2JEAI

Structure of a 9-subunit archaeal exosome bound to rna
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
215
structure length
207
Chain Sequence
QEIVLQPRSIVVPGELLAEGEFQIPWSPYILKINSKYYSTVVGLFDVKDTQFEVIPLEGSFYYPKINDIVIGLVEDVEIYGWVVDIKAPYKAYLPASNLLGRSINVGEDLRRYLDVGDYVIARIENFDRSIDPVLSVKGKDLGRVSNGIVIDIMPVKVPRVIGKNKSMYETLTSKSIFVANNGRIWAFSEEILIEAIRKIENESHIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EXOSOME COMPLEX EXONUCLEASE 2
publication title RNA Channelling by the Archaeal Exosome.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Hydrolase/rna
total genus 38
structure length 207
sequence length 215
ec nomenclature
pdb deposition date 2007-01-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2jeaI01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2jeaI02
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 2jeaI03
3HOWG 3PUVA 2B8FA 4LW1A 2A6HC 3U1KA 1X9NA 5BN3A 1BKBA 1HNZQ 2OCEA 2BH2A 1H9RA 3TQYA 4C3IH 2F4VQ 1OXSC 2MQHA 2MO1A 1EIYB 1L1OA 4L5QA 4A3BG 1SROA 3AFPA 3OW7A 1WOCA 4Y7NH 3BG3A 1YVCA 3DLLA 1VQJA 2QA4A 5C44H 1B7YB 4YCWA 4NXNL 1K73C 4WJ4A 5C44G 1PH8A 1DD2A 3CF5A 3T51B 3HGBA 3F2BA 2CTKA 1HCZA 2AXYA 5K36H 1HNWL 3TREA 4O0AA 1S40A 4JI5Q 4AYBG 1SMXA 1ZZJA 3TRZA 5C4JH 4LJZC 4DV4Q 4WALA 3CCVA 1PV4A 2I5MX 2D5DA 2P2RA 3KJPA 5IP9G 1CTMA 4BA2I 2MJHA 2E75C 2IHFA 5AJ3Q 1HZAA 4DR1L 1LABA 1KC8C 4JI6L 4LUVA 3N6RA 5GADC 4DUYQ 1SR3A 1M1KC 2E74C 3RLFA 4GOPA 4AQYQ 1KQSA 3U58A 3PUWA 1Z9FA 3UDFA 3EIVA 5HGQA 2ID0A 2ES2A 1JJGA 1SFOH 3A7AB 2GVAA 4KKTA 4DV7L 3CQZH 4LFAL 5ELOA 4X6AH 4A3DG 1YI2A 4QGUA 4P73A 4DV0L 1VCIA 1YJWA 5M3MH 4HJ8A 4L5RC 1A0IA 1DTJA 1BDOA 4C3HH 3F1ZA 4BXXG 3F2CA 1JJ2A 2VQFL 3EN2A 4RMFA 3S24A 1KRSA 2KENA 3T1YL 2DN8A 1N34L 2DGRA 4LF5Q 2UXCL 3GD7A 3E9IA 1YZ6A 1EYGA 2E2HH 5C0XJ 4B3RQ 2JA9A 4TQUS 1UWVA 3FKIG 1J6QA 1U0LA 4BY1G 1B9NA 2VY3A 2H5XA 1H9SA 2YU9H 4IFDJ 1PFSA 1UEBA 4IOAA 4JI1L 3KDFA 4GKKQ 4JV5Q 3GTJH 4OWWB 4KHPQ 4DV5L 3GTOH 3A8KE 1HNXL 3CRKC 5IYCH 1T9HA 2PQAB 2UUAL 4BY7G 1PMRA 1XJVA 3ERSX 2VZAA 1XMOQ 4A75A 2ALYB 2E2IH 5M5YH 1ASYA 4OXPA 2OTJA 3S16H 4LK1C 