2JDYA

Mutant (g24n) of pseudomonas aeruginosa lectin ii (pa-iil) complexed with methyl-b-d-mannoyranoside
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
114
structure length
114
Chain Sequence
b'ATQGVFTLPANTRFGVTAFANSSNTQTVNVLVNNETAATFSGQSTNNAVIGTQVLNSGSSGKVQVQVSVNGRPSDLVSAQVILTNELNFALVGSEDGTDNDYNDAVVVINWPLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FUCOSE-BINDING LECTIN PA-IIL
publication title Engineering of Pa-Iil Lectin from Pseudomonas Aeruginosa - Unravelling the Role of the Specificity Loop for Sugar Preference.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Lectin
total genus 20
structure length 114
sequence length 114
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07472 PA-IIL Fucose-binding lectin II (PA-IIL)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.400 Mainly Beta Sandwich Jelly Rolls Calcium-mediated lectin 2jdyA00
1OUXA 2BV4A 2JDYA 5HCHA 2WRAA 4CE8A 1OURA 2BP6A 2VUDA 1OVSA 5A3OA 1UZVA 2BOJA 1OUSA 4UT5A 2VUCA 2XR4A 2JDHA 2JDUA 2WR9A 5A6XA 1W8HA 2BOIA 2JDPA 1UQXA 5D2AA 1OXCA 2VNVA 4AOCA 2JDKA 1GZTA 2JDNA 3DCQA 3ZDVA 5A6ZA 1OVPA 2CHHA 5A70A 5A6QA 5A6YA 2JDMA 1W8FA
chains in the Genus database with same CATH superfamily
5LA2A 3UJOA 4CEYA 4JZRA 4CU7A 2FDIA 1VBA3 3UESA 4CE8A 1BYHA 2PHDA 3A0KA 3T1MA 4J1XA 1H8TB 1GNYA 1PO22 1BEV3 2ATFA 5D1IA 1LOBA 1DLCA 3QBQA 3VZOA 2DWRA 2W08A 5F5AA 5E1RA 2A70A 1GR3A 2DVBA 4LBMA 5FZHA 1RUC1 3VBSC 2HWD3 4IGPA 1PX3A 2E6VA 1D4M1 5T52A 3B94A 5CISA 4XJAA 3BU7A 3TN91 3ZMNA 1TE1B 3DPRB 1W3XA 1I1EA 1NCQC 3AZYA 1GYKA 1B35C 4P9JA 4V2WA 3THPA 2JXAA 2XQXA 3TBDA 2GALA 1YQ8A 3HOBA 4FPKA 2AR6A 1N47A 1X8MA 1G9FA 1QY4A 5A32A 5HPOA 2VBPA 4EN6B 2VMFA 3D3AA 4IV1C 2OQ7A 4JRLA 1AR71 5FAXA 2FDHA 1SBDA 4QD2A 1IS4A 3FUQA 4QPGB 2R0HA 1UY3A 5C8CC 3C8XA 3LOIA 2VW2A 5GZGA 1ZZ7A 5F6KA 1O4YA 1PMJX 2ET1A 2R30A 4PDWB 4XFFA 3OYWA 4M3CB 5CFCC 4IDZA 3I3BA 3KT4A 4B3NA 3WQ1A 1VMFA 1Q8PA 4JHTA 1E5HA 3WSOA 1O5UA 3MV01 1UYZA 2WJSA 3AM2A 2WQZC 2FDFA 1RVF3 3WP3A 2EAKA 1SLBA 4RS5B 4E9KA 3GDBA 2BU9A 4FTSA 2DYCA 4MGTA 4FSJA 3KCYA 1DDLA 1UIJA 1ND3C 2JDZA 3IBMA 5DAWA 4AEMA 5J3UA 1XJAA 2ZBJA 1OLRA 3RWNA 3A4UA 1PGW2 2BZDA 4WM8A 5T5LA 3WV6A 2O8QA 2BPA2 2OIIA 2WN2A 1W0OA 1XOYA 3AYAA 5DUWA 1QXRA 1KDMA 1XB9A 4LPLA 4TLGA 5SV5A 4GAZA 4GULA 1S4CA 1JUHA 1C8NA 4LTAA 1BVVA 1PO12 1AXYA 1DFQA 3M1HA 4PLOA 1POV0 2ZS6B 1GOGA 5I8SA 4OHVA 1S1AA 5GLZA 3THTA 5C70A 1GP6A 1IG0A 1PK6A 3PIGA 4Q4W3 2NMNA 1PM7A 4S2DA 4XW3A 3RI9A 3VBHB 4DUVA 4JCKA 1EPZA 3M3IA 2VJXA 3BOWA 3WQBA 1R082 1IS3A 5I8TA 2QKDA 4AI1A 5JLVA 5T55A 4ZXEA 4CVUA 4HZFA 1EV13 2W92A 3K3OA 3EJKA 1FMD2 1H1AA 4NVPA 2BTVC 2PLV3 4LHKA 1J3RA 1WUVA 4INDA 2OPWA 1RGSA 4RQPA 1H8TC 4CTEA 2R043 2HWE2 2ZKNA 4JGYA 1RUJ3 5JXIA 1J3PA 4DINB 1H9PA 2A75A 2RS13 3ZFEB 4XMIA 4BWOA 3C7GA 3ZSMA 1ULCA 4ATEA 2ZX1A 5F7UA 1O8SA 4IE4A 5GLVA 5KXBA 1AYM3 2JD9A 4HFSA 1LESA 4RGKA 5FUIA 2X09A 2VZRA 3CZJA 5GZEA 3AJZA 3DPRC 4GH4A 4XUTA 1LECA 1MS5A 4A41A 2DTYA 1PVC2 4MXWB 2ZTNA 4FTEA 1OD5A 4UAPA 1PGW1 1GOFA 4AQ6A 4ZXKA 3ABZA 3ZXKA 1YEWA 1HB4A 2HKXA 2V5YA 5C3OA 3U10A 3WF4A 2Y60A 4CDXA 1VAMA 5DABA 2X5IB 3ZN6A 3NJXA 1XYNA 1C3HA 2VXRA 4QPGC 2UWAA 1AF9A 3JZVA 1NT0A 4XF0A 5BYNA 5D8AB 5EYXA 2VTFA 3ALQA 3BN6A 4E8CA 5HV4A 2QQVA 4PDWC 1AYN2 1O3RA 5FFOC 2N7GA 5FZ1A 2R072 3GM8A 1U5YA 2K46A 3J9SA 4CCCA 5CFDB 1LHOA 2L9LA 2R1DA 4KWJA 3H8RA 1EPWA 1BLZA 1NXMA 3ILFA 1T2XA 4NHMA 5FZ4A 4YM1A 1N3OA 3GGLA 4RS5C 1XBFA 4ARYA 1J84A 2JG9B 3AFGA 5LY1A 1FMD1 5FP9A 1OPOA 4LBNA 1WLWA 1LULA 2RR12 4Y22B 1CAUB 3IIIA 3FJSA 1RITA 2O8OA 5ABJA 2PHXA 1UWWA 1LGBA 3AX4A 1VLNA 3IPVA 1N3QA 2HWE1 4E4DX 1DQ6A 2VO5A 2ZACA 2XHKA 4QKNA 3CLPA 4HLTA 1HQNA 1Y3TA 4H7LA 2CAVA 3DN7A 3IN9A 1W06A 5FZOB 1UU4A 4YM3A 1TG7A 2W87A 2VQUA 1U5ZA 4B1LA 1W2AX 4I09A 2HEVF 1UL9A 3HAGA 5K0UA 3OGRA 2WLQA 2PMWB 4AVBA 4AEDB 3VHOA 3VBHC 4QDRA 3DF0A 1VE0A 2WO2A 2D6NA 2G4IA 3N9QA 4TXWA 4Q4V3 1ZRDA 1B09A 2D6MA 5GLWA 1PVC1 1O4ZA 1E5IA 4MOAA 4N53A 3VDCA 3E5UA 4XBNA 3A22A 1UX7A 3ORJA 4DXTA 5FZIA 4JQTA 1DBNA 2ENRA 3EBRA 3T4HB 3MICA 3R0RA 2Z42A 1VB2A 5DG1A 2ADDA 4LOSA 3POJA 1W2UA 4TWTA 2V4VA 3SLIA 5FCCA 2MNGA 2KR2A 1O6UA 3KV6A 1GANA 1ULPA 3AKQA 4WVWA 2G19A 1CX4A 1OLME 4GB31 4XFGA 4XIOA 4AAPA 4CEWB 4EYUA 3U0ZA 1VAKA 1H1IA 3PIJA 3O12A 2Q8DA 1VBC3 1AYN1 3ZSKA 3MUZ1 2VZ1A 2R071 4P9GA 2JB8A 5JOYA 1WMXA 3ZFEC 2GMMA 1COV3 2ZGOA 3DXTA 2IXIA 3GJAA 4NOTA 5FZEA 4UF0A 1RUE2 3LEIA 4NRPA 1MR5A 2CGPA 3OTFA 2DDUA 2OA2A 2WNUB 3MIDA 4LIUA 4XUPA 3ZDSA 4EZHA 5FXXA 2A7AA 4R52A 1N1VA 1VRH3 1LOFC 1GICA 2RR11 1MQTA 3KLSA 1IKPA 3GBFA 3EYPA 3POSA 1I3HA 4RA0A 1AL22 4XJUA 2BOIA 3UETA 4BM8A 2QQIA 1UN1A 5FZBA 3UNPA 1NX9A 3SCFA 1JOBA 1RINA 1YRZA 2W91A 5FYMA 3VZMA 4CP2A 2QQOA 3C3VA 3O1VA 5T5OA 1NA1A 1PNFA 2X5IC 3SMHA 4Y4RA 5FZ3A 3ME2A 2G1MA 3ZYRA 4LKFA 5FYSA 4FXKB 3VKFC 2I74A 1IPKA 1G7YA 5D8AC 3ZKYA 5EIYB 3ZXDA 1W9TA 1OURA 3OPZA 2DUOA 2RMU2 4GWIA 1C8M3 5KC6A 2NM1A 3ZOIA 5CFDC 4MGZE 1RYYA 4Y20B 5AVAA 4MYEA 1QQP2 2XVGA 3USUA 2B9UA 1W0PA 2R16A 1YC61 4FPLA 2JG9C 1TNRA 2VZVA 1J83A 1GZTA 3M4FA 4BQ3A 2NYYA 3VBSA 4YARA 2ERFA 3JB8A 2BYVE 1WMEA 1C4RA 1DF0A 1VAVA 1PMIA 4DQAA 1TNFA 4Z1VA 1NCQA 4L8QA 1ZBE2 1B35A 1VBD2 2VECA 3OYWB 5FOBB 5JCTA 3B9IA 4ASMB 2XGXA 2YV8A 3M70A 4AZZA 4P08A 1HB3A 3WNPA 1AR61 4JDOA 1RUE1 2H6CA 1WWYA 5LBEA 3UV9A 3ZM8A 5CEHA 5GJ6A 3MW2A 3POBA 1NY72 4IV1A 3SC7X 1SLCA 4AEDC 4OVEA 1NUKA 5LASA 1VJ2A 1DQ1A 3AKRA 2ZMLA 3RI8A 3VKLA 5A6ZA 5C8CA 4M0NA 5A70A 4HT1T 5FKBA 5KBFA 3H50A 1ASJ3 4PF1A 5DZEA 1AL21 4AXOA 2X8KA 1TME3 1JZ3A 2EAAA 2OPKA 5CFCA 1MZEA 3H3UA 4DPNA 3AP4A 3BUCA 5IHRA 1PVXA 4CDUB 4R8HA 1HXS2 1IG3A 1C1LA 3RMYA 3VHRA 3AZXA 1HJGA 5EP9A 1XU2A 3RZMA 1ULFA 1XNAA 5K9YA 5FR3A 4H14A 4CEWC 3H1YA 1ND3A 1PK6B 3MYXA 5IATA 1MPXA 2ZGKA 1SDWA 3AXEA 4IQPA 2RMU1 2A6ZA 2VXJA 4AYUA 3U14A 1AZDA 4PCRA 4RFT0 4A7YA 4EJRA 4NJ4A 4CP9A 2A6XA 5I91A 1QKQA 1QQP1 1U12A 3FHIB 4K8FA 2WNUC 1OUXA 2C6SA 5DXDA 4ZS3A 3UKVA 3WF1A 5F39A 1JOJA 4Q2FA 5JOZA 5LEJA 3MHZA 3H1WA 1MEC2 2ZGPA 3NMBA 4AI3A 1WW7A 5ANNA 3LFIA 3UYJA 2A3YA 2D40A 2UURA 4H55A 4K7JA 3U4SA 1OLMA 2FZ1A 3JQXA 3TEWA 2QZ3A 2DUPA 4F8AA 4RL7A 4RFRB 1JYTA 1HV1A 1W6NA 3D0JA 4NIGA 1VBD1 3SKJE 3BU0A 2JJ6A 4AK3A 5DDJ2 3WOGA 3C7EA 4A6SA 3LE0A 2I07B 1OT5A 5JIUA 2PAKA 5GZDA 2O1QA 3M2MA 3SKVA 4HONA 4YVWB 3WX5A 2DU1A 1EAH2 2C9AA 3WF3A 1NY71 2D6OX 4R9DA 4I0BA 2R7EB 3CBNA 2QJVA 3JD73 5IFTA 3WVJA 2B8MA 2W0XA 2G9GA 1O59A 3ZYFA 3VDAA 1H8TA 4L9BA 3WG3A 4XF3A 3TNQA 3K3NA 5FY4A 2WSVA 2XLAA 4CA9A 1OD3A 5JVVA 2C9KA 4LA3A 4CXWA 1HQLA 4HKLA 4GIQA 1HQWA 3T08A 4CDXB 3HVDA 1HXS1 3BOPA 2BWAA 3DGTA 4YGEA 1VRBA 5A7NA 3N3HA 3N9NA 5H9PA 5IAVA 4FPFA 1FNZA 1SLIA 1S0DA 2ZOEB 3DPRA 3ZDVA 2BRTA 5GZFA 3LZZA 3U75A 4DRRA 1CZTA 1XNBA 2WFF3 2Z5WA 2P1BA 1W04A 2VQTA 2BFUS 1GWMA 2JDMA 3LAGA 3J8F1 2RJ2A 1GZWB 3K2OA 1S2KA 5FPUA 3N4MA 3HT1A 4F83A 4Z2WA 4I2OA 1ODMA 3WW2A 4COZA 5C33A 1H2MA 1OBNA 3AYCA 5CG9A 2VZUA 2WUHA 3K77A 1RUH2 2ZHKA 3ASIA 5FWEA 1C5HA 1MEC1 1YO8A 2W1UA 4QPGA 4A3ZA 1QJY3 3VD3A 1AR81 4QKBA 4ZU7A 3VZKA 3OB8A 1F9KA 3LDBA 1AR91 4META 1ACCA 4GQ7A 4PDWA 4QU2A 4BISA 4FPCA 4X8PA 5FXWA 2BJSA 4M3CA 3U37A 4Z2AA 2VMDA 3ETPA 4D7YA 2XKOA 3JBG1 4CDUC 3CU7A 4K9SA 4QHBA 5DDJ1 5IK7A 4HPKA 2ADEA 4K20A 2ZGRA 1HB1A 5FZGA 2HWB2 5FMBA 5C7GA 1DQ5A 1OA2A 4AHWA 2RE9A 5K0UB 3Q8EA 2AENA 3KV9A 1PK6C 4AR2A 2G9FA 3WP6A 1OVSA 3C2UA 1R091 3ST7A 3I3DA 2IVIB 5HV0A 1KDKA 4IEQA 1HX6A 3I59A 3IIAA 4XF9A 2RS52 4CCOA 3PMEA 1Q3EA 4QX3A 4JTOA 1V6KA 4C1WA 3BI3A 4NPRA 5A7OA 1REDA 1UOFA 2XJSA 5FYVA 4AVSA 1QHDA 5DZGA 2WYFA 4DB5A 4FBFA 4QT6A 4XXAA 1QOOA 3GZAA 3J4UH 4TTGA 3O1OA 4YSFA 1UOBA 2R6QA 1HRV3 3E6CC 2OXBA 2AZ5A 3VBHA 4Q4X2 5A3MA 2YZ4A 1H4HA 1H6YA 2NPIA 4MHRA 1UKGA 2C5DA 5FZ7A 4CU6A 1HRI2 3FBYA 2ZEZA 2VL4A 3UKNA 4IE5A 3AK0A 4I3PA 4QM8A 1XE8A 1H0BA 2W1QA 4YVWC 4DO0A 2ZGTA 2Y64A 5E6HA 5L73A 4EWAA 1VP6A 4CYDA 4S2GA 4AEKA 1LOAA 1KD7A 2K9ZA 5F5CA 3VZNA 3WHUA 4A6OA 3M3CA 4LNVA 1YIFA 2JDKA 1RUI3 3FFQA 1LCLA 1SLAA 3GXUA 4GKYA 3TYJA 4BCUA 4JKLA 3T0DA 5T50A 1W6QB 1H2NA 2ZZQA 2HWD2 1QDCA 3ZFEA 3RZZA 2YFUA 1KS5A 2AYHA 4CDXC 4ZKTB 1RTVA 4YW2A 1AJOA 1CONA 2B42B 5FQ0A 1RUD3 4LHLA 2HWB1 3THDA 4W65A 1LOFA 1UZ0A 3RFRA 4Q1PA 3MZHA 1OQDA 5A1LA 5FUPA 1WMFA 4MXWA 3TB0A 1JODA 3B69A 1OF4A 2VOVA 2IUWA 4OYUA 4O61A 2JDNA 3PUQA 2WZPP 5J7MA 1SCRA 2W9XA 1Q8OA 2LTNA 3OPWA 1TQ5A 3ZMOA 2VBBA 1HJFA 2XMLA 4JAAA 5AVPA 4I02A 1GNHA 2CAUA 2DU0A 4OFGA 4OI1A 3S5QA 5I0UA 2X5IA 5FP4A 5LY2A 4ASLA 2Q0AA 2QQKA 2YGMA 2XVKA 2H0BA 5D8AA 1KJRA 3E5XA 3OGSA 2E51A 4KWLA 2RS31 