2JDYA

Mutant (g24n) of pseudomonas aeruginosa lectin ii (pa-iil) complexed with methyl-b-d-mannoyranoside
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
114
structure length
114
Chain Sequence
ATQGVFTLPANTRFGVTAFANSSNTQTVNVLVNNETAATFSGQSTNNAVIGTQVLNSGSSGKVQVQVSVNGRPSDLVSAQVILTNELNFALVGSEDGTDNDYNDAVVVINWPLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FUCOSE-BINDING LECTIN PA-IIL
publication title Engineering of Pa-Iil Lectin from Pseudomonas Aeruginosa - Unravelling the Role of the Specificity Loop for Sugar Preference.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Lectin
total genus 20
structure length 114
sequence length 114
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07472 PA-IIL Fucose-binding lectin II (PA-IIL)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.400 Mainly Beta Sandwich Jelly Rolls Calcium-mediated lectin 2jdyA00
3DCQA 2JDYA 2WRAA 2JDKA 2WR9A 1OUXA 2VUDA 2XR4A 5A3OA 5D2AA 2JDMA 1OVSA 1OUSA 1OURA 2JDNA 5HCHA 2BOIA 2JDUA 1W8FA 1OVPA 1UZVA 4AOCA 2JDPA 2JDHA 4CE8A 1GZTA 2BP6A 5A6QA 1OXCA 2BV4A 4UT5A 2VNVA 1UQXA 5A6YA 2VUCA 5A6ZA 3ZDVA 1W8HA 2CHHA 2BOJA 5A70A 5A6XA
chains in the Genus database with same CATH superfamily
4NR1A 4ASMB 3WD5A 2R061 3K4ZA 3ZYGA 1HXS1 3BOWA 5D21A 3WEZA 3PNAA 1UIKA 2GP3A 2CWSA 4AI8A 4F3JA 2HJIA 3KCCA 2DWRA 3ZSJA 4MXVA 2P1BA 3O1PA 4AFBA 5EPAA 4A4AA 2XHKA 2WLPA 1C4RA 2K46A 2OX0A 2VO5A 4LTAA 1UOFA 5FZGA 3AP5A 5GZEA 1CAWB 5IK4A 1CJDA 5LBBA 3GBWA 2JD9A 3VUOA 1O5LA 1AL21 3UKTA 4P00B 4IEXA 2FCUA 4NRQA 1OXCA 1OA4A 3GXUA 5FR3A 5JXGA 1AR73 1OQEA 5L73A 1UQXA 2W0XA 3IBMA 2CV6A 2D6OX 2PAMA 3A7QA 3DYMA 1VBD3 3CJXA 2ZMNA 4P02B 3CBNA 5FMDA 1UMHA 2R041 1YJKA 4E2SA 4BM8A 3R4SA 1SLIA 3S6PA 4FAGA 4JV4A 3RQ0A 2HEVF 3C2UA 3BOPA 5IW0A 2V73A 1PX4A 2A6ZA 2YBKA 4RN5A 1LB2A 3CJIC 4CCEA 4CDWA 2VM9A 4GKYA 4KBZA 4IV3C 4E4SA 1LEMA 1W8FA 5FZ4A 2G9GA 2VW0A 3FLRA 3K48A 4GALA 1JYWA 4AAXA 1FI2A 4XF1A 1HRI1 1QJX2 3OYWA 5BNOC 3V0AB 1HQLA 2I45A 3OPTA 3JB8A 1U5XA 1AR63 4JKKA 2VUAA 1W90A 4FFFA 4RYDA 3VD7A 5HI0A 1G86A 2DYCA 2VUJA 5FWEA 3LSDA 5EZWA 3VHNA 3BKZA 2B46X 4JQRA 2YDEA 5IJRA 4JKMA 2PAKA 4L99A 5C8WA 5C9AC 2R071 5KC6A 4LA3A 4GWMA 4PF1A 4XBNA 5A3PA 4MGTA 1A8DA 1UY1A 2W91A 2BEOA 3VBSB 1VBC2 3POEA 1YFUA 4Q0QA 3VBHB 3LDKA 2R32A 2YXSA 5JCTA 2QTWB 5FZ3A 3KWVA 1GYKA 1RUG2 4BJ0A 3AYEA 1UD1A 2VMCA 3GHNA 4W6XA 3CIHA 4XF3A 4RHV2 4QPIC 2DBNA 1QJZA 4I0WB 4D6RA 5J7MA 4ZU4A 3O5SA 1YFYA 4AAPA 3U4XA 3AJZA 3JBG3 4NHYA 2XJPA 3A0NA 2H0VA 4QX3A 2IUWA 1TME3 2WA4A 2GP5A 3TN91 2XL9A 1OH3A 1XE0A 4YFZA 1B35B 3RDIA 2OIIA 3PJYA 1HN0A 5FUNA 4TLFA 2B8MA 4DEQA 2A71A 5FLIA 2UWBA 5FZEA 3OPWA 3GALA 5FFOC 2D3PA 2AACA 2RR11 2Y6GA 2Z79A 2XL7A 2XMLA 4CDUC 2CGOA 1KQRA 5A7WB 2F6BA 3PHMA 3KCYA 2VTFA 2ZGMA 3GZAA 3B9CA 3PVNA 2VZPA 2P3JA 4GWNA 3T08A 4LT5A 1DQ5A 1EAH1 2HWB1 1POQA 3B02A 1HN1A 2Q0AA 4Q0UA 1DZQA 1VBE3 2ZMKA 3AXDA 4GULA 4TWTA 5F2WA 4AL9A 3U4SA 4WM8A 3I2DA 3LD8A 1GICA 2ZZJA 1CAXA 4RGGA 3TWIA 3IMNA 1S0DA 3ME2A 4WVMB 4EN7B 4CDXB 3ORJA 4Y24A 1PZ9A 3THTA 1IQAA 1W9SA 1RUH3 3AL6A 3T2OA 1LOFC 1UZVA 3T2QA 2VE1A 1F15A 1U5ZA 4Q8LA 5GZDA 3UKNA 3WNKA 4CXXA 2PQSA 2ES3A 1I1EA 2O14A 3OF1A 1BHGA 1H8TC 3CF6E 1VE0A 1A78A 2VMHA 2ZGSA 5GZGA 2ZX2A 1URXA 3DYPA 1AR92 5CISA 2FD8A 1GKBA 3RZJA 2X10A 1S55A 3SXWA 3GNEA 3IT8A 4OMDA 1PO13 1G6NA 3VZOA 1ZREA 2OQ7A 5AFBA 4LKFA 2VZRA 2IXIA 2A75A 4L2NA 4OUSA 5HV0A 2E33A 1F9KA 4V1PA 3RGBA 3K4DA 3U75A 1IKPA 3Q8BA 4B3NA 4QWNA 4LMFA 5F6LB 1PGSA 1PK6C 3MV01 1S0IA 3OD0A 4E2QA 3QOPA 3L2HA 1ZNPA 2TNFA 1NCRA 2VVFA 2X5IC 3IWZA 3OBTA 1DYKA 1UYYA 1FNZA 3H50A 2DTYA 1RUJ3 5DUWA 4DY5A 4F83A 3HAGA 4DXRA 2FHRA 1H6XA 3DV8A 4RR3A 1QGLA 1S2BA 1ZRRA 2GNBA 2E26A 2WN3A 4QPGC 2WWJA 2CTVA 5D2AA 4EWDA 1QJX1 2L9LA 4FQZA 4CEWC 1T6BX 3FC0A 3J4UH 3ITQA 2ZAHA 1NCQC 1W8TA 3PU3A 4BQ4A 1XYNA 3POBA 5DAXA 4WVWA 4PDWC 1I5ZA 4E9KA 3TEWA 2Z42A 5DMYA 1W28A 1OPOA 3RVHA 1OOPC 3NV2A 1SFPA 2VXJA 4XFIA 4XUOA 4AF9A 3LB9A 3MW4A 2ETEA 1G7YA 1AYN3 1LHNA 2DDUA 2WL1A 2XKPA 3WHTA 3WV6A 4BIOA 3ZKYA 1MACA 2D5HA 1ZBE3 4FFGA 1T6GC 4Z2WA 1F8VA 1UZ0A 2XH6A 1IQDC 2GC1A 1UXZA 3OUJA 2WINB 4FQ4A 1OPMA 5GLTA 4BQ3A 3D5OA 1Z0HA 4Z82A 4EE2A 3I49A 1SDDB 5CZKA 1VBC1 1VLNA 4EQVA 3EBRA 3W9AA 5E8AA 3HBKA 1W04A 3AK0A 3LIGA 4IV1B 5JAXA 5DQ0A 4Q8KA 1RUG1 3LEGA 4IEZA 1OA2A 4KL1A 2JDAA 3HJRA 2JICA 4OLLA 5CKQA 4Q4W2 3T2PA 3KF3A 2R7EB 3AFGA 1T2XA 5LA1A 5FY9A 5CG8A 1MZFA 1ULPA 3E5QA 4AHXA 2JKBA 1E5RA 4OHWA 3VBFA 3ZXLA 5D8AC 3VLBB 2EIEA 5F5AA 2BGCA 4I09A 5CFCB 4BQYA 5FYZA 1HJFA 3LE0A 1W8NA 3AVRA 4LHSA 3V65A 1QDCA 2J7MA 4QDRA 4ZXEA 3P5BA 1NA1A 3G6JB 1O4YA 4COUA 4I0BA 1WMXA 2F4LA 4M01A 5IT6A 5JMOA 3VKFC 5KHJA 2ZCWA 5IYYA 3KGLA 5IVVA 2R1DA 3FHAA 1ZA4A 1W0NA 3WP3A 4A3XA 2B39A 2NYYA 5CU1A 2XLGA 5CNAA 3ATGA 4Q27A 4NHLA 4NIGA 3VKOA 1BXHA 1L7LA 2PQQA 1KFXL 1NZCA 4ZU7A 3S30A 1R093 1W6OB 1NLQA 2VCBA 2J1TA 3ZFGB 1U5IA 4BZ4A 4UF0B 1GNHA 1LECA 1WCQA 2ZACA 4HN0A 4XUQA 2DFBA 4UW6A 4LQRA 3RSJA 1YC61 4IERA 1HQNA 1C8M1 3SH4A 4BHPA 1EY2A 4XFCA 4Y5TA 3ZXKA 1UYPA 1AR91 1MS9A 1G9CA 3H7YA 5EIYB 1VMHA 1RUD3 4MADA 2PLV3 3RI8A 1RTVA 3ZR6A 4ES9A 3WNXA 2RM23 3JBG2 1J1TA 1VMFA 5A32B 1JOPA 1W06A 4DXZA 1A8MA 5AC93 2YG0A 5IVYA 1ODMA 5I0SA 3BTYA 3BI3A 4ZU5A 1KXGA 4BWOA 4B7KA 2R063 2UYAA 1QQP1 2ET7A 2ARBA 1HXS3 1OBNA 3AP7A 4H55A 4KWKA 4ZS3A 1NX9A 4QT6A 3WG2A 4EN0A 1D2QA 1ONAA 2OS2A 2GMPA 4IEVA 2VZSA 2D7FA 4UYBA 4DS0A 4Z1VA 1OLRA 4CXWA 2B9VA 2BVVA 4J25A 4IEOA 3WQ0A 4AEDC 2VZTA 3C7FA 4FPFA 2NP0A 2XUEA 1DGWX 4Q4Y3 1Q8QA 1PX3A 3R0RA 4LO5B 1H9PA 3F2ZA 4M00A 2RJ2A 3I54A 2HWF1 1VBE2 1OH4A 3GBFA 1QHDA 3OGGA 2VTXJ 5FPBA 4MGIE 3CKHA 2QKDA 2XJQA 3H8RA 5DAPA 3TAYA 5JOXA 4J1WA 1DGRA 4IGQA 4SBVA 2JG9B 1REFA 2R043 2R6QA 2V4AA 2XONA 1SBEA 5TSWA 3M4FA 5BNNC 1PGL2 5FREA 3DXUA 2GC0A 3H3ZA 5BNPC 3R4UA 1H2LA 4CCCA 3RPQA 3KGZA 1MZ6A 1TVGA 5KXEA 1AXZA 1PMIA 2K9ZA 1UYZA 3RZKA 4MH0E 1KRIA 2WLQA 3FN9A 3GBGA 3K4AA 3TEYA 1ZZ8A 3M3OA 3D0JA 5JR7B 3J7HA 5FZFA 1ZZ9A 5KXBA 1UY3A 1SPPA 5HBAA 1Y9QA 1XJAA 2YGMA 3FE5A 3IAQA 4JGYA 4Z07A 5FY8A 1B09A 1HQWA 1CX4A 2PHRA 2PHWA 3KHBA 3O0WA 4LKSA 4WBBA 4XQ4A 5FXWA 1IS5A 4FCAA 4AI0A 3LFMA 1K12A 2VULA 4Q4W1 4XUTA 2HEYF 3PVBB 4PT6A 4Y20A 3LZZA 1YWKA 1LHUA 4N7UA 4YVSA 2AYHA 2E7TA 1RUJ2 1UOBA 2BWAA 2R073 4AEKA 5FWJA 3PIJA 2P6CA 3MPPG 5C4WC 1ULFA 4GWJA 1JYTA 1ENQA 2VG9A 1S0BA 4YW4A 2DUQA 4NPRA 4OHVA 3ZFEA 1HB4A 2NQYA 5DXDA 2VMEA 5JDBA 1UY2A 5KXDA 4LK7A 2XQXA 3DPRB 2ZAAA 2ADDA 3NAPA 4RS5C 1MQTA 4P9YA 1N3QA 1PGW2 5EYYA 4NE9A 4FT8A 5B2GB 5DG2A 5F3GA 3BCWA 1H1MA 4Y4RA 1RXFA 2W95A 1WW7A 3TN93 1DQ1A 4B7EA 5FY7A 3M3IA 4CEYB 2GALA 1RUC2 4BQ1A 5BYNA 5T50A 1V00A 4XJZA 4HPKB 4UBHA 1ENRA 1W6PB 2WC2A 1VRH2 2OZ6A 2GN7A 5L36A 2RR13 3WF3A 2AZ5A 2W47A 5FY0A 2RDRA 3CO2A 1UOGA 2PA7A 4B1LA 1AR82 1Y3TA 1GR3A 3HQXA 4HXCA 5FZAA 1YFWA 4JQTA 5HCBA 3WT3A 2A7AA 2GH2A 4N53A 3J9SA 1ND3C 1EAH3 3QACA 2HWB3 4NAOA 3TB0A 3D82A 2A6VA 2Q30A 1CAUB 4XAEA 5I8SA 4JGZA 1RB8G 2CL2A 4H3WA 2YB7A 3O1OA 2W52A 5EHDA 4QAWA 2VUDA 3JBG1 5FZDA 5FPZA 2YC0A 3QCWA 5IAXA 4QB2A 2YY1A 3MO4A 3VD3A 4FFIA 4XF9A 4R4ZA 1UY4A 1SDWA 3SQOA 3FFZA 2VW1A 2XBO1 4H2AA 4M0NA 1JI6A 4IETA 3ZKUA 3UJOA 3B69A 4XF4A 3O0VA 1SBDA 4HKWA 2BV4A 2JE8A 4LBQD 3WY6A 4FPJA 1CWPA 4MGZE 2GNMA 3VBUA 5FYHA 5I0UA 4QKDA 4X8NA 3LEMA 1TZOA 2A3WA 5ABJA 3N3HA 5I91A 1YQ5A 5AVPA 4DXTA 1LEDA 4QPGB 1NUKA 5KHKA 4RGAA 3T30A 3E6DA 1DHKB 1H2NA 5FYMA 1VBE1 2ZEXA 3AFKA 5F2SA 3ZFFC 1S0CA 4CEWB 4DFSA 3ZIWA 3GYDA 4ZPIA 1LTEA 1RINA 4CP9B 3WF1A 1NCQB 2ZX1A 1LHOA 2P6HA 3A0KA 4OUEA 4AI9A 3VDDA 5K7PA 1XNCA 2D98A 3SH5A 3NQHA 2C9AA 1OOPB 5FKCA 1BCXA 5L9BA 4FPGA 2C24A 4BIFA 1K42A 4MXWB 3FFQA 4QX7A 1WCKA 1O3TA 1PGL1 2ZX0A 2WAOA 2TBVA 5EQUA 5J37A 1CJPA 1CD3G 2HEWF 2PELA 4OVEA 1LODA 5EFUA 4D7TA 2VZUA 3OGSA 4R8HA 3RRDA 5IK8A 2WO3A 3RNSA 3DECA 4GXLA 1BMV2 4YVWC 4DNYA 5FMOL 2GNTA 4QGMA 4UAPA 4CPBD 3S5QA 5JZGB 2VBPA 1QJEA 4WV8A 2ZX4A 1WW5A 1QY4A 2ZEWA 5T5JA 3B7MA 3KV9A 1GZCA 5EV7A 1X82A 5CKMA 1HXS2 4OUMA 1NLRA 2HH9A 3H8UA 3H42B 4RD7A 2ERFA 2FDKA 5FK7A 5FY1A 3VBRA 5JR2A 2V4VA 3HNYM 4W8JA 2B9UA 2WQ8A 4MSVA 3I8TA 2ZHLA 1F2NA 1RUJ1 2CSGA 2ZPXA 4Q4Y2 4YM0A 5FKBA 3FBMA 3GJBA 3T09A 5FLJA 4MV2A 1DG6A 5L7OB 4PBOA 4I3PA 3LA2A 5HXVA 5K9YA 3KZ4C 5GALA 4C8DA 1DZRA 4OHZA 3WF0A 2A5ZA 2JECA 2DVBA 3AP9A 4X8PA 5FZ0A 4AQ2A 2R042 4NUBA 4XJWA 2EXKA 2G19A 2J1AA 2IFRA 4K9SA 1L7QA 2D44A 3OEAA 5APAA 1KEXA 1RMU2 2AEYA 3ZM8A 2UY9A 3RWNA 1JOBA 4EN8B 1WMDA 1YJLA 5C7GA 1VB2A 3N7KA 1CAWA 1ZZBA 3I97A 2VUCA 2WN2A 4FVVA 1XNAA 1XNTA 3MF6A 2FCTA 2MPFA 3E6BA 