2L15A 3S2HH 1LUZA 4DR6Q 4KN7C 1J5KA 4LF6Q 3BU2A 1K83H 1H9KA 3KF6B 1Y1VG 2A6HD 4H02A 4JOIA 1PH5A 2VQEL 3S2DH 1N32Q 1V1QA 1QUQA 1O7LA 4DR3L 1GVPA 4GN3B 5JEAH 1H9JA 5M5WH 4EX5A 1PA6A 1TWCH 1E2WA 1IYVA 1AE2A 3NENA 5E7NA 1N33Q 1XTDA 3CPWA 1C7YA 4A3IG 4LF7Q 4OGQC 1N8RC 3U4VA 2ZTCA 3CMAA 4A93H 1L0WA 3HOUH 2EIFA 1VQNA 3BZKA 2K52A 4JI4L 1I50H 1PH6A 1BBWA 3FPPA 1HZCA 1SRUA 1C0AA 1HJPA 1HZBA 4OO1I 2E5LL 3PO3H 1VQEA 2R93H 3GQBA 5M5XH 2E76C 3KF8B 4HJ5A 4DR7L 3PO3G 2K50A 2A68C 1YNNC 4BBRG 2Q2IA 4JVYA 3AFQA 5M3FH 4KI0A 2L5TA 3KLRA 4JBWA 3HOVG 1E22A 4QQBX 3CD6A 1UE5A 3IFTA 1YEZA 3TS2A 5M3FG 1X4MA 2F1MA 1DT4A 1E1OA 2Q2HA 3OTOQ 1MJEA 1XMQL 3UDXA 3JAMc 3AB9A 2JXMB 3L0OA 4MNOA 4UY8C 4DK0A 4IJHA 2KBNA 2JA5H 4DR4Q 2R7ZG 2AHOB 3OYYA 4JCVE 3ULLA 4TKOB 1I6HH 2N49A 4TVAB 3PO2G 4NPSA 4X62Q 4DUZL 5J3BA 4DNTB 1GUGA 1J4WA 1B9MA 2BE5C 3H0GH 1VIHA 4R4CA 1VF7A 2CTFA 2O5JC 1ZTGA 2K32A 3AYHB 2QGQA 4K0KQ 4GNXA 3JC66 1NY4A 1IBLL 1G51A 2N8NA 3I55A 1K9MC 3M85A 1HR0L 2BH8A 3A5UA 2B8GA 4RG1A 4LFCQ 1VQ6A 4NXML 3I4NG 1IBML 4DPGA 4LFBL 4LF4Q 4H0LC 3STBC 1N36L 2Z0SA 4QL5A 5IYBH 3CC7A 4A4IA 3S1QH 1WFQA 2RCNA 3P20A 2ANNA 2UUBL 1YJ9A 2LXJA 4IOCA 1JE5A 4DV3Q 1CKOA 1GHJA 2VS1A 1E1TA 1I94L 5IYDG 4OO1H 1X3FA 2PQUA 1Z6HA 3PIOA 4IO9A 1VDZA 4J15A 4H44C 4DNRB 4A3JH 3W1GA 1VQFA 2CW0C 3K0XA 4YHHL 4GS3A 3ER0A 5IE8A 4XTCS 3J80i 2OQ0A 2UXBL 2VW9A 3CRLC 5IWAL 2UUCL 2NZOA 1LACA 4KKSA 4OWXB 4DV1L 2Z6KC 1KD1C 1X56A 2RHQB 1VS0A 1YBYA 1V43A 5KNBA 4R1JA 2AWOA 3HOXH 2E3UA 4GLVB 4DKAC 4DR2Q 1DXMA 1VQMA 2BL5A 1K1GA 1GUSA 1EWIA 1Y69U 4A3GH 3S14H 4LIJA 3KOJA 3AEVB 4JI7L 5KNDA 4JI0Q 3EBEA 4QMFB 3IRBA 2CWPA 5GROA 2OPVA 3VR2A 4APVA 4DV2L 2CFMA 2R6GA 4JI3Q 4ME3A 2JQOA 4X64L 4UPAA 1VQ7A 2I5LX 1EQRA 2A68D 4B3SQ 2PPBC 4DK6C 4EQ5A 1D7QA 4A3BH 3W5OA 3M4OH 4HIDA 1IZ6A 4B3MQ 4JYAQ 2A6EC 1IBKL 1QVCA 2NN6G 3PV0A 4A3KG 4HJAA 2CTLA 4IPCA 2K75A 2DNCA 4GLAC 2QF7A 4Y52H 4JI2L 2PNRC 2KHJA 3A0JA 2D62A 3J81i 5IP7G 5BR8Q 4R4IA 3BDOA 1P8LA 2ASBA 1TXYA 1J5EL 1FJGL 4UP9A 2HHHL 2BE5D 4RCNA 2KCCA 3MXNB 5IP9H 4DK1A 2HIXA 4YY3Q 1Q1EA 1N33L 2YTVA 2R7FA 1O78A 4LUOA 3CCJA 4GKJQ 2JZXA 