3CQOA 2IVJA 2UWBA 4Q4X1 5FLJA 4K1YA 1GKBA 3HNBM 2ETEA 3POYA 2A6VA 1HRI1 5CFDA 4FPHA 5FY9A 2WR9A 3NRUA 4XXPA 2EALA 1F4HA 5EJ1B 1KFXL 1N1SA 5BY5A 2JG9A 5FZDA 2CHHA 5K0UC 2PAMA 1JZ5A 4L99A 4P9IA 1OH4A 4Y22A 1BEV1 3PJYA 3FWEA 2XPJA 1CAUA 1M06G 2F4LA 2DFBA 4PBPA 1ND2B 3WCRA 2SBAA 5FZAA 3AP7A 2VC9A 5FZ9A 2B5HA 5A1AA 1ULGA 2ARAA 4YW7A 3R6SA 2HWD1 3I7DA 2ZEWA 4CCKA 4KU7A 2XJRA 4Q4Y2 3AP5A 5FZOA 3BTXA 1WLCA 4XFCA 3UJQA 4Q4W2 2FCTA 5FXVA 3L2HA 4COYA 5IVFA 2VCBA 3MIFA 1QOSA 1OMIA 5LW9A 3DYOA 1AUYA 1RUNA 1H30A 4L11A 2VMEA 4DUXA 3Q8BA 4HANA 3BYWA 1EV12 1REEA 1W99A 5LA0A 1TMF3 5E8AA 2RVAA 4G4FA 1S2EA 4XYXA 4BHPA 2ZGSA 5FWJA 1BKZA 3N36A 1BBT3 4QAWA 5FXZA 5A7QA 2Q4SA 1X36A 1W8NA 5HXVA 2PHLA 5JAXA 1XNCA 4Q5OA 3I49A 4LT5A 4QXKA 3MLLA 1QJEA 3SH3A 2WLPA 3A0NA 2CU5A 1W6PB 4XBLA 4HSJA 4CEWA 3ZN5A 5HI0A 1QJX3 1W8OA 4I0AA 4CUCA 4G3YC 2RM23 1UD1A 1OFSA 2D98A 4XQDA 1AYM2 4TZDA 1SLLA 1SEFA 2OW4A 1JN2P 3OEBA 5CB7A 1W28A 2C24A 4FFHA 1QIQA 5DG2A 1DGLA 2R32A 3TEZA 1MS3A 4MSVA 5D21A 1FOD2 1UO9A 3D5OA 2SLIA 1K12A 1OKQA 1WCDJ 1D2SA 1W8UA 2BV4A 2P3JA 3N9PA 5F2SA 2RDSA 1Z78A 4L0PA 1Z7S2 3J7NA 5FO8B 3MFCA 4DS0A 4UWDA 4BIFA 5JOWA 4CU8A 1KQRA 2IXKA 4V2VA 4XVHA 5H9QA 3G7DA 2BNOA 3LF7A 2X10A 1K42A 3P3NA 5T5JA 2DCZA 1K45A 1FX5A 2PYTA 2XQRA 5IVCA 4XCAA 3FZ3A 3VGIA 3DL3A 4AG4A 2GNBA 2HBTA 1IQDC 1UQXA 4ET7A 4Q4Y1 3ZSLA 1JOPA 1LOGA 5AC91 4Q4W1 3RDIA 2D97A 4CUAA 4ATFA 4XZUG 5C3RA 4BOWA 2DV9A 2WQ4A 3IMNA 4ES9A 4UYBA 2ARXA 3U1XA 4NRQA 4AHYA 1EV11 4AFAA 3B93A 3AMNA 2X05A 4YZ3A 4H2AA 4ARXA 4Y20A 1S0GA 3WDWA 3T3YA 2GH8A 2A6YA 2PLV1 4CCEA 1NE6A 3N7KA 4N43B 4BU2A 4WVZA 1YNAA 1Q8SA 4XBQA 2WS93 4BB3A 2FD8A 1A34A 3IDBB 2AC1A 4BH9A 3EB7A 1ND2C 1DYKA 1RUJ1 3WNMA 4QXBA 3WQ7A 2VZ3A 2ZGUA 3UKTA 3VB9A 2RS11 2GNMA 2YY1A 4YGBA 3U4XA 4M4PA 3SISA 3MI8A 2W94A 2GC1A 2QQPA 1AYM1 1W05A 2ZZJA 1BCXA 3KHBA 3RYPA 2VQAA 3V0AB 4HPKB 2VR4A 1KXGA 4ASKA 1BK0A 3V0BB 1GBGA 2QDNA 1FOD1 4GMP0 2Y6FA 1EYBA 1VBE3 2MEV2 2JIJA 2WZR3 1XRUA 4HL0A 4AQ2A 1JYNA 1Z7S1 3VDDB 5FV3A 3MIEA 5IYYA 4P00B 1V0AA 3NNMA 2UYBA 1PIV3 1ZVFA 2EIEA 4AGGA 2E7QA 1O7FA 2EXJA 2JENA 3M3EA 3I59B 1CZVA 3IB3A 4HETA 2XBO3 4LR4A 1UKRA 4XETA 3VHNA 2EVXA 3MLKA 5LBFA 1M4WA 2DCTA 1MS1A 5LRSA 3ACGA 4CDUA 3BPSA 3BVCA 3GBWA 4H7MA 4XDPA 1VBB2 1RMU3 3HBZA 2G9ZA 3OGVA 1VPHA 1S0CA 2XJPA 1JYVA 4H3WA 1ZRRA 3LCPA 3HT2A 1COV2 2BP6A 4NPLA 4BQ2A 3D6EA 1XSRA 2VW1A 1D0HA 2RDQA 4NWVA 2ILMA 4BLJA 2E53A 4BXFA 1NXD1 5DAPA 4S2FA 1ODNA 1YFWA 3AVSA 5DUUA 4R4XA 5L19A 3E1F1 4GJYA 4IEWA 4AI0A 1YQ6A 3LDRA 3UGHA 1PZ8A 3OUHA 1Y9MA 1O3TA 2EXKA 1KITA 3R4SA 5KXDA 3FFZA 1MZ5A 4RGAA 4LQRA 1S0FA 2ZX0A 1ZBA2 4XMAA 3WW3A 5I93A 4MH0E 3G6JB 3GZEA 1LGNA 1LNSA 2VVFA 1W39A 4IETA 4Y5Z0 1NOVA 1WCSA 1OH3A 4PI0A 4IEUA 4NE9A 4FPEA 5LWBA 4ZHNA 3ZFGB 1YQ5A 4YVWA 1S0EA 2IZWA 3VBUB 3BB6A 1J3QA 3KT1A 1BJQA 2O14A 4IGQA 4Q4V1 5FQ0B 1ZRCA 1N1YA 1WBFA 2VBDA 4PF5A 1FPN3 5EPAA 2ARCA 2MEV1 5FLHA 4DRVA 3O1TA 4BPZA 3HPNA 4FI9A 3VL8A 1V6IA 3EMRA 4AGVA 5DAVA 2XHNA 3U07A 3TRSB 1V6OA 2YBPA 4Y1XA 1ONAA 1ULDA 1YQ2A 2CY6A 4N43C 5FY8A 1F2NA 4OUMA 2GC3A 3MW4A 1PHMA 5FY5A 1HV0A 1VBB1 4LE3A 2LRPA 2XJUA 2VOWA 3USSA 2OZJA 4GB32 5IK8A 5J1XA 1COV1 1E57A 4QGMA 2WWUA 2JKBA 3LB9A 4Y1YA 4EV0A 3MW3A 5F3IA 4Z92B 4XZPA 2FZ2A 1R1ZA 2FCUA 3WNXA 1JYWA 5CZKA 4A7ZA 1GZWA 5CVRA 1A8MA 2J22A 3WDUA 1HKDA 2VQ0A 4CCNA 2JIGA 2D93A 4EN0A 4B7EA 3ROUA 1XQNA 4R9AA 1PO23 1ZZ6A 3WF0A 4LO8A 4N90A 2DTWA 3AP9A 3P1IA 5IVYA 5I0RA 2F4PA 3H7JA 2A5ZA 4CXYA 1OF3A 3VDDC 2Z2SB 2YPDA 3PJQA 2WDBA 4LA2A 4Y4YA 4DUWA 2AEYA 2LM3A 2RHPA 1GU3A 1ST8A 2NZ9A 2BBVA 2A1XA 2VD7A 3M3OA 3R4UA 4Y33A 1CZSA 1G9BA 1ZBA1 2F17A 1RHI3 1K5MB 3QCWA 2TUNA 5JZGA 1CJDA 4YRDA 3VZJA 3NQHA 3AYDA 2WWSA 3PDQA 2WO7A 3PVOA 3S6PA 2TNFA 4KG0A 4BK5A 3HNYM 4RD7A 2GZWA 3M8LA 2JECA 3SEEA 1YFXA 5A6YA 3O0WA 1LU1A 1A6CA 2D7FA 5G05L 2ARBA 3I2HA 1LAJA 3HBKA 2DVDA 2VNGA 3TWIA 3R05A 4AQTA 1LHWA 2VUAA 4BZ4A 4Q8KA 4D6SA 4CPBD 5IK5A 4XF1A 4XUOA 2ZGNA 5A3OA 5L36A 1UCXA 3NO8A 4QPWA 4JGZA 1C5IA 1G86A 2JB4A 5CADA 4B29A 3RYKA 4Y5SA 4IE6A 2EF6A 2E26A 1RJ8A 1QU0A 2B9VA 1Y4WA 2DVGA 1WD4A 1J1TA 2PHFA 5B2GB 1UOGA 1W9FA 1QJU2 2BW8A 1AJKA 1QXPA 1F15A 1UU6A 2AACA 1OKOA 3DCQA 4IUGA 1F4AA 4XJZA 4OI0A 3OEAA 4FVVA 5CBLA 4QQOA 2BVVA 2J1RA 3ZXLA 1V6LA 4C90A 3MEPA 4J1WA 4NRMA 1AR62 1DZRA 2FCVA 5FZ8A 3ZFGC 2YMZA 5K7PA 2F6BA 4EWDA 3IMMA 4B4RA 3VBUC 1CAWB 2QQUA 4K1ZA 5C4WB 2EXIA 2Y6JA 1QMJA 4IL7A 2AREA 4FP2A 3AKSA 4NAOA 2KA3A 1QXJA 1TME1 2VNRA 3EHKA 1H2KA 1H6XA 4FT8A 4JTNA 5E16A 3BKZA 5C3PA 2GMPA 1SBFA 2V72A 2H6BA 5FYBA 3SCGA 1W6QA 1SG3A 2RG4A 5F8PA 1DZTA 1RUG2 1BMV2 1PO13 2ZAAA 2XWBB 1YLLA 1CESA 1P8JA 3N35A 3IDEA 4Y1VA 1W8TA 3AZVA 2AGSA 3BGAA 1A8DA 2MPFA 2P6CA 4YW3A 1R083 5FZKA 3QD6A 2QCSB 3ECQA 3ZN4A 3DYMA 1SZBA 4MGQA 3E97A 3MDPA 3PL0A 4YZ4A 4Y5TA 5KHKA 1OFNA 1AX2A 4AI2A 1RUF2 3CF6E 4XFIA 5IWFA 2JDUA 2Y0IA 1WCKA 2A3XA 2XVLA 3TNPB 3ZO0B 4YFZA 3GALA 4E8DA 4PJYA 4LO5B 4URAA 1OXCA 2HWE3 3MIBA 4D6RA 4W50A 1YI7A 2QUOA 4LJHA 5C71A 3WDXA 5M0TA 1GQHA 4A44A 4XUNA 4LOTA 2HWF3 2LALA 3TEXA 1UZWA 2KXLA 4E2QA 1H2LA 4CCDA 1DZQA 1QJU1 4XPVA 1F8VA 5JSRA 4DEVA 1XE0A 1CAVB 5JI7A 4F3JA 3H3LA 4UW5A 4NIHA 3FUOA 4YNIA 1K5MC 4UI9L 4M3CE 1MS8A 3H8OA 1MS0A 4NAMA 3C7HA 4E2GA 5C3QA 4J25A 4BQWA 3RZLA 3DECA 1O91A 2PQQA 1PVC3 5F2WA 1CAXB 3E6DA 3IAQA 1RB8G 5J09A 1R64A 4AVAA 3ZPOA 1LU2A 3VN4A 2ZEXA 4Q0QA 1CGPA 3J7LA 5LK5A 3WR0A 4D3WA 4LITA 2ZMNA 4DY5A 4AVTA 4ES8A 1ND2A 3KF5A 3NVCA 1DGRA 3WNKA 2FHRA 3KT7A 4LO4B 1OA4A 2CWMA 2DCJA 5F37A 1US2A 1G9AA 3KV5A 1RUG1 3DKWA 3T1LA 1BMV1 5FYUA 2B45X 3ZFFB 1SBEA 1A3KA 2CDOA 2VH9A 3AMQA 4XFHA 2XL7A 1G6NA 1HRV2 2YFZA 3MIHA 3H8UA 2FMYA 3PTYA 4JV4A 5DUVA 2XB6C 3W20A 4B4QA 5A7WB 2WFF1 1ULOA 4J6GA 2VE1A 5FTTC 5ERLA 4RSUA 4XEZA 3KD4A 4MLOA 4P5HA 3ACHA 2VY0A 4GALA 4GXLA 1TVGA 1CIWA 3KVBA 3KZ4C 4DIQA 3LD8A 3J8F2 4MG2A 2EA7A 1UMZA 3AP6A 1QGLA 4A42A 2QQLA 5C5UA 4BLIA 1RUF1 5F3GA 3IDAA 5DUXA 2VMCA 1FV3A 1UMIA 3I2JA 4HN1A 5C4WC 2O0OA 4YZ1A 3VHPA 3WW1A 3CL1A 4MGKE 1U5XA 4LBQB 3O1UA 4LK6A 1JU4A 5FZ0A 3WW4A 5LZ6A 1LHNA 4AFBA 2P4EA 1AR82 3ES4A 4IGOA 3OBZA 5GLUA 1W6PA 1AR92 2XDVA 2R1BA 1IOAA 2RV9A 3AL6A 3VV1A 4E4HA 4UW6A 2VGDA 3VKNA 4UFKA 2WWJA 2Z69A 3KS7A 3JBG2 4XFAA 2JDPA 4KL1A 2VM9A 1VB4A 2BUKA 5F6LB 3H0OA 3POEA 5FZFA 5I0TA 3SH4A 4AOCA 4ZZ8A 1WW6A 3SCHA 1CVNA 4XILA 3HD8B 3RG0A 2BWCA 4AFMA 1NE4A 4LMFA 2D6PA 3PUHA 2XJQA 3POWA 4FAHA 1R092 4BMEA 5JI9A 2D5FA 1V6MA 1FAYA 2OZ6A 1GLHA 1YHFA 2HJIA 2R0FA 1V9U2 3I4IA 4HKWA 5LK7B 2CSGA 4XABA 4XCBA 2WQ8A 1NZIA 3WG1A 2VVEA 3PVEA 2DURA 2P6HA 4WZCA 4NWWA 4JVAA 5ACA2 2GN3A 4YWAA 1HRV1 3NKGA 4FFGA 1BHGA 4PT6A 4QX5A 2Q8OA 2X29A 5A3NA 2RDNA 1W90A 4F7ZA 3ACFA 4IEYA 2VMGA 4CDWA 2VULA 2A6WA 2OUHA 4K21A 5A3UA 1RUE3 3K51A 2BGCA 4NHKA 4KH9A 5KHIA 4PLMA 3PVBB 1W8WA 2ORXA 3OF1A 4BJ0A 1L7LA 1UY4A 1ZZ8A 3GZUC 3ILNA 4XURA 4YVSA 3VBFA 3VKMA 4AW7A 4LBQD 2KM2A 3PUAA 1GWKA 1DQ4A 1POV1 4LUKA 4N43A 3MIGA 3FE5A 4A45A 5LCWL 1R1A2 4Y24A 1AL23 2NN8A 4O7XA 4QQ2A 5BNPB 1RUI1 3KGLA 3RZKA 4KQ7A 5CU1A 4COVA 3WXPA 5A3LA 2D5HA 2QQWA 3NV1A 1D4VB 2ZABA 4GZ9A 1IKQA 4MADA 4XAEA 1ZZ9A 4KBZA 4BQ4A 3HNMA 4JKMA 1H4GA 3ZXJA 1WA4A 4WBBA 2Q1ZB 4YG6A 3ZFFC 3B00A 5JZGB 1RUD1 2BNNA 3VD5A 2X53S 3VDBA 4CP0A 2HBUA 3V0AA 2RMU3 3FHAA 3V0BA 4O9GA 4MHUA 4A2UA 3LPFA 5HBAA 1NG0A 4K8RB 2Y33A 4HBNA 2LS6A 4IW3A 2E32A 3O1SA 1XYOA 5A7PA 3LQCA 2ZEYA 4IEOA 1UW8A 3CDZB 3VDDA 1UZVA 1UNBA 4EN9B 1FXZA 4QB1A 3BTYA 4QX0A 1QJFA 1PZ9A 2GU9A 3INAA 4MVTA 4Q1RA 1XE7A 3WD5A 1V9U1 4YZ5A 3B3QE 5FP8A 1NLRA 4EROA 2WZ8A 2GNTA 1DIWA 1L7RA 4R9CA 3AMHA 2WAOA 4QM9A 5FY0A 3L2YA 4GWMA 4JGZB 3EXUA 4DXRA 1MS4A 2B39A 2VMIA 4QPYA 1UIKA 4GMP3 2NLRA 1UPIA 5ACA1 1ZBE3 3AJYA 1VIWB 4U36A 3WDTA 5L9RA 2TEPA 4DNYA 2AUYA 2WA4A 2RS32 3KCCA 5KHHA 3RWKX 4YGCA 1VALA 4IXLA 2ZGMA 3T2PA 3NW4A 1AVBA 2XJVA 1JUIA 3HIFA 3LEGA 4C91A 1IQAA 1JYCA 3ZSEA 4COUA 3BPZA 3SEPA 1EY2A 4WM7A 3GF6A 1E5SA 1APNA 3UGGA 1PZ7A 1QDOA 2HYXA 5A33B 1O3SA 1YUDA 4XE9A 1VBA2 1OOPB 4WZFA 1FV2A 5CA6A 1W2OA 2VAUA 3JCIA 4N9IA 3IDCB 5A6XA 5IFPA 1R1A1 3O1PA 3LEMA 1BEV2 3LDKA 5FZCA 2ZAHA 3WNOA 4YW5A 2HLEA 3I3QA 4TYSA 1ENQA 2UY9A 1HXS3 5FUNA 3ZXEA 5KHGA 1AL0G 4OHYA 1PGSA 2BDRA 3ITQA 3ZXAC 3GHMA 4DZGA 4Q8LA 4Y1ZA 1W6OB 4IEZA 4FO9A 4I30A 3ZYGA 1GWLA 1W8ZA 3V64A 1C28A 4LO6B 3SHRA 3BCWA 1DYOA 2VUDA 3NNFA 4ZPIA 3ZFGA 1QNWA 4AVCA 2W5FA 2ZXQA 4S2HA 3HQXA 2GC0A 3VBUA 1GOHA 2NP0A 4XJ8A 4OMDA 3W9AA 4ITCA 1TMF1 3N9MA 4PQ9A 1S0BA 2VCMA 3BIWE 2IXJA 2IXLA 1CJPA 2BVBA 5LRRA 3VUOA 3GCWA 1FT9A 2R063 1BBT1 1O5LA 1EUTA 4JC1A 5AFBA 1MEC3 3Q9OA 