4DPNA 3ZVXA 4LKDA 4OULA 1BVP1 1V9U3 1RUC1 1VBA1 4ORFA 2VOVA 2D97A 4FPKA 4XUNA 4V2WA 1Q8SA 1F35A 1VRH1 2WNVB 4P9JA 1L7RA 4A6SA 4CDWC 5IVJA 3UT0A 1LENA 3VHOA 4CXYA 2A1XA 2VH9A 2RS12 4EN6B 5HV4A 1MVEA 4UFLA 4X6RB 1ULCA 4R9AA 3QH7A 1AR81 5FYVA 3IIAA 1WD3A 2Y34A 3LPGA 1AVBA 2VCMA 1LOEA 1VAKA 1A3KA 4YZ5A 4AFAA 1DZTA 2B42B 2GDFA 4L92A 3PJQA 1Y9GA 4MG2A 3DN7A 3MIDA 2XVKA 4G3YC 4ATFA 4COYA 5JXHA 4Y4YA 4A42A 1X8EA 3FHIB 2VBBA 3B01A 3PTYA 4Y1XA 4GJYA 3VZLA 4RFRB 3LFIA 3AC0A 3V0AA 2ET1A 5HCFA 1A6CA 2V72A 1BBT2 5DAVA 1IPKA 1YIPA 3PVOA 1C8M3 4NVPA 4AEDB 3P3PA 1BLZA 1F4HA 1RHI3 3AKTA 1LOBA 4FI9A 2W46A 4PLNA 4ARYA 2BOIA 2PXJA 4QX5A 2VQ0A 2VCCA 3E1F1 4ARXA 4BXFA 4JZRA 2P3KA 3B94A 1LOGA 3L2YA 1NAEA 4ZXKA 2WZR1 3MYXA 5IUQA 2P17A 2AREA 3UESA 3DF0A 4K40A 1QQP3 1JODA 4MGQA 5FZLA 4CDQB 2I2SA 5BNNB 5C3PA 2ZXQA 2SLIA 4CP1A 3LKJA 4A7KA 2DVFA 2FMDA 2DU0A 1JZ2A 3VKNA 5LA2A 4URAA 5E1RA 3NNJA 4L11A 2BTVC 3WG4A 1WLWA 3ZYJB 1AHSA 4NWVA 1HRV3 5H9RA 3K2OA 3O1UA 3EQEA 3HR9A 1QEXA 1ZRDA 2HWB2 5CFDB 2D3RA 2CU5A 2NLRA 1IPSA 4JAAA 4ZS2A 2H6CA 2HWF3 2B5HA 4OYUA 4OHXA 3SCHA 1JZ3A 1SFYA 5FZOA 4Z2AA 3VBOA 3GCXA 5EJZB 5FPXA 2WA3A 2FZ2A 2D3SA 2A6YA 4LPLA 4LOSA 1M06G 1ZBA1 2VNOA 5IVEA 2JWPA 2WBKA 1IG0A 2P3IA 3JXSA 2G4IA 5FZHA 5A7WA 4KWUA 4WM8C 2V5YA 3RG0A 5JOZA 1J3QA 3S57A 4JKLA 1KDKA 4ES8A 2VPVA 1CR7A 2YGLA 2H0BA 1C28A 4LIUA 1QH7A 1OURA 1Z7S2 2J1VA 2X8KA 5CIRA 2QQWA 2VCAA 2SBAA 3W20A 3KHCA 2XJTA 5A3LA 1D0GA 2BW8A 3ZXAC 1OKQA 4WVMA 4QMAA 3WZ1A 4CDXA 3NL1A 4Q4Y1 5LEJA 5F9TA 1MEC1 3FUOA 2HKXA 1NE4A 2JX9A 3C7HA 3VHPA 1GQHA 4K21A 1W2NA 4RS5B 1WD4A 2HWD2 2WNOA 1XC6A 3KV5A 5F39A 3AKRA 4I2OA 1V70A 4XDOA 4PLMA 3BODA 1OF4A 2G1MA 2JDYA 1YI9A 4QU2A 4XHBA 3FX3A 1REDA 1DYPA 1HLCA 4Q4W3 1RMU1 2XR4A 4W6WA 4K6BA 3RS6A 3U07A 1RUE2 5LEKA 5CB7A 4E4HA 2FDIA 5K8SA 2IXHA 4YM2A 1J83A 2Y33A 3IM0A 1CIWA 1UOJA 1UU6A 2QJVA 1GQGA 3WP5A 3JB4C 3NVCA 1NCRC 4P9XA 5SV5A 1KJRA 2WNUA 1CZVA 1YLLA 4RQPB 4UW5A 1VIWB 2XJSA 4W65A 3ZOIA 2KR2A 4S2HA 1WCDJ 3SKJE 5FP7A 2HBUA 1ND3B 4YW2A 1VAVA 4NAMA 2WT0A 1XE7A 2LS6A 3U37A 2RS11 4RR3C 2E63A 1IGOA 5BPXA 2BPA2 3KSCA 1GP6A 4Q0VA 3TEXA 4IEPA 1DGLA 3K75B 5BY5A 1TG7A 5ISLA 4QXKA 2XVLA 3ILRA 2BJSA 2MHFA 2W39A 2ZMLA 1ND2B 5A33B 4CCNA 2LW8A 1XSRA 1YRZA 2ORXA 3SCGA 3VB9A 3ACFA 1MS3A 3C7OA 3ON7A 4IXLA 4XFFA 1W2UA 1DLCA 3O1VA 5F5QA 2PHLA 4O9GA 1J1LA 1BBT1 2C0ZA 3ACHA 4E27A 2Y60A 3RJ2X 3GM8A 1RC6A 1K5MB 5E89A 4PCRA 2XQRA 3K51A 4P5YA 4O61A 1UY0A 2WYFA 4HG6B 3H8XA 3KLSA 4XVHA 3GZTB 4UBGA 4XBLA 5LBEA 2P5BA 3O1SA 2D6LX 2NMNA 3JQXA 3RYRA 1PIV2 2BU9A 2OUHA 3AB0A 4M3CE 2VGDA 1V9U2 3EB7A 2IFWA 2XBO3 4K20A 2XWJB 4Y1YA 3BIWE 4GIQA 5A6QA 5LRSA 5CVRA 3HT1A 1SQ4A 5FYCA 1D4M2 1HJGA 5GM0A 3VBFC 4XFHA 4HVQA 4YWAA 1Q3EA 3N7LA 1FT9A 3OY8A 5JI9A 1CN1A 4QPYA 1XU1A 3S5AA 4YVWB 4BMEA 2EIDA 2A6WA 2VMIA 4OI1A 1D2SA 1E5HA 5G04L 3I3BA 1NA1C 3ILFA 4UFKA 4XTMA 2VMFA 3AZWA 1RUI1 4HLTA 4QHBA 2JG8B 4DRRA 4DZGA 2JE7A 4YW5A 1XB9A 1Y43B 5CFCA 1LAJA 4H14A 5GJ6A 4TXWA 2Y6JA 5FYUA 5LWBA 5DAQA 4KQ7A 3NO8A 3OEBA 2EIBA 1V6OA 2ZGOA 4ZKTB 2PFWA 3LA7A 3SLIA 4MVTA 2F17A 3CLPA 3CMGA 1JBCA 4INDA 1VBB1 1C8M2 1MPXA 2EF6A 4HK8A 4QDSA 2PHTA 3JD71 3SNMA 1RHI2 1XNBA 4D7SA 4C1XA 1W2TA 3W58A 5LW9A 1YCIA 4GH4B 4GWIA 1Z7S1 1RUNA 3J7LA 2RHPA 3WF4A 1R1ZA 2EA7A 4CUAA 3ZFGA 1CAVB 3R05A 1JU4A 4LOTA 4WM7B 1UZWA 1SCSA 2A3YA 1TMF1 2XKOA 4W50A 2VL4A 2C4XA 1J84A 4P14A 4QQOA 1TNRA 3P1IA 4XZUG 3VZMA 3I3QA 1OD3A 2DCKA 1FV3A 1QQP2 3I3EA 3OSDA 3MIHA 1LOCA 4O7XA 5DN2A 2HWD1 3N9OA 5FK8A 5A3NA 2VMDA 3U11A 1YNAA 1YI7A 1FMD2 1MS4A 2DURA 1H4HA 1RL3A 2VOXA 3ZYBA 4CYDA 3POYA 3IB3A 1WW6A 3OUIA 5FMBA 1V6LA 2ZGPA 5FCCA 1HRV2 3I3DA 5T5PA 1JZ7A 5DAWA 3RFRA 3SMHA 5A32A 1RUE1 4YNIA 4C1WA 3WNMA 3K3OA 5KHHA 2HWF2 4JRLA 3AMNA 1XOYA 1WLDA 4Z92B 2VZVA 3LIHA 4JVAA 1ULEA 3K77A 5IK5A 5GLWA 4DEVA 3OGRA 5I8YA 4NO4A 3ASIA 1YYNA 4QKBA 3RZMA 3MIEA 3ZMOA 2QCSB 1G9BA 5CG9A 2WNEA 1UAIA 2K2SA 1HV1A 1PM7A 3ZN6B 4XF0A 1LGCA 2C1FA 4BU2A 2PMWB 2WDBA 2PHUA 1VBA3 1RUC3 5K0UA 5C3QA 2JIJA 4B4PA 4QHZA 3KMHA 1W2AX 1VRH3 2ZGUA 4DUVA 5JPMB 1W9FA 2Y0OA 1WWYA 3AP6A 3I2GA 2JG9A 1JTZX 1V6JA 4Y33A 3CNAA 4HK9A 1UXXX 4GA9A 3WNOA 3WW2A 5C71A 2BFUS 1GNYA 4RA0A 1FX5A 1KFUL 1LHVA 2ZOEB 1AR83 2D6NA 1JU3A 3HT2A 1O3SA 2DCYA 2KA3A 5C3SA 2OVUA 4RFT0 4XXAA 1I5PA 2OUJA 4DY3A 2AENA 1KGYA 4LULA 2O0OA 4JGYC 3POGA 4RSUA 4Y5Z0 4R9DA 3LEIA 5L9VA 3SEPA 1QWRA 5KBFA 1PHMA 1AXKA 5FY4A 3ETQA 1D7PM 1PIV1 1NY72 2YMZA 4LO4B 3NNFA 1H6YA 5F3IA 4DRVA 1V9U1 3MGUA 3VDBA 1Z78A 1OLQA 2Q8OA 1OUXA 5LK5A 5A7NA 1AX2A 1IPJA 4YVSC 1UU5A 1WGPA 3LAGA 3WCSA 4K1ZA 2ORZA 2W1QA 5LBCA 1D4M1 4UFJA 3WUCA 1QH6A 2JE9A 2NPIA 2D93A 3BALA 1J3RA 3ZFEC 2A6XA 5JPNB 1WCUA 5KC5A 1H30A 2J1RA 3IMMA 2A3XA 1STMA 3ZYRA 5DUVA 4HONA 3WOGA 1ZZ6A 2VTXA 4EYUA 4YW6A 4CVUA 2W08A 1S0FA 2JJ6A 2WZR3 4XZPA 3X29B 2VECA 3TRSB 2UY8A 3NAPC 1MQTC 1QOOA 5J09A 3NJXA 4COWA 4PI0A 2RDNA 2WQZC 2R0HA 4FFHA 1X50A 5A7SA 5F7UA 1UPSA 5LA0A 1XXNA 5A3UA 2QBXA 3IDBB 2GAUA 4NIIA 1LHWA 4LO8A 3VDAA 2P34A 2ZA9A 3Q9OA 3DPRA 3QD6A 5FDBA 4IDZA 5J48A 3RZLA 1W99A 3IN9A 4HZFA 3NV4A 4AVAA 1V6IA 4MGYE 1RHI1 2HYKA 4XDPA 3WXPA 1OT5A 1SACA 4WZFA 1GWKA 2FDFA 1QMJA 1UMIA 2BERA 2YPJA 1GZTA 2JB8A 4CEYA 3BUCA 1O3QA 3IZOA 4UFHA 1QU0A 2BNMA 4YZ2A 4HPKA 1EUTA 2WSVA 1US2A 1LGBA 2FCVA 3D6EA 1W6PA 3ZYFA 4N53C 1ZBA3 4KGQA 4KGGA 4Q29A 4LHLA 1S1AA 4FOQA 2H6BA 2ZGQA 4JGZC 4AVTA 3IPVB 5FO9B 2XBO2 4G4FA 1H8VA 1JYXA 3POFA 4Q1RA 1WBFA 4UWDA 5BV6A 3Q8AA 4LBLA 1AL0G 2JIGA 3CJIB 4CSWA 1FMD1 5HXMA 3ZYHA 3HNMA 1CIYA 4IV3B 5JWPA 1CAUA 2JDNA 2JDZA 2QQOA 3NV1A 4P9WA 5FZCA 4LUMA 2RS32 1HRV1 5FPLA 1ZX5A 4TZDA 1Q8OA 1UYXA 5DZFA 3VBUC 4IGPA 1MEC3 5BNOB 4WVZA 3KVBA 3ZXEA 2XJVA 5ABJC 2O8QA 4AXOA 1W9YA 2TEPA 5FQ0B 4D3WA 1MS5A 4BQWA 4IE5A 2AC1A 4TN7A 3ZDVA 5A6XA 2A70A 3I59B 4CTEA 2E51A 5DZEA 2LALA 3ZN5A 5A7OA 4YW1A 4NWWA 3N9PA 2IWGB 3OGJA 1RMU3 5G05L 5CEHA 3WG1A 2YZ4A 5CYYA 1O6UA 4FBFA 5C9AB 3Q8CA 3VDDC 1F5JA 1H4GA 3CZJA 3BN6A 3P3NA 1I6XA 1OSGA 3OOXA 1GUIA 1W8ZA 2W1WA 3V0BA 3OJBA 5H9SA 3WDUA 1YO8A 2Y0IA 4HSLA 3VDCA 4DIQA 4CP9A 5C8CA 3T1MA 4D6QA 4UT5A 3VV1A 5FLHA 5F8PA 1JHJA 1SHWB 1AYM2 1PVC3 5D1IA 2CAVA 4AVCA 4QPIB 1W0OA 2E31A 2RS13 1W03A 2PTMA 3UYJA 1VB4A 1S0EA 1P8JA 1UW8A 1ASJ1 4A3ZA 3L9JT 4QDQA 1XSQA 4CU6A 4IE4A 4JHZA 4IEUA 4ZZ5A 1UF2C 4GJZA 5CBLA 2R0FA 4NN0A 3M3QA 2Q8DA 2OYZA 2OW4A 1QXJA 2R16A 2C6SA 2W2IA 2EAAA 4AQ6A 2Z2SB 3AKPA 3FHQA 4PBPA 4CP2A 1HX6A 2DCTA 4B4QA 5GZCA 1W3VA 3WDVA 4AFCA 3LSEA 5FXVA 3MPBA 5JZGA 3FUQA 1IG3A 2G9ZA 1EUUA 3ALQA 1YQ6A 1NY71 3KQ4B 4GAZA 5EP9A 5FZ7A 1CZTA 3VBRC 4CDUB 3BTXA 3GZEA 1BZWA 3O1TA 1BBT3 2XXZA 2QNKA 1UWWA 4P08A 1NA1B 4XETA 1CX1A 2YUEA 4LBQA 1DQ6A 5HPOA 3LDBA 3IIIA 4D0QA 2WO1A 5DABA 2ENRA 1V6MA 2CDPA 2FDHA 5A3TA 4OFGA 1XNDA 2X29A 1I3HA 4N90A 3LQCA 2DV9A 3WP6A 2VJXA 1IHMA 1VBA2 1WCSA 2WZEA 4K3UA 5L7OA 1YQCA 3HD8B 4LXLA 1ZRFA 4BISA 1H8TB 4YZ4A 4LBMA 3WNPA 3VD4A 1WMEA 4Q4X3 1FAYA 2QVSB 1G9DA 1APNA 3I2OA 3THCA 1RXGA 5FZ8A 2CYFA 3J7MA 2Q1MA 2WT2A 3AYCA 4MLOA 3E6CC 2LROA 4NHMA 2WR9A 1G9AA 1BYHA 4TLGA 4M4PA 1RUI3 4N9IA 5DZGA 3ILNA 2W92A 1N3OA 4IGOA 3PUAA 2DCZA 4P5HA 5FYIA 3USUB 3JCIA 4L0PA 4CU9A 1QJU3 4BA6A 3ZYPA 4ZHNA 1ZA7A 2WNVA 1JZ5A 4JDOA 1X9PA 1PK6B 2Y64A 4S2DA 1RJ8A 1W8WA 2YC2A 3CU7A 4CPBA 4O9EA 3ABZA 2JENA 3AKQA 4AFDA 4CUBA 1VBB3 3VZKA 2X5IB 1VRBA 1C8NA 3JD73 4MGSA 1BJQA 1IZ3A 3RZGA 2IXLA 1IS4A 1XBFA 1Z7S3 2YFUA 1QKQA 4N43A 2RS31 1R1A2 1G9FA 1JZ8A 5I0TA 5ERLA 2QQJA 2WZR2 2ZEZA 3AMPA 4MHUA 4LEJA 1TMF3 5T5LA 4HT1T 4BMBA 3D3AA 1GNZA 1OF3A 2Y6LA 1NQJA 1ENSA 2HWD3 2J1SA 1W0PA 2EXJA 2QDRA 2WO2A 4UXAA 4QD2A 4PDWB 4WZCA 2XJRA 3UGFA 5A3MA 4COVA 1POV0 3LA3A 2D5FA 3SITA 2QQLA 3I4IA 1JS9A 4EV0A 4KG0A 4FAHA 1S2KA 2ZBJA 2W87A 3H1MA 1RUE3 1WMFA 1NLSA 3LOIA 2WS92 3NSTA 1US3A 4D8MA 3DCQA 2E32A 1GQPA 5FP4A 1UO9A 4GB31 4XXPA 1WA4A 3GZUC 4ISQA 3M1HA 2GH8A 2BBVA 2DTWA 2VW2A 1R083 1AF9A 2ZABA 3MHZA 2ZKLA 1QIQA 3EJKA 4JDMA 3THDA 4CDQA 2E7AA 1ZBA2 3EO6A 2YBPA 2P2KA 5KWRA 5FJKA 1AYM1 4FOVA 2ZGRA 2BNOA 4YLZA 4AOCA 3VBOC 2JDPA 2WKKA 4DQAA 3UNPA 1J58A 4GQ7A 1HW5A 1HB3A 3DKQA 4JGYB 1LULA 2G9FA 1S2EA 1POV1 1REEA 2VNVA 3EHKA 4FXGB 5CFDA 5FYYA 4KI5M 5JXIA 4YW3A 3MUZ1 1KD7A 5D8AB 1O59A 1FNYA 3W5MA 5IAVA 2ZGTA 2AR6A 4AVBA 5FPUA 2UURA 1ZVFA 2PAEA 4YVSB 3WNLA 4B1MA 4WVVA 3O1MA 1MEC2 4XE9A 1QOSA 1Y9MA 1UU4A 1QXPA 4XW3A 5DDJ1 2DUPA 4BQ2A 5KXCA 4N8MA 2ZX3A 4S2FA 4CDXC 1GOFA 2NMOA 5ACA1 1CZSA 3EMRA 5IFPA 1MR5A 4YRDA 5J96B 2HWC1 3S0MA 1MQTB 2ZKNA 1SEFA 3OPZA 2WAAA 2DVDA 3UL2A 1LR5A 1K5JA 5A6YA 3T0BA 1FXZA 5JI7A 1AUYA 