2UXDL 3GDEA 1Q1BA 1XPUA 4GOPB 2D2CC 1K8GA 4PV1C 1SLJA 3J7A5 2XGTA 2WB1G 2WAQG 1XNRQ 2R92G 4C2MH 1WYDA 2EJGC 1VQKA 5FJ8G 3FMCA 1NJIC 3V69A 4A3DH 4X65L 4JBJA 2RHSB 1NE3A 3E9HA 2QNDA 1KAWA 1PH1A 1BBUA 4QJFA 2EDGA 3A5ZB 1YIJA 4MTNA 1EUJA 4BXXH 3ULJA 4HJ7A 4X66L 5C0XG 1AE3A 4KLKA 2VNUD 3CCRA 2Y0SE 1EFWA 3GTPH 3HKSA 1E24A 4IFDG 4G7OC 2NVTH 1KHMA 3K7AH 3NE5B 4JI8Q 2K33A 1JJCB 3AQQA 1OTCA 3FKIH 4P72A 4BY1H 1VQPA 3T1HL 4WJ3M 1MJCA 4NB3A 3KDFB 2WFWA 5LMNQ 3BZCA 2WP8J 2DGYA 4LF9Q 4B3TL 4A3EG 4DNIA 1KXLA 1Q7YC 1Q8KA 3D0FA 4BY7H 2K4KA 4DR5Q 3PUYA 2ZTEA 2ZM6Q 1VQOA 4XIGS 1ZKOA 2A69D 4JBKA 4OX9L 2LSSA 3CCLA 2OPUA 4GN5A 1VQ9A 2D0OA 3I4MH 1WJJA 4PZ6A 2R7DA 2K14A 3I4MG 3CXCA 2ZJQA 1UE7A 1I3QH 1Y1VH 1IW7C 1NMGA 4P71A 1L2FA 3CAMA 5LMUL 1PH2A 1QUQB 3GTMH 4GOPC 3B6YA 4IPDA 1A63A 2K5VA 5IT9c 4NXNQ 3L7ZC 3PF4A 4A3IH 2JJQA 2A6ED 2NVYH 2HH2A 1WCMG 3KF6A 3K80C 4L5SA 1HPCA 3D31A 3UE0A 1HNWQ 3PGZA 1OXUA 3KJOA 4IJLA 1UE6A 3RN5A 3DXJC 2VL6A 3HKZG 4YCVA 2QEXA 5JJIA 3CCQA 2JK8A 2KHIA 1K3RA 3HFZB 3HOZG 1GJXA 1Y8NB 4G7HC 1VQ5A 2C35B 3U4ZA 4GZYC 3U9SA 4DR1Q 4JI6Q 1HTPA 4BBRH 3SDZA 1T5EA 5JEAJ 3F2DA 1ZZIA 4LUZA 1CI3M 3HOVH 5GAGC 4JC0A 1IYUA 2CTJA 3BJUA 4LFAQ 4LNQA 4DV0Q 1Y1WG 4LF8L 4KMUC 4DV6Q 4MZ9A 1V8QA 3CC4A 2JA6G 2IX1A 4OONA 2R7ZH 3SGIA 3PSIA 1K8OA 3I4OA 3U50C 2HQLA 1CSPA 1Q90A 1X55A 3PO2H 3VR6A 4BBSG 1Q86C 1IXRA 1HNZL 2KA7A 2VQFQ 2PI2E 1UE1A 5KNCA 2F4VL 3S15H 3T1YQ 1Q12A 2E8GA 1N34Q 4QY7A 3LWUA 3H15A 2UXCQ 1VQHA 2CCZA 2F3IA 2YYZA 3G71A 5JJKA 3K81C 3HOYG 2JE6I 5GAEC 4R4OA 3RR5A 4KKUA 3PUXA 4GN4B 1O7IA 1IL2A 4JI1Q 2B3GA 4YCUA 4POFA 4DV5Q 2V4DA 3I4NH 1AH9A 1E3PA 1HNXQ 1PH7A 4JI5L 2F52A 1FGUA 2UUAQ 2NN6I 2FMRA 3PF5A 5A35A 2YTYA 5C3EG 2JEAI 1OXVA 4DV4L 4PMWA 3KYHC 1GHKA 1GO3E 3S1NH 3NBHB 3RLNA 3CCMA 5AJ3L 5IYDH 1SE8A 5LMNW 5HY6A 4DUYL 1VQDA 1DGSA 4AQYL 3A8IE 2IY5B 4HIKA 1E2ZA 4UP7A 2VQEQ 2K5NA 3RLOA 1S3OA 3ICEA 1NBWA 4DR3Q 4WANA 2RF4A 1B8AA 1X3EA 2ZJRA 2JA7G 5GQOA 3GTLH 3GTQH 2HH3A 3Q8DA 3M3YH 2V1CC 1A6XA 1P16A 2K5HA 4A3FG 2VUMG 3M7NA 2AUJD 1GUNA 1VQLA 3CCUA 5EAYA 3CMEA 4A3MH 1XPRA 4DK3C 4LF5L 1TWFH 3CCSA 4A3MG 2E5LQ 