2WS92 3CJIB 4X6RB 4UW4A 2DVFA 1DU3D 1OA3A 2C1FA 4P02B 2JG8B 1JI6A 5EXOA 5BNNB 4CCJA 5A3WA 4OHZA 5HCBA 4CPBA 5FIXA 2P3IA 3NNGA 3ENRA 4OI4A 5BNPC 5JXGA 4AEJA 4YM2A 2BNMA 3H7YA 2R49A 1W03A 3ACIA 4PHZA 5EJ3A 1QJX1 2WRAA 4U2AA 2RM21 1S2BA 4M0HA 3D82A 3UGFA 5CG8A 5DDJ3 1MS9A 5A7SA 4IERA 3VZLA 4EN8B 1RVF2 3HMYA 1EAH3 5JZGC 4Q0PA 1ALYA 4LKEA 4E2SA 2LROA 3NV2A 3LPGA 4QPIB 5JMCA 2J1EA 1LRHA 1VBA1 4QQLA 3KSCA 4W6WA 3SNMA 2NQYA 5A6QA 3WZ1A 2PHRA 2UYAA 1Q5OA 1V6JA 1MZ6A 2J7MA 3MF6A 4Q0UA 4QKFA 2Y38A 2ZGLA 3S30A 1UXXX 2WAAA 2VCCA 4UXAA 4W8JA 3WP4A 5FPXA 3F2ZA 3PURA 4L2NA 1YYNA 5C9AB 5CAZA 4BK4A 1UPSA 4FPGA 1FNYA 1K5MA 2ZHLA 4HVRA 2JD4A 3PUIA 4JGZC 4Q0VA 2ZX4A 3K4ZA 5AC92 1O8PA 4LXLA 4ORFA 5A80A 4YLZA 2QZ2A 3ETQA 2HYKA 1ULEA 4QHOA 5FO7B 3TEYA 1NQDA 2RJLA 2J1AA 4B7KA 1CX1A 5KHJA 1MVQA 1SFYA 5J36A 1W2TA 4YPJA 1EUUA 1SACA 2VCAA 3RJRA 3IKWA 1W6MB 1YFYA 1RUH3 2VUJA 3OGGA 2JE7A 2WS91 2PLV2 3LA2A 1OOPC 1HN0A 1YWKA 1XSQA 4YW1A 3UT0A 3ZPYA 2WL1A 1XNKA 1QH6A 3QACA 2R042 3T2QA 5EJZB 5KXCA 3ZVXA 3S5AA 2VOTA 1RUJ2 3KQRA 4IESA 1X50A 4UFLA 3WF2A 4YG0A 2RS12 3RS6A 4V1PA 2D43A 3T0AA 4BQ5A 3LKJA 2IFRA 2P34A 2B4KA 2FDKA 4OZXA 4R4ZA 2HWB3 3K75B 3AKPA 3NWKA 3KQ4B 1RVF1 1UY2A 1KRIA 1WCQA 4FOVA 2E31A 2BBAA 1N1TA 2YU2A 3LIGA 1VBE1 4FOYA 4WVVA 5DQ0A 1I5PA 2VTXA 5F5IA 4C0HA 1VR3A 5CNAA 1CAWA 5C4WA 1W9SA 1TZOA 1PM4A 4DOUA 5JSPA 2WNVA 1NLQA 1YJKA 3V65A 3NV3A 1IZ3A 2RS53 3WCSA 1WLTA 2QQJA 1QH7A 4W4ZA 4CUBA 5JR2A 3NSTA 5LBBA 4O65A 4BQYA 1AHSA 1OLQA 2LW8A 5FLIA 1GFF2 1IS5A 4NR1A 4PIXA 4KI5M 5F3EA 4B4PA 2XR4A 3CJIC 4XQWA 4KBBA 3CJXA 2P37A 4KU8A 4SLIA 5BNNC 2JG8C 2DBIA 2W39A 4NIIA 1QF3A 3MPBA 2YC0A 1RMU1 4YM0A 5K4LA 5FBZA 4D7TA 5FPAA 3IT8A 4Q4X3 3MLJA 2OVUA 5BUVA 5LB6A 1HRI3 5DN2A 1KS4A 3ZYHA 1UYPA 4CDWB 4IE0A 5C3SA 5KC5A 2GP3A 3NJZA 4OHXA 2ZHMA 2P3KA 2ZX3A 3PU3A 2CL2A 2W1SA 5J37A 1S55A 3T2TA 4W6XA 3OY8B 3AC0A 1DP0A 1LHVA 3Q8FA 2Y6HA 4YVSB 4ZZ5A 3VBFB 4QPIC 1YJLA 1K5JA 3K4DA 2WYSA 1WMDA 4P5YA 2GH2A 3I2FA 4MUVA 4X8NA 4BYYA 4A3XA 1XNDA 2R041 2C4XA 1X82A 3HQUA 3ZIXA 1OC1A 5JXHA 4HSLA 5L9VA 2VNVA 2YC4A 1RHI2 4JDNA 5B4XA 5C9AC 3VLBB 5CYYA 3ZR6A 3WY6A 2CGNA 4JX0A 3LSDA 1CAVA 4FTBA 3LGRA 4MO3M 5FOJB 1OI6A 1OHFA 2C0ZA 3I2GA 4NN0A 4Q29A 2HEWF 1CQ9A 3RMXA 1L3JA 3B01A 3CKHA 3NKTA 5EWSA 3SXWA 1FATA 3T0BA 1NCRA 1FPN1 1CAXA 3N7LA 4LHSA 4PQQA 1OUSA 4Q4V2 4KMQA 2W95A 2YBKA 1GZCA 5JR7B 2ZKLA 1W2NA 1AX0A 4RHV3 1QNYA 2HWC3 4COWA 1X9TA 1REFA 4OULA 1KFUL 4HVOA 4CRQA 1UYYA 3B7MA 4SBVA 4CZSA 4XOGA 2V73A 2DF7A 3MF9A 2CWSA 4FCAA 1N3PA 4MV2A 5J96B 3I54A 3VBOA 3ZFFA 2J42A 1CIYA 5CIRA 3O0VA 3ACLA 1U5IA 2ZCWA 1YIPA 3O14A 2NMOA 3RNSA 2YPJA 3ZX7A 2D3PA 2DCKA 1VBC2 1LEDA 2J1TA 5APAA 4QHZA 5A7WA 5DAXA 2OKXA 1UZZA 3KWVA 1X9PA 4NHYA 4C8DA 2FQPA 5F9TA 2QE3A 5L7OB 1Y43B 4NMIA 2CV6A 3VL9A 3WT3A 2WABA 5HCAA 2OQ6A 2ZMKA 5FY7A 1U0AA 4CU9A 4WM7B 1JH5A 1PO21 3TOJA 3GYDA 5BNOB 5T54A 4YG3A 4WV8A 5LA1A 1VRH2 3OD4A 4LKDA 3BTZA 3D4KA 1OVPA 4QX7A 4LBQA 1MZFA 4NPMA 2PQSA 4RR3B 4XDQA 5EHDA 1JZ6A 2AEZA 1YCIA 4Q0SA 1RXGA 4OUEA 1RHI1 4Q4Y3 3WP5A 1DYPA 4K3UA 1RUC3 3ZLIA 2GDFA 3A21A 4WVMA 5B4NA 5KR7A 1GQGA 1D4M3 2QQNA 2XKPA 4ZS2A 2E63A 2P5BA 3CNAA 2XG3A 3TN93 4OLLA 5F5QA 2OX0A 2YYOA 4BA6A 3IM0A 1W0NA 1GP4A 2YB7A 3CZUA 5DZFA 4A4AA 2YU1A 2C26A 1ZYBA 2CTVA 2TBVA 5FY1A 1GQPA 3I3MA 2W3JA 1CPMA 3J7HA 1C8M2 3ILRA 5FPLA 3V56A 2W47A 4CDWC 2UWCA 5FJKA 1UMHA 4LBJA 2VPVA 2J1SA 4XC9A 3OJBA 3FN9A 4QGNA 4UW3A 3GCXA 4AAXA 1AR73 4YVSC 4CCMA 5CKQA 3VBFC 3OG2A 3ES1A 3ZXGA 4BIOA 2HWF2 2IWGB 2VTXJ 3OBAA 4CDQA 1H8VA 2GP5A 3T2OA 3EO6A 1WW5A 3OBTA 5J98B 2A3WA 5IW0A 2GAUA 1VBC1 1BZWA 1GUIA 1SHWB 1Q43A 4QGLA 2FBEA 2IFWA 5JWPA 4DY3A 1LENA 3QLQA 4UFHA 4JDMA 2Y8KA 2Y6KA 5D2AA 1NYWA 5H9SA 3RSJA 4EN7B 4PLNA 3K46A 1FOD3 3ZYPA 5F1RA 2EXHA 1ZREA 4M4RA 5FMOS 1SPPA 1ZZBA 3AKTA 1Z7S3 3DKQA 2PN5A 2EICA 4AWDA 1VRH1 2J1VA 5FKCA 5ANQA 5BNPA 1RL3A 2OYZA 1ASJ2 2FMDA 2YBSA 2ZA9A 1TME2 3ZYIB 1PMHX 4OMCA 5FO9B 3MV11 3WG4A 5FREA 1PO11 5FYZA 5FYYA 4XACA 3HJRA 5EYYA 2BEOA 3WLUA 3RPQA 2D6KA 4AHXA 1KJLA 1W8HA 1HN1A 1JS9A 3FX3A 1R081 4Z07A 3WNLA 3T30A 3NAPB 4MGYE 3M3QA 2K2SA 1D0GA 4GWJA 4O9EA 2Y6LA 3RRDA 1UXZA 1F5FA 1C8M1 3S0MA 5L7OC 3GNEA 4BDVB 4AF9A 1JZ4A 4IV3B 1JMUB 2V4AA 3A23A 1XXNA 2XLFA 3GJBA 2PTMA 4Z82A 1I5ZA 2JKXA 4N7UA 4L97A 4WM7C 5FYIA 5BNOC 1SMVA 2BFUL 3I2OA 5FYCA 5A1FA 4XFBA 3U78A 4AHZA 3ZKUA 2DCYA 4JHZA 2VG9A 4HN0A 2JDAA 2HWF1 4OCTA 5H9RA 1DLLA 4RR3C 1WCUA 3JXSA 3FLRA 3N9LA 1LOEA 3PHMA 1D7PM 2AH2A 3W5MA 2Q1MA 1LKNA 1SDDB 4CUGA 2E9QA 5FZ6A 1IHMA 2XJTA 3CO2A 1S0JA 3NNJA 1WD3A 1PNGA 1IPJA 2IC1A 4M01A 5I8YA 4YW4A 2BGOA 3KM5A 5JDBA 2MEV3 5A33A 2V09A 3OGJA 3OCPA 2YUEA 2GC2A 4PBOA 3JD72 1OOPA 1I9RA 2B46X 4P9LA 2ZPXA 2PXJA 1SFPA 4MX3A 5FDBA 1NQJA 4D0QA 1XYPA 3THCA 2WNVB 2VUCA 1ASJ1 1ZX5A 5E89A 3H8XA 3ZIWA 5FK7A 4A7KA 4MGIE 4OHWA 2QBXA 4B8EA 1TEIA 4ISRA 2BQPA 2DFCA 2YXSA 4FPOB 4MXVA 3AXDA 1VBB3 4C0BA 2VZOA 1Y7BA 4HMZA 1Q8VA 4KWUA 1W6OA 3ZSJA 4NIAA 1WZXA 5F32A 4YZ2A 2VZTA 3CIHA 2YROA 1SLTA 1AXKA 4JRAA 1XPWA 3LSEA 4LO7A 5GZCA 1KGYA 3RYRA 1RC6A 2W2IA 5BNQA 2WFF2 3I97A 3WINE 2QQMA 3QH7A 2IXHA 3Q8AA 4FPJA 4ZONA 5FPBA 4CEYB 2OT7A 5CKNA 2XL9A 4RGGA 5IJRA 3FL7A 4BE3A 4LK7A 5FMDA 2ZGQA 2JEMA 4BMBA 1FMD3 4YYOA 1DGWA 4E4SA 3CJIA 5FZMA 3D8CA 5BNNA 4Y1UA 2GMEA 2JG8A 2OS2A 2WC2A 2ZX2A 1QJY2 3E6BA 4UBGA 3HN1A 3O7OA 3PNAA 4XIKA 3VBRA 1ZBA3 4XF4A 5C8WA 1JZ2A 4XJ9A 3LA3A 4FOQA 3RJ2X 3KVAA 3LIHA 4R9BA 1US3A 4OQ9A 2CGOA 2P2KA 4NIDA 1LHUA 1NAEA 1LR5A 4JKKA 3OUJA 5BPXA 1HW5A 5EQUA 4LHNA 4QPIA 4PIYA 3NAPC 1RJ7A 2YDEA 3I3EA 4FFFA 1DQ2A 1LTEA 1DHKB 1NCRB 3JD71 3RQ0A 5JPMB 5A32B 3GZTB 1O4TA 1C1FA 1SCSA 1UY0A 4D7SA 1J59A 5FPZA 4ZU5A 4IV3C 3LA7A 3O1RA 1X7NA 3CMGA 2JICA 1HB2A 2Q30A 1SQ4A 2WINB 3OD0A 1WBLA 3PTRB 4LORA 2BERA 2Z79A 1GMMA 1F35A 4LIVA 4M00A 5C9AA 5IAXA 3WUCA 1XC6A 1OSGA 1Y9QA 3B9CA 1AX1A 3WQ0A 3APBA 3PVNA 2JDYA 3VBOB 5LATA 5FP7A 4GB33 4I0WB 4CXXA 3MFAA 5JIAA 4AQSA 3QH6A 1AYN3 3OUIA 3I2IA 4XHBA 4QX8A 5EV7A 1G9DA 2R073 3WG2A 3ATGA 1A78A 5JSOA 3GHNA 3AFKA 4IEXA 4K40A 1STMA 3FLPA 5GKAC 3WNNA 3OSDA 3OBRA 1K3IA 3KCXA 5JOXA 1X8EA 5KXEA 2PFWA 1JHJA 1F5JA 2KD7A 1SFNA 3L9JT 5FP3A 4B1MA 2Q8EA 3R4DB 4D94A 5SV8A 1W6MA 4QQPA 1XU1A 4WM8B 4AGRA 2RR13 1CR7A 1NLSA 5FYTA 1OQEA 1YXWA 1QJY1 1UX6A 2RDRA 5J48A 1RUI2 1LODA 3AZZA 2WNVC 2Z4FA 4HK9A 1NKGA 4ONUA 5E88A 3WDYA 4CCLA 5HCHA 2WT0A 3JUUA 3PMSA 5I0DA 1ZRFA 3UK9A 3N7JA 5CKMA 3URFA 3RZJA 2XLGA 3J7MA 2Y6GA 4P9YA 3C7FA 4NO4A 3ON7A 4WVMB 1UZYA 2XH6A 4QB2A 2EIBA 4QXHA 4XUQA 5A3PA 3SQOA 1Y9GA 3ZXFA 1RUD2 3I2DA 2QTWB 4DXZA 4QB6A 5JPNB 3AMMA 5FZLA 3FMGA 4QQHA 3KMHA 2H0VA 4P9XA 4CSWA 2R062 2RJKA 4JQRA 4RYDA 4CEYC 5L9BA 2GNDA 2JE8A 2PAEA 4HK8A 4QDQA 5LA9A 4E4ZA 1CPNA 2JE9A 4FQ4A 4KG8A 1S0IA 4LBKA 4E27A 5F3CA 4RQPB 3F95A 3ZYBA 5LEKA 5FBJA 3MUY1 4L92A 2W68A 1QJZA 2HEYF 2Y34A 3O0XA 4JGYB 4GMP1 1DGRN 1UF2C 1ENXA 1VMJA 1ZBE1 3P6BA 1QJU3 1J1LA 4QX2A 4I3GA 4ZU4A 4CDQB 2D3SA 2Q5TA 3JU9A 2ET7A 3NNLA 1DGWX 3WUDA 3JQWA 1J58A 3O1MA 3FC0A 4P9WA 1ENSA 4M3CF 4GJZA 3RZGA 1AR63 2Q8CA 4GH4B 4QDSA 3AMPA 5T5PA 3ZYJB 3S57A 1EP0A 1OPMA 2K0GA 3J26N 3X29B 1W3VA 3OY8A 4LLFA 1W9WA 5JXJA 2UY8A 1SPPB 2WA3A 2MHFA 4G9SB 2D6LX 1BK1A 1V00A 3OPTA 1NCRC 2Y0OA 4XJWA 5FPVA 1FI2A 1KEXA 5JUVA 2ES3A 2WKKA 1UY1A 5AC93 3IAPA 3DEMA 4UT5A 3RVHA 3VD4A 1RUG3 3H3ZA 3ZN6B 3A7QA 2YHJA 3KGZA 1E5RA 2WIIB 3FLTA 5IVVA 3DV8A 1YFUA 1H9WA 4Y26A 1DCSA 1JXNA 2VU9A 1DQ0A 2ZJCA 5DAQA 3W21A 3BTAA 3UL2A 4AFDA 5FYHA 1HDKA 5C6CA 4AVVA 2GN7A 1LOCA 4LLOA 4P14A 2WO1A 3VBOC 4GD4A 2XUEA 3C7OA 2VVDA 4FOWA 4UFIA 3S7EA 3W5NA 1LEMA 3AL5A 1MVEA 4Q26A 4C1XA 4TLFA 4OI2A 3LOBA 2R061 1TMF2 1RUF3 4N7IA 3KHCA 3CHXA 1QQP3 1GSLA 2XONA 5GM0A 4HXCA 3LWCA 1BBT2 3ELNA 1WW4A 2J1UA 3MPPG 4WM8C 1GV9A 4X6QB 3POFA 4KGGA 3IPVB 5GALA 3RGBA 5ABJB 1GNZA 3P5BA 5K8SA 2D44A 1CD3G 1ZZCA 1QOTA 4DFSA 5FRAA 5GLTA 4XTPA 4GWNA 4LBOA 1URXA 2YC2A 4LUMA 4OZOA 3VD7A 1QJX2 1T6BX 1Q56A 1UU5A 1VBD3 2RM22 3PUSA 4RS5A 4XDOA 2ZHNA 1POQA 4QMAA 1UYXA 3VKOA 4UFMA 5JMOA 1ZA7A 4YGDA 5L7OA 4ZY9A 1EAH1 4RN5A 2DUQA 3MBWA 1BVP1 4URTA 3O5SA 3HR9A 4IE7A 4AE2A 1Z0HA 2E33A 5HCFA 3TAYA 4N53B 5BNOA 4TSVA 3T09A 2W46A 4D6QA 4LKSA 5IVJA 2P3YA 1GP5A 1W9YA 4RR3A 2ORZA 4AI8A 3BODA 3WEZA 4HOOA 3WDVA 1JYXA 4QX1A 2WT2A 3D0SA 4GKXA 5IUQA 3SITA 1PGL2 2A71A 4RQPC 4N9HA 3W59A 4N8MA 5FK8A 4OQ8A 1BQPA 1IGOA 1WGPA 3B5LB 4XTMA 4JGYC 4CP1A 2WNOA 5HXMA 2E7TA 3E5QA 1UOJA 4CDQC 2PHUA 4GA9A 2LUWA 1JHNA 2XWJB 2WSUA 1RXFA 2QFEA 4UF0B 2PHTA 5IK4A 2WNEA 4NHXA 1G9CA 3J8F3 2I45A 1JTZX 3SH5A 5BXXA 2JDHA 