5FP3A 1PIV3 4DINB 2AH2A 1BEV2 2OQ6A 2YHJA 3DGTA 1IKQA 1M4WA 4GMP0 4IEYA 3I2IA 4ASKA 2EXIA 5KR7A 4YW7A 1V6NA 4KU7A 5IVCA 3ECQA 4D69A 3T4HB 1D4M3 1PVC2 4L97A 4JCKA 4NHKA 4O65A 5FP8A 2EICA 2FMYA 4PQQA 1JUIA 2BRTA 2JKXA 4OQ8A 3B5LB 1GV9A 2WNUC 4OZOA 3AMQA 4E8DA 4QX8A 3J26N 1UZYA 2VVEA 2MNGA 1GZWB 1NOVA 1QXRA 3AZVA 1UCXA 4PI2A 3E5UA 1ACCA 2YPDA 4LHNA 3AYAA 4JTNA 3V64A 3PLQA 1X8MA 1W05A 3JUUA 4AWDA 4IE7A 1W8HA 1RYYA 4RQPA 2Q8EA 2X05A 4U2AA 4GMP1 3VD9A 1N1YA 4QB1A 3I2HA 3K3NA 1PNGA 1QJFA 2WUHA 3H3UA 3ACLA 1N3PA 3KB5A 3Q8EA 1JMUB 1F31A 1DQ4A 3E5XA 1OQ1A 1W6NB 5FO7B 3DYOA 4QQ2A 1SLCA 3VBUB 5A1LA 1BK1A 1QJY1 1UNBA 3H1YA 1ZYBA 2JDHA 5A1FA 1ND2A 2HLEA 5A33A 4BLJA 5IHRA 5A7PA 2BP6A 2WABA 1R1A1 1AJKA 3BVCA 1YQ2A 3VZJA 3OB8A 4PIYA 2EAKA 5JVVA 3OTFA 1AJOA 1KJLA 4QQPA 1J3PA 3WNNA 3BIEA 2BBAA 1HB2A 3VBSA 4Y1UA 4FPCA 5FZMA 3VBHA 3OBRA 3NNGA 3O7OA 3T4VA 5IFTA 1W6MB 3B93A 5BNPB 4AQTA 2UU8A 4Q4X2 2VAUA 1FMD3 1UKRA 1K5MA 2WZ8A 3AMMA 1OVSA 3U78A 3D4KA 2Z5WA 4EN9B 4Y1ZA 4LA2A 5ANNA 1LGNA 4Q4V3 4H7MA 2WS91 4IL7A 1SLLA 1X9TA 2EXHA 1RUI2 4QX0A 2O1QA 2E53A 5A3WA 1B35A 4FO9A 1JZ6A 4UI9L 1QJU2 3WX5A 3ZPOA 2F4PA 4QKFA 4W6YA 3IAPA 4CCOA 2MEV2 2Q8CA 4ZZ8A 2EALA 2ZS6B 1SLBA 1W2OA 3UKVA 1YQ8A 4HOOA 1IS6A 1X36A 1VBB2 4BCUA 4ET7A 5CFCC 4MO3M 3JD72 4EZHA 1O8PA 1DYOA 2BGPA 3ACGA 2P3YA 1RGSA 2W68A 3CHXA 1NXD1 5C4WB 2RJKA 4LE4A 3GHMA 1NT0A 3AXEA 2J1EA 3C8XA 2JG8A 3BPSA 4M3CB 3AX4A 1NXMA 3FJSA 5KHIA 3BU7A 2DF7A 2VNRA 5F3EA 3MW3A 1DQ2A 1UPIA 1TMF2 2UWAA 4J1XA 3FL7A 4XJ8A 2WZPP 3ZIXA 2TUNA 2YBSA 4E4DX 2HWE3 4R9BA 1ASJ3 5FP9A 3ZFGC 1RVF3 1SCRA 3J7NA 4NMIA 3ZPYA 5F6KA 2HYXA 4CCKA 1AZDA 5JIUA 4GH4A 3TNPB 3S7EA 3WDTA 2ZGNA 1N1TA 1OKOA 1O3RA 5FZBA 2R30A 1IOAA 3PL0A 5LATA 3URFA 1CAVA 1F4AA 4WM7A 4Y3OA 3WP4A 4KH9A 5K4LA 1PVXA 3MV11 3SEEA 1BEV1 3V56A 1HKDA 5JLVA 1R082 4A44A 5CAZA 1X7NA 2X53S 2WSUA 5F1RA 4XAAA 3T1LA 4R9CA 2XPJA 1RUF1 4X6QB 4K7JA 1PVC1 4JX0A 4NIDA 4V2VA 4A2UA 3WUDA 5C70A 4CRQA 3KVAA 3Q8FA 5DPNA 1DGRN 3T0DA 2GC3A 2VZ1A 4QM8A 4PQ9A 3OBAA 2YYOA 2E6VA 1GOHA 3SC7X 4JRAA 1Y7BA 1W6QB 1ZRIA 1PMHX 2VZOA 4ATEA 2ZHKA 4JTOA 1W9WA 4DB5A 4AVVA 4D94A 3WINE 3WQBA 3I2KA 4FSJA 4YGBA 2VQTA 3WQ7A 1EPWA 3MICA 4QKNA 2WJSA 4N7IA 1JW6A 5EJ3A 2Y38A 2DFCA 1RIRA 4YZ3A 3IDAA 5K0UC 4I01A 3A22A 1UX7A 3HIFA 1LOAA 1HB1A 2FBEA 1H2KA 3AKSA 2ARXA 3NMBA 2C5DA 1W8UA 4YPJA 4NPLA 4OQ9A 5F5CA 2JG9C 4BH9A 4OI2A 4U36A 1X33A 2KM2A 1EV12 3ZN6A 2DVAA 4C91A 2B4KA 2Z69A 3ZFFB 4C90A 3K46A 4FOYA 4QXBA 5FRAA 5A3OA 4ZONA 4XJAA 1CPNA 4CUCA 1AXYA 1SBFA 1OMIA 1OFNA 1OFSA 4AGVA 4AGGA 2VOKA 4FPOB 2VVDA 3W21A 4NPMA 5J1XA 3AJYA 5FBZA 3MZHA 4IQPA 4IV1A 2ARCA 4HSJA 5T5OA 1V6KA 2DUOA 2GSYA 3HN1A 4K8RB 4Q4X1 2VBDA 3NV3A 4LITA 3RMXA 5BXXA 3N4MA 2QQNA 3I2JA 4AHWA 2W9XA 5FZKA 3QH6A 4XFGA 1PMJX 2JB4A 3MIFA 4KBBA 2RS33 5A7QA 3PTRB 5E16A 2WRAA 1NQDA 4YARA 4B4RA 1PO22 3M2MA 4JC1A 1FPN2 2PHDA 4MZUA 4GD4A 2RMU3 4C0BA 4CUGA 4YM3A 1JN2P 2JDMA 4R52A 1GBGA 1Q56A 5GKAC 4P9GA 2IXCA 4W4ZA 2QQIA 5FZOB 2GN3A 3VBOB 1QJU1 1UIJA 5JXJA 4YFWA 3BTZA 1COV2 2CGNA 3RYKA 3V0BB 1TQ5A 4QM9A 5T54A 2PYTA 2MEV1 4UFMA 1Q5OA 4YG0A 5LASA 4XIOA 1W39A 4Y5SA 1C1FA 1Y4WA 4P9IA 1DDLA 4HMZA 2D6PA 3M8LA 4QGLA 1F5FA 5FXZA 3BB6A 2BDRA 5C5TA 5FOJB 2ADEA 2CY6A 1DP0A 2RVAA 4QQLA 4SLIA 3J8F2 5EYXA 4GB33 3DPRC 4KWLA 3VD5A 3WF2A 5IVFA 4IUGA 4CCMA 1GLHA 1ULDA 5IWFA 2WFF2 1W6OA 1RJ7A 3C3VA 1XRUA 3POWA 3AMHA 4UF0A 1UKGA 3KT7A 1TEIA 1AYM3 3TNQA 4AK3A 3HBZA 4CEYC 4CZSA 1NZIA 1MZ5A 3ST7A 4RL7A 2BFUL 3MFAA 4QHOA 5B4XA 1LRHA 4UOJA 1POV3 4AG4A 1JYVA 1MVQA 4XEZA 5J36A 4XCAA 2NM1A 4PIXA 4DUXA 1BQPA 1O5UA 4BQXA 2ILMA 3POSA 2BGOA 3GGLA 2AGSA 1NE6A 4Q4V2 5AVAA 2LRPA 3PUSA 4CDWB 3ZDSA 1U0AA 3HQRA 1EYBA 3USSA 3TBDA 4AFMA 5F37A 3I7DA 2VZQA 2V5DA 3IPVA 2BUKA 2J22A 2ATFA 3H7JA 5DDJ3 1ULGA 3LEKA 3ZN4A 1R081 4A45A 5LY1A 4EWAA 2WNUB 1LCLA 1WBLA 1GMMA 5ACA3 4Y26A 3OYWB 3CJIA 3FWEA 3NW4A 2GZWA 2OPKA 2XGXA 3I3MA 4H7LA 4IV3A 3VZNA 1EPZA 2HWC3 3DXTA 2FDJA 4QB6A 2D40A 1LESA 4MUVA 1N1VA 1ZZ7A 5F3CA 4LIVA 4CCLA 1QNYA 1G8WA 4TSVA 5BNOA 2RS53 3NNMA 3PURA 5HCAA 4EROA 1LU1A 3NJZA 4OI4A 5FQ0A 1OHFA 3POIA 2PHXA 1FOD2 1C57A 5FZ9A 2YC4A 3I59A 4BDVB 4M4RA 1GANA 2E7QA 4FPYA 5FPVA 4AHZA 3JU9A 1UX6A 2RE9A 2IVIB 1YEWA 2RV9A 3CZUA 5F32A 3C7GA 3LCPA 5T55A 4D7YA 4AYUA 2HWE2 5C8CC 1ASJ2 3APBA 1TE1B 3KM5A 2DVGA 3UJQA 1E5SA 3AZYA 1RVF2 2VXRA 5C9AA 4A41A 5BNQA 5LRRA 5E6HA 4TYSA 1YHFA 1ZM1A 4EWEA 1EV11 3SKVA 2NZ9A 4AZZA 4F7ZA 3MUY1 4Q0SA 1XYOA 4XYXA 3H8OA 1QDOA 2CHHA 2I74A 2W1SA 3KF5A 1DIWA 4QX2A 4AE2A 1OLMA 3FBYA 1E57A 2W3JA 4FPEA 1V0AA 4GMP3 2Y26A 2NN8A 2WWUA 5L19A 1W8OA 1VALA 2I07B 2J1UA 1MS1A 4QPIA 3MW2A 1AR72 1YIFA 3MLLA 1GWMA 2ARAA 5SV8A 2QQVA 4AW7A 1S0JA 3MFCA 3SCFA 5FXXA 4E4ZA 4FOWA 4CP0A 2CDOA 1VBD2 5JZGC 3H1WA 3MBWA 1FV2A 3EYPA 1H2MA 5FUPA 3WW3A 1QJY3 2QZ2A 4RHV1 4AI2A 1GOGA 5JUVA 3OY8B 3WCRA 4UFIA 2D43A 1R1A3 3JZVA 1PO21 1N47A 2Q1FA 4N9HA 1Q8PA 1FPN1 4AHYA 1LNSA 5JSRA 3UETA 4CDUA 4XMAA 2Y8KA 5EJ1B 4WM8B 5B4NA 4CE8A 2WQ4A 1CAXB 3A23A 1DQ0A 1COV1 4LHKA 1HV0A 3ACIA 3SH3A 2VOWA 3PDQA 3RZHA 2Y6KA 4DMIA 2GNDA 4LJHA 1VJ2A 1XE8A 1PNFA 4XILA 1GP4A 5L7OC 3U0ZA 1OUSA 4I0AA 4Z8BA 5CKNA 4IE0A 1AX1A 2C9KA 4M0HA 1AR62 2ZJCA 2Q1ZB 3A4UA 1N1SA 2B7YA 4XMIA 1CONA 5LY2A 2WS93 3LOBA 1GP5A 1DF0A 2WO7A 1UN1A 2BZDA 3J8F1 2LUWA 3FZ3A 4P9LA 3N9NA 4XBQA 1LOFA 4HN1A 3FMGA 2DBIA 4JHTA 3THPA 2QQKA 4XPVA 3UK9A 4FTEA 2FDGA 2C26A 1ZZCA 2WFF1 2QZ3A 1H8TA 1SFNA 4NRMA 3LPFA 3GDBA 1ODNA 1JYNA 2A73B 1O4TA 1UL9A 2VD7A 2XOMA 3B00A 3AYDA 4NIHA 4B8EA 1CVNA 4OZXA 5JOYA 3DUIA 2PHFA 4ZY9A 3NWKA 3NKTA 1RITA 2WNVC 1GU3A 3WDXA 4LBOA 5FOBB 4HETA 3USUA 1NCRB 3NRUA 4OHYA 5FUIA 4S2GA 4UW3A 5LA9A 2ZHNA 4Q4V1 3AVSA 2WT1A 3PMSA 2RMU2 1TME2 2ZGKA 1PK6A 1FATA 1FYUA 2OXBA 4N43C 1QNWA 3ZX7A 5A6ZA 4RR3B 3N9QA 5J98B 1Q8VA 2X5IA 4ONUA 4LBNA 5FYBA 3VHRA 5JSOA 3POJA 5I93A 3WDYA 3MLKA 4NJ4A 4HL0A 3NKGA 5EXOA 1VAMA 3PUQA 5L9RA 3WR0A 3BPZA 4QPGA 2RG4A 3FLTA 1GFF2 4HKOA 4IEWA 2Q5TA 4KNCA 5IVBA 3S7IA 4GB32 1AL23 3UV9A 2W5FA 2ZEYA 3VKMA 1BEV3 2BWCA 4AEJA 4FXKB 4Y22B 3ZSEA 4BPZA 4AR2A 4CEWA 5K0UB 1NCQA 3RMYA 1O7FA 2N7GA 4Y22A 1FOD1 3T2TA 1YXWA 4MHRA 4PDWA 4D6SA 1RUF3 4C0HA 1OOPA 1RUH2 3KD4A 2OPWA 3PVEA 1D4VB 3PUHA 3WW4A 4Q0PA 4XQDA 3ZR5A 3DKWA 2CAUA 2IC1A 4MXWA 1WLCA 2HWE1 2RDSA 5I0DA 3W5NA 1VPHA 2YU2A 4CDQC 1RVF1 4IESA 2X09A 5IATA 3VL9A 4IW3A 4QQHA 3AM2A 4L8QA 2Y6HA 4YG3A 5FMCA 5I8TA 5DUUA 4R4XA 1C5IA 1E5IA 5FZ6A 1LU2A 1ST8A 3ZSKA 5M0TA 1PO12 2V09A 4Y1VA 3EXUA 3WVJA 3WQ1A 1HRI3 1O4ZA 5FAXA 1NG0A 2KXLA 2LM3A 1XU2A 3U14A 3VBFB 4A7YA 5CFDC 4HVOA 5DUXA 2YU1A 4YGCA 4AI3A 5DDJ2 3N9LA 1AR71 3INAA 5C3RA 3HNBM 4KU8A 3R6SA 4QU1A 5ACA2 1A34A 1VBD1 4NIAA 4FP3A 3ES4A 1BVVA 1JXNA 2HWC2 5D8AA 3ETPA 2QDNA 2UWCA 3N36A 3ZYIB 1PZ8A 2DU1A 1JYCA 4LBKA 2LTNA 3B3QE 4XIKA 3H3LA 4Q5OA 4AVSA 2IXJA 5FZIA 5HCHA 2IZWA 2RS52 3KV4A 3NJYA 2JDUA 4RGKA 1DLLA 4XUPA 4BB3A 2ID4A 2IVJA 1YUDA 2BQPA 3HQUA 3O14A 2D6KA 4FP2A 2VZ3A 4OMCA 1L3JA 5FTTC 4AQSA 4BXSV 1BKZA 4FPLA 4CU7A 1S4CA 1H1AA 2OZJA 4JDNA 3RI9A 1JZ4A 1MS0A 2OA2A 1O91A 4QPWA 1WLTA 1AR61 1VR3A 2QQPA 3PIGA 5FBJA 3H9AA 2WWSA 4HBNA 2ZZQA 2BYVE 4F8AA 5H9QA 2EIGA 2VQAA 1AYN2 1OQDA 2FZ1A 2HBTA 2XG3A 2YROA 3HN3A 3AZZA 4LO7A 5LB6A 4B29A 1ZBE2 2P4EA 3BTAA 3OCPA 4HFSA 5FYTA 3LDRA 4GZ9A 3ZLIA 4BK5A 3U10A 4YSFA 2MEV3 4LR4A 4QX1A 4DUWA 1DCSA 1UMZA 3ZSLA 4AEMA 4META 5C5UA 3VKLA 3OUHA 2P37A 4XC9A 5F5IA 2FQPA 3MLJA 4LBJA 4A6OA 4RQPC 4FTBA 3M3EA 1GZWA 2QFEA 1QJY2 4LO6B 4XCBA 3WSOA 3HPNA 2R1BA 1EP0A 4K8FA 2B45X 4COZA 2RDQA 4HANA 1KITA 1SLTA 1WUVA 3E97A 3G7DA 4NRPA 2PN5A 4PIZA 4URTA 2RMU1 5GLZA 3VN4A 3OGVA 4CA9A 5JMCA 1TME1 4BQ5A 5FV3A 1ND2C 4NHXA 3UGGA 5IK7A 4CCJA 1OLME 1IS3A 3HWJA 3M3CA 1KS4A 2XVGA 3GF6A 3CEWA 5DG1A 5FY5A 1MZEA 1W6NA 4YG6A 2WIIB 4AEDA 3ZO0B 5JSPA 4EZ4A 1H0BA 2XUMA 3O12A 1K3IA 3VBSC 2ZHMA 3VBHC 4I30A 2YFZA 1C1LA 5A70A 2BOJA 4LNVA 3GCWA 5T3NA 1U12A 3ZXDA 4E8CA 2VU9A 1K5MC 3WLUA 1CQ9A 3T0AA 3KS7A 2XJUA 5LZ6A 2XWBB 2XLAA 1PZ7A 3GJAA 5CADA 3WW1A 3KT4A 1S0GA 4LK6A 1R092 5BNNA 5C8CB 3ELNA 1W6MA 5BNPA 1JHNA 4BK4A 3FLPA 2VQUA 3CQOA 1RUH1 1B35C 2RJLA 4XFAA 3ZXJA 1RUOA 1XQNA 4GKXA 1SPPB 4XJUA 1D0HA 5A1AA 1XYPA 5FYSA 4UW4A 3ROUA 3ZXFA 2WFPA 1HIXA 2BNNA 5LK7B 2AEZA 3M7AA 1RUD2 4KG8A 3LF7A 1OA3A 2PLV2 5C6CA 4Y20B 5H9PA 2RM22 1PO11 3WHUA 2GMEA 1HDKA 3B9IA 3RZZA 1JYIA 4NOTA 3T3YA 5AC92 1JH5A 4HVRA 3TEZA 1WA6X 1AX0A 1QJX3 3PUIA 4YGDA 3ENRA 2ZGLA 4PLOA 4XQWA 3C7EA 4YGEA 2JG8C 1K45A 2E9QA 5FJHA 2QUOA 4XACA 1W9TA 3N35A 3ZFEB 2R062 3BU0A 2R49A 3OG2A 5I0RA 1SZBA 1DBNA 