1A62A 2N3SA 4PZ8A 4B3RL 1YJNA 4IPGA 4DR7Q 1CKNB 3TS0A 2I0QA 3CW2C 3UDIA 4IFDI 1VF5C 1BVSA 4AM3A 4GKKL 4JV5L 4L5TA 1TUAA 4QIWE 4KHPL 1I5FA 3M4QA 1ONLA 3I7FA 4UP8A 3S1MH 2PMZE 1EC6A 3QG1A 5FLMG 1DCZA 3FHWA 1MKHA 1XMQQ 1YNJC 1XMOL 1L1OB 2UU9Q 5JJLA 1VIGA 4AH6A 2NN6H 3SE0A 3W3AA 1K0RA 4A3KH 4AYBE 5DLQE 3GO5A 4DR6L 2GVBA 1FL0A 1GD7A 4DUZQ 1SMYC 4LF6L 3A74A 4AIMA 5IP7H 1N32L 1NTGA 1EWHA 1Z47A 3K8AA 1GKHA 3CPFA 2MO0A 1IBLQ 3F8TA 2WB1E 2WAQE 3PIPA 3J81c 1JMCA 2N78A 1HR0Q 3W1BA 1CKMA 4NXMQ 2EXDA 1IBMQ 4LF7L 2FXQA 4LFBQ 5K36G 1N36Q 1VQBA 1WE8A 2XTIA 3H94A 2JEBI 2R92H 1ZYRC 5IY0A 3IKJA 3L2PA 5FJ8H 3G48A 5C4XH 1YHAA 1A8VA 1KL9A 2UUBQ 1TU2B 3STBD 5C4XG 1Y8OB 4R4QA 3S17H 4OWTB 1I94Q 1PH4A 2ANRA 1TWGH 1Q46A 4C3JH 3LGJA 1X6OA 5C0XH 1PYSB 3H3VI 4YHHQ 4IFDH 3GTKH 2DNEA 2UXBQ 2CKZB 1X54A 3OTOL 4DV6L 4LWCA 4PZ7A 3VA7A 2A8VA 5IWAQ 2UUCQ 5FLXc 5M3MG 3ULPA 4DR4L 3D4RA 4DV1Q 1QJOA 1H9SB 1L1OC 1SN8A 4X62L 1XPOA 2OQKA 1R9TH 2Q8IB 4YWMA 4A3EH 1Z7TA 5GAHC 1RIPA 1GUOA 4JK1C 2NVXH 1YNXA 2JVZA 2A19A 1LM0A 4K0KL 2KCTA 4JI7Q 2CPQA 2Y0SG 4YWKA 1PH9A 4HJ9A 1KIXA 3CC2A 2AUKA 1XNQQ 3QIAA 4P75A 2D0PA 3M9BA 4DV2Q 1K8AC 2MFIA 3ND8A 4LFCL 4POGA 3M4PA 4X64Q 3I73A 4LF4L 2YTXA 5IYCG 3J81j 2PQAA 3MEFA 3OOCA 1D8LA 3NELA 1VQAA 4HIMA 4GLXA 1WI5A 2PI2A 1FVIA 1TWHH 1IBKQ 4NBQA 1KRTA 1YHQA 3I56A 3KLWA 1OXTA 1I6VC 4L8JA 2AMCB 3HKZE 4DV3L 2NZHA 2B29A 3OPOA 4JG2A 3RNUA 1WCMH 4JI2Q 5BN4A 1QZGA 1X3GA 3VR4A 2LXKA 4A3LH 1M90C 3RN2A 1H95A 2IX0A 3QJYA 4FDBA 1PHJA 4A3LG 1J5EQ 1FJGQ 1EQQA 2HT1A 2HHHQ 1MIUA 3HOZH 2EQSA 2CTEA 5JEAG 4HIOA 1HQMC 3H3VH 2CQOA 3PCOB 3TEHB 4A3CH 1Q82C 2UXDQ 1PYBA 3VDYA 4DAYB 2I5HA 3RZDH 1TWAH 1Q81C 3GTGH 4A3CG 4A93G 4A76A 3HOUG 1RL2A 4B8TA 3VR3A 4KHZA 4DR2L 3WWVA 4P74A 4JVHA 3FP9A 2EJFC 4X65Q 1VQ8A 1Y1WH 1X65A 4DV7Q 3G6EA 2IHEA 3DM3A 4JI0L 3ND9A 2BA1A 1V9PA 2JA6H 4G7ZC 2OTLA 2R93G 1HR0W 1Y14B 4BBSH 3JAMi 3I2ZA 4X66Q 4JI3L 2ZT9C 3CCEA 1PH3A 1U5KA 2OWOA 1ASZA 1ZZKA 1JT8A 1H9MA 4B3SL 2CTMA 3TZUA 2UU9L 5BN5A 4IPHA 2Z6KA 2PNHA 3J7ZC 3I72A 3UE1A 1VQCA 3G4SA 3HOYH 2YV5A 4O2DA 4B3ML 4JYAL 2KCMA 4GNXB 1LYLA 2HIVA 2JA5G 3T1HQ 