2PELA 1JW6A 4FFIA 4AL9A 1POV3 1UAIA 1C57A 1RUH1 1T6GC 2EIGA 3OOXA 1WA6X 4GH4C 2JX9A 4XQ4A 2VMHA 1CN1A 2XOMA 1MQTB 4LEJA 2WBKA 3POIA 2V5DA 4KWKA 2HH9A 5EZWA 4KGQA 3IWZA 4LULA 4FXGB 5DPNA 1AR83 3NJYA 1L7QA 1W8FA 3HQRA 4IEPA 5BV6A 3N7MA 4QXCA 1AR93 1BXHA 1CWPA 4W6YA 3POGA 3K48A 1LJ7A 2QDRA 1DG6A 3QOPA 5FJHA 4DMIA 1NA1B 3FHQA 3KF3A 3I2KA 2WFPA 1MACA 3VBRB 2WT1A 4UOJA 4YW6A 2CNAA 1RIRA 2IXCA 3HEIA 3JBG3 2YGLA 2DBNA 1ZM1A 3NJVA 4DXSA 2JWPA 4DEQA 4BXSV 1QEXA 4FPYA 5T3NA 4NROA 2PHWA 4OUSA 3DYPA 5G04L 1VBE2 2CDPA 4RHV2 2HWC2 2WZR2 1JZ8A 1R093 2RS51 1GZ9A 3MGUA 4PIZA 3HN3A 3USUB 2FDJA 1H1MA 1V9U3 2WZEA 2Q1FA 4MZUA 3AYEA 1PIV2 4QU1A 1XNTA 3IZOA 5AFEA 3VBSB 2XBO2 2Y26A 3BALA 3DUIA 5A3TA 4LE4A 3PLQA 3H1MA 1PGL1 2VOXA 2UU8A 4FQZA 3U11A 5ABJC 5ACA3 3KB5A 2PA7A 3HWJA 3H9AA 1WLDA 3LFMA 1NCQB 3Q8CA 4Q27A 1B35B 1RMU2 1ZNPA 1WKYA 1YQCA 2VOKA 2VZQA 2VNOA 2YG0A 4QKDA 3NAPA 1D2QA 2BGPA 5FMCA 4UFJA 4NHLA 4FAGA 3H42B 1JZ7A 2QNKA 3NV4A 2CYFA 2QVSB 2W1WA 3CEWA 1PX4A 3P3PA 4IV1B 1JYIA 4IV3A 2WO3A 4ISQA 3AVRA 4EZ4A 3N9OA 4K6BA 1IPSA 1R1A3 5C8CB 3M7AA 2ID4A 4N53C 2VW0A 2P17A 4FP3A 3JB4C 5FMOL 1LB2A 1LGCA 3MO4A 5CFCB 2GSYA 3B02A 1O3QA 1F31A 2I2SA 4I01A 1V70A 1JBCA 5IT6A 1QWRA 1RUC2 3FBMA 1ENRA 2E7AA 1D4M2 3AZWA 2XUMA 2D3RA 1G8WA 3TN92 1I6XA 5IVEA 4AEDA 2DVAA 4NUBA 3LEKA 1ND3B 3W58A 4EWEA 1ZA4A 3BIEA 5EFUA 1JU3A 3S7IA 3EQEA 1OQ1A 4UBHA 5C5TA 5DMYA 4IEVA 3T4VA 5IVBA 3VD9A 3ZR5A 5ISLA 3RZHA 2EIDA 2FDGA 5LBCA 2WN3A 1FPN2 3DXUA 4YFWA 4RHV1 4PI2A 2HWC1 2WZR1 4MGSA 4CP9B 4BQ1A 4D69A 4EQVA 1YI9A 4LBLA 4BQXA 5I0SA 5TSWA 4D8MA 1VMHA 1AR72 1PIV1 2B7YA 4XHXA 4HVQA 2BOJA 3WHTA 4Y3OA 1MQTC 2VZPA 3K4AA 2XBO1 1HLCA 2W52A 3AB0A 1X33A 4HKOA 3PU8A 4KNCA 2A73B 2VZSA 1IS6A 1RUOA 2XXZA 4QWNA 1Q8QA 1W6NB 1HIXA 1V6NA 2RS33 4AFCA 4EE2A 1AXZA 3I8TA 4HG6B 4TN7A 2OUJA 5KWRA 4XAAA 1NA1C 1NZCA 3KV4A 1FYUA 4AI9A 3VBRC 4Z8BA 3GBGA 3NL1A 2WNUA 1ZRIA
chains in the Genus database with same CATH topology
1OUXA 2BV4A 2JDYA 5HCHA 2WRAA 4CE8A 1OURA 2BP6A 2VUDA 1OVSA 5A3OA 1UZVA 2BOJA 1OUSA 4UT5A 2VUCA 2XR4A 2JDHA 2JDUA 2WR9A 5A6XA 1W8HA 2BOIA 2JDPA 1UQXA 5D2AA 1OXCA 2VNVA 4AOCA 2JDKA 1GZTA 2JDNA 3DCQA 3ZDVA 5A6ZA 1OVPA 2CHHA 5A70A 5A6QA 5A6YA 2JDMA 1W8FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OUX A;  2BV4 A;  2JDY A;  5HCH A;  2WRA A;  4CE8 A;  1OUR A;  2BP6 A;  2VUD A;  1OVS A;  5A3O A;  1UZV A;  2BOJ A;  1OUS A;  4UT5 A;  2VUC A;  2XR4 A;  2JDH A;  2JDU A;  2WR9 A;  5A6X A;  1W8H A;  2BOI A;  2JDP A;  1UQX A;  5D2A A;  1OXC A;  2VNV A;  4AOC A;  2JDK A;  1GZT A;  2JDN A;  3DCQ A;  3ZDV A;  5A6Z A;  1OVP A;  2CHH A;  5A70 A;  5A6Q A;  5A6Y A;  2JDM A;  1W8F A; 
#chains in the Genus database with same CATH topology
 5LA2 A;  3UJO A;  4CEY A;  4JZR A;  4CU7 A;  2FDI A;  1VBA 3;  3UES A;  4CE8 A;  1BYH A;  2PHD A;  3A0K A;  3T1M A;  4J1X A;  1H8T B;  1GNY A;  1PO2 2;  1BEV 3;  2ATF A;  5D1I A;  1LOB A;  1DLC A;  3QBQ A;  3VZO A;  2DWR A;  2W08 A;  5F5A A;  5E1R A;  2A70 A;  1GR3 A;  2DVB A;  4LBM A;  5FZH A;  1RUC 1;  3VBS C;  2HWD 3;  4IGP A;  1PX3 A;  2E6V A;  1D4M 1;  5T52 A;  3B94 A;  5CIS A;  4XJA A;  3BU7 A;  3TN9 1;  3ZMN A;  1TE1 B;  3DPR B;  1W3X A;  1I1E A;  1NCQ C;  3AZY A;  1GYK A;  1B35 C;  4P9J A;  4V2W A;  3THP A;  2JXA A;  2XQX A;  3TBD A;  2GAL A;  1YQ8 A;  3HOB A;  4FPK A;  2AR6 A;  1N47 A;  1X8M A;  1G9F A;  1QY4 A;  5A32 A;  5HPO A;  2VBP A;  4EN6 B;  2VMF A;  3D3A A;  4IV1 C;  2OQ7 A;  4JRL A;  1AR7 1;  5FAX A;  2FDH A;  1SBD A;  4QD2 A;  1IS4 A;  3FUQ A;  4QPG B;  2R0H A;  1UY3 A;  5C8C C;  3C8X A;  3LOI A;  2VW2 A;  5GZG A;  1ZZ7 A;  5F6K A;  1O4Y A;  1PMJ X;  2ET1 A;  2R30 A;  4PDW B;  4XFF A;  3OYW A;  4M3C B;  5CFC C;  4IDZ A;  3I3B A;  3KT4 A;  4B3N A;  3WQ1 A;  1VMF A;  1Q8P A;  4JHT A;  1E5H A;  3WSO A;  1O5U A;  3MV0 1;  1UYZ A;  2WJS A;  3AM2 A;  2WQZ C;  2FDF A;  1RVF 3;  3WP3 A;  2EAK A;  1SLB A;  4RS5 B;  4E9K A;  3GDB A;  2BU9 A;  4FTS A;  2DYC A;  4MGT A;  4FSJ A;  3KCY A;  1DDL A;  1UIJ A;  1ND3 C;  2JDZ A;  3IBM A;  5DAW A;  4AEM A;  5J3U A;  1XJA A;  2ZBJ A;  1OLR A;  3RWN A;  3A4U A;  1PGW 2;  2BZD A;  4WM8 A;  5T5L A;  3WV6 A;  2O8Q A;  2BPA 2;  2OII A;  2WN2 A;  1W0O A;  1XOY A;  3AYA A;  5DUW A;  1QXR A;  1KDM A;  1XB9 A;  4LPL A;  4TLG A;  5SV5 A;  4GAZ A;  4GUL A;  1S4C A;  1JUH A;  1C8N A;  4LTA A;  1BVV A;  1PO1 2;  1AXY A;  1DFQ A;  3M1H A;  4PLO A;  1POV 0;  2ZS6 B;  1GOG A;  5I8S A;  4OHV A;  1S1A A;  5GLZ A;  3THT A;  5C70 A;  1GP6 A;  1IG0 A;  1PK6 A;  3PIG A;  4Q4W 3;  2NMN A;  1PM7 A;  4S2D A;  4XW3 A;  3RI9 A;  3VBH B;  4DUV A;  4JCK A;  1EPZ A;  3M3I A;  2VJX A;  3BOW A;  3WQB A;  1R08 2;  1IS3 A;  5I8T A;  2QKD A;  4AI1 A;  5JLV A;  5T55 A;  4ZXE A;  4CVU A;  4HZF A;  1EV1 3;  2W92 A;  3K3O A;  3EJK A;  1FMD 2;  1H1A A;  4NVP A;  2BTV C;  2PLV 3;  4LHK A;  1J3R A;  1WUV A;  4IND A;  2OPW A;  1RGS A;  4RQP A;  1H8T C;  4CTE A;  2R04 3;  2HWE 2;  2ZKN A;  4JGY A;  1RUJ 3;  5JXI A;  1J3P A;  4DIN B;  1H9P A;  2A75 A;  2RS1 3;  3ZFE B;  4XMI A;  4BWO A;  3C7G A;  3ZSM A;  1ULC A;  4ATE A;  2ZX1 A;  5F7U A;  1O8S A;  4IE4 A;  5GLV A;  5KXB A;  1AYM 3;  2JD9 A;  4HFS A;  1LES A;  4RGK A;  5FUI A;  2X09 A;  2VZR A;  3CZJ A;  5GZE A;  3AJZ A;  3DPR C;  4GH4 A;  4XUT A;  1LEC A;  1MS5 A;  4A41 A;  2DTY A;  1PVC 2;  4MXW B;  2ZTN A;  4FTE A;  1OD5 A;  4UAP A;  1PGW 1;  1GOF A;  4AQ6 A;  4ZXK A;  3ABZ A;  3ZXK A;  1YEW A;  1HB4 A;  2HKX A;  2V5Y A;  5C3O A;  3U10 A;  3WF4 A;  2Y60 A;  4CDX A;  1VAM A;  5DAB A;  2X5I B;  3ZN6 A;  3NJX A;  1XYN A;  1C3H A;  2VXR A;  4QPG C;  2UWA A;  1AF9 A;  3JZV A;  1NT0 A;  4XF0 A;  5BYN A;  5D8A B;  5EYX A;  2VTF A;  3ALQ A;  3BN6 A;  4E8C A;  5HV4 A;  2QQV A;  4PDW C;  1AYN 2;  1O3R A;  5FFO C;  2N7G A;  5FZ1 A;  2R07 2;  3GM8 A;  1U5Y A;  2K46 A;  3J9S A;  4CCC A;  5CFD B;  1LHO A;  2L9L A;  2R1D A;  4KWJ A;  3H8R A;  1EPW A;  1BLZ A;  1NXM A;  3ILF A;  1T2X A;  4NHM A;  5FZ4 A;  4YM1 A;  1N3O A;  3GGL A;  4RS5 C;  1XBF A;  4ARY A;  1J84 A;  2JG9 B;  3AFG A;  5LY1 A;  1FMD 1;  5FP9 A;  1OPO A;  4LBN A;  1WLW A;  1LUL A;  2RR1 2;  4Y22 B;  1CAU B;  3III A;  3FJS A;  1RIT A;  2O8O A;  5ABJ A;  2PHX A;  1UWW A;  1LGB A;  3AX4 A;  1VLN A;  3IPV A;  1N3Q A;  2HWE 1;  4E4D X;  1DQ6 A;  2VO5 A;  2ZAC A;  2XHK A;  4QKN A;  3CLP A;  4HLT A;  1HQN A;  1Y3T A;  4H7L A;  2CAV A;  3DN7 A;  3IN9 A;  1W06 A;  5FZO B;  1UU4 A;  4YM3 A;  1TG7 A;  2W87 A;  2VQU A;  1U5Z A;  4B1L A;  1W2A X;  4I09 A;  2HEV F;  1UL9 A;  3HAG A;  5K0U A;  3OGR A;  2WLQ A;  2PMW B;  4AVB A;  4AED B;  3VHO A;  3VBH C;  4QDR A;  3DF0 A;  1VE0 A;  2WO2 A;  2D6N A;  2G4I A;  3N9Q A;  4TXW A;  4Q4V 3;  1ZRD A;  1B09 A;  2D6M A;  5GLW A;  1PVC 1;  1O4Z A;  1E5I A;  4MOA A;  4N53 A;  3VDC A;  3E5U A;  4XBN A;  3A22 A;  1UX7 A;  3ORJ A;  4DXT A;  5FZI A;  4JQT A;  1DBN A;  2ENR A;  3EBR A;  3T4H B;  3MIC A;  3R0R A;  2Z42 A;  1VB2 A;  5DG1 A;  2ADD A;  4LOS A;  3POJ A;  1W2U A;  4TWT A;  2V4V A;  3SLI A;  5FCC A;  2MNG A;  2KR2 A;  1O6U A;  3KV6 A;  1GAN A;  1ULP A;  3AKQ A;  4WVW A;  2G19 A;  1CX4 A;  1OLM E;  4GB3 1;  4XFG A;  4XIO A;  4AAP A;  4CEW B;  4EYU A;  3U0Z A;  1VAK A;  1H1I A;  3PIJ A;  3O12 A;  2Q8D A;  1VBC 3;  1AYN 1;  3ZSK A;  3MUZ 1;  2VZ1 A;  2R07 1;  4P9G A;  2JB8 A;  5JOY A;  1WMX A;  3ZFE C;  2GMM A;  1COV 3;  2ZGO A;  3DXT A;  2IXI A;  3GJA A;  4NOT A;  5FZE A;  4UF0 A;  1RUE 2;  3LEI A;  4NRP A;  1MR5 A;  2CGP A;  3OTF A;  2DDU A;  2OA2 A;  2WNU B;  3MID A;  4LIU A;  4XUP A;  3ZDS A;  4EZH A;  5FXX A;  2A7A A;  4R52 A;  1N1V A;  1VRH 3;  1LOF C;  1GIC A;  2RR1 1;  1MQT A;  3KLS A;  1IKP A;  3GBF A;  3EYP A;  3POS A;  1I3H A;  4RA0 A;  1AL2 2;  4XJU A;  2BOI A;  3UET A;  4BM8 A;  2QQI A;  1UN1 A;  5FZB A;  3UNP A;  1NX9 A;  3SCF A;  1JOB A;  1RIN A;  1YRZ A;  2W91 A;  5FYM A;  3VZM A;  4CP2 A;  2QQO A;  3C3V A;  3O1V A;  5T5O A;  1NA1 A;  1PNF A;  2X5I C;  3SMH A;  4Y4R A;  5FZ3 A;  3ME2 A;  2G1M A;  3ZYR A;  4LKF A;  5FYS A;  4FXK B;  3VKF C;  2I74 A;  1IPK A;  1G7Y A;  5D8A C;  3ZKY A;  5EIY B;  3ZXD A;  1W9T A;  1OUR A;  3OPZ A;  2DUO A;  2RMU 2;  4GWI A;  1C8M 3;  5KC6 A;  2NM1 A;  3ZOI A;  5CFD C;  4MGZ E;  1RYY A;  4Y20 B;  5AVA A;  4MYE A;  1QQP 2;  2XVG A;  3USU A;  2B9U A;  1W0P A;  2R16 A;  1YC6 1;  4FPL A;  2JG9 C;  1TNR A;  2VZV A;  1J83 A;  1GZT A;  3M4F A;  4BQ3 A;  2NYY A;  3VBS A;  4YAR A;  2ERF