4XABA 2AUYA 1GSLA 2GU9A 3N9MA 4Q2FA 5T52A 4XOGA 5C4WA 1EV13 3VGIA 2Y6FA 1GWLA 4J6GA 3ES1A 3NAPB 3D8CA 1SG3A 4LBQB 1U5YA 3WDWA 3DEMA 1OD5A 4M3CA 3IDEA 1KDMA 5C3OA 2QE3A 4I3GA 4MGKE 2ZTNA 5J3UA 1AL22 4NROA 1NYWA 4XURA 2W1UA 2XLFA 2RS51 3CDZB 4GH4C 4XTPA 1NKGA 3O0XA 4ITCA 5FIXA 4Q26A 4KWJA 4IE6A 1VBC3 4RS5A 2GMMA 3PU8A 2GC2A 3SHRA 1ULOA 1KS5A 1UZZA 4WM7C 1DU3D 4LLFA 1RUF2 2JD4A 4XJ9A 1RUG3 4I02A 5GLUA 2OKXA 3LWCA 2CWMA 4RHV3 2VMGA 2D6MA 2J42A 1VP6A 1LKNA 3PMEA 3HEIA 4PF5A 1PGW1 3H0OA 4CU8A 4AI1A 1ZRCA 4BOWA 1PO23 4BE3A 4DXSA 1FPN3 2VC9A 4N53B 3MEPA 5A80A 1C3HA 2OT7A 1C5HA 1H1IA 1PM4A 1ALYA 3KT1A 4JGZB 5FMOS 3RJRA 3RYPA 1AYN1 3MI8A 4CCDA 4FPHA 4EJRA 2JXAA 3SISA 3VL8A 5AFEA 3AZXA 1COV3 1ZBE1 5LCWL 4PHZA 3TYJA 2VOTA 4OCTA 1HRI2 5FPAA 1QOTA 3HOBA 3NNLA 3A21A 1JUHA 4QXCA 1CGPA 1ND3A 3O1RA 2QQUA 3NJVA 2DCJA 2VY0A 4YZ1A 4G9SB 5FO8B 1DFQA 4K1YA 3TOJA 4A7ZA 4QGNA 1BK0A 1SMVA 2CNAA 3F95A 3KQRA 3OD4A 2XHNA 1TNFA 1W6QA 1XNKA 3IDCB 3J8F3 3I2FA 4XHXA 4YM1A 1VMJA 4AGRA 2IXKA 4BYYA 4FTSA 1XPWA 1R64A 3BGAA 5ABJB 4N43B 3M70A 2Z4FA 1OC1A 2WFF3 1Q43A 2R072 3JQWA 4XFBA 3CL1A 3OBZA 3QLQA 1CPMA 5CA6A 1MS8A 1WW4A 4TTGA 3LGRA 3MDPA 4XDQA 4ASLA 1SLAA 1LJ7A 4HKLA 3VDDB 3KV6A 5C33A 1AR93 1YFXA 2UYBA 1DGWA 3DL3A 1WKYA 3ZFFA 3U1XA 5JIAA 1QF3A 2JEMA 2Q4SA 4IV1C 5EWSA 5JOWA 2CGPA 1W3XA 1O8SA 3P6BA 1OI6A 3UGHA 1ENXA 4KMQA 3TN92 2XDVA 4M3CF 4E2GA 4ISRA 4DO0A 4LKEA 3AP4A 1R091 2EVXA 3IKWA 1GZ9A 4QXHA 4YYOA 3AL5A 3HVDA 3QBQA 3R4DB 3W59A 3WG3A 2RR12 2JDKA 5KHGA 4MOAA 3N7JA 4Q1PA 2WYSA 4OI0A 1CESA 4LORA 4LUKA 4YVWA 2VR4A 5E88A 2YV8A 1J59A 1H9WA 1EAH2 3RWKX 4LE3A 1OVPA 1JOJA 3ZSMA 1RUD1 2O8OA 3VBRB 5BUVA 3BYWA 4BLIA 4IEQA 5FZ1A 2PLV1 1BMV1 5GZFA 2RM21 2QQMA 2K0GA 4MX3A 3ZXGA 1FOD3 3N7MA 4PJYA 3MF9A 3D0SA 4L9BA 4MYEA 5ANQA 3ZMNA 4DOUA 5AC91 2KD7A 2XB6C 2BVBA 2W94A 3HMYA 3MIGA 2VNGA 5GLVA 1I9RA 1WZXA 3KCXA 5LBFA 3MIBA 4LLOA
chains in the Genus database with same CATH topology
3DCQA 2JDYA 2WRAA 2JDKA 2WR9A 1OUXA 2VUDA 2XR4A 5A3OA 5D2AA 2JDMA 1OVSA 1OUSA 1OURA 2JDNA 5HCHA 2BOIA 2JDUA 1W8FA 1OVPA 1UZVA 4AOCA 2JDPA 2JDHA 4CE8A 1GZTA 2BP6A 5A6QA 1OXCA 2BV4A 4UT5A 2VNVA 1UQXA 5A6YA 2VUCA 5A6ZA 3ZDVA 1W8HA 2CHHA 2BOJA 5A70A 5A6XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DCQ A;  2JDY A;  2WRA A;  2JDK A;  2WR9 A;  1OUX A;  2VUD A;  2XR4 A;  5A3O A;  5D2A A;  2JDM A;  1OVS A;  1OUS A;  1OUR A;  2JDN A;  5HCH A;  2BOI A;  2JDU A;  1W8F A;  1OVP A;  1UZV A;  4AOC A;  2JDP A;  2JDH A;  4CE8 A;  1GZT A;  2BP6 A;  5A6Q A;  1OXC A;  2BV4 A;  4UT5 A;  2VNV A;  1UQX A;  5A6Y A;  2VUC A;  5A6Z A;  3ZDV A;  1W8H A;  2CHH A;  2BOJ A;  5A70 A;  5A6X A; 
#chains in the Genus database with same CATH topology
 4NR1 A;  4ASM B;  3WD5 A;  2R06 1;  3K4Z A;  3ZYG A;  1HXS 1;  3BOW A;  5D21 A;  3WEZ A;  3PNA A;  1UIK A;  2GP3 A;  2CWS A;  4AI8 A;  4F3J A;  2HJI A;  3KCC A;  2DWR A;  3ZSJ A;  4MXV A;  2P1B A;  3O1P A;  4AFB A;  5EPA A;  4A4A A;  2XHK A;  2WLP A;  1C4R A;  2K46 A;  2OX0 A;  2VO5 A;  4LTA A;  1UOF A;  5FZG A;  3AP5 A;  5GZE A;  1CAW B;  5IK4 A;  1CJD A;  5LBB A;  3GBW A;  2JD9 A;  3VUO A;  1O5L A;  1AL2 1;  3UKT A;  4P00 B;  4IEX A;  2FCU A;  4NRQ A;  1OXC A;  1OA4 A;  3GXU A;  5FR3 A;  5JXG A;  1AR7 3;  1OQE A;  5L73 A;  1UQX A;  2W0X A;  3IBM A;  2CV6 A;  2D6O X;  2PAM A;  3A7Q A;  3DYM A;  1VBD 3;  3CJX A;  2ZMN A;  4P02 B;  3CBN A;  5FMD A;  1UMH A;  2R04 1;  1YJK A;  4E2S A;  4BM8 A;  3R4S A;  1SLI A;  3S6P A;  4FAG A;  4JV4 A;  3RQ0 A;  2HEV F;  3C2U A;  3BOP A;  5IW0 A;  2V73 A;  1PX4 A;  2A6Z A;  2YBK A;  4RN5 A;  1LB2 A;  3CJI C;  4CCE A;  4CDW A;  2VM9 A;  4GKY A;  4KBZ A;  4IV3 C;  4E4S A;  1LEM A;  1W8F A;  5FZ4 A;  2G9G A;  2VW0 A;  3FLR A;  3K48 A;  4GAL A;  1JYW A;  4AAX A;  1FI2 A;  4XF1 A;  1HRI 1;  1QJX 2;  3OYW A;  5BNO C;  3V0A B;  1HQL A;  2I45 A;  3OPT A;  3JB8 A;  1U5X A;  1AR6 3;  4JKK A;  2VUA A;  1W90 A;  4FFF A;  4RYD A;  3VD7 A;  5HI0 A;  1G86 A;  2DYC A;  2VUJ A;  5FWE A;  3LSD A;  5EZW A;  3VHN A;  3BKZ A;  2B46 X;  4JQR A;  2YDE A;  5IJR A;  4JKM A;  2PAK A;  4L99 A;  5C8W A;  5C9A C;  2R07 1;  5KC6 A;  4LA3 A;  4GWM A;  4PF1 A;  4XBN A;  5A3P A;  4MGT A;  1A8D A;  1UY1 A;  2W91 A;  2BEO A;  3VBS B;  1VBC 2;  3POE A;  1YFU A;  4Q0Q A;  3VBH B;  3LDK A;  2R32 A;  2YXS A;  5JCT A;  2QTW B;  5FZ3 A;  3KWV A;  1GYK A;  1RUG 2;  4BJ0 A;  3AYE A;  1UD1 A;  2VMC A;  3GHN A;  4W6X A;  3CIH A;  4XF3 A;  4RHV 2;  4QPI C;  2DBN A;  1QJZ A;  4I0W B;  4D6R A;  5J7M A;  4ZU4 A;  3O5S A;  1YFY A;  4AAP A;  3U4X A;  3AJZ A;  3JBG 3;  4NHY A;  2XJP A;  3A0N A;  2H0V A;  4QX3 A;  2IUW A;  1TME 3;  2WA4 A;  2GP5 A;  3TN9 1;  2XL9 A;  1OH3 A;  1XE0 A;  4YFZ A;  1B35 B;  3RDI A;  2OII A;  3PJY A;  1HN0 A;  5FUN A;  4TLF A;  2B8M A;  4DEQ A;  2A71 A;  5FLI A;  2UWB A;  5FZE A;  3OPW A;  3GAL A;  5FFO C;  2D3P A;  2AAC A;  2RR1 1;  2Y6G A;  2Z79 A;  2XL7 A;  2XML A;  4CDU C;  2CGO A;  1KQR A;  5A7W B;  2F6B A;  3PHM A;  3KCY A;  2VTF A;  2ZGM A;  3GZA A;  3B9C A;  3PVN A;  2VZP A;  2P3J A;  4GWN A;  3T08 A;  4LT5 A;  1DQ5 A;  1EAH 1;  2HWB 1;  1POQ A;  3B02 A;  1HN1 A;  2Q0A A;  4Q0U A;  1DZQ A;  1VBE 3;  2ZMK A;  3AXD A;  4GUL A;  4TWT A;  5F2W A;  4AL9 A;  3U4S A;  4WM8 A;  3I2D A;  3LD8 A;  1GIC A;  2ZZJ A;  1CAX A;  4RGG A;  3TWI A;  3IMN A;  1S0D A;  3ME2 A;  4WVM B;  4EN7 B;  4CDX B;  3ORJ A;  4Y24 A;  1PZ9 A;  3THT A;  1IQA A;  1W9S A;  1RUH 3;  3AL6 A;  3T2O A;  1LOF C;  1UZV A;  3T2Q A;  2VE1 A;  1F15 A;  1U5Z A;  4Q8L A;  5GZD A;  3UKN A;  3WNK A;  4CXX A;  2PQS A;  2ES3 A;  1I1E A;  2O14 A;  3OF1 A;  1BHG A;  1H8T C;  3CF6 E;  1VE0 A;  1A78 A;  2VMH A;  2ZGS A;  5GZG A;  2ZX2 A;  1URX A;  3DYP A;  1AR9 2;  5CIS A;  2FD8 A;  1GKB A;  3RZJ A;  2X10 A;  1S55 A;  3SXW A;  3GNE A;  3IT8 A;  4OMD A;  1PO1 3;  1G6N A;  3VZO A;  1ZRE A;  2OQ7 A;  5AFB A;  4LKF A;  2VZR A;  2IXI A;  2A75 A;  4L2N A;  4OUS A;  5HV0 A;  2E33 A;  1F9K A;  4V1P A;  3RGB A;  3K4D A;  3U75 A;  1IKP A;  3Q8B A;  4B3N A;  4QWN A;  4LMF A;  5F6L B;  1PGS A;  1PK6 C;  3MV0 1;  1S0I A;  3OD0 A;  4E2Q A;  3QOP A;  3L2H A;  1ZNP A;  2TNF A;  1NCR A;  2VVF A;  2X5I C;  3IWZ A;  3OBT A;  1DYK A;  1UYY A;  1FNZ A;  3H50 A;  2DTY A;  1RUJ 3;  5DUW A;  4DY5 A;  4F83 A;  3HAG A;  4DXR A;  2FHR A;  1H6X A;  3DV8 A;  4RR3 A;  1QGL A;  1S2B A;  1ZRR A;  2GNB A;  2E26 A;  2WN3 A;  4QPG C;  2WWJ A;  2CTV A;  5D2A A;  4EWD A;  1QJX 1;  2L9L A;  4FQZ A;  4CEW C;  1T6B X;  3FC0 A;  3J4U H;  3ITQ A;  2ZAH A;  1NCQ C;  1W8T A;  3PU3 A;  4BQ4 A;  1XYN A;  3POB A;  5DAX A;  4WVW A;  4PDW C;  1I5Z A;  4E9K A;  3TEW A;  2Z42 A;  5DMY A;  1W28 A;  1OPO A;  3RVH A;  1OOP C;  3NV2 A;  1SFP A;  2VXJ A;  4XFI A;  4XUO A;  4AF9 A;  3LB9 A;  3MW4 A;  2ETE A;  1G7Y A;  1AYN 3;  1LHN A;  2DDU A;  2WL1 A;  2XKP A;  3WHT A;  3WV6 A;  4BIO A;  3ZKY A;  1MAC A;  2D5H A;  1ZBE 3;  4FFG A;  1T6G C;  4Z2W A;  1F8V A;  1UZ0 A;  2XH6 A;  1IQD C;  2GC1 A;  1UXZ A;  3OUJ A;  2WIN B;  4FQ4 A;  1OPM A;  5GLT A;  4BQ3 A;  3D5O A;  1Z0H A;  4Z82 A;  4EE2 A;  3I49 A;  1SDD B;  5CZK A;  1VBC 1;  1VLN A;  4EQV A;  3EBR A;  3W9A A;  5E8A A;  3HBK A;  1W04 A;  3AK0 A;  3LIG A;  4IV1 B;  5JAX A;  5DQ0 A;  4Q8K A;  1RUG 1;  3LEG A;  4IEZ A;  1OA2 A;  4KL1 A;  2JDA A;  3HJR A;  2JIC A;  4OLL A;  5CKQ A;  4Q4W 2;  3T2P A;  3KF3 A;  2R7E B;  3AFG A;  1T2X A;  5LA1 A;  5FY9 A;  5CG8 A;  1MZF A;  1ULP A;  3E5Q A;  4AHX A;  2JKB A;  1E5R A;  4OHW A;  3VBF A;  3ZXL A;  5D8A C;  3VLB B;  2EIE A;  5F5A A;  2BGC A;  4I09 A;  5CFC B;  4BQY A;  5FYZ A;  1HJF A;  3LE0 A;  1W8N A;  3AVR A;  4LHS A;  3V65 A;  1QDC A;  2J7M A;  4QDR A;  4ZXE A;  3P5B A;  1NA1 A;  3G6J B;  1O4Y A;  4COU A;  4I0B A;  1WMX A;  2F4L A;  4M01 A;  5IT6 A;  5JMO A;  3VKF C;  5KHJ A;  2ZCW A;  5IYY A;  3KGL A;  5IVV A;  2R1D A;  3FHA A;  1ZA4 A;  1W0N A;  3WP3 A;  4A3X A;  2B39 A;  2NYY A;  5CU1 A;  2XLG A;  5CNA A;  3ATG A;  4Q27 A;  4NHL A;  4NIG A;  3VKO A;  1BXH A;  1L7L A;  2PQQ A;  1KFX L;  1NZC A;  4ZU7 A;  3S30 A;  1R09 3;  1W6O B;  1NLQ A;  2VCB A;  2J1T A;  3ZFG B;  1U5I A;  4BZ4 A;  4UF0 B;  1GNH A;  1LEC A;  1WCQ A;  2ZAC A;  4HN0 A;  4XUQ A;  2DFB A;  4UW6 A;  4LQR A;  3RSJ A;  1YC6 1;  4IER A;  1HQN A;  1C8M 1;  3SH4 A;  4BHP A;  1EY2 A;  4XFC A;  4Y5T A;  3ZXK A;  1UYP A;  1AR9 1;  1MS9 A;  1G9C A;  3H7Y A;  5EIY B;  1VMH A;  1RUD 3;  4MAD A;  2PLV 