1B70B 4JOIC 3MFYA 4B3TQ 1EOVA 4JBMA 3WDNA 1VQIA 3I4LA 1IYJB 3H0GG 2EVBA 5BR8L 1GM5A 4OX9Q 1E7ZA 2EJMA 5C3EH 3CP0A 3ZJYC 2ZTDA 3LNNA 2YQRA 2AWNA 1W3SA 1JB7A 3T56B 4YY3L 3NEMA 2MNAA 1CSQA 2NVQH 4GKJL 4ALPA 2LMCB 1YITA 2AKWB 4DAMA 1C9OA 2GN5A 2K7VA 5IYBG 5LMUQ 3OW2A 1XNRL 2BDOA 3T53B 4KN4C 1Y8PB 1QZHA 4R4TA 3EQLC 3RZOH 3VR5A 1LTLA 3VKEA 2JA7H 2BA0A 1IW7D 2Q2TA 1YHBA 4IQZA 4PG3A 3PUZA 4OO1G 1VQGA 1OXXK 2Q2UA 1PVOA 2O5IC 1G6PA 4A3FH 2CWAA 2VUMH 4BA1I 2E2JH 1W2BA 2A1AA 1FYCA 3E0EA 3J80c 3S1RH 4I7ZC 1E2VA 4A3JG 3KFUA 1G291 2JA8H 3MXUA 1WVNA 3A8JE 1K8MA 1S72A 1EIFA 4JI4Q 2JA8G 2DUDA 5ELNA 4JI8L 2IT1A 3M4YA 3K7UC 5C0XI 1QVGA 2A69C 1HZ9A 1N9WA 2PCFB 5LMNL 5H1SE 4HR7B 4LF9L 1CFMA 1TKWB 5FLMH 4H13C 4GNXC 3HOXG 1NMFA 1QVFA 2PY9A 4DR5L 1HH2P 3UDGA 2ZJPA 2ZM6L 4YWLA 1X4NA 2ATWA 4A3GG 1CUKA 4LF8Q 2B63H 3AEVA 3A7LA 1CKNA 1XNQL 1GUTA 3HOWH 1FR3A 1VQ4A 1KHIA 2B63G
chains in the Genus database with same CATH superfamily
2YU9B 3HOWG 3PUVA 2B8FA 4DR5H 4LW1A 1TS4A 2A6HC 2XRSD 3GTJB 3U1KA 1X9NA 1B50A 5BN3A 1BKBA 3TBIB 1HNZQ 2OCEA 3ONAB 2BH2A 3GTOB 1H9RA 3TQYA 3HEJA 4C3IH 2F4VQ 1XNQH 2L55A 2RVLA 1OXSC 2MQHA 2MO1A 4X3UA 2B2UA 1EIYB 1L1OA 2QCPX 3BDCA 4L5QA 4A3BG 1SROA 3AFPA 4X64H 2E2IB 3OW7A 2EYOA 1WOCA 2KUMA 1HQRD 5M5YB 5EKLA 4Y7NH 3BG3A 1YVCA 3DLLA 1NAPA 1VQJA 3S16B 2QA4A 3D8GA 5C44H 1G91A 1B7YB 4YCWA 4NXNL 1EYAA 1K73C 1QB5D 1RKNA 4WJ4A 5C44G 4H7BA 1PH8A 1K83B 3CF5A 3T51B 1DD2A 3HGBA 3F2BA 2CTKA 1HCZA 2B2WA 2AXYA 4CDFC 5K36H 4QF4A 1HNWL 3TREA 4O0AA 1S40A 4JI5Q 4AYBG 5CV5A 3D4DA 1SMXA 3S2DB 1ZZJA 1LTSD 4KK7A 1D5MC 3TRZA 1DZ1A 4ODGA 2H4OA 5CR3A 5C4JH 4LJZC 4NXNH 4DV4Q 1KNEA 3G6JB 2O2LD 4WALA 3ERQA 3URYA 3CCVA 1Z2IA 1PV4A 5M5WB 2I5MX 2PQEA 2D5DA 2P2RA 4TSSA 3KJPA 5IP9G 1CTMA 4BA2I 2MJHA 2I46A 4FF3A 1HNWH 2RCFA 3J7AF 3NWSA 2E75C 1PTOF 2IHFA 1HZAA 5AJ3Q 4DR1L 1WD1A 1LABA 3SB1A 1QWYA 1KC8C 3K6OA 4JI6L 4LUVA 3N6RA 4EQPA 4PNYA 5GADC 3Q22A 2WKDA 4DUYQ 1SR3A 1M1KC 2E74C 5LHY1 3RLFA 4GOPA 4A93B 4AQYQ 4ZKBB 1KQSA 2PO4A 3HOUB 3U58A 1EIGA 2X6GA 3PUWA 3R2IA 1Z9FA 3MVVA 3UDFA 3EIVA 5HGQA 2ID0A 2ES2A 1I4HA 1I50B 5EBDA 1JJGA 