HKL A;  5IJR A;  1D4M 2;  2ARX A;  3DXT A;  4AI3 A;  2QQI A;  5I0S A;  3ES4 A;  1LOA A;  3NV1 A;  3MF9 A;  1W39 A;  5JI9 A;  4CDW B;  3ZXK A;  4AAX A;  1GZC A;  5FPU A;  3CO2 A;  2GC3 A;  3C7H A;  1UOJ A;  1LCL A;  1W99 A;  1PGW 1;  1KDM A;  1WUV A;  2OKX A;  2CGN A;  2VZR A;  4BK5 A;  4MLO A;  3ZFE B;  3M2M A;  4WBB A;  5FV3 A;  4BLJ A;  5GZC A;  5I93 A;  4D7T A;  4LUL A;  2VXJ A;  2E7T A;  2JE8 A;  5CFD B;  1AVB A;  4IW3 A;  4YGD A;  5ACA 3;  3HQR A;  2RM2 1;  4WM8 C;  5FYC A;  1CQ9 A;  1A34 A;  1O8S A;  5FFO C;  4QB6 A;  5IAX A;  4XIK A;  5A1L A;  4CP9 A;  3M70 A;  5IT6 A;  3LPG A;  4HKO A;  5DAX A;  3AKQ A;  1DZQ A;  1GNZ A;  3GHN A;  4Q29 A;  2BP6 A;  5HBA A;  1RUN A;  4WM8 A;  1PZ9 A;  1EV1 1;  4LJH A;  2HJI A;  3O1R A;  1BKZ A;  1N3Q A;  1ND2 B;  2XJT A;  2UWB A;  5DPN A;  2R04 2;  3TYJ A;  1VP6 A;  1U5X A;  3E1F 1;  2OII A;  4FOQ A;  5CVR A;  5A3O A;  3U4X A;  3LA7 A;  3UET A;  2JDH A;  2R06 3;  4YZ5 A;  1C28 A;  1OH3 A;  5EWS A;  1MS3 A;  1UCX A;  1PO2 3;  3VBH B;  2BWC A;  4XF0 A;  2UUR A;  5EP9 A;  2IWG B;  5FZC A;  2VXR A;  1LHW A;  1W8Z A;  3LEK A;  1FXZ A;  1DYK A;  3PUS A;  5FZF A;  4MGK E;  2GP3 A;  3ASI A;  4NIA A;  1W6P A;  1GZW B;  1Q3E A;  1X7N A;  2WZ8 A;  4FQ4 A;  3IPV A;  3VZM A;  4MVT A;  2JEM A;  2ZOE B;  3WQ0 A;  3J7N A;  2XON A;  1OOP C;  5LA2 A;  1JOP A;  2P2K A;  4QQO A;  3O1P A;  3U10 A;  4HN0 A;  5A6Z A;  5BNP A;  3M3E A;  4JGY C;  2ZTN A;  4S2G A;  4F8A A;  4A7Y A;  4XE9 A;  4L11 A;  4ZHN A;  3O1S A;  2PHL A;  1MS5 A;  1OOP A;  2VUL A;  4TN7 A;  3USS A;  4ZKT B;  3RZG A;  5E89 A;  1VMF A;  1DQ1 A;  5BNP C;  1A6C A;  4BQW A;  2R07 1;  4LBQ B;  1EAH 3;  1H8T A;  1GSL A;  3MUY 1;  5IVB A; 
#chains in the Genus database with same CATH homology
 1UQX A;  2VNV A;  2JDM A;  2JDK A;  5A6Y A;  1OVS A;  4UT5 A;  2BP6 A;  5HCH A;  1W8F A;  2BOI A;  2WR9 A;  4CE8 A;  2BV4 A;  5A6Z A;  1UZV A;  2JDP A;  5A6Q A;  1GZT A;  1OUX A;  2VUD A;  4AOC A;  5A3O A;  3ZDV A;  5D2A A;  1OXC A;  5A70 A;  1OVP A;  2VUC A;  2JDH A;  5A6X A;  2BOJ A;  1OUR A;  1OUS A;  2CHH A;  2JDN A;  3DCQ A;  2JDU A;  2XR4 A;  1W8H A;  2WRA A;  2JDY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...