3;  3RI8 A;  1RTV A;  3ZR6 A;  4ES9 A;  3WNX A;  2RM2 3;  3JBG 2;  1J1T A;  1VMF A;  5A32 B;  1JOP A;  1W06 A;  4DXZ A;  1A8M A;  5AC9 3;  2YG0 A;  5IVY A;  1ODM A;  5I0S A;  3BTY A;  3BI3 A;  4ZU5 A;  1KXG A;  4BWO A;  4B7K A;  2R06 3;  2UYA A;  1QQP 1;  2ET7 A;  2ARB A;  1HXS 3;  1OBN A;  3AP7 A;  4H55 A;  4KWK A;  4ZS3 A;  1NX9 A;  4QT6 A;  3WG2 A;  4EN0 A;  1D2Q A;  1ONA A;  2OS2 A;  2GMP A;  4IEV A;  2VZS A;  2D7F A;  4UYB A;  4DS0 A;  4Z1V A;  1OLR A;  4CXW A;  2B9V A;  2BVV A;  4J25 A;  4IEO A;  3WQ0 A;  4AED C;  2VZT A;  3C7F A;  4FPF A;  2NP0 A;  2XUE A;  1DGW X;  4Q4Y 3;  1Q8Q A;  1PX3 A;  3R0R A;  4LO5 B;  1H9P A;  3F2Z A;  4M00 A;  2RJ2 A;  3I54 A;  2HWF 1;  1VBE 2;  1OH4 A;  3GBF A;  1QHD A;  3OGG A;  2VTX J;  5FPB A;  4MGI E;  3CKH A;  2QKD A;  2XJQ A;  3H8R A;  5DAP A;  3TAY A;  5JOX A;  4J1W A;  1DGR A;  4IGQ A;  4SBV A;  2JG9 B;  1REF A;  2R04 3;  2R6Q A;  2V4A A;  2XON A;  1SBE A;  5TSW A;  3M4F A;  5BNN C;  1PGL 2;  5FRE A;  3DXU A;  2GC0 A;  3H3Z A;  5BNP C;  3R4U A;  1H2L A;  4CCC A;  3RPQ A;  3KGZ A;  1MZ6 A;  1TVG A;  5KXE A;  1AXZ A;  1PMI A;  2K9Z A;  1UYZ A;  3RZK A;  4MH0 E;  1KRI A;  2WLQ A;  3FN9 A;  3GBG A;  3K4A A;  3TEY A;  1ZZ8 A;  3M3O A;  3D0J A;  5JR7 B;  3J7H A;  5FZF A;  1ZZ9 A;  5KXB A;  1UY3 A;  1SPP A;  5HBA A;  1Y9Q A;  1XJA A;  2YGM A;  3FE5 A;  3IAQ A;  4JGY A;  4Z07 A;  5FY8 A;  1B09 A;  1HQW A;  1CX4 A;  2PHR A;  2PHW A;  3KHB A;  3O0W A;  4LKS A;  4WBB A;  4XQ4 A;  5FXW A;  1IS5 A;  4FCA A;  4AI0 A;  3LFM A;  1K12 A;  2VUL A;  4Q4W 1;  4XUT A;  2HEY F;  3PVB B;  4PT6 A;  4Y20 A;  3LZZ A;  1YWK A;  1LHU A;  4N7U A;  4YVS A;  2AYH A;  2E7T A;  1RUJ 2;  1UOB A;  2BWA A;  2R07 3;  4AEK A;  5FWJ A;  3PIJ A;  2P6C A;  3MPP G;  5C4W C;  1ULF A;  4GWJ A;  1JYT A;  1ENQ A;  2VG9 A;  1S0B A;  4YW4 A;  2DUQ A;  4NPR A;  4OHV A;  3ZFE A;  1HB4 A;  2NQY A;  5DXD A;  2VME A;  5JDB A;  1UY2 A;  5KXD A;  4LK7 A;  2XQX A;  3DPR B;  2ZAA A;  2ADD A;  3NAP A;  4RS5 C;  1MQT A;  4P9Y A;  1N3Q A;  1PGW 2;  5EYY A;  4NE9 A;  4FT8 A;  5B2G B;  5DG2 A;  5F3G A;  3BCW A;  1H1M A;  4Y4R A;  1RXF A;  2W95 A;  1WW7 A;  3TN9 3;  1DQ1 A;  4B7E A;  5FY7 A;  3M3I A;  4CEY B;  2GAL A;  1RUC 2;  4BQ1 A;  5BYN A;  5T50 A;  1V00 A;  4XJZ A;  4HPK B;  4UBH A;  1ENR A;  1W6P B;  2WC2 A;  1VRH 2;  2OZ6 A;  2GN7 A;  5L36 A;  2RR1 3;  3WF3 A;  2AZ5 A;  2W47 A;  5FY0 A;  2RDR A;  3CO2 A;  1UOG A;  2PA7 A;  4B1L A;  1AR8 2;  1Y3T A;  1GR3 A;  3HQX A;  4HXC A;  5FZA A;  1YFW A;  4JQT A;  5HCB A;  3WT3 A;  2A7A A;  2GH2 A;  4N53 A;  3J9S A;  1ND3 C;  1EAH 3;  3QAC A;  2HWB 3;  4NAO A;  3TB0 A;  3D82 A;  2A6V A;  2Q30 A;  1CAU B;  4XAE A;  5I8S A;  4JGZ A;  1RB8 G;  2CL2 A;  4H3W A;  2YB7 A;  3O1O A;  2W52 A;  5EHD A;  4QAW A;  2VUD A;  3JBG 1;  5FZD A;  5FPZ A;  2YC0 A;  3QCW A;  5IAX A;  4QB2 A;  2YY1 A;  3MO4 A;  3VD3 A;  4FFI A;  4XF9 A;  4R4Z A;  1UY4 A;  1SDW A;  3SQO A;  3FFZ A;  2VW1 A;  2XBO 1;  4H2A A;  4M0N A;  1JI6 A;  4IET A;  3ZKU A;  3UJO A;  3B69 A;  4XF4 A;  3O0V A;  1SBD A;  4HKW A;  2BV4 A;  2JE8 A;  4LBQ D;  3WY6 A;  4FPJ A;  1CWP A;  4MGZ E;  2GNM A;  3VBU A;  5FYH A;  5I0U A;  4QKD A;  4X8N A;  3LEM A;  1TZO A;  2A3W A;  5ABJ A;  3N3H A;  5I91 A;  1YQ5 A;  5AVP A;  4DXT A;  1LED A;  4QPG B;  1NUK A;  5KHK A;  4RGA A;  3T30 A;  3E6D A;  1DHK B;  1H2N A;  5FYM A;  1VBE 1;  2ZEX A;  3AFK A;  5F2S A;  3ZFF C;  1S0C A;  4CEW B;  4DFS A;  3ZIW A;  3GYD A;  4ZPI A;  1LTE A;  1RIN A;  4CP9 B;  3WF1 A;  1NCQ B;  2ZX1 A;  1LHO A;  2P6H A;  3A0K A;  4OUE A;  4AI9 A;  3VDD A;  5K7P A;  1XNC A;  2D98 A;  3SH5 A;  3NQH A;  2C9A A;  1OOP B;  5FKC A;  1BCX A;  5L9B A;  4FPG A;  2C24 A;  4BIF A;  1K42 A;  4MXW B;  3FFQ A;  4QX7 A;  1WCK A;  1O3T A;  1PGL 1;  2ZX0 A;  2WAO A;  2TBV A;  5EQU A;  5J37 A;  1CJP A;  1CD3 G;  2HEW F;  2PEL A;  4OVE A;  1LOD A;  5EFU A;  4D7T A;  2VZU A;  3OGS A;  4R8H A;  3RRD A;  5IK8 A;  2WO3 A;  3RNS A;  3DEC A;  4GXL A;  1BMV 2;  4YVW C;  4DNY A;  5FMO L;  2GNT A;  4QGM A;  4UAP A;  4CPB D;  3S5Q A;  5JZG B;  2VBP A;  1QJE A;  4WV8 A;  2ZX4 A;  1WW5 A;  1QY4 A;  2ZEW A;  5T5J A;  3B7M A;  3KV9 A;  1GZC A;  5EV7 A;  1X82 A;  5CKM A;  1HXS 2;  4OUM A;  1NLR A;  2HH9 A;  3H8U A;  3H42 B;  4RD7 A;  2ERF A;  2FDK A;  5FK7 A;  5FY1 A;  3VBR A;  5JR2 A;  2V4V A;  3HNY M;  4W8J A;  2B9U A;  2WQ8 A;  4MSV A;  3I8T A;  2ZHL A;  1F2N A;  1RUJ 1;  2CSG A;  2ZPX A;  4Q4Y 2;  4YM0 A;  5FKB A;  3FBM A;  3GJB A;  3T09 A;  5FLJ A;  4MV2 A;  1DG6 A;  5L7O B;  4PBO A;  4I3P A;  3LA2 A;  5HXV A;  5K9Y A;  3KZ4 C;  5GAL A;  4C8D A;  1DZR A;  4OHZ A;  3WF0 A;  2A5Z A;  2JEC A;  2DVB A;  3AP9 A;  4X8P A;  5FZ0 A;  4AQ2 A;  2R04 2;  4NUB A;  4XJW A;  2EXK A;  2G19 A;  2J1A A;  2IFR A;  4K9S A;  1L7Q A;  2D44 A;  3OEA A;  5APA A;  1KEX A;  1RMU 2;  2AEY A;  3ZM8 A;  2UY9 A;  3RWN A;  1JOB A;  4EN8 B;  1WMD A;  1YJL A;  5C7G A;  1VB2 A;  3N7K A;  1CAW A;  1ZZB A;  3I97 A;  2VUC A;  2WN2 A;  4FVV A;  1XNA A;  1XNT A;  3MF6 A;  2FCT A;  2MPF A;  3E6B A;  4DPN A;  3ZVX A;  4LKD A;  4OUL A;  1BVP 1;  1V9U 3;  1RUC 1;  1VBA 1;  4ORF A;  2VOV A;  2D97 A;  4FPK A;  4XUN A;  4V2W A;  1Q8S A;  1F35 A;  1VRH 1;  2WNV B;  4P9J A;  1L7R A;  4A6S A;  4CDW C;  5IVJ A;  3UT0 A;  1LEN A;  3VHO A;  4CXY A;  2A1X A;  2VH9 A;  2RS1 2;  4EN6 B;  5HV4 A;  1MVE A;  4UFL A;  4X6R B;  1ULC A;  4R9A A;  3QH7 A;  1AR8 1;  5FYV A;  3IIA A;  1WD3 A;  2Y34 A;  3LPG A;  1AVB A;  2VCM A;  1LOE A;  1VAK A;  1A3K A;  4YZ5 A;  4AFA A;  1DZT A;  2B42 B;  2GDF A;  4L92 A;  3PJQ A;  1Y9G A;  4MG2 A;  3DN7 A;  3MID A;  2XVK A;  4G3Y C;  4ATF A;  4COY A;  5JXH A;  4Y4Y A;  4A42 A;  1X8E A;  3FHI B;  2VBB A;  3B01 A;  3PTY A;  4Y1X A;  4GJY A;  3VZL A;  4RFR B;  3LFI A;  3AC0 A;  3V0A A;  2ET1 A;  5HCF A;  1A6C A;  2V72 A;  1BBT 2;  5DAV A;  1IPK A;  1YIP A;  3PVO A;  1C8M 3;  4NVP A;  4AED B;  3P3P A;  1BLZ A;  1F4H A;  1RHI 3;  3AKT A;  1LOB A;  4FI9 A;  2W46 A;  4PLN A;  4ARY A;  2BOI A;  2PXJ A;  4QX5 A;  2VQ0 A;  2VCC A;  3E1F 1;  4ARX A;  4BXF A;  4JZR A;  2P3K A;  3B94 A;  1LOG A;  3L2Y A;  1NAE A;  4ZXK A;  2WZR 1;  3MYX A;  5IUQ A;  2P17 A;  2ARE A;  3UES A;  3DF0 A;  4K40 A;  1QQP 3;  1JOD A;  4MGQ A;  5FZL A;  4CDQ B;  2I2S A;  5BNN B;  5C3P A;  2ZXQ A;  2SLI A;  4CP1 A;  3LKJ A;  4A7K A;  2DVF A;  2FMD A;  2DU0 A;  1JZ2 A;  3VKN A;  5LA2 A;  4URA A;  5E1R A;  3NNJ A;  4L11 A;  2BTV C;  3WG4 A;  1WLW A;  3ZYJ B;  1AHS A;  4NWV A;  1HRV 3;  5H9R A;  3K2O A;  3O1U A;  3EQE A;  3HR9 A;  1QEX A;  1ZRD A;  2HWB 2;  5CFD B;  2D3R A;  2CU5 A;  2NLR A;  1IPS A;  4JAA A;  4ZS2 A;  2H6C A;  2HWF 3;  2B5H A;  4OYU A;  4OHX A;  3SCH A;  1JZ3 A;  1SFY A;  5FZO A;  4Z2A A;  3VBO A;  3GCX A;  5EJZ B;  5FPX A;  2WA3 A;  2FZ2 A;  2D3S A;  2A6Y A;  4LPL A;  4LOS A;  1M06 G;  1ZBA 1;  2VNO A;  5IVE A;  2JWP A;  2WBK A;  1IG0 A;  2P3I A;  3JXS A;  2G4I A;  5FZH A;  5A7W A;  4KWU A;  4WM8 C;  2V5Y A;  3RG0 A;  5JOZ A;  1J3Q A;  3S57 A;  4JKL A;  1KDK A;  4ES8 A;  2VPV A;  1CR7 A;  2YGL A;  2H0B A;  1C28 A;  4LIU A;  1QH7 A;  1OUR A;  1Z7S 2;  2J1V A;  2X8K A;  5CIR A;  2QQW A;  2VCA A;  2SBA A;  3W20 A;  3KHC A;  2XJT A;  5A3L A;  1D0G A;  2BW8 A;  3ZXA C;  1OKQ A;  4WVM A;  4QMA A;  3WZ1 A;  4CDX A;  3NL1 A;  4Q4Y 1;  5LEJ A;  5F9T A;  1MEC 1;  3FUO A;  2HKX A;  1NE4 A;  2JX9 A;  3C7H A;  3VHP A;  1GQH A;  4K21 A;  1W2N A;  4RS5 B;  1WD4 A;  2HWD 2;  2WNO A;  1XC6 A;  3KV5 A;  5F39 A;  3AKR A;  4I2O A;  1V70 A;  4XDO A;  4PLM A;  3BOD A;  1OF4 A;  2G1M A;  2JDY A;  1YI9 A;  4QU2 A;  4XHB A;  3FX3 A;  1RED A;  1DYP A;  1HLC A;  4Q4W 3;  1RMU 1;  2XR4 A;  4W6W A;  4K6B A;  3RS6 A;  3U07 A;  1RUE 2;  5LEK A;  5CB7 A;  4E4H A;  2FDI A;  5K8S A;  2IXH A;  4YM2 A;  1J83 A;  2Y33 A;  3IM0 A;  1CIW A;  1UOJ A;  1UU6 A;  2QJV A;  1GQG A;  3WP5 A;  3JB4 C;  3NVC A;  1NCR C;  4P9X A;  5SV5 A;  1KJR A;  2WNU A;  1CZV A;  1YLL A;  4RQP B;  4UW5 A;  1VIW B;  2XJS A;  4W65 A;  3ZOI A;  2KR2 A;  4S2H A;  1WCD J;  3SKJ E;  5FP7 A;  2HBU A;  1ND3 B;  4YW2 A;  1VAV A;  4NAM A;  2WT0 A;  1XE7 A;  2LS6 A;  3U37 A;  2RS1 1;  4RR3 C;  2E63 A;  1IGO A;  5BPX A;  2BPA 2;  3KSC A;  1GP6 A;  4Q0V A;  3TEX A;  4IEP A;  1DGL A;  3K75 B;  5BY5 A;  1TG7 A;  5ISL A;  4QXK A;  2XVL A;  3ILR A;  2BJS A;  2MHF A;  2W39 A;  2ZML A;  1ND2 B;  5A33 B;  4CCN A;  2LW8 A;  1XSR A;  