1SFOH 5M9OA 3A7AB 4JI6H 2GVAA 4KKTA 4DV7L 3CQZH 4LFAL 5ELOA 4TRDA 4X6AH 2Z1CA 4A3DG 1PZKD 1YI2A 4QGUA 3PO3B 4P73A 4DV0L 1VCIA 1YJWA 5M3MH 2L0CA 3NQTA 4HJ8A 4L5RC 2R93B 5M5XB 4WORA 2RQXA 1A0IA 1DTJA 4FXDA 4DXFA 4PMCA 1B53A 5DAUA 1BDOA 2XIWA 4C3HH 1LT3D 5CV7A 5C5LA 3F1ZA 4DV7H 1EY0A 4LFAH 5CORA 3HOVB 4BXXG 3F2CA 1JJ2A 5M3FB 2VQFL 3EN2A 4RMFA 4DV0H 2A1SA 3S24A 1KRSA 5C5MA 2ICEC 2KENA 1S20A 3T1YL 2DN8A 2JN4A 1N34L 2EYJA 2DGRA 4LF5Q 1LV9A 2UXCL 3GD7A 3E9IA 1SSOA 1YZ6A 1EYGA 2E2HH 4G57A 3MEHA 1BUVT 5C0XJ 3MWYW 1DOMA 5D3DA 4B3RQ 2JA9A 2VQFH 1UWVA 3FKIG 4TQUS 2JA5B 1J6QA 1U0LA 4BY1G 1B9NA 2VY3A 2H5XA 1H9SA 2YU9H 4IFDJ 3T1YH 1PFSA 3PQIA 1N34H 4JVZA 4DN4M 1UEBA 4IOAA 1I6HB 4JI1L 3KDFA 2UXCH 3FRPB 4GKKQ 3GTJH 4JV5Q 4OWWB 1FNUA 5LL6S 4KHPQ 3EZJA 4DV5L 5I4DA 3GTOH 3A8KE 3J81L 1HNXL 3CRKC 1TR5A 5IYCH 1EIHA 1FNVA 1T9HA 1L0XB 2PQAB 3LX0A 2UUAL 4BY7G 1PMRA 2ENBA 1XJVA 1MI2A 3ERSX 2VZAA 3HZXA 1XMOQ 4A75A 4JI1H 2ALYB 2E2IH 4HEDA 4DV5H 1PFMA 5M5YH 1KNAA 1ASYA 5CYUA 2PZUA 2RBMA 4OXPA 4MTKA 2OTJA 3S16H 4LK1C 2L15A 3S2HH 1LUZA 2UUAH 1LTBD 4DR6Q 4KN7C 1J5KA 4X3KA 1YNJD 2J4XA 5CV4A 4LF6Q 1PRTD 1J9OA 3BU2A 1K83H 4CGYB 1IKMA 1H9KA 2SDFA 3K59A 5KYLA 3NQIA 3KF6B 1Y1VG 2A6HD 4KJOA 4H02A 4JOIA 1PH5A 2F3VA 3OIPA 4OEMB 2VQEL 3S2DH 2CPMA 1N32Q 1AZQA 1V1QA 3S1QB 1QUQA 1O7LA 1SMYD 2WV6D 3GP7A 4ZQ3A 4DR3L 1ESFA 4MIUA 1GVPA 1FGBD 2WIIB 4GN3B 5JEAH 3H6MA 2K1HA 1H9JA 1C8CA 5IGCA 4EX5A 5M5WH 2SNMA 3EROA 1PA6A 1TWCH 4EGVA 2F0OA 3QOLA 1E2WA 2EY1A 1IYVA 1AE2A 1TS3A 2VQEH 3NENA 4DFAA 1QNKA 2MUYA 1OO9B 5E7NA 1BBXC 1N33Q 1XTDA 3CPWA 1C7YA 4A3IG 1PRTF 5FLXL 4OGQC 1N8RC 4LF7Q 3U4VA 2ZXPA 2ZTCA 1I4PA 3CMAA 1WTOA 3QO2A 5FLXE 4A93H 1L0WA 3HOUH 2F0JA 1LTID 2EIFA 4A3JB 4J6HA 2NWGA 1VQNA 2DJGC 2EY5A 3BZKA 2K52A 4JI4L 1I50H 1PH6A 1BBWA 3FPPA 1HZCA 1SRUA 4K8JA 4N8X1 1C0AA 1BQQT 1CZGA 5E4XA 1ML0D 4HMIA 1HJPA 1HZBA 2QEJC 4IUQA 4BWGB 3K57A 4I7AA 4OO1I 2E5LL 3PO3H 3K5LA 1EFID 4IUUA 2VXWA 2P5ZX 2K04A 1VQEA 2R93H 3GQBA 5M5XH 2E76C 3KF8B 1MD2D 1X32A 1ZYRD 1SXTA 4DAYA 4HJ5A 3PO3G 4DR7L 1TQOA 4JI4H 2K50A 4XT3B 2ZXRA 3FVQA 1T5XD 2TMPA 2A68C 1YNNC 