A;  3JB8 A;  2BYV E;  1WME A;  1C4R A;  1DF0 A;  1VAV A;  1PMI A;  4DQA A;  1TNF A;  4Z1V A;  1NCQ A;  4L8Q A;  1ZBE 2;  1B35 A;  1VBD 2;  2VEC A;  3OYW B;  5FOB B;  5JCT A;  3B9I A;  4ASM B;  2XGX A;  2YV8 A;  3M70 A;  4AZZ A;  4P08 A;  1HB3 A;  3WNP A;  1AR6 1;  4JDO A;  1RUE 1;  2H6C A;  1WWY A;  5LBE A;  3UV9 A;  3ZM8 A;  5CEH A;  5GJ6 A;  3MW2 A;  3POB A;  1NY7 2;  4IV1 A;  3SC7 X;  1SLC A;  4AED C;  4OVE A;  1NUK A;  5LAS A;  1VJ2 A;  1DQ1 A;  3AKR A;  2ZML A;  3RI8 A;  3VKL A;  5A6Z A;  5C8C A;  4M0N A;  5A70 A;  4HT1 T;  5FKB A;  5KBF A;  3H50 A;  1ASJ 3;  4PF1 A;  5DZE A;  1AL2 1;  4AXO A;  2X8K A;  1TME 3;  1JZ3 A;  2EAA A;  2OPK A;  5CFC A;  1MZE A;  3H3U A;  4DPN A;  3AP4 A;  3BUC A;  5IHR A;  1PVX A;  4CDU B;  4R8H A;  1HXS 2;  1IG3 A;  1C1L A;  3RMY A;  3VHR A;  3AZX A;  1HJG A;  5EP9 A;  1XU2 A;  3RZM A;  1ULF A;  1XNA A;  5K9Y A;  5FR3 A;  4H14 A;  4CEW C;  3H1Y A;  1ND3 A;  1PK6 B;  3MYX A;  5IAT A;  1MPX A;  2ZGK A;  1SDW A;  3AXE A;  4IQP A;  2RMU 1;  2A6Z A;  2VXJ A;  4AYU A;  3U14 A;  1AZD A;  4PCR A;  4RFT 0;  4A7Y A;  4EJR A;  4NJ4 A;  4CP9 A;  2A6X A;  5I91 A;  1QKQ A;  1QQP 1;  1U12 A;  3FHI B;  4K8F A;  2WNU C;  1OUX A;  2C6S A;  5DXD A;  4ZS3 A;  3UKV A;  3WF1 A;  5F39 A;  1JOJ A;  4Q2F A;  5JOZ A;  5LEJ A;  3MHZ A;  3H1W A;  1MEC 2;  2ZGP A;  3NMB A;  4AI3 A;  1WW7 A;  5ANN A;  3LFI A;  3UYJ A;  2A3Y A;  2D40 A;  2UUR A;  4H55 A;  4K7J A;  3U4S A;  1OLM A;  2FZ1 A;  3JQX A;  3TEW A;  2QZ3 A;  2DUP A;  4F8A A;  4RL7 A;  4RFR B;  1JYT A;  1HV1 A;  1W6N A;  3D0J A;  4NIG A;  1VBD 1;  3SKJ E;  3BU0 A;  2JJ6 A;  4AK3 A;  5DDJ 2;  3WOG A;  3C7E A;  4A6S A;  3LE0 A;  2I07 B;  1OT5 A;  5JIU A;  2PAK A;  5GZD A;  2O1Q A;  3M2M A;  3SKV A;  4HON A;  4YVW B;  3WX5 A;  2DU1 A;  1EAH 2;  2C9A A;  3WF3 A;  1NY7 1;  2D6O X;  4R9D A;  4I0B A;  2R7E B;  3CBN A;  2QJV A;  3JD7 3;  5IFT A;  3WVJ A;  2B8M A;  2W0X A;  2G9G A;  1O59 A;  3ZYF A;  3VDA A;  1H8T A;  4L9B A;  3WG3 A;  4XF3 A;  3TNQ A;  3K3N A;  5FY4 A;  2WSV A;  2XLA A;  4CA9 A;  1OD3 A;  5JVV A;  2C9K A;  4LA3 A;  4CXW A;  1HQL A;  4HKL A;  4GIQ A;  1HQW A;  3T08 A;  4CDX B;  3HVD A;  1HXS 1;  3BOP A;  2BWA A;  3DGT A;  4YGE A;  1VRB A;  5A7N A;  3N3H A;  3N9N A;  5H9P A;  5IAV A;  4FPF A;  1FNZ A;  1SLI A;  1S0D A;  2ZOE B;  3DPR A;  3ZDV A;  2BRT A;  5GZF A;  3LZZ A;  3U75 A;  4DRR A;  1CZT A;  1XNB A;  2WFF 3;  2Z5W A;  2P1B A;  1W04 A;  2VQT A;  2BFU S;  1GWM A;  2JDM A;  3LAG A;  3J8F 1;  2RJ2 A;  1GZW B;  3K2O A;  1S2K A;  5FPU A;  3N4M A;  3HT1 A;  4F83 A;  4Z2W A;  4I2O A;  1ODM A;  3WW2 A;  4COZ A;  5C33 A;  1H2M A;  1OBN A;  3AYC A;  5CG9 A;  2VZU A;  2WUH A;  3K77 A;  1RUH 2;  2ZHK A;  3ASI A;  5FWE A;  1C5H A;  1MEC 1;  1YO8 A;  2W1U A;  4QPG A;  4A3Z A;  1QJY 3;  3VD3 A;  1AR8 1;  4QKB A;  4ZU7 A;  3VZK A;  3OB8 A;  1F9K A;  3LDB A;  1AR9 1;  4MET A;  1ACC A;  4GQ7 A;  4PDW A;  4QU2 A;  4BIS A;  4FPC A;  4X8P A;  5FXW A;  2BJS A;  4M3C A;  3U37 A;  4Z2A A;  2VMD A;  3ETP A;  4D7Y A;  2XKO A;  3JBG 1;  4CDU C;  3CU7 A;  4K9S A;  4QHB A;  5DDJ 1;  5IK7 A;  4HPK A;  2ADE A;  4K20 A;  2ZGR A;  1HB1 A;  5FZG A;  2HWB 2;  5FMB A;  5C7G A;  1DQ5 A;  1OA2 A;  4AHW A;  2RE9 A;  5K0U B;  3Q8E A;  2AEN A;  3KV9 A;  1PK6 C;  4AR2 A;  2G9F A;  3WP6 A;  1OVS A;  3C2U A;  1R09 1;  3ST7 A;  3I3D A;  2IVI B;  5HV0 A;  1KDK A;  4IEQ A;  1HX6 A;  3I59 A;  3IIA A;  4XF9 A;  2RS5 2;  4CCO A;  3PME A;  1Q3E A;  4QX3 A;  4JTO A;  1V6K A;  4C1W A;  3BI3 A;  4NPR A;  5A7O A;  1RED A;  1UOF A;  2XJS A;  5FYV A;  4AVS A;  1QHD A;  5DZG A;  2WYF A;  4DB5 A;  4FBF A;  4QT6 A;  4XXA A;  1QOO A;  3GZA A;  3J4U H;  4TTG A;  3O1O A;  4YSF A;  1UOB A;  2R6Q A;  1HRV 3;  3E6C C;  2OXB A;  2AZ5 A;  3VBH A;  4Q4X 2;  5A3M A;  2YZ4 A;  1H4H A;  1H6Y A;  2NPI A;  4MHR A;  1UKG A;  2C5D A;  5FZ7 A;  4CU6 A;  1HRI 2;  3FBY A;  2ZEZ A;  2VL4 A;  3UKN A;  4IE5 A;  3AK0 A;  4I3P A;  4QM8 A;  1XE8 A;  1H0B A;  2W1Q A;  4YVW C;  4DO0 A;  2ZGT A;  2Y64 A;  5E6H A;  5L73 A;  4EWA A;  1VP6 A;  4CYD A;  4S2G A;  4AEK A;  1LOA A;  1KD7 A;  2K9Z A;  5F5C A;  3VZN A;  3WHU A;  4A6O A;  3M3C A;  4LNV A;  1YIF A;  2JDK A;  1RUI 3;  3FFQ A;  1LCL A;  1SLA A;  3GXU A;  4GKY A;  3TYJ A;  4BCU A;  4JKL A;  3T0D A;  5T50 A;  1W6Q B;  1H2N A;  2ZZQ A;  2HWD 2;  1QDC A;  3ZFE A;  3RZZ A;  2YFU A;  1KS5 A;  2AYH A;  4CDX C;  4ZKT B;  1RTV A;  4YW2 A;  1AJO A;  1CON A;  2B42 B;  5FQ0 A;  1RUD 3;  4LHL A;  2HWB 1;  3THD A;  4W65 A;  1LOF A;  1UZ0 A;  3RFR A;  4Q1P A;  3MZH A;  1OQD A;  5A1L A;  5FUP A;  1WMF A;  4MXW A;  3TB0 A;  1JOD A;  3B69 A;  1OF4 A;  2VOV A;  2IUW A;  4OYU A;  4O61 A;  2JDN A;  3PUQ A;  2WZP P;  5J7M A;  1SCR A;  2W9X A;  1Q8O A;  2LTN A;  3OPW A;  1TQ5 A;  3ZMO A;  2VBB A;  1HJF A;  2XML A;  4JAA A;  5AVP A;  4I02 A;  1GNH A;  2CAU A;  2DU0 A;  4OFG A;  4OI1 A;  3S5Q A;  5I0U A;  2X5I A;  5FP4 A;  5LY2 A;  4ASL A;  2Q0A A;  2QQK A;  2YGM A;  2XVK A;  2H0B A;  5D8A A;  1KJR A;  3E5X A;  3OGS A;  2E51 A;  4KWL A;  2RS3 1;  3CQO A;  2IVJ A;  2UWB A;  4Q4X 1;  5FLJ A;  4K1Y A;  1GKB A;  3HNB M;  2ETE A;  3POY A;  2A6V A;  1HRI 1;  5CFD A;  4FPH A;  5FY9 A;  2WR9 A;  3NRU A;  4XXP A;  2EAL A;  1F4H A;  5EJ1 B;  1KFX L;  1N1S A;  5BY5 A;  2JG9 A;  5FZD A;  2CHH A;  5K0U C;  2PAM A;  1JZ5 A;  4L99 A;  4P9I A;  1OH4 A;  4Y22 A;  1BEV 1;  3PJY A;  3FWE A;  2XPJ A;  1CAU A;  1M06 G;  2F4L A;  2DFB A;  4PBP A;  1ND2 B;  3WCR A;  2SBA A;  5FZA A;  3AP7 A;  2VC9 A;  5FZ9 A;  2B5H A;  5A1A A;  1ULG A;  2ARA A;  4YW7 A;  3R6S A;  2HWD 1;  3I7D A;  2ZEW A;  4CCK A;  4KU7 A;  2XJR A;  4Q4Y 2;  3AP5 A;  5FZO A;  3BTX A;  1WLC A;  4XFC A;  3UJQ A;  4Q4W 2;  2FCT A;  5FXV A;  3L2H A;  4COY A;  5IVF A;  2VCB A;  3MIF A;  1QOS A;  1OMI A;  5LW9 A;  3DYO A;  1AUY A;  1RUN A;  1H30 A;  4L11 A;  2VME A;  4DUX A;  3Q8B A;  4HAN A;  3BYW A;  1EV1 2;  1REE A;  1W99 A;  5LA0 A;  1TMF 3;  5E8A A;  2RVA A;  4G4F A;  1S2E A;  4XYX A;  4BHP A;  2ZGS A;  5FWJ A;  1BKZ A;  3N36 A;  1BBT 3;  4QAW A;  5FXZ A;  5A7Q A;  2Q4S A;  1X36 A;  1W8N A;  5HXV A;  2PHL A;  5JAX A;  1XNC A;  4Q5O A;  3I49 A;  4LT5 A;  4QXK A;  3MLL A;  1QJE A;  3SH3 A;  2WLP A;  3A0N A;  2CU5 A;  1W6P B;  4XBL A;  4HSJ A;  4CEW A;  3ZN5 A;  5HI0 A;  1QJX 3;  1W8O A;  4I0A A;  4CUC A;  4G3Y C;  2RM2 3;  1UD1 A;  1OFS A;  2D98 A;  4XQD A;  1AYM 2;  4TZD A;  1SLL A;  1SEF A;  2OW4 A;  1JN2 P;  3OEB A;  5CB7 A;  1W28 A;  2C24 A;  4FFH A;  1QIQ A;  5DG2 A;  1DGL A;  2R32 A;  3TEZ A;  1MS3 A;  4MSV A;  5D21 A;  1FOD 2;  1UO9 A;  3D5O A;  2SLI A;  1K12 A;  1OKQ A;  1WCD J;  1D2S A;  1W8U A;  2BV4 A;  2P3J A;  3N9P A;  5F2S A;  2RDS A;  1Z78 A;  4L0P A;  1Z7S 2;  3J7N A;  5FO8 B;  3MFC A;  4DS0 A;  4UWD A;  4BIF A;  5JOW A;  4CU8 A;  1KQR A;  2IXK A;  4V2V A;  4XVH A;  5H9Q A;  3G7D A;  2BNO A;  3LF7 A;  2X10 A;  1K42 A;  3P3N A;  5T5J A;  2DCZ A;  1K45 A;  1FX5 A;  2PYT A;  2XQR A;  5IVC A;  4XCA A;  3FZ3 A;  3VGI A;  3DL3 A;  4AG4 A;  2GNB A;  2HBT A;  1IQD C;  1UQX A;  4ET7 A;  4Q4Y 1;  3ZSL A;  1JOP A;  1LOG A;  5AC9 1;  4Q4W 1;  3RDI A;  2D97 A;  4CUA A;  4ATF A;  4XZU G;  5C3R A;  4BOW A;  2DV9 A;  2WQ4 A;  3IMN A;  4ES9 A;  4UYB A;  2ARX A;  3U1X A;  4NRQ A;  4AHY A;  1EV1 1;  4AFA A;  3B93 A;  3AMN A;  2X05 A;  4YZ3 A;  4H2A A;  4ARX A;  4Y20 A;  1S0G A;  3WDW A;  3T3Y A;  2GH8 A;  2A6Y A;  2PLV 1;  4CCE A;  1NE6 A;  3N7K A;  4N43 B;  4BU2 A;  4WVZ A;  1YNA A;  1Q8S A;  4XBQ A;  2WS9 3;  4BB3 A;  2FD8 A;  1A34 A;  3IDB B;  2AC1 A;  4BH9 A;  3EB7 A;  1ND2 C;  1DYK A;  1RUJ 1;  3WNM A;  4QXB A;  3WQ7 A;  2VZ3 A;  2ZGU A;  3UKT A;  3VB9 A;  2RS1 1;  2GNM A;  2YY1 A;  4YGB A;  3U4X A;  4M4P A;  3SIS A;  3MI8 A;  2W94 A;  2GC1 A;  2QQP A;  1AYM 1;  1W05 A;  2ZZJ A;  1BCX A;  3KHB A;  3RYP A;  2VQA A;  3V0A B;  4HPK B;  2VR4 A;  1KXG A;  4ASK A;  1BK0 A;  3V0B B;  1GBG A;  2QDN A;  1FOD 1;  4GMP 0;  2Y6F A;  1EYB A;  1VBE 3;  2MEV 2;  2JIJ A;  2WZR 3;  1XRU A;  4HL0 A;  4AQ2 A;  1JYN A;  1Z7S 1;  3VDD B;  5FV3 A;  3MIE A;  5IYY A;  4P00 B;  1V0A A;  3NNM A;  2UYB A;  1PIV 3;  1ZVF A;  2EIE A;  4AGG A;  2E7Q A;  1O7F A;  2EXJ A;  2JEN A;  3M3E A;  3I59 B;  1CZV A;  3IB3 A;  4HET A;  2XBO 3;  4LR4 A;  1UKR A;  4XET A;  3VHN A;  2EVX A;  3MLK A;  5LBF A;  1M4W A;  2DCT A;  1MS1 A;  5LRS A;  3ACG A;  4CDU A;  3BPS A;  3BVC A;  3GBW A;  