1YRZ A;  2ORX A;  3SCG A;  3VB9 A;  3ACF A;  1MS3 A;  3C7O A;  3ON7 A;  4IXL A;  4XFF A;  1W2U A;  1DLC A;  3O1V A;  5F5Q A;  2PHL A;  4O9G A;  1J1L A;  1BBT 1;  2C0Z A;  3ACH A;  4E27 A;  2Y60 A;  3RJ2 X;  3GM8 A;  1RC6 A;  1K5M B;  5E89 A;  4PCR A;  2XQR A;  3K51 A;  4P5Y A;  4O61 A;  1UY0 A;  2WYF A;  4HG6 B;  3H8X A;  3KLS A;  4XVH A;  3GZT B;  4UBG A;  4XBL A;  5LBE A;  2P5B A;  3O1S A;  2D6L X;  2NMN A;  3JQX A;  3RYR A;  1PIV 2;  2BU9 A;  2OUH A;  3AB0 A;  4M3C E;  2VGD A;  1V9U 2;  3EB7 A;  2IFW A;  2XBO 3;  4K20 A;  2XWJ B;  4Y1Y A;  3BIW E;  4GIQ A;  5A6Q A;  5LRS A;  5CVR A;  3HT1 A;  1SQ4 A;  5FYC A;  1D4M 2;  1HJG A;  5GM0 A;  3VBF C;  4XFH A;  4HVQ A;  4YWA A;  1Q3E A;  3N7L A;  1FT9 A;  3OY8 A;  5JI9 A;  1CN1 A;  4QPY A;  1XU1 A;  3S5A A;  4YVW B;  4BME A;  2EID A;  2A6W A;  2VMI A;  4OI1 A;  1D2S A;  1E5H A;  5G04 L;  3I3B A;  1NA1 C;  3ILF A;  4UFK A;  4XTM A;  2VMF A;  3AZW A;  1RUI 1;  4HLT A;  4QHB A;  2JG8 B;  4DRR A;  4DZG A;  2JE7 A;  4YW5 A;  1XB9 A;  1Y43 B;  5CFC A;  1LAJ A;  4H14 A;  5GJ6 A;  4TXW A;  2Y6J A;  5FYU A;  5LWB A;  5DAQ A;  4KQ7 A;  3NO8 A;  3OEB A;  2EIB A;  1V6O A;  2ZGO A;  4ZKT B;  2PFW A;  3LA7 A;  3SLI A;  4MVT A;  2F17 A;  3CLP A;  3CMG A;  1JBC A;  4IND A;  1VBB 1;  1C8M 2;  1MPX A;  2EF6 A;  4HK8 A;  4QDS A;  2PHT A;  3JD7 1;  3SNM A;  1RHI 2;  1XNB A;  4D7S A;  4C1X A;  1W2T A;  3W58 A;  5LW9 A;  1YCI A;  4GH4 B;  4GWI A;  1Z7S 1;  1RUN A;  3J7L A;  2RHP A;  3WF4 A;  1R1Z A;  2EA7 A;  4CUA A;  3ZFG A;  1CAV B;  3R05 A;  1JU4 A;  4LOT A;  4WM7 B;  1UZW A;  1SCS A;  2A3Y A;  1TMF 1;  2XKO A;  4W50 A;  2VL4 A;  2C4X A;  1J84 A;  4P14 A;  4QQO A;  1TNR A;  3P1I A;  4XZU G;  3VZM A;  3I3Q A;  1OD3 A;  2DCK A;  1FV3 A;  1QQP 2;  3I3E A;  3OSD A;  3MIH A;  1LOC A;  4O7X A;  5DN2 A;  2HWD 1;  3N9O A;  5FK8 A;  5A3N A;  2VMD A;  3U11 A;  1YNA A;  1YI7 A;  1FMD 2;  1MS4 A;  2DUR A;  1H4H A;  1RL3 A;  2VOX A;  3ZYB A;  4CYD A;  3POY A;  3IB3 A;  1WW6 A;  3OUI A;  5FMB A;  1V6L A;  2ZGP A;  5FCC A;  1HRV 2;  3I3D A;  5T5P A;  1JZ7 A;  5DAW A;  3RFR A;  3SMH A;  5A32 A;  1RUE 1;  4YNI A;  4C1W A;  3WNM A;  3K3O A;  5KHH A;  2HWF 2;  4JRL A;  3AMN A;  1XOY A;  1WLD A;  4Z92 B;  2VZV A;  3LIH A;  4JVA A;  1ULE A;  3K77 A;  5IK5 A;  5GLW A;  4DEV A;  3OGR A;  5I8Y A;  4NO4 A;  3ASI A;  1YYN A;  4QKB A;  3RZM A;  3MIE A;  3ZMO A;  2QCS B;  1G9B A;  5CG9 A;  2WNE A;  1UAI A;  2K2S A;  1HV1 A;  1PM7 A;  3ZN6 B;  4XF0 A;  1LGC A;  2C1F A;  4BU2 A;  2PMW B;  2WDB A;  2PHU A;  1VBA 3;  1RUC 3;  5K0U A;  5C3Q A;  2JIJ A;  4B4P A;  4QHZ A;  3KMH A;  1W2A X;  1VRH 3;  2ZGU A;  4DUV A;  5JPM B;  1W9F A;  2Y0O A;  1WWY A;  3AP6 A;  3I2G A;  2JG9 A;  1JTZ X;  1V6J A;  4Y33 A;  3CNA A;  4HK9 A;  1UXX X;  4GA9 A;  3WNO A;  3WW2 A;  5C71 A;  2BFU S;  1GNY A;  4RA0 A;  1FX5 A;  1KFU L;  1LHV A;  2ZOE B;  1AR8 3;  2D6N A;  1JU3 A;  3HT2 A;  1O3S A;  2DCY A;  2KA3 A;  5C3S A;  2OVU A;  4RFT 0;  4XXA A;  1I5P A;  2OUJ A;  4DY3 A;  2AEN A;  1KGY A;  4LUL A;  2O0O A;  4JGY C;  3POG A;  4RSU A;  4Y5Z 0;  4R9D A;  3LEI A;  5L9V A;  3SEP A;  1QWR A;  5KBF A;  1PHM A;  1AXK A;  5FY4 A;  3ETQ A;  1D7P M;  1PIV 1;  1NY7 2;  2YMZ A;  4LO4 B;  3NNF A;  1H6Y A;  5F3I A;  4DRV A;  1V9U 1;  3MGU A;  3VDB A;  1Z78 A;  1OLQ A;  2Q8O A;  1OUX A;  5LK5 A;  5A7N A;  1AX2 A;  1IPJ A;  4YVS C;  1UU5 A;  1WGP A;  3LAG A;  3WCS A;  4K1Z A;  2ORZ A;  2W1Q A;  5LBC A;  1D4M 1;  4UFJ A;  3WUC A;  1QH6 A;  2JE9 A;  2NPI A;  2D93 A;  3BAL A;  1J3R A;  3ZFE C;  2A6X A;  5JPN B;  1WCU A;  5KC5 A;  1H30 A;  2J1R A;  3IMM A;  2A3X A;  1STM A;  3ZYR A;  5DUV A;  4HON A;  3WOG A;  1ZZ6 A;  2VTX A;  4EYU A;  4YW6 A;  4CVU A;  2W08 A;  1S0F A;  2JJ6 A;  2WZR 3;  4XZP A;  3X29 B;  2VEC A;  3TRS B;  2UY8 A;  3NAP C;  1MQT C;  1QOO A;  5J09 A;  3NJX A;  4COW A;  4PI0 A;  2RDN A;  2WQZ C;  2R0H A;  4FFH A;  1X50 A;  5A7S A;  5F7U A;  1UPS A;  5LA0 A;  1XXN A;  5A3U A;  2QBX A;  3IDB B;  2GAU A;  4NII A;  1LHW A;  4LO8 A;  3VDA A;  2P34 A;  2ZA9 A;  3Q9O A;  3DPR A;  3QD6 A;  5FDB A;  4IDZ A;  5J48 A;  3RZL A;  1W99 A;  3IN9 A;  4HZF A;  3NV4 A;  4AVA A;  1V6I A;  4MGY E;  1RHI 1;  2HYK A;  4XDP A;  3WXP A;  1OT5 A;  1SAC A;  4WZF A;  1GWK A;  2FDF A;  1QMJ A;  1UMI A;  2BER A;  2YPJ A;  1GZT A;  2JB8 A;  4CEY A;  3BUC A;  1O3Q A;  3IZO A;  4UFH A;  1QU0 A;  2BNM A;  4YZ2 A;  4HPK A;  1EUT A;  2WSV A;  1US2 A;  1LGB A;  2FCV A;  3D6E A;  1W6P A;  3ZYF A;  4N53 C;  1ZBA 3;  4KGQ A;  4KGG A;  4Q29 A;  4LHL A;  1S1A A;  4FOQ A;  2H6B A;  2ZGQ A;  4JGZ C;  4AVT A;  3IPV B;  5FO9 B;  2XBO 2;  4G4F A;  1H8V A;  1JYX A;  3POF A;  4Q1R A;  1WBF A;  4UWD A;  5BV6 A;  3Q8A A;  4LBL A;  1AL0 G;  2JIG A;  3CJI B;  4CSW A;  1FMD 1;  5HXM A;  3ZYH A;  3HNM A;  1CIY A;  4IV3 B;  5JWP A;  1CAU A;  2JDN A;  2JDZ A;  2QQO A;  3NV1 A;  4P9W A;  5FZC A;  4LUM A;  2RS3 2;  1HRV 1;  5FPL A;  1ZX5 A;  4TZD A;  1Q8O A;  1UYX A;  5DZF A;  3VBU C;  4IGP A;  1MEC 3;  5BNO B;  4WVZ A;  3KVB A;  3ZXE A;  2XJV A;  5ABJ C;  2O8Q A;  4AXO A;  1W9Y A;  2TEP A;  5FQ0 B;  4D3W A;  1MS5 A;  4BQW A;  4IE5 A;  2AC1 A;  4TN7 A;  3ZDV A;  5A6X A;  2A70 A;  3I59 B;  4CTE A;  2E51 A;  5DZE A;  2LAL A;  3ZN5 A;  5A7O A;  4YW1 A;  4NWW A;  3N9P A;  2IWG B;  3OGJ A;  1RMU 3;  5G05 L;  5CEH A;  3WG1 A;  2YZ4 A;  5CYY A;  1O6U A;  4FBF A;  5C9A B;  3Q8C A;  3VDD C;  1F5J A;  1H4G A;  3CZJ A;  3BN6 A;  3P3N A;  1I6X A;  1OSG A;  3OOX A;  1GUI A;  1W8Z A;  2W1W A;  3V0B A;  3OJB A;  5H9S A;  3WDU A;  1YO8 A;  2Y0I A;  4HSL A;  3VDC A;  4DIQ A;  4CP9 A;  5C8C A;  3T1M A;  4D6Q A;  4UT5 A;  3VV1 A;  5FLH A;  5F8P A;  1JHJ A;  1SHW B;  1AYM 2;  1PVC 3;  5D1I A;  2CAV A;  4AVC A;  4QPI B;  1W0O A;  2E31 A;  2RS1 3;  1W03 A;  2PTM A;  3UYJ A;  1VB4 A;  1S0E A;  1P8J A;  1UW8 A;  1ASJ 1;  4A3Z A;  3L9J T;  4QDQ A;  1XSQ A;  4CU6 A;  4IE4 A;  4JHZ A;  4IEU A;  4ZZ5 A;  1UF2 C;  4GJZ A;  5CBL A;  2R0F A;  4NN0 A;  3M3Q A;  2Q8D A;  2OYZ A;  2OW4 A;  1QXJ A;  2R16 A;  2C6S A;  2W2I A;  2EAA A;  4AQ6 A;  2Z2S B;  3AKP A;  3FHQ A;  4PBP A;  4CP2 A;  1HX6 A;  2DCT A;  4B4Q A;  5GZC A;  1W3V A;  3WDV A;  4AFC A;  3LSE A;  5FXV A;  3MPB A;  5JZG A;  3FUQ A;  1IG3 A;  2G9Z A;  1EUU A;  3ALQ A;  1YQ6 A;  1NY7 1;  3KQ4 B;  4GAZ A;  5EP9 A;  5FZ7 A;  1CZT A;  3VBR C;  4CDU B;  3BTX A;  3GZE A;  1BZW A;  3O1T A;  1BBT 3;  2XXZ A;  2QNK A;  1UWW A;  4P08 A;  1NA1 B;  4XET A;  1CX1 A;  2YUE A;  4LBQ A;  1DQ6 A;  5HPO A;  3LDB A;  3III A;  4D0Q A;  2WO1 A;  5DAB A;  2ENR A;  1V6M A;  2CDP A;  2FDH A;  5A3T A;  4OFG A;  1XND A;  2X29 A;  1I3H A;  4N90 A;  3LQC A;  2DV9 A;  3WP6 A;  2VJX A;  1IHM A;  1VBA 2;  1WCS A;  2WZE A;  4K3U A;  5L7O A;  1YQC A;  3HD8 B;  4LXL A;  1ZRF A;  4BIS A;  1H8T B;  4YZ4 A;  4LBM A;  3WNP A;  3VD4 A;  1WME A;  4Q4X 3;  1FAY A;  2QVS B;  1G9D A;  1APN A;  3I2O A;  3THC A;  1RXG A;  5FZ8 A;  2CYF A;  3J7M A;  2Q1M A;  2WT2 A;  3AYC A;  4MLO A;  3E6C C;  2LRO A;  4NHM A;  2WR9 A;  1G9A A;  1BYH A;  4TLG A;  4M4P A;  1RUI 3;  4N9I A;  5DZG A;  3ILN A;  2W92 A;  1N3O A;  4IGO A;  3PUA A;  2DCZ A;  4P5H A;  5FYI A;  3USU B;  3JCI A;  4L0P A;  4CU9 A;  1QJU 3;  4BA6 A;  3ZYP A;  4ZHN A;  1ZA7 A;  2WNV A;  1JZ5 A;  4JDO A;  1X9P A;  1PK6 B;  2Y64 A;  4S2D A;  1RJ8 A;  1W8W A;  2YC2 A;  3CU7 A;  4CPB A;  4O9E A;  3ABZ A;  2JEN A;  3AKQ A;  4AFD A;  4CUB A;  1VBB 3;  3VZK A;  2X5I B;  1VRB A;  1C8N A;  3JD7 3;  4MGS A;  1BJQ A;  1IZ3 A;  3RZG A;  2IXL A;  1IS4 A;  1XBF A;  1Z7S 3;  2YFU A;  1QKQ A;  4N43 A;  2RS3 1;  1R1A 2;  1G9F A;  1JZ8 A;  5I0T A;  5ERL A;  2QQJ A;  2WZR 2;  2ZEZ A;  3AMP A;  4MHU A;  4LEJ A;  1TMF 3;  5T5L A;  4HT1 T;  4BMB A;  3D3A A;  1GNZ A;  1OF3 A;  2Y6L A;  1NQJ A;  1ENS A;  2HWD 3;  2J1S A;  1W0P A;  2EXJ A;  2QDR A;  2WO2 A;  4UXA A;  4QD2 A;  4PDW B;  4WZC A;  2XJR A;  3UGF A;  5A3M A;  4COV A;  1POV 0;  3LA3 A;  2D5F A;  3SIT A;  2QQL A;  3I4I A;  1JS9 A;  4EV0 A;  4KG0 A;  4FAH A;  1S2K A;  2ZBJ A;  2W87 A;  3H1M A;  1RUE 3;  1WMF A;  1NLS A;  3LOI A;  2WS9 2;  3NST A;  1US3 A;  4D8M A;  3DCQ A;  2E32 A;  1GQP A;  5FP4 A;  1UO9 A;  4GB3 1;  4XXP A;  1WA4 A;  3GZU C;  4ISQ A;  3M1H A;  2GH8 A;  2BBV A;  2DTW A;  2VW2 A;  1R08 3;  1AF9 A;  2ZAB A;  3MHZ A;  2ZKL A;  1QIQ A;  3EJK A;  4JDM A;  3THD A;  4CDQ A;  2E7A A;  1ZBA 2;  3EO6 A;  2YBP A;  2P2K