4BBRG 2Q2IA 1WTHA 3MXPA 2NTTA 4JVYA 3AFQA 1HA6A 2E5LH 5IGFA 3NTIA 5M3FH 1F2MA 4KI0A 2L5TA 1DOLA 3KLRA 4JBWA 3HOVG 1E22A 1ENAA 4QQBX 3CD6A 2KECA 1UE5A 1YEZA 3IFTA 3BYTB 3TS2A 5M3FG 4DR7H 1F2YA 1X4MA 2F1MA 1DT4A 4B08A 2O4CA 1E1OA 2M00A 2Q2HA 1WVLA 1EYCA 5EQ0A 5FOBB 2C9OA 3OTOQ 1AN8A 4A3GB 3S14B 1MJEA 1WHRA 1XMQL 3UDXA 3JAMc 3AB9A 4E9JA 2JXMB 3ZYYX 3L0OA 3MXGA 4MNOA 5FO7B 4UY8C 4DK0A 1NCVA 4IJHA 1G6ZA 2KBNA 2QW7A 2CVRA 2JA5H 4DR4Q 2CWHA 2R7ZG 1NR2A 2AHOB 3AU7A 3Q24A 5FKAC 3OYYA 1C48A 4JCVE 3ULLA 3IL8A 4TKOB 4WFN3 1I6HH 2N49A 4TVAB 3PO2G 3HS0C 3NP8A 4NPSA 4X62Q 4DUZL 5J3BA 1XMQH 4DNTB 1GUGA 1SYGA 3D3RA 2B39A 2K1BA 1J4WA 1B9MA 2BE5C 3H0GH 1WTXA 1VIHA 4R4CA 3VYRA 4RGMA 2EPBA 1VF7A 4N8FA 2CTFA 4OIJA 5CBAE 2O5JC 2F0MA 5IT9E 1ZTGA 2K32A 3DM1A 3AYHB 1HNZH 2MP1A 4FXKC 2QGQA 4K0KQ 2Q8TA 5COYA 4DUZH 1STBA 4GNXA 4IUNA 1EL0A 5ELDA 2IW3A 3JC66 2L12A 1NY4A 2F0NA 3P7JA 4RAUC 2LKVA 3R8BA 2XRQD 5DM73 1IBLL 3JAMW 3T4AC 1G51A 2GA4B 5EKIA 2N8NA 3I55A 1ENFA 1K9MC 4Q0FA 5HURA 3M85A 1HR0L 4FJUA 2BH8A 5EPLA 5IIFA 4PMBA 3A5UA 1WTQA 4ZKCB 2B8GA 1I4QA 4RG1A 5KYIA 4LFCQ 1RCVD 1VQ6A 4NXML 3I4NG 4O42A 1IBML 4DPGA 4LFBL 3R93A 4LF4Q 4AYBB 4H0LC 3STBC 1N36L 2Z0SA 2SNSA 4QL5A 5KRUA 5IYBH 3CC7A 1IL8A 1IBLH 3TP5A 1RHPA 4ZUJA 5NUCA 2LTMA 1EY7A 4A4IA 3R3OA 3S1QH 1PZID 4DGZA 2SEBD 2G5DA 1WFQA 2RCNA 1HR0H 3P20A 2ANNA 2EYHA 3EJIA 3TMEA 3A56A 2UUBL 3DEPA 1XYIA 4JI5H 4NXMH 5DEHA 1YJ9A 1IBMH 2LXJA 4IOCA 4DAPA 1JE5A 1QILA 2CH4W 2F0PA 4V0BA 1N36H 4DV3Q 1CKOA 1GHJA 2VS1A 1E1TA 2X6LA 1I94L 5IYDG 4OO1H 1X3FA 2PQUA 1Z6HA 3PIOA 5IOCA 4IO9A 1VDZA 1PYWD 3BS1A 4J15A 2CWFA 2UUBH 2RDGA 4DNRB 2A5HA 4A3JH 1F9PA 1UAPA 3W1GA 1VQFA 1EQTA 2CW0C 3K0XA 4YHHL 4C2MB 4GS3A 3I90A 3ER0A 4KD4A 1I94H 5IE8A 4KY7A 4XTCS 3J80i 2OQ0A 2UXBL 2VW9A 2MGSA 4A3DB 5JVH3 3S17B 3CRLC 1SJED 1JWUD 3BZDB 4HTHA 5IWAL 1EZ8A 2UUCL 4XQJA 2F0GA 2JP1A 2NZOA 4C3JB 1MSHA 1LACA 4C56C 4KKSA 4OWXB 4YHHH 3NHHA 4DV1L 2Z6KC 1BXTA 1KD1C 1X56A 2RHQB 2B2VC 2UXBH 2LFNA 1VS0A 4KD3A 1YBYA 1V43A 5KNBA 4R1JA 2AWOA 1NUCA 4NMZA 3IFDA 5CV9A 5IWAH 2UUCH 3HOXH 1G8ZD 2E3UA 4GLVB 4DKAC 3GTPB 4DR2Q 1DXMA 