4H7M A;  4XDP A;  1VBB 2;  1RMU 3;  3HBZ A;  2G9Z A;  3OGV A;  1VPH A;  1S0C A;  2XJP A;  1JYV A;  4H3W A;  1ZRR A;  3LCP A;  3HT2 A;  1COV 2;  2BP6 A;  4NPL A;  4BQ2 A;  3D6E A;  1XSR A;  2VW1 A;  1D0H A;  2RDQ A;  4NWV A;  2ILM A;  4BLJ A;  2E53 A;  4BXF A;  1NXD 1;  5DAP A;  4S2F A;  1ODN A;  1YFW A;  3AVS A;  5DUU A;  4R4X A;  5L19 A;  3E1F 1;  4GJY A;  4IEW A;  4AI0 A;  1YQ6 A;  3LDR A;  3UGH A;  1PZ8 A;  3OUH A;  1Y9M A;  1O3T A;  2EXK A;  1KIT A;  3R4S A;  5KXD A;  3FFZ A;  1MZ5 A;  4RGA A;  4LQR A;  1S0F A;  2ZX0 A;  1ZBA 2;  4XMA A;  3WW3 A;  5I93 A;  4MH0 E;  3G6J B;  3GZE A;  1LGN A;  1LNS A;  2VVF A;  1W39 A;  4IET A;  4Y5Z 0;  1NOV A;  1WCS A;  1OH3 A;  4PI0 A;  4IEU A;  4NE9 A;  4FPE A;  5LWB A;  4ZHN A;  3ZFG B;  1YQ5 A;  4YVW A;  1S0E A;  2IZW A;  3VBU B;  3BB6 A;  1J3Q A;  3KT1 A;  1BJQ A;  2O14 A;  4IGQ A;  4Q4V 1;  5FQ0 B;  1ZRC A;  1N1Y A;  1WBF A;  2VBD A;  4PF5 A;  1FPN 3;  5EPA A;  2ARC A;  2MEV 1;  5FLH A;  4DRV A;  3O1T A;  4BPZ A;  3HPN A;  4FI9 A;  3VL8 A;  1V6I A;  3EMR A;  4AGV A;  5DAV A;  2XHN A;  3U07 A;  3TRS B;  1V6O A;  2YBP A;  4Y1X A;  1ONA A;  1ULD A;  1YQ2 A;  2CY6 A;  4N43 C;  5FY8 A;  1F2N A;  4OUM A;  2GC3 A;  3MW4 A;  1PHM A;  5FY5 A;  1HV0 A;  1VBB 1;  4LE3 A;  2LRP A;  2XJU A;  2VOW A;  3USS A;  2OZJ A;  4GB3 2;  5IK8 A;  5J1X A;  1COV 1;  1E57 A;  4QGM A;  2WWU A;  2JKB A;  3LB9 A;  4Y1Y A;  4EV0 A;  3MW3 A;  5F3I A;  4Z92 B;  4XZP A;  2FZ2 A;  1R1Z A;  2FCU A;  3WNX A;  1JYW A;  5CZK A;  4A7Z A;  1GZW A;  5CVR A;  1A8M A;  2J22 A;  3WDU A;  1HKD A;  2VQ0 A;  4CCN A;  2JIG A;  2D93 A;  4EN0 A;  4B7E A;  3ROU A;  1XQN A;  4R9A A;  1PO2 3;  1ZZ6 A;  3WF0 A;  4LO8 A;  4N90 A;  2DTW A;  3AP9 A;  3P1I A;  5IVY A;  5I0R A;  2F4P A;  3H7J A;  2A5Z A;  4CXY A;  1OF3 A;  3VDD C;  2Z2S B;  2YPD A;  3PJQ A;  2WDB A;  4LA2 A;  4Y4Y A;  4DUW A;  2AEY A;  2LM3 A;  2RHP A;  1GU3 A;  1ST8 A;  2NZ9 A;  2BBV A;  2A1X A;  2VD7 A;  3M3O A;  3R4U A;  4Y33 A;  1CZS A;  1G9B A;  1ZBA 1;  2F17 A;  1RHI 3;  1K5M B;  3QCW A;  2TUN A;  5JZG A;  1CJD A;  4YRD A;  3VZJ A;  3NQH A;  3AYD A;  2WWS A;  3PDQ A;  2WO7 A;  3PVO A;  3S6P A;  2TNF A;  4KG0 A;  4BK5 A;  3HNY M;  4RD7 A;  2GZW A;  3M8L A;  2JEC A;  3SEE A;  1YFX A;  5A6Y A;  3O0W A;  1LU1 A;  1A6C A;  2D7F A;  5G05 L;  2ARB A;  3I2H A;  1LAJ A;  3HBK A;  2DVD A;  2VNG A;  3TWI A;  3R05 A;  4AQT A;  1LHW A;  2VUA A;  4BZ4 A;  4Q8K A;  4D6S A;  4CPB D;  5IK5 A;  4XF1 A;  4XUO A;  2ZGN A;  5A3O A;  5L36 A;  1UCX A;  3NO8 A;  4QPW A;  4JGZ A;  1C5I A;  1G86 A;  2JB4 A;  5CAD A;  4B29 A;  3RYK A;  4Y5S A;  4IE6 A;  2EF6 A;  2E26 A;  1RJ8 A;  1QU0 A;  2B9V A;  1Y4W A;  2DVG A;  1WD4 A;  1J1T A;  2PHF A;  5B2G B;  1UOG A;  1W9F A;  1QJU 2;  2BW8 A;  1AJK A;  1QXP A;  1F15 A;  1UU6 A;  2AAC A;  1OKO A;  3DCQ A;  4IUG A;  1F4A A;  4XJZ A;  4OI0 A;  3OEA A;  4FVV A;  5CBL A;  4QQO A;  2BVV A;  2J1R A;  3ZXL A;  1V6L A;  4C90 A;  3MEP A;  4J1W A;  4NRM A;  1AR6 2;  1DZR A;  2FCV A;  5FZ8 A;  3ZFG C;  2YMZ A;  5K7P A;  2F6B A;  4EWD A;  3IMM A;  4B4R A;  3VBU C;  1CAW B;  2QQU A;  4K1Z A;  5C4W B;  2EXI A;  2Y6J A;  1QMJ A;  4IL7 A;  2ARE A;  4FP2 A;  3AKS A;  4NAO A;  2KA3 A;  1QXJ A;  1TME 1;  2VNR A;  3EHK A;  1H2K A;  1H6X A;  4FT8 A;  4JTN A;  5E16 A;  3BKZ A;  5C3P A;  2GMP A;  1SBF A;  2V72 A;  2H6B A;  5FYB A;  3SCG A;  1W6Q A;  1SG3 A;  2RG4 A;  5F8P A;  1DZT A;  1RUG 2;  1BMV 2;  1PO1 3;  2ZAA A;  2XWB B;  1YLL A;  1CES A;  1P8J A;  3N35 A;  3IDE A;  4Y1V A;  1W8T A;  3AZV A;  2AGS A;  3BGA A;  1A8D A;  2MPF A;  2P6C A;  4YW3 A;  1R08 3;  5FZK A;  3QD6 A;  2QCS B;  3ECQ A;  3ZN4 A;  3DYM A;  1SZB A;  4MGQ A;  3E97 A;  3MDP A;  3PL0 A;  4YZ4 A;  4Y5T A;  5KHK A;  1OFN A;  1AX2 A;  4AI2 A;  1RUF 2;  3CF6 E;  4XFI A;  5IWF A;  2JDU A;  2Y0I A;  1WCK A;  2A3X A;  2XVL A;  3TNP B;  3ZO0 B;  4YFZ A;  3GAL A;  4E8D A;  4PJY A;  4LO5 B;  4URA A;  1OXC A;  2HWE 3;  3MIB A;  4D6R A;  4W50 A;  1YI7 A;  2QUO A;  4LJH A;  5C71 A;  3WDX A;  5M0T A;  1GQH A;  4A44 A;  4XUN A;  4LOT A;  2HWF 3;  2LAL A;  3TEX A;  1UZW A;  2KXL A;  4E2Q A;  1H2L A;  4CCD A;  1DZQ A;  1QJU 1;  4XPV A;  1F8V A;  5JSR A;  4DEV A;  1XE0 A;  1CAV B;  5JI7 A;  4F3J A;  3H3L A;  4UW5 A;  4NIH A;  3FUO A;  4YNI A;  1K5M C;  4UI9 L;  4M3C E;  1MS8 A;  3H8O A;  1MS0 A;  4NAM A;  3C7H A;  4E2G A;  5C3Q A;  4J25 A;  4BQW A;  3RZL A;  3DEC A;  1O91 A;  2PQQ A;  1PVC 3;  5F2W A;  1CAX B;  3E6D A;  3IAQ A;  1RB8 G;  5J09 A;  1R64 A;  4AVA A;  3ZPO A;  1LU2 A;  3VN4 A;  2ZEX A;  4Q0Q A;  1CGP A;  3J7L A;  5LK5 A;  3WR0 A;  4D3W A;  4LIT A;  2ZMN A;  4DY5 A;  4AVT A;  4ES8 A;  1ND2 A;  3KF5 A;  3NVC A;  1DGR A;  3WNK A;  2FHR A;  3KT7 A;  4LO4 B;  1OA4 A;  2CWM A;  2DCJ A;  5F37 A;  1US2 A;  1G9A A;  3KV5 A;  1RUG 1;  3DKW A;  3T1L A;  1BMV 1;  5FYU A;  2B45 X;  3ZFF B;  1SBE A;  1A3K A;  2CDO A;  2VH9 A;  3AMQ A;  4XFH A;  2XL7 A;  1G6N A;  1HRV 2;  2YFZ A;  3MIH A;  3H8U A;  2FMY A;  3PTY A;  4JV4 A;  5DUV A;  2XB6 C;  3W20 A;  4B4Q A;  5A7W B;  2WFF 1;  1ULO A;  4J6G A;  2VE1 A;  5FTT C;  5ERL A;  4RSU A;  4XEZ A;  3KD4 A;  4MLO A;  4P5H A;  3ACH A;  2VY0 A;  4GAL A;  4GXL A;  1TVG A;  1CIW A;  3KVB A;  3KZ4 C;  4DIQ A;  3LD8 A;  3J8F 2;  4MG2 A;  2EA7 A;  1UMZ A;  3AP6 A;  1QGL A;  4A42 A;  2QQL A;  5C5U A;  4BLI A;  1RUF 1;  5F3G A;  3IDA A;  5DUX A;  2VMC A;  1FV3 A;  1UMI A;  3I2J A;  4HN1 A;  5C4W C;  2O0O A;  4YZ1 A;  3VHP A;  3WW1 A;  3CL1 A;  4MGK E;  1U5X A;  4LBQ B;  3O1U A;  4LK6 A;  1JU4 A;  5FZ0 A;  3WW4 A;  5LZ6 A;  1LHN A;  4AFB A;  2P4E A;  1AR8 2;  3ES4 A;  4IGO A;  3OBZ A;  5GLU A;  1W6P A;  1AR9 2;  2XDV A;  2R1B A;  1IOA A;  2RV9 A;  3AL6 A;  3VV1 A;  4E4H A;  4UW6 A;  2VGD A;  3VKN A;  4UFK A;  2WWJ A;  2Z69 A;  3KS7 A;  3JBG 2;  4XFA A;  2JDP A;  4KL1 A;  2VM9 A;  1VB4 A;  2BUK A;  5F6L B;  3H0O A;  3POE A;  5FZF A;  5I0T A;  3SH4 A;  4AOC A;  4ZZ8 A;  1WW6 A;  3SCH A;  1CVN A;  4XIL A;  3HD8 B;  3RG0 A;  2BWC A;  4AFM A;  1NE4 A;  4LMF A;  2D6P A;  3PUH A;  2XJQ A;  3POW A;  4FAH A;  1R09 2;  4BME A;  5JI9 A;  2D5F A;  1V6M A;  1FAY A;  2OZ6 A;  1GLH A;  1YHF A;  2HJI A;  2R0F A;  1V9U 2;  3I4I A;  4HKW A;  5LK7 B;  2CSG A;  4XAB A;  4XCB A;  2WQ8 A;  1NZI A;  3WG1 A;  2VVE A;  3PVE A;  2DUR A;  2P6H A;  4WZC A;  4NWW A;  4JVA A;  5ACA 2;  2GN3 A;  4YWA A;  1HRV 1;  3NKG A;  4FFG A;  1BHG A;  4PT6 A;  4QX5 A;  2Q8O A;  2X29 A;  5A3N A;  2RDN A;  1W90 A;  4F7Z A;  3ACF A;  4IEY A;  2VMG A;  4CDW A;  2VUL A;  2A6W A;  2OUH A;  4K21 A;  5A3U A;  1RUE 3;  3K51 A;  2BGC A;  4NHK A;  4KH9 A;  5KHI A;  4PLM A;  3PVB B;  1W8W A;  2ORX A;  3OF1 A;  4BJ0 A;  1L7L A;  1UY4 A;  1ZZ8 A;  3GZU C;  3ILN A;  4XUR A;  4YVS A;  3VBF A;  3VKM A;  4AW7 A;  4LBQ D;  2KM2 A;  3PUA A;  1GWK A;  1DQ4 A;  1POV 1;  4LUK A;  4N43 A;  3MIG A;  3FE5 A;  4A45 A;  5LCW L;  1R1A 2;  4Y24 A;  1AL2 3;  2NN8 A;  4O7X A;  4QQ2 A;  5BNP B;  1RUI 1;  3KGL A;  3RZK A;  4KQ7 A;  5CU1 A;  4COV A;  3WXP A;  5A3L A;  2D5H A;  2QQW A;  3NV1 A;  1D4V B;  2ZAB A;  4GZ9 A;  1IKQ A;  4MAD A;  4XAE A;  1ZZ9 A;  4KBZ A;  4BQ4 A;  3HNM A;  4JKM A;  1H4G A;  3ZXJ A;  1WA4 A;  4WBB A;  2Q1Z B;  4YG6 A;  3ZFF C;  3B00 A;  5JZG B;  1RUD 1;  2BNN A;  3VD5 A;  2X53 S;  3VDB A;  4CP0 A;  2HBU A;  3V0A A;  2RMU 3;  3FHA A;  3V0B A;  4O9G A;  4MHU A;  4A2U A;  3LPF A;  5HBA A;  1NG0 A;  4K8R B;  2Y33 A;  4HBN A;  2LS6 A;  4IW3 A;  2E32 A;  3O1S A;  1XYO A;  5A7P A;  3LQC A;  2ZEY A;  4IEO A;  1UW8 A;  3CDZ B;  3VDD A;  1UZV A;  1UNB A;  4EN9 B;  1FXZ A;  4QB1 A;  3BTY A;  4QX0 A;  1QJF A;  1PZ9 A;  2GU9 A;  3INA A;  4MVT A;  4Q1R A;  1XE7 A;  3WD5 A;  1V9U 1;  4YZ5 A;  3B3Q E;  5FP8 A;  1NLR A;  4ERO A;  2WZ8 A;  2GNT A;  1DIW A;  1L7R A;  4R9C A;  3AMH A;  2WAO A;  4QM9 A;  5FY0 A;  3L2Y A;  4GWM A;  4JGZ B;  3EXU A;  4DXR A;  1MS4 A;  2B39 A;  2VMI A;  4QPY A;  1UIK A;  4GMP 3;  2NLR A;  1UPI A;  5ACA 1;  1ZBE 3;  3AJY A;  1VIW B;  4U36 A;  3WDT A;  5L9R A;  2TEP A;  4DNY A;  2AUY A;  2WA4 A;  2RS3 2;  3KCC A;  5KHH A;  3RWK X;  4YGC A;  1VAL A;  4IXL A;  2ZGM A;  3T2P A;  3NW4 A;  1AVB A;  2XJV A;  1JUI A;  3HIF A;  3LEG A;  4C91 A;  1IQA A;  1JYC A;  3ZSE A;  4COU A;  3BPZ A;  3SEP A;  1EY2 A;  4WM7 A;  3GF6 A;  1E5S A;  1APN A;  3UGG A;  1PZ7 A;  1QDO A;  2HYX A;  5A33 B;  1O3S A;  1YUD A;  4XE9 A;  1VBA 2;  1OOP