A;  5KWR A;  5FJK A;  1AYM 1;  4FOV A;  2ZGR A;  2BNO A;  4YLZ A;  4AOC A;  3VBO C;  2JDP A;  2WKK A;  4DQA A;  3UNP A;  1J58 A;  4GQ7 A;  1HW5 A;  1HB3 A;  3DKQ A;  4JGY B;  1LUL A;  2G9F A;  1S2E A;  1POV 1;  1REE A;  2VNV A;  3EHK A;  4FXG B;  5CFD A;  5FYY A;  4KI5 M;  5JXI A;  4YW3 A;  3MUZ 1;  1KD7 A;  5D8A B;  1O59 A;  1FNY A;  3W5M A;  5IAV A;  2ZGT A;  2AR6 A;  4AVB A;  5FPU A;  2UUR A;  1ZVF A;  2PAE A;  4YVS B;  3WNL A;  4B1M A;  4WVV A;  3O1M A;  1MEC 2;  4XE9 A;  1QOS A;  1Y9M A;  1UU4 A;  1QXP A;  4XW3 A;  5DDJ 1;  2DUP A;  4BQ2 A;  5KXC A;  4N8M A;  2ZX3 A;  4S2F A;  4CDX C;  1GOF A;  2NMO A;  5ACA 1;  1CZS A;  3EMR A;  5IFP A;  1MR5 A;  4YRD A;  5J96 B;  2HWC 1;  3S0M A;  1MQT B;  2ZKN A;  1SEF A;  3OPZ A;  2WAA A;  2DVD A;  3UL2 A;  1LR5 A;  1K5J A;  5A6Y A;  3T0B A;  1FXZ A;  5JI7 A;  1AUY A;  5FP3 A;  1PIV 3;  4DIN B;  2AH2 A;  1BEV 2;  2OQ6 A;  2YHJ A;  3DGT A;  1IKQ A;  1M4W A;  4GMP 0;  4IEY A;  3I2I A;  4ASK A;  2EXI A;  5KR7 A;  4YW7 A;  1V6N A;  4KU7 A;  5IVC A;  3ECQ A;  4D69 A;  3T4H B;  1D4M 3;  1PVC 2;  4L97 A;  4JCK A;  4NHK A;  4O65 A;  5FP8 A;  2EIC A;  2FMY A;  4PQQ A;  1JUI A;  2BRT A;  2JKX A;  4OQ8 A;  3B5L B;  1GV9 A;  2WNU C;  4OZO A;  3AMQ A;  4E8D A;  4QX8 A;  3J26 N;  1UZY A;  2VVE A;  2MNG A;  1GZW B;  1NOV A;  1QXR A;  3AZV A;  1UCX A;  4PI2 A;  3E5U A;  1ACC A;  2YPD A;  4LHN A;  3AYA A;  4JTN A;  3V64 A;  3PLQ A;  1X8M A;  1W05 A;  3JUU A;  4AWD A;  4IE7 A;  1W8H A;  1RYY A;  4RQP A;  2Q8E A;  2X05 A;  4U2A A;  4GMP 1;  3VD9 A;  1N1Y A;  4QB1 A;  3I2H A;  3K3N A;  1PNG A;  1QJF A;  2WUH A;  3H3U A;  3ACL A;  1N3P A;  3KB5 A;  3Q8E A;  1JMU B;  1F31 A;  1DQ4 A;  3E5X A;  1OQ1 A;  1W6N B;  5FO7 B;  3DYO A;  4QQ2 A;  1SLC A;  3VBU B;  5A1L A;  1BK1 A;  1QJY 1;  1UNB A;  3H1Y A;  1ZYB A;  2JDH A;  5A1F A;  1ND2 A;  2HLE A;  5A33 A;  4BLJ A;  5IHR A;  5A7P A;  2BP6 A;  2WAB A;  1R1A 1;  1AJK A;  3BVC A;  1YQ2 A;  3VZJ A;  3OB8 A;  4PIY A;  2EAK A;  5JVV A;  3OTF A;  1AJO A;  1KJL A;  4QQP A;  1J3P A;  3WNN A;  3BIE A;  2BBA A;  1HB2 A;  3VBS A;  4Y1U A;  4FPC A;  5FZM A;  3VBH A;  3OBR A;  3NNG A;  3O7O A;  3T4V A;  5IFT A;  1W6M B;  3B93 A;  5BNP B;  4AQT A;  2UU8 A;  4Q4X 2;  2VAU A;  1FMD 3;  1UKR A;  1K5M A;  2WZ8 A;  3AMM A;  1OVS A;  3U78 A;  3D4K A;  2Z5W A;  4EN9 B;  4Y1Z A;  4LA2 A;  5ANN A;  1LGN A;  4Q4V 3;  4H7M A;  2WS9 1;  4IL7 A;  1SLL A;  1X9T A;  2EXH A;  1RUI 2;  4QX0 A;  2O1Q A;  2E53 A;  5A3W A;  1B35 A;  4FO9 A;  1JZ6 A;  4UI9 L;  1QJU 2;  3WX5 A;  3ZPO A;  2F4P A;  4QKF A;  4W6Y A;  3IAP A;  4CCO A;  2MEV 2;  2Q8C A;  4ZZ8 A;  2EAL A;  2ZS6 B;  1SLB A;  1W2O A;  3UKV A;  1YQ8 A;  4HOO A;  1IS6 A;  1X36 A;  1VBB 2;  4BCU A;  4ET7 A;  5CFC C;  4MO3 M;  3JD7 2;  4EZH A;  1O8P A;  1DYO A;  2BGP A;  3ACG A;  2P3Y A;  1RGS A;  2W68 A;  3CHX A;  1NXD 1;  5C4W B;  2RJK A;  4LE4 A;  3GHM A;  1NT0 A;  3AXE A;  2J1E A;  3C8X A;  2JG8 A;  3BPS A;  4M3C B;  3AX4 A;  1NXM A;  3FJS A;  5KHI A;  3BU7 A;  2DF7 A;  2VNR A;  5F3E A;  3MW3 A;  1DQ2 A;  1UPI A;  1TMF 2;  2UWA A;  4J1X A;  3FL7 A;  4XJ8 A;  2WZP P;  3ZIX A;  2TUN A;  2YBS A;  4E4D X;  2HWE 3;  4R9B A;  1ASJ 3;  5FP9 A;  3ZFG C;  1RVF 3;  1SCR A;  3J7N A;  4NMI A;  3ZPY A;  5F6K A;  2HYX A;  4CCK A;  1AZD A;  5JIU A;  4GH4 A;  3TNP B;  3S7E A;  3WDT A;  2ZGN A;  1N1T A;  1OKO A;  1O3R A;  5FZB A;  2R30 A;  1IOA A;  3PL0 A;  5LAT A;  3URF A;  1CAV A;  1F4A A;  4WM7 A;  4Y3O A;  3WP4 A;  4KH9 A;  5K4L A;  1PVX A;  3MV1 1;  3SEE A;  1BEV 1;  3V56 A;  1HKD A;  5JLV A;  1R08 2;  4A44 A;  5CAZ A;  1X7N A;  2X53 S;  2WSU A;  5F1R A;  4XAA A;  3T1L A;  4R9C A;  2XPJ A;  1RUF 1;  4X6Q B;  4K7J A;  1PVC 1;  4JX0 A;  4NID A;  4V2V A;  4A2U A;  3WUD A;  5C70 A;  4CRQ A;  3KVA A;  3Q8F A;  5DPN A;  1DGR N;  3T0D A;  2GC3 A;  2VZ1 A;  4QM8 A;  4PQ9 A;  3OBA A;  2YYO A;  2E6V A;  1GOH A;  3SC7 X;  4JRA A;  1Y7B A;  1W6Q B;  1ZRI A;  1PMH X;  2VZO A;  4ATE A;  2ZHK A;  4JTO A;  1W9W A;  4DB5 A;  4AVV A;  4D94 A;  3WIN E;  3WQB A;  3I2K A;  4FSJ A;  4YGB A;  2VQT A;  3WQ7 A;  1EPW A;  3MIC A;  4QKN A;  2WJS A;  4N7I A;  1JW6 A;  5EJ3 A;  2Y38 A;  2DFC A;  1RIR A;  4YZ3 A;  3IDA A;  5K0U C;  4I01 A;  3A22 A;  1UX7 A;  3HIF A;  1LOA A;  1HB1 A;  2FBE A;  1H2K A;  3AKS A;  2ARX A;  3NMB A;  2C5D A;  1W8U A;  4YPJ A;  4NPL A;  4OQ9 A;  5F5C A;  2JG9 C;  4BH9 A;  4OI2 A;  4U36 A;  1X33 A;  2KM2 A;  1EV1 2;  3ZN6 A;  2DVA A;  4C91 A;  2B4K A;  2Z69 A;  3ZFF B;  4C90 A;  3K46 A;  4FOY A;  4QXB A;  5FRA A;  5A3O A;  4ZON A;  4XJA A;  1CPN A;  4CUC A;  1AXY A;  1SBF A;  1OMI A;  1OFN A;  1OFS A;  4AGV A;  4AGG A;  2VOK A;  4FPO B;  2VVD A;  3W21 A;  4NPM A;  5J1X A;  3AJY A;  5FBZ A;  3MZH A;  4IQP A;  4IV1 A;  2ARC A;  4HSJ A;  5T5O A;  1V6K A;  2DUO A;  2GSY A;  3HN1 A;  4K8R B;  4Q4X 1;  2VBD A;  3NV3 A;  4LIT A;  3RMX A;  5BXX A;  3N4M A;  2QQN A;  3I2J A;  4AHW A;  2W9X A;  5FZK A;  3QH6 A;  4XFG A;  1PMJ X;  2JB4 A;  3MIF A;  4KBB A;  2RS3 3;  5A7Q A;  3PTR B;  5E16 A;  2WRA A;  1NQD A;  4YAR A;  4B4R A;  1PO2 2;  3M2M A;  4JC1 A;  1FPN 2;  2PHD A;  4MZU A;  4GD4 A;  2RMU 3;  4C0B A;  4CUG A;  4YM3 A;  1JN2 P;  2JDM A;  4R52 A;  1GBG A;  1Q56 A;  5GKA C;  4P9G A;  2IXC A;  4W4Z A;  2QQI A;  5FZO B;  2GN3 A;  3VBO B;  1QJU 1;  1UIJ A;  5JXJ A;  4YFW A;  3BTZ A;  1COV 2;  2CGN A;  3RYK A;  3V0B B;  1TQ5 A;  4QM9 A;  5T54 A;  2PYT A;  2MEV 1;  4UFM A;  1Q5O A;  4YG0 A;  5LAS A;  4XIO A;  1W39 A;  4Y5S A;  1C1F A;  1Y4W A;  4P9I A;  1DDL A;  4HMZ A;  2D6P A;  3M8L A;  4QGL A;  1F5F A;  5FXZ A;  3BB6 A;  2BDR A;  5C5T A;  5FOJ B;  2ADE A;  2CY6 A;  1DP0 A;  2RVA A;  4QQL A;  4SLI A;  3J8F 2;  5EYX A;  4GB3 3;  3DPR C;  4KWL A;  3VD5 A;  3WF2 A;  5IVF A;  4IUG A;  4CCM A;  1GLH A;  1ULD A;  5IWF A;  2WFF 2;  1W6O A;  1RJ7 A;  3C3V A;  1XRU A;  3POW A;  3AMH A;  4UF0 A;  1UKG A;  3KT7 A;  1TEI A;  1AYM 3;  3TNQ A;  4AK3 A;  3HBZ A;  4CEY C;  4CZS A;  1NZI A;  1MZ5 A;  3ST7 A;  4RL7 A;  2BFU L;  3MFA A;  4QHO A;  5B4X A;  1LRH A;  4UOJ A;  1POV 3;  4AG4 A;  1JYV A;  1MVQ A;  4XEZ A;  5J36 A;  4XCA A;  2NM1 A;  4PIX A;  4DUX A;  1BQP A;  1O5U A;  4BQX A;  2ILM A;  3POS A;  2BGO A;  3GGL A;  2AGS A;  1NE6 A;  4Q4V 2;  5AVA A;  2LRP A;  3PUS A;  4CDW B;  3ZDS A;  1U0A A;  3HQR A;  1EYB A;  3USS A;  3TBD A;  4AFM A;  5F37 A;  3I7D A;  2VZQ A;  2V5D A;  3IPV A;  2BUK A;  2J22 A;  2ATF A;  3H7J A;  5DDJ 3;  1ULG A;  3LEK A;  3ZN4 A;  1R08 1;  4A45 A;  5LY1 A;  4EWA A;  2WNU B;  1LCL A;  1WBL A;  1GMM A;  5ACA 3;  4Y26 A;  3OYW B;  3CJI A;  3FWE A;  3NW4 A;  2GZW A;  2OPK A;  2XGX A;  3I3M A;  4H7L A;  4IV3 A;  3VZN A;  1EPZ A;  2HWC 3;  3DXT A;  2FDJ A;  4QB6 A;  2D40 A;  1LES A;  4MUV A;  1N1V A;  1ZZ7 A;  5F3C A;  4LIV A;  4CCL A;  1QNY A;  1G8W A;  4TSV A;  5BNO A;  2RS5 3;  3NNM A;  3PUR A;  5HCA A;  4ERO A;  1LU1 A;  3NJZ A;  4OI4 A;  5FQ0 A;  1OHF A;  3POI A;  2PHX A;  1FOD 2;  1C57 A;  5FZ9 A;  2YC4 A;  3I59 A;  4BDV B;  4M4R A;  1GAN A;  2E7Q A;  4FPY A;  5FPV A;  4AHZ A;  3JU9 A;  1UX6 A;  2RE9 A;  2IVI B;  1YEW A;  2RV9 A;  3CZU A;  5F32 A;  3C7G A;  3LCP A;  5T55 A;  4D7Y A;  4AYU A;  2HWE 2;  5C8C C;  1ASJ 2;  3APB A;  1TE1 B;  3KM5 A;  2DVG A;  3UJQ A;  1E5S A;  3AZY A;  1RVF 2;  2VXR A;  5C9A A;  4A41 A;  5BNQ A;  5LRR A;  5E6H A;  4TYS A;  1YHF A;  1ZM1 A;  4EWE A;  1EV1 1;  3SKV A;  2NZ9 A;  4AZZ A;  4F7Z A;  3MUY 1;  4Q0S A;  1XYO A;  4XYX A;  3H8O A;  1QDO A;  2CHH A;  2I74 A;  2W1S A;  3KF5 A;  1DIW A;  4QX2 A;  4AE2 A;  1OLM A;  3FBY A;  1E57 A;  2W3J A;  4FPE A;  1V0A A;  4GMP 3;  2Y26 A;  2NN8 A;  2WWU A;  5L19 A;  1W8O A;  1VAL A;  2I07 B;  2J1U A;  1MS1 A;  4QPI A;  3MW2 A;  1AR7 2;  1YIF A;  3MLL A;  1GWM A;  2ARA A;  5SV8 A;  2QQV A;  4AW7 A;  1S0J A;  3MFC A;  3SCF A;  5FXX A;  4E4Z A;  4FOW A;  4CP0 A;  2CDO A;  1VBD 2;  5JZG C;  3H1W A;  3MBW A;  1FV2 A;  3EYP A;  1H2M A;  5FUP A;  3WW3 A;  1QJY 3;  2QZ2 A;  4RHV 1;  4AI2 A;  1GOG A;  5JUV A;  3OY8 B;  3WCR A;  4UFI A;  2D43 A;  1R1A 3;  3JZV A;  1PO2 1;  1N47 A;  2Q1F A;  4N9H A;  1Q8P A;  1FPN 1;  4AHY A;  1LNS A;  5JSR A;  3UET A;  4CDU A;  4XMA A;  2Y8K A;  5EJ1 B;  4WM8 B;  5B4N A;  4CE8 A;  2WQ4 A;  1CAX B;  3A23 A;  1DQ0 A;  1COV 1;  4LHK A;  1HV0 A;  3ACI A;  3SH3 A;  2VOW A;  3PDQ A;  3RZH A;  2Y6K A;  4DMI A;  2GND A;  4LJH A;  1VJ2 A;  1XE8 A;  1PNF A;  4XIL A;  1GP4 A;  5L7O C;  3U0Z A;  1OUS A;  4I0A A;  4Z8B A;  5CKN A;  4IE0 A;  1AX1 A;  2C9K A;  4M0H A;  1AR6 2;  2ZJC A;  2Q1Z B;  3A4U A;  1N1S A;  2B7Y A;  4XMI A;  1CON A;  5LY2 A;  2WS9 3;  3LOB A;  1GP5 A;  1DF0 A;  2WO7 A;  1UN1 A;  2BZD A;  3J8F 1;  2LUW A;  3FZ3 A;  4P9L A;  3N9N A;  4XBQ A;  1LOF A;  4HN1 A;  3FMG A;  2DBI A;  4JHT A;  3THP A;  2QQK A;  4XPV A;  3UK9 A;  4FTE A;  2FDG A;  2C26 A;  1ZZC A;  2WFF 1;  2QZ3 A;  1H8T A;  1SFN A;  4NRM A;  3LPF A;  3GDB A;  1ODN A;  1JYN A;  2A73 B;  1O4T A;  1UL9 A;  2VD7 A;  2XOM A;  3B00 A;  3AYD A;  4NIH A;  4B8E A;  1CVN A;  4OZX A;  5JOY A;  3DUI A;  2PHF A;  4ZY9 A;  3NWK A;  3NKT A;  1RIT A;  2WNV C;  1GU3 A;  3WDX A;  4LBO A;  5FOB B;  4HET A;  3USU A;  1NCR B;  3NRU A;  4OHY A;  5FUI A;  4S2G A;  4UW3 A;  5LA9 A;  2ZHN A;  4Q4V 1;  3AVS A;  2WT1 A;  3PMS A;  2RMU 2;  1TME 2;  2ZGK A;  1PK6 A;  1FAT A;  1FYU A;  2OXB A;  4N43 C;  1QNW A;  3ZX7 A;  5A6Z A;  4RR3 B;  3N9Q A;  5J98 B;  1Q8V A;  2X5I A;  4ONU A;  4LBN A;  5FYB A;  3VHR A;  5JSO A;  3POJ A;  5I93 A;  3WDY A;  3MLK A;  4NJ4 A;  4HL0 A;  3NKG A;  5EXO A;  1VAM A;  3PUQ A;  5L9R A;  3WR0 A;  3BPZ A;  4QPG A;  2RG4 A;  3FLT A;  1GFF 2;  4HKO A;  4IEW A;  2Q5T A;  4KNC A;  5IVB A;  3S7I A;  4GB3 2;  1AL2 3;  3UV9 A;  2W5F A;  2ZEY A;  3VKM A;  1BEV 3;  2BWC A;  4AEJ A;  4FXK B;  4Y22 B;  3ZSE A;  4BPZ A;  4AR2 A;  4CEW A;  5K0U B;  1NCQ A;  3RMY A;  1O7F A;  2N7G A;  4Y22 A;  1FOD 1;  3T2T A;  1YXW A;  4MHR A;  4PDW A;  4D6S A;  1RUF 3;  4C0H A;  1OOP A;  1RUH 2;  3KD4 A;  2OPW A;  3PVE A;  1D4V B;  3PUH A;  3WW4 A;  4Q0P A;  4XQD A;  3ZR5 A;  3DKW A;  2CAU A;  2IC1 A;  4MXW A;  1WLC A;  2HWE 1;  2RDS A;  5I0D A;  3W5N A;  1VPH A;  2YU2 A;  4CDQ C;  1RVF 1;  4IES A;  2X09 A;  5IAT A;  3VL9 A;  4IW3 A;  4QQH A;  3AM2 A;  4L8Q A;  2Y6H A;  4YG3 A;  5FMC A;  5I8T A;  5DUU A;  4R4X A;  1C5I A;  1E5I A;  5FZ6 A;  1LU2 A;  1ST8 A;  3ZSK A;  5M0T A;  1PO1 2;  2V09 A;  4Y1V A;  3EXU A;  3WVJ A;  3WQ1 A;  1HRI 3;  1O4Z A;  5FAX A;  1NG0 A;  2KXL A;  2LM3 A;  1XU2 A;  3U14 A;  3VBF B;  4A7Y A;  5CFD C;  4HVO A;  5DUX A;  2YU1 A;  4YGC A;  4AI3 A;  5DDJ 2;  3N9L A;  1AR7 1;  3INA A;  5C3R A;  3HNB M;  4KU8 A;  3R6S A;  4QU1 A;  5ACA 2;  1A34 A;  1VBD 1;  4NIA A;  4FP3 A;  3ES4 A;  1BVV A;  1JXN A;  2HWC 2;  5D8A A;  3ETP A;  2QDN A;  2UWC A;  3N36 A;  3ZYI B;  1PZ8 A;  2DU1 A;  1JYC A;  4LBK A;  2LTN A;  3B3Q E;  4XIK A;  3H3L A;  4Q5O A;  4AVS A;  2IXJ A;  5FZI A;  5HCH A;  2IZW A;  2RS5 2;  3KV4 A;  3NJY A;  2JDU A;  4RGK A;  1DLL A;  4XUP A;  4BB3 A;  2ID4 A;  2IVJ A;  1YUD A;  2BQP A;  3HQU A;  3O14 A;  2D6K A;  4FP2 A;  2VZ3 A;  4OMC A;  1L3J A;  5FTT C;  4AQS A;  4BXS V;  1BKZ A;  4FPL A;  4CU7 A;  1S4C A;  1H1A A;  2OZJ A;  4JDN A;  3RI9 A;  1JZ4 A;  1MS0 A;  2OA2 A;  1O91 A;  4QPW A;  1WLT A;  1AR6 1;  1VR3 A;  2QQP A;  3PIG A;  5FBJ A;  3H9A A;  2WWS A;  4HBN A;  2ZZQ A;  2BYV E;  4F8A A;  5H9Q A;  2EIG A;  2VQA A;  1AYN 2;  1OQD A;  2FZ1 A;  2HBT A;  2XG3 A;  2YRO A;  3HN3 A;  3AZZ A;  4LO7 A;  5LB6 A;  4B29 A;  1ZBE 2;  2P4E A;  3BTA A;  3OCP A;  4HFS A;  5FYT A;  3LDR A;  4GZ9 A;  3ZLI A;  4BK5 A;  3U10 A;  4YSF A;  2MEV 3;  4LR4 A;  4QX1 A;  4DUW A;  1DCS A;  1UMZ A;  3ZSL A;  4AEM A;  4MET A;  5C5U A;  3VKL A;  3OUH A;  2P37 A;  4XC9 A;  5F5I A;  2FQP A;  3MLJ A;  4LBJ A;  4A6O A;  4RQP C;  4FTB A;  3M3E A;  1GZW A;  2QFE A;  1QJY 2;  4LO6 B;  4XCB A;  3WSO A;  3HPN A;  2R1B A;  1EP0 A;  4K8F A;  2B45 X;  4COZ A;  2RDQ A;  4HAN A;  1KIT A;  1SLT A;  1WUV A;  3E97 A;  3G7D A;  4NRP A;  2PN5 A;  4PIZ A;  4URT A;  2RMU 1;  5GLZ A;  3VN4 A;  3OGV A;  4CA9 A;  5JMC A;  1TME 1;  4BQ5 A;  5FV3 A;  1ND2 C;  4NHX A;  3UGG A;  5IK7 A;  4CCJ A;  1OLM E;  1IS3 A;  3HWJ A;  3M3C A;  1KS4 A;  2XVG A;  3GF6 A;  3CEW A;  5DG1 A;  5FY5 A;  1MZE A;  1W6N A;  4YG6 A;  2WII B;  4AED A;  3ZO0 B;  5JSP A;  4EZ4 A;  1H0B A;  2XUM A;  3O12 A;  1K3I A;  3VBS C;  2ZHM A;  3VBH C;  4I30 A;  2YFZ A;  1C1L A;  5A70 A;  2BOJ A;  4LNV A;  3GCW A;  5T3N A;  1U12 A;  3ZXD A;  4E8C A;  2VU9 A;  1K5M C;  3WLU A;  1CQ9 A;  3T0A A;  3KS7 A;  2XJU A;  5LZ6 A;  2XWB B;  2XLA A;  1PZ7 A;  3GJA A;  5CAD A;  3WW1 A;  3KT4 A;  1S0G A;  4LK6 A;  1R09 2;  5BNN A;  5C8C B;  3ELN A;  1W6M A;  5BNP A;  1JHN A;  4BK4 A;  3FLP A;  2VQU A;  3CQO A;  1RUH 1;  1B35 C;  2RJL A;  4XFA A;  3ZXJ A;  1RUO A;  1XQN A;  4GKX A;  1SPP B;  4XJU A;  1D0H A;  5A1A A;  1XYP A;  5FYS A;  4UW4 A;  3ROU A;  3ZXF A;  2WFP A;  1HIX A;  2BNN A;  5LK7 B;  2AEZ A;  3M7A A;  1RUD 2;  4KG8 A;  3LF7 A;  1OA3 A;  2PLV 2;  5C6C A;  4Y20 B;  5H9P A;  2RM2 2;  1PO1 1;  3WHU A;  2GME A;  1HDK A;  3B9I A;  3RZZ A;  1JYI A;  4NOT A;  3T3Y A;  5AC9 2;  1JH5 A;  4HVR A;  3TEZ A;  1WA6 X;  1AX0 A;  1QJX 3;  3PUI A;  4YGD A;  3ENR A;  2ZGL A;  4PLO A;  4XQW A;  3C7E A;  4YGE A;  2JG8 C;  1K45 A;  2E9Q A;  5FJH A;  2QUO A;  4XAC A;  1W9T A;  3N35 A;  3ZFE B;  2R06 2;  3BU0 A;  2R49 A;  3OG2 A;  5I0R A;  1SZB A;  1DBN A;  4XAB A;  2AUY A;  1GSL A;  2GU9 A;  3N9M A;  4Q2F A;  5T52 A;  4XOG A;  5C4W A;  1EV1 3;  3VGI A;  2Y6F A;  1GWL A;  4J6G A;  3ES1 A;  3NAP B;  3D8C A;  1SG3 A;  4LBQ B;  1U5Y A;  3WDW A;  3DEM A;  1OD5 A;  4M3C A;  3IDE A;  1KDM A;  5C3O A;  2QE3 A;  4I3G A;  4MGK E;  2ZTN A;  5J3U A;  1AL2 2;  4NRO A;  1NYW A;  4XUR A;  2W1U A;  2XLF A;  2RS5 1;  3CDZ B;  4GH4 C;  4XTP A;  1NKG A;  3O0X A;  4ITC A;  5FIX A;  4Q26 A;  4KWJ A;  4IE6 A;  1VBC 3;  4RS5 A;  2GMM A;  3PU8 A;  2GC2 A;  3SHR A;  1ULO A;  1KS5 A;  1UZZ A;  4WM7 C;  1DU3 D;  4LLF A;  1RUF 2;  2JD4 A;  4XJ9 A;  1RUG 3;  4I02 A;  5GLU A;  2OKX A;  3LWC A;  2CWM A;  4RHV 3;  2VMG A;  2D6M A;  2J42 A;  1VP6 A;  1LKN A;  3PME A;  3HEI A;  4PF5 A;  1PGW 1;  3H0O A;  4CU8 A;  4AI1 A;  1ZRC A;  4BOW A;  1PO2 3;  4BE3 A;  4DXS A;  1FPN 3;  2VC9 A;  4N53 B;  3MEP A;  5A80 A;  1C3H A;  2OT7 A;  1C5H A;  1H1I A;  1PM4 A;  1ALY A;  3KT1 A;  4JGZ B;  5FMO S;  3RJR A;  3RYP A;  1AYN 1;  3MI8 A;  4CCD A;  4FPH A;  4EJR A;  2JXA A;  3SIS A;  3VL8 A;  5AFE A;  3AZX A;  1COV 3;  1ZBE 1;  5LCW L;  4PHZ A;  3TYJ A;  2VOT A;  4OCT A;  1HRI 2;  5FPA A;  1QOT A;  3HOB A;  3NNL A;  3A21 A;  1JUH A;  4QXC A;  1CGP A;  1ND3 A;  3O1R A;  2QQU A;  3NJV A;  2DCJ A;  2VY0 A;  4YZ1 A;  4G9S B;  5FO8 B;  1DFQ A;  4K1Y A;  3TOJ A;  4A7Z A;  4QGN A;  1BK0 A;  1SMV A;  2CNA A;  3F95 A;  3KQR A;  3OD4 A;  2XHN A;  1TNF A;  1W6Q A;  1XNK A;  3IDC B;  3J8F 3;  3I2F A;  4XHX A;  4YM1 A;  1VMJ A;  4AGR A;  2IXK A;  4BYY A;  4FTS A;  1XPW A;  1R64 A;  3BGA A;  5ABJ B;  4N43 B;  3M70 A;  2Z4F A;  1OC1 A;  2WFF 3;  1Q43 A;  2R07 2;  3JQW A;  4XFB A;  3CL1 A;  3OBZ A;  3QLQ A;  1CPM A;  5CA6 A;  1MS8 A;  1WW4 A;  4TTG A;  3LGR A;  3MDP A;  4XDQ A;  4ASL A;  1SLA A;  1LJ7 A;  4HKL A;  3VDD B;  3KV6 A;  5C33 A;  1AR9 3;  1YFX A;  2UYB A;  1DGW A;  3DL3 A;  1WKY A;  3ZFF A;  3U1X A;  5JIA A;  1QF3 A;  2JEM A;  2Q4S A;  4IV1 C;  5EWS A;  5JOW A;  2CGP A;  1W3X A;  1O8S A;  3P6B A;  1OI6 A;  3UGH A;  1ENX A;  4KMQ A;  3TN9 2;  2XDV A;  4M3C F;  4E2G A;  4ISR A;  4DO0 A;  4LKE A;  3AP4 A;  1R09 1;  2EVX A;  3IKW A;  1GZ9 A;  4QXH A;  4YYO A;  3AL5 A;  3HVD A;  3QBQ A;  3R4D B;  3W59 A;  3WG3 A;  2RR1 2;  2JDK A;  5KHG A;  4MOA A;  3N7J A;  4Q1P A;  2WYS A;  4OI0 A;  1CES A;  4LOR A;  4LUK A;  4YVW A;  2VR4 A;  5E88 A;  2YV8 A;  1J59 A;  1H9W A;  1EAH 2;  3RWK X;  4LE3 A;  1OVP A;  1JOJ A;  3ZSM A;  1RUD 1;  2O8O A;  3VBR B;  5BUV A;  3BYW A;  4BLI A;  4IEQ A;  5FZ1 A;  2PLV 1;  1BMV 1;  5GZF A;  2RM2 1;  2QQM A;  2K0G A;  4MX3 A;  3ZXG A;  1FOD 3;  3N7M A;  4PJY A;  3MF9 A;  3D0S A;  4L9B A;  4MYE A;  5ANQ A;  3ZMN A;  4DOU A;  5AC9 1;  2KD7 A;  2XB6 C;  2BVB A;  2W94 A;  3HMY A;  3MIG A;  2VNG A;  5GLV A;  1I9R A;  1WZX A;  3KCX A;  5LBF A;  3MIB A;  4LLO A; 
#chains in the Genus database with same CATH homology
 3DCQ A;  2JDY A;  2WRA A;  2JDK A;  2WR9 A;  1OUX A;  2VUD A;  2XR4 A;  5A3O A;  5D2A A;  2JDM A;  1OVS A;  1OUS A;  1OUR A;  2JDN A;  5HCH A;  2BOI A;  2JDU A;  1W8F A;  1OVP A;  1UZV A;  4AOC A;  2JDP A;  2JDH A;  4CE8 A;  1GZT A;  2BP6 A;  5A6Q A;  1OXC A;  2BV4 A;  4UT5 A;  2VNV A;  1UQX A;  5A6Y A;  2VUC A;  5A6Z A;  3ZDV A;  1W8H A;  2CHH A;  2BOJ A;  5A70 A;  5A6X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...