B;  4WZF A;  1FV2 A;  5CA6 A;  1W2O A;  2VAU A;  3JCI A;  4N9I A;  3IDC B;  5A6X A;  5IFP A;  1R1A 1;  3O1P A;  3LEM A;  1BEV 2;  3LDK A;  5FZC A;  2ZAH A;  3WNO A;  4YW5 A;  2HLE A;  3I3Q A;  4TYS A;  1ENQ A;  2UY9 A;  1HXS 3;  5FUN A;  3ZXE A;  5KHG A;  1AL0 G;  4OHY A;  1PGS A;  2BDR A;  3ITQ A;  3ZXA C;  3GHM A;  4DZG A;  4Q8L A;  4Y1Z A;  1W6O B;  4IEZ A;  4FO9 A;  4I30 A;  3ZYG A;  1GWL A;  1W8Z A;  3V64 A;  1C28 A;  4LO6 B;  3SHR A;  3BCW A;  1DYO A;  2VUD A;  3NNF A;  4ZPI A;  3ZFG A;  1QNW A;  4AVC A;  2W5F A;  2ZXQ A;  4S2H A;  3HQX A;  2GC0 A;  3VBU A;  1GOH A;  2NP0 A;  4XJ8 A;  4OMD A;  3W9A A;  4ITC A;  1TMF 1;  3N9M A;  4PQ9 A;  1S0B A;  2VCM A;  3BIW E;  2IXJ A;  2IXL A;  1CJP A;  2BVB A;  5LRR A;  3VUO A;  3GCW A;  1FT9 A;  2R06 3;  1BBT 1;  1O5L A;  1EUT A;  4JC1 A;  5AFB A;  1MEC 3;  3Q9O A;  2WS9 2;  3CJI B;  4X6R B;  4UW4 A;  2DVF A;  1DU3 D;  1OA3 A;  2C1F A;  4P02 B;  2JG8 B;  1JI6 A;  5EXO A;  5BNN B;  4CCJ A;  5A3W A;  4OHZ A;  5HCB A;  4CPB A;  5FIX A;  2P3I A;  3NNG A;  3ENR A;  4OI4 A;  5BNP C;  5JXG A;  4AEJ A;  4YM2 A;  2BNM A;  3H7Y A;  2R49 A;  1W03 A;  3ACI A;  4PHZ A;  5EJ3 A;  1QJX 1;  2WRA A;  4U2A A;  2RM2 1;  1S2B A;  4M0H A;  3D82 A;  3UGF A;  5CG8 A;  5DDJ 3;  1MS9 A;  5A7S A;  4IER A;  3VZL A;  4EN8 B;  1RVF 2;  3HMY A;  1EAH 3;  5JZG C;  4Q0P A;  1ALY A;  4LKE A;  4E2S A;  2LRO A;  3NV2 A;  3LPG A;  4QPI B;  5JMC A;  2J1E A;  1LRH A;  1VBA 1;  4QQL A;  3KSC A;  4W6W A;  3SNM A;  2NQY A;  5A6Q A;  3WZ1 A;  2PHR A;  2UYA A;  1Q5O A;  1V6J A;  1MZ6 A;  2J7M A;  3MF6 A;  4Q0U A;  4QKF A;  2Y38 A;  2ZGL A;  3S30 A;  1UXX X;  2WAA A;  2VCC A;  4UXA A;  4W8J A;  3WP4 A;  5FPX A;  3F2Z A;  3PUR A;  4L2N A;  1YYN A;  5C9A B;  5CAZ A;  4BK4 A;  1UPS A;  4FPG A;  1FNY A;  1K5M A;  2ZHL A;  4HVR A;  2JD4 A;  3PUI A;  4JGZ C;  4Q0V A;  2ZX4 A;  3K4Z A;  5AC9 2;  1O8P A;  4LXL A;  4ORF A;  5A80 A;  4YLZ A;  2QZ2 A;  3ETQ A;  2HYK A;  1ULE A;  4QHO A;  5FO7 B;  3TEY A;  1NQD A;  2RJL A;  2J1A A;  4B7K A;  1CX1 A;  5KHJ A;  1MVQ A;  1SFY A;  5J36 A;  1W2T A;  4YPJ A;  1EUU A;  1SAC A;  2VCA A;  3RJR A;  3IKW A;  1W6M B;  1YFY A;  1RUH 3;  2VUJ A;  3OGG A;  2JE7 A;  2WS9 1;  2PLV 2;  3LA2 A;  1OOP C;  1HN0 A;  1YWK A;  1XSQ A;  4YW1 A;  3UT0 A;  3ZPY A;  2WL1 A;  1XNK A;  1QH6 A;  3QAC A;  2R04 2;  3T2Q A;  5EJZ B;  5KXC A;  3ZVX A;  3S5A A;  2VOT A;  1RUJ 2;  3KQR A;  4IES A;  1X50 A;  4UFL A;  3WF2 A;  4YG0 A;  2RS1 2;  3RS6 A;  4V1P A;  2D43 A;  3T0A A;  4BQ5 A;  3LKJ A;  2IFR A;  2P34 A;  2B4K A;  2FDK A;  4OZX A;  4R4Z A;  2HWB 3;  3K75 B;  3AKP A;  3NWK A;  3KQ4 B;  1RVF 1;  1UY2 A;  1KRI A;  1WCQ A;  4FOV A;  2E31 A;  2BBA A;  1N1T A;  2YU2 A;  3LIG A;  1VBE 1;  4FOY A;  4WVV A;  5DQ0 A;  1I5P A;  2VTX A;  5F5I A;  4C0H A;  1VR3 A;  5CNA A;  1CAW A;  5C4W A;  1W9S A;  1TZO A;  1PM4 A;  4DOU A;  5JSP A;  2WNV A;  1NLQ A;  1YJK A;  3V65 A;  3NV3 A;  1IZ3 A;  2RS5 3;  3WCS A;  1WLT A;  2QQJ A;  1QH7 A;  4W4Z A;  4CUB A;  5JR2 A;  3NST A;  5LBB A;  4O65 A;  4BQY A;  1AHS A;  1OLQ A;  2LW8 A;  5FLI A;  1GFF 2;  1IS5 A;  4NR1 A;  4PIX A;  4KI5 M;  5F3E A;  4B4P A;  2XR4 A;  3CJI C;  4XQW A;  4KBB A;  3CJX A;  2P37 A;  4KU8 A;  4SLI A;  5BNN C;  2JG8 C;  2DBI A;  2W39 A;  4NII A;  1QF3 A;  3MPB A;  2YC0 A;  1RMU 1;  4YM0 A;  5K4L A;  5FBZ A;  4D7T A;  5FPA A;  3IT8 A;  4Q4X 3;  3MLJ A;  2OVU A;  5BUV A;  5LB6 A;  1HRI 3;  5DN2 A;  1KS4 A;  3ZYH A;  1UYP A;  4CDW B;  4IE0 A;  5C3S A;  5KC5 A;  2GP3 A;  3NJZ A;  4OHX A;  2ZHM A;  2P3K A;  2ZX3 A;  3PU3 A;  2CL2 A;  2W1S A;  5J37 A;  1S55 A;  3T2T A;  4W6X A;  3OY8 B;  3AC0 A;  1DP0 A;  1LHV A;  3Q8F A;  2Y6H A;  4YVS B;  4ZZ5 A;  3VBF B;  4QPI C;  1YJL A;  1K5J A;  3K4D A;  2WYS A;  1WMD A;  4P5Y A;  2GH2 A;  3I2F A;  4MUV A;  4X8N A;  4BYY A;  4A3X A;  1XND A;  2R04 1;  2C4X A;  1X82 A;  3HQU A;  3ZIX A;  1OC1 A;  5JXH A;  4HSL A;  5L9V A;  2VNV A;  2YC4 A;  1RHI 2;  4JDN A;  5B4X A;  5C9A C;  3VLB B;  5CYY A;  3ZR6 A;  3WY6 A;  2CGN A;  4JX0 A;  3LSD A;  1CAV A;  4FTB A;  3LGR A;  4MO3 M;  5FOJ B;  1OI6 A;  1OHF A;  2C0Z A;  3I2G A;  4NN0 A;  4Q29 A;  2HEW F;  1CQ9 A;  3RMX A;  1L3J A;  3B01 A;  3CKH A;  3NKT A;  5EWS A;  3SXW A;  1FAT A;  3T0B A;  1NCR A;  1FPN 1;  1CAX A;  3N7L A;  4LHS A;  4PQQ A;  1OUS A;  4Q4V 2;  4KMQ A;  2W95 A;  2YBK A;  1GZC A;  5JR7 B;  2ZKL A;  1W2N A;  1AX0 A;  4RHV 3;  1QNY A;  2HWC 3;  4COW A;  1X9T A;  1REF A;  4OUL A;  1KFU L;  4HVO A;  4CRQ A;  1UYY A;  3B7M A;  4SBV A;  4CZS A;  4XOG A;  2V73 A;  2DF7 A;  3MF9 A;  2CWS A;  4FCA A;  1N3P A;  4MV2 A;  5J96 B;  3I54 A;  3VBO A;  3ZFF A;  2J42 A;  1CIY A;  5CIR A;  3O0V A;  3ACL A;  1U5I A;  2ZCW A;  1YIP A;  3O14 A;  2NMO A;  3RNS A;  2YPJ A;  3ZX7 A;  2D3P A;  2DCK A;  1VBC 2;  1LED A;  2J1T A;  5APA A;  4QHZ A;  5A7W A;  5DAX A;  2OKX A;  1UZZ A;  3KWV A;  1X9P A;  4NHY A;  4C8D A;  2FQP A;  5F9T A;  2QE3 A;  5L7O B;  1Y43 B;  4NMI A;  2CV6 A;  3VL9 A;  3WT3 A;  2WAB A;  5HCA A;  2OQ6 A;  2ZMK A;  5FY7 A;  1U0A A;  4CU9 A;  4WM7 B;  1JH5 A;  1PO2 1;  3TOJ A;  3GYD A;  5BNO B;  5T54 A;  4YG3 A;  4WV8 A;  5LA1 A;  1VRH 2;  3OD4 A;  4LKD A;  3BTZ A;  3D4K A;  1OVP A;  4QX7 A;  4LBQ A;  1MZF A;  4NPM A;  2PQS A;  4RR3 B;  4XDQ A;  5EHD A;  1JZ6 A;  2AEZ A;  1YCI A;  4Q0S A;  1RXG A;  4OUE A;  1RHI 1;  4Q4Y 3;  3WP5 A;  1DYP A;  4K3U A;  1RUC 3;  3ZLI A;  2GDF A;  3A21 A;  4WVM A;  5B4N A;  5KR7 A;  1GQG A;  1D4M 3;  2QQN A;  2XKP A;  4ZS2 A;  2E63 A;  2P5B A;  3CNA A;  2XG3 A;  3TN9 3;  4OLL A;  5F5Q A;  2OX0 A;  2YYO A;  4BA6 A;  3IM0 A;  1W0N A;  1GP4 A;  2YB7 A;  3CZU A;  5DZF A;  4A4A A;  2YU1 A;  2C26 A;  1ZYB A;  2CTV A;  2TBV A;  5FY1 A;  1GQP A;  3I3M A;  2W3J A;  1CPM A;  3J7H A;  1C8M 2;  3ILR A;  5FPL A;  3V56 A;  2W47 A;  4CDW C;  2UWC A;  5FJK A;  1UMH A;  4LBJ A;  2VPV A;  2J1S A;  4XC9 A;  3OJB A;  3FN9 A;  4QGN A;  4UW3 A;  3GCX A;  4AAX A;  1AR7 3;  4YVS C;  4CCM A;  5CKQ A;  3VBF C;  3OG2 A;  3ES1 A;  3ZXG A;  4BIO A;  2HWF 2;  2IWG B;  2VTX J;  3OBA A;  4CDQ A;  1H8V A;  2GP5 A;  3T2O A;  3EO6 A;  1WW5 A;  3OBT A;  5J98 B;  2A3W A;  5IW0 A;  2GAU A;  1VBC 1;  1BZW A;  1GUI A;  1SHW B;  1Q43 A;  4QGL A;  2FBE A;  2IFW A;  5JWP A;  4DY3 A;  1LEN A;  3QLQ A;  4UFH A;  4JDM A;  2Y8K A;  2Y6K A;  5D2A A;  1NYW A;  5H9S A;  3RSJ A;  4EN7 B;  4PLN A;  3K46 A;  1FOD 3;  3ZYP A;  5F1R A;  2EXH A;  1ZRE A;  4M4R A;  5FMO S;  1SPP A;  1ZZB A;  3AKT A;  1Z7S 3;  3DKQ A;  2PN5 A;  2EIC A;  4AWD A;  1VRH 1;  2J1V A;  5FKC A;  5ANQ A;  5BNP A;  1RL3 A;  2OYZ A;  1ASJ 2;  2FMD A;  2YBS A;  2ZA9 A;  1TME 2;  3ZYI B;  1PMH X;  4OMC A;  5FO9 B;  3MV1 1;  3WG4 A;  5FRE A;  1PO1 1;  5FYZ A;  5FYY A;  4XAC A;  3HJR A;  5EYY A;  2BEO A;  3WLU A;  3RPQ A;  2D6K A;  4AHX A;  1KJL A;  1W8H A;  1HN1 A;  1JS9 A;  3FX3 A;  1R08 1;  4Z07 A;  3WNL A;  3T30 A;  3NAP B;  4MGY E;  3M3Q A;  2K2S A;  1D0G A;  4GWJ A;  4O9E A;  2Y6L A;  3RRD A;  1UXZ A;  1F5F A;  1C8M 1;  3S0M A;  5L7O C;  3GNE A;  4BDV B;  4AF9 A;  1JZ4 A;  4IV3 B;  1JMU B;  2V4A A;  3A23 A;  1XXN A;  2XLF A;  3GJB A;  2PTM A;  4Z82 A;  1I5Z A;  2JKX A;  4N7U A;  4L97 A;  4WM7 C;  5FYI A;  5BNO C;  1SMV A;  2BFU L;  3I2O A;  5FYC A;  5A1F A;  4XFB A;  3U78 A;  4AHZ A;  3ZKU A;  2DCY A;  4JHZ A;  2VG9 A;  4HN0 A;  2JDA A;  2HWF 1;  4OCT A;  5H9R A;  1DLL A;  4RR3 C;  1WCU A;  3JXS A;  3FLR A;  3N9L A;  1LOE A;  3PHM A;  1D7P M;  2AH2 A;  3W5M A;  2Q1M A;  1LKN A;  1SDD B;  4CUG A;  2E9Q A;  5FZ6 A;  1IHM A;  2XJT A;  3CO2 A;  1S0J A;  3NNJ A;  1WD3 A;  1PNG A;  1IPJ A;  2IC1 A;  4M01 A;  5I8Y A;  4YW4 A;  2BGO A;  3KM5 A;  5JDB A;  2MEV 3;  5A33 A;  2V09 A;  3OGJ A;  3OCP A;  2YUE A;  2GC2 A;  4PBO A;  3JD7 2;  1OOP A;  1I9R A;  2B46 X;  4P9L A;  2ZPX A;  2PXJ A;  1SFP A;  4MX3 A;  5FDB A;  1NQJ A;  4D0Q A;  1XYP A;  3THC A;  2WNV B;  2VUC A;  1ASJ 1;  1ZX5 A;  5E89 A;  3H8X A;  3ZIW A;  5FK7 A;  4A7K A;  4MGI E;  4OHW A;  2QBX A;  4B8E A;  1TEI A;  4ISR A;  2BQP A;  2DFC A;  2YXS A;  4FPO B;  4MXV A;  3AXD A;  1VBB 3;  4C0B A;  2VZO A;  1Y7B A;  4HMZ A;  1Q8V A;  4KWU A;  1W6O A;  3ZSJ A;  4NIA A;  1WZX A;  5F32 A;  4YZ2 A;  2VZT A;  3CIH A;  2YRO A;  1SLT A;  1AXK A;  4JRA A;  1XPW A;  3LSE A;  4LO7 A;  5GZC A;  1KGY A;  3RYR A;  1RC6 A;  2W2I A;  5BNQ A;  2WFF 2;  3I97 A;  3WIN E;  2QQM A;  3QH7 A;  2IXH A;  3Q8A A;  4FPJ A;  4ZON A;  5FPB A;  4CEY B;  2OT7 A;  5CKN A;  2XL9 A;  4RGG A;  5IJR A;  3FL7 A;  4BE3 A;  4LK7 A;  5FMD A;  2ZGQ A;  2JEM A;  4BMB A;  1FMD 3;  4YYO A;  1DGW A;  4E4S A;  3CJI A;  5FZM A;  3D8C A;  5BNN A;  4Y1U A;  2GME A;  2JG8 A;  2OS2 A;  2WC2 A;  2ZX2 A;  1QJY 2;  3E6B A;  4UBG A;  3HN1 A;  3O7O A;  3PNA A;  4XIK A;  3VBR A;  1ZBA 3;  4XF4 A;  5C8W A;  1JZ2 A;  4XJ9 A;  3LA3 A;  4FOQ A;  3RJ2 X;  3KVA A;  3LIH A;  4R9B A;  1US3 A;  4OQ9 A;  2CGO A;  2P2K A;  4NID A;  1LHU A;  1NAE A;  1LR5 A;  4JKK A;  3OUJ A;  5BPX A;  1HW5 A;  5EQU A;  4LHN A;  4QPI A;  4PIY A;  3NAP C;  1RJ7 A;  2YDE A;  3I3E A;  4FFF A;  1DQ2 A;  1LTE A;  1DHK B;  1NCR B;  3JD7 1;  3RQ0 A;  5JPM B;  5A32 B;  3GZT B;  1O4T A;  1C1F A;  1SCS A;  1UY0 A;  4D7S A;  1J59 A;  5FPZ A;  4ZU5 A;  4IV3 C;  3LA7 A;  3O1R A;  1X7N A;  3CMG A;  2JIC A;  1HB2 A;  2Q30 A;  1SQ4 A;  2WIN B;  3OD0 A;  1WBL A;  3PTR B;  4LOR A;  2BER A;  2Z79 A;  1GMM A;  1F35 A;  4LIV A;  4M00 A;  5C9A A;  5IAX A;  3WUC A;  1XC6 A;  1OSG A;  1Y9Q A;  3B9C A;  1AX1 A;  3WQ0 A;  3APB A;  3PVN A;  2JDY A;  3VBO B;  5LAT A;  5FP7 A;  4GB3 3;  4I0W B;  4CXX A;  3MFA A;  5JIA A;  4AQS A;  3QH6 A;  1AYN 3;  3OUI A;  3I2I A;  4XHB A;  4QX8 A;  5EV7 A;  1G9D A;  2R07 3;  3WG2 A;  3ATG A;  1A78 A;  5JSO A;  3GHN A;  3AFK A;  4IEX A;  4K40 A;  1STM A;  3FLP A;  5GKA C;  3WNN A;  3OSD A;  3OBR A;  1K3I A;  3KCX A;  5JOX A;  1X8E A;  5KXE A;  2PFW A;  1JHJ A;  1F5J A;  2KD7 A;  1SFN A;  3L9J T;  5FP3 A;  4B1M A;  2Q8E A;  3R4D B;  4D94 A;  5SV8 A;  1W6M A;  4QQP A;  1XU1 A;  4WM8 B;  4AGR A;  2RR1 3;  1CR7 A;  1NLS A;  5FYT A;  1OQE A;  1YXW A;  1QJY 1;  1UX6 A;  2RDR A;  5J48 A;  1RUI 2;  1LOD A;  3AZZ A;  2WNV C;  2Z4F A;  4HK9 A;  1NKG A;  4ONU A;  5E88 A;  3WDY A;  4CCL A;  5HCH A;  2WT0 A;  3JUU A;  3PMS A;  5I0D A;  1ZRF A;  3UK9 A;  3N7J A;  5CKM A;  3URF A;  3RZJ A;  2XLG A;  3J7M A;  2Y6G A;  4P9Y A;  3C7F A;  4NO4 A;  3ON7 A;  4WVM B;  1UZY A;  2XH6 A;  4QB2 A;  2EIB A;  4QXH A;  4XUQ A;  5A3P A;  3SQO A;  1Y9G A;  3ZXF A;  1RUD 2;  3I2D A;  2QTW B;  4DXZ A;  4QB6 A;  5JPN B;  3AMM A;  5FZL A;  3FMG A;  4QQH A;  3KMH A;  2H0V A;  4P9X A;  4CSW A;  2R06 2;  2RJK A;  4JQR A;  4RYD A;  4CEY C;  5L9B A;  2GND A;  2JE8 A;  2PAE A;  4HK8 A;  4QDQ A;  5LA9 A;  4E4Z A;  1CPN A;  2JE9 A;  4FQ4 A;  4KG8 A;  1S0I A;  4LBK A;  4E27 A;  5F3C A;  4RQP B;  3F95 A;  3ZYB A;  5LEK A;  5FBJ A;  3MUY 1;  4L92 A;  2W68 A;  1QJZ A;  2HEY F;  2Y34 A;  3O0X A;  4JGY B;  4GMP 1;  1DGR N;  1UF2 C;  1ENX A;  1VMJ A;  1ZBE 1;  3P6B A;  1QJU 3;  1J1L A;  4QX2 A;  4I3G A;  4ZU4 A;  4CDQ B;  2D3S A;  2Q5T A;  3JU9 A;  2ET7 A;  3NNL A;  1DGW X;  3WUD A;  3JQW A;  1J58 A;  3O1M A;  3FC0 A;  4P9W A;  1ENS A;  4M3C F;  4GJZ A;  3RZG A;  1AR6 3;  2Q8C A;  4GH4 B;  4QDS A;  3AMP A;  5T5P A;  3ZYJ B;  3S57 A;  1EP0 A;  1OPM A;  2K0G A;  3J26 N;  3X29 B;  1W3V A;  3OY8 A;  4LLF A;  1W9W A;  5JXJ A;  2UY8 A;  1SPP B;  2WA3 A;  2MHF A;  4G9S B;  2D6L X;  1BK1 A;  1V00 A;  3OPT A;  1NCR C;  2Y0O A;  4XJW A;  5FPV A;  1FI2 A;  1KEX A;  5JUV A;  2ES3 A;  2WKK A;  1UY1 A;  5AC9 3;  3IAP A;  3DEM A;  4UT5 A;  3RVH A;  3VD4 A;  1RUG 3;  3H3Z A;  3ZN6 B;  3A7Q A;  2YHJ A;  3KGZ A;  1E5R A;  2WII B;  3FLT A;  5IVV A;  3DV8 A;  1YFU A;  1H9W A;  4Y26 A;  1DCS A;  1JXN A;  2VU9 A;  1DQ0 A;  2ZJC A;  5DAQ A;  3W21 A;  3BTA A;  3UL2 A;  4AFD A;  5FYH A;  1HDK A;  5C6C A;  4AVV A;  2GN7 A;  1LOC A;  4LLO A;  4P14 A;  2WO1 A;  3VBO C;  4GD4 A;  2XUE A;  3C7O A;  2VVD A;  4FOW A;  4UFI A;  3S7E A;  3W5N A;  1LEM A;  3AL5 A;  1MVE A;  4Q26 A;  4C1X A;  4TLF A;  4OI2 A;  3LOB A;  2R06 1;  1TMF 2;  1RUF 3;  4N7I A;  3KHC A;  3CHX A;  1QQP 3;  1GSL A;  2XON A;  5GM0 A;  4HXC A;  3LWC A;  1BBT 2;  3ELN A;  1WW4 A;  2J1U A;  3MPP G;  4WM8 C;  1GV9 A;  4X6Q B;  3POF A;  4KGG A;  3IPV B;  5GAL A;  3RGB A;  5ABJ B;  1GNZ A;  3P5B A;  5K8S A;  2D44 A;  1CD3 G;  1ZZC A;  1QOT A;  4DFS A;  5FRA A;  5GLT A;  4XTP A;  4GWN A;  4LBO A;  1URX A;  2YC2 A;  4LUM A;  4OZO A;  3VD7 A;  1QJX 2;  1T6B X;  1Q56 A;  1UU5 A;  1VBD 3;  2RM2 2;  3PUS A;  4RS5 A;  4XDO A;  2ZHN A;  1POQ A;  4QMA A;  1UYX A;  3VKO A;  4UFM A;  5JMO A;  1ZA7 A;  4YGD A;  5L7O A;  4ZY9 A;  1EAH 1;  4RN5 A;  2DUQ A;  3MBW A;  1BVP 1;  4URT A;  3O5S A;  3HR9 A;  4IE7 A;  4AE2 A;  1Z0H A;  2E33 A;  5HCF A;  3TAY A;  4N53 B;  5BNO A;  4TSV A;  3T09 A;  2W46 A;  4D6Q A;  4LKS A;  5IVJ A;  2P3Y A;  1GP5 A;  1W9Y A;  4RR3 A;  2ORZ A;  4AI8 A;  3BOD A;  3WEZ A;  4HOO A;  3WDV A;  1JYX A;  4QX1 A;  2WT2 A;  3D0S A;  4GKX A;  5IUQ A;  3SIT A;  1PGL 2;  2A71 A;  4RQP C;  4N9H A;  3W59 A;  4N8M A;  5FK8 A;  4OQ8 A;  1BQP A;  1IGO A;  1WGP A;  3B5L B;  4XTM A;  4JGY C;  4CP1 A;  2WNO A;  5HXM A;  2E7T A;  3E5Q A;  1UOJ A;  4CDQ C;  2PHU A;  4GA9 A;  2LUW A;  1JHN A;  2XWJ B;  2WSU A;  1RXF A;  2QFE A;  4UF0 B;  2PHT A;  5IK4 A;  2WNE A;  4NHX A;  1G9C A;  3J8F 3;  2I45 A;  1JTZ X;  3SH5 A;  5BXX A;  2JDH A;  2PEL A;  1JW6 A;  4FFI A;  4AL9 A;  1POV 3;  1UAI A;  1C57 A;  1RUH 1;  1T6G C;  2EIG A;  3OOX A;  1WA6 X;  4GH4 C;  2JX9 A;  4XQ4 A;  2VMH A;  1CN1 A;  2XOM A;  1MQT B;  4LEJ A;  2WBK A;  3POI A;  2V5D A;  4KWK A;  2HH9 A;  5EZW A;  4KGQ A;  3IWZ A;  4LUL A;  4FXG B;  5DPN A;  1AR8 3;  3NJY A;  1L7Q A;  1W8F A;  3HQR A;  4IEP A;  5BV6 A;  3N7M A;  4QXC A;  1AR9 3;  1BXH A;  1CWP A;  4W6Y A;  3POG A;  3K48 A;  1LJ7 A;  2QDR A;  1DG6 A;  3QOP A;  5FJH A;  4DMI A;  1NA1 B;  3FHQ A;  3KF3 A;  3I2K A;  2WFP A;  1MAC A;  3VBR B;  2WT1 A;  4UOJ A;  4YW6 A;  2CNA A;  1RIR A;  2IXC A;  3HEI A;  3JBG 3;  2YGL A;  2DBN A;  1ZM1 A;  3NJV A;  4DXS A;  2JWP A;  4DEQ A;  4BXS V;  1QEX A;  4FPY A;  5T3N A;  4NRO A;  2PHW A;  4OUS A;  3DYP A;  5G04 L;  1VBE 2;  2CDP A;  4RHV 2;  2HWC 2;  2WZR 2;  1JZ8 A;  1R09 3;  2RS5 1;  1GZ9 A;  3MGU A;  4PIZ A;  3HN3 A;  3USU B;  2FDJ A;  1H1M A;  1V9U 3;  2WZE A;  2Q1F A;  4MZU A;  3AYE A;  1PIV 2;  4QU1 A;  1XNT A;  3IZO A;  5AFE A;  3VBS B;  2XBO 2;  2Y26 A;  3BAL A;  3DUI A;  5A3T A;  4LE4 A;  3PLQ A;  3H1M A;  1PGL 1;  2VOX A;  2UU8 A;  4FQZ A;  3U11 A;  5ABJ C;  5ACA 3;  3KB5 A;  2PA7 A;  3HWJ A;  3H9A A;  1WLD A;  3LFM A;  1NCQ B;  3Q8C A;  4Q27 A;  1B35 B;  1RMU 2;  1ZNP A;  1WKY A;  1YQC A;  2VOK A;  2VZQ A;  2VNO A;  2YG0 A;  4QKD A;  3NAP A;  1D2Q A;  2BGP A;  5FMC A;  4UFJ A;  4NHL A;  4FAG A;  3H42 B;  1JZ7 A;  2QNK A;  3NV4 A;  2CYF A;  2QVS B;  2W1W A;  3CEW A;  1PX4 A;  3P3P A;  4IV1 B;  1JYI A;  4IV3 A;  2WO3 A;  4ISQ A;  3AVR A;  4EZ4 A;  3N9O A;  4K6B A;  1IPS A;  1R1A 3;  5C8C B;  3M7A A;  2ID4 A;  4N53 C;  2VW0 A;  2P17 A;  4FP3 A;  3JB4 C;  5FMO L;  1LB2 A;  1LGC A;  3MO4 A;  5CFC B;  2GSY A;  3B02 A;  1O3Q A;  1F31 A;  2I2S A;  4I01 A;  1V70 A;  1JBC A;  5IT6 A;  1QWR A;  1RUC 2;  3FBM A;  1ENR A;  2E7A A;  1D4M 2;  3AZW A;  2XUM A;  2D3R A;  1G8W A;  3TN9 2;  1I6X A;  5IVE A;  4AED A;  2DVA A;  4NUB A;  3LEK A;  1ND3 B;  3W58 A;  4EWE A;  1ZA4 A;  3BIE A;  5EFU A;  1JU3 A;  3S7I A;  3EQE A;  1OQ1 A;  4UBH A;  5C5T A;  5DMY A;  4IEV A;  3T4V A;  5IVB A;  3VD9 A;  3ZR5 A;  5ISL A;  3RZH A;  2EID A;  2FDG A;  5LBC A;  2WN3 A;  1FPN 2;  3DXU A;  4YFW A;  4RHV 1;  4PI2 A;  2HWC 1;  2WZR 1;  4MGS A;  4CP9 B;  4BQ1 A;  4D69 A;  4EQV A;  1YI9 A;  4LBL A;  4BQX A;  5I0S A;  5TSW A;  4D8M A;  1VMH A;  1AR7 2;  1PIV 1;  2B7Y A;  4XHX A;  4HVQ A;  2BOJ A;  3WHT A;  4Y3O A;  1MQT C;  2VZP A;  3K4A A;  2XBO 1;  1HLC A;  2W52 A;  3AB0 A;  1X33 A;  4HKO A;  3PU8 A;  4KNC A;  2A73 B;  2VZS A;  1IS6 A;  1RUO A;  2XXZ A;  4QWN A;  1Q8Q A;  1W6N B;  1HIX A;  1V6N A;  2RS3 3;  4AFC A;  4EE2 A;  1AXZ A;  3I8T A;  4HG6 B;  4TN7 A;  2OUJ A;  5KWR A;  4XAA A;  1NA1 C;  1NZC A;  3KV4 A;  1FYU A;  4AI9 A;  3VBR C;  4Z8B A;  3GBG A;  3NL1 A;  2WNU A;  1ZRI A; 
#chains in the Genus database with same CATH homology
 1OUX A;  2BV4 A;  2JDY A;  5HCH A;  2WRA A;  4CE8 A;  1OUR A;  2BP6 A;  2VUD A;  1OVS A;  5A3O A;  1UZV A;  2BOJ A;  1OUS A;  4UT5 A;  2VUC A;  2XR4 A;  2JDH A;  2JDU A;  2WR9 A;  5A6X A;  1W8H A;  2BOI A;  2JDP A;  1UQX A;  5D2A A;  1OXC A;  2VNV A;  4AOC A;  2JDK A;  1GZT A;  2JDN A;  3DCQ A;  3ZDV A;  5A6Z A;  1OVP A;  2CHH A;  5A70 A;  5A6Q A;  5A6Y A;  2JDM A;  1W8F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...