1VQMA 2BL5A 1K1GA 1ILQA 1GUSA 1VMPA 4F7XA 1SYCA 1HUNA 1EWIA 1Y69U 1S5CD 2NVTB 4DV1H 2D9IA 4A3GH 3S14H 3K7AB 1JCKB 4LIJA 3KOJA 2F0TA 3HP3A 3AEVB 4JI7L 5KNDA 4JI0Q 1SNDA 3EBEA 1A2UA 1XTCD 4QMFB 3FKIB 1BCPB 3IRBA 5IGDA 2CWPA 4BY1B 2OXPA 4LF5H 5GROA 1DJRD 2OPVA 2F0VA 1ZEQX 4RHSA 3VR2A 4RKLA 4ZCKA 4APVA 5DT9A 1VBIA 4DV2L 4A3EB 2CFMA 2R6GA 4JI3Q 4ME3A 1B3QA 2JQOA 2RKSA 1W6KA 4JI7H 4X64L 4UPAA 1VQ7A 2I5LX 1EQRA 2A68D 5HGTA 1YNND 5ELBA 4BY7B 4B3SQ 3QWNA 2PPBC 1SJHD 4DK6C 1RF2D 4EQ5A 1D7QA 5C3XA 3KDKA 4A3BH 3W5OA 4DV2H 3M4OH 4KY5A 2AQ3B 4HIDA 1IZ6A 4B3MQ 2JSOA 4JYAQ 2A6EC 1IBKL 1QVCA 3WOFA 2NN6G 4ZYSA 3PV0A 4A3KG 4HJAA 2CTLA 2F0DA 4IPCA 4XYOA 2VB3X 3I4MB 3C1EA 2K75A 2DNCA 1IHZA 4GLAC 2QF7A 1PTOD 4Y52H 2XWJB 4JI2L 2PNRC 2IL8A 1HFGA 2KHJA 3A0JA 1I3QB 1Y1VB 2D62A 4XXEA 1IBKH 3J81i 2AQ1B 5IP7G 5BR8Q 3KBXA 4R4IA 1P8LA 3BDOA 3SK5A 3OSSD 3GTMB 3S9WA 1TXYA 2ASBA 1J5EL 1FJGL 4UP9A 2HHHL 3NXWA 1SYDA 2F0WA 2BE5D 3J80L 5IODA 3J80E 4JI2H 3HRZC 2J0TD 4RCNA 2KCCA 1DOKA 3MXNB 5IP9H 1U4RA 4DK1A 2HIXA 4YY3Q 1RDPD 1Q1EA 3I91A 1D1KA 1N33L 2YTVA 1WCMB 4PDBA 2R7FA 1LTAD 3SK4A 1O78A 4LUOA 4A3IB 3CCJA 4GKJQ 2NVYB 2JZXA 2UXDL 3GDEA 1J5EH 3D6CA 1FJGH 1TS5A 1Q1BA 2K03A 1XPUA 2HHHH 4GOPB 3BVGA 2D2CC 1K8GA 2RA4A 3J7YW 4PV1C 4QUCA 1SLJA 2EYFA 2WACA 1SYFA 1S5DD 3J7A5 2XGTA 3NPPA 2WB1G 2WAQG 1Q8IA 1N33H 2F0FA 1XNRQ 2R92G 4C2MH 5IGGA 1WYDA 2EJGC 1VQKA 5ISRA 2UXDH 5FJ8G 3FMCA 3I8ZA 1NJIC 1WTWA 3V69A 4A3DH 4X65L 2A73B 5T1GA 4JBJA 3OWFA 2LS01 2RHSB 1NE3A 3E9HA 2QNDA 1DYQA 1KAWA 1PH1A 1BBUA 4QJFA 3RZDB 1TWAB 2EDGA 3A5ZB 1YIJA 4MTNA 4BBRB 1EUJA 4C3JG 3P75A 2F0KA 4BXXH 3ULJA 4HJ7A 4X66L 4X65H 3E6ZX 5C0XG 4PQXA 1BCPC 1AEXA 1AE3A 1A3TA 4KLKA 2VNUD 1SYEA 4FF4A 3CCRA 2Y0SE 1EFWA 2ZXOA 1DM0B 2F4IA 3GTPH 4ILWA 3HKSA 1E24A 4IFDG 1BF4A 4G7OC 3K5OA 4FYDA 2NVTH 1KHMA 3K7AH 3NE5B 4JI8Q 2K33A 4X66H 1QG7A 1JJCB 3AQQA 1SE4A 1TT2A 1OTCA 3FKIH 4P72A 4BY1H 2R7ZB 3NBIA 2B2YA 2PT7G 3QR8A 1G2SA 1VQPA 3T1HL 4WJ3M 1MJCA 3PO2B 4NB3A 3KDFB 2WFWA 1EY4A 2I07B 5LMNQ 3BZCA 5I2XA 2WP8J 4FF1A 5J39A 2DGYA 2F0IA 4LF9Q 5EPJA 4B3TL 2IJ0A 2EY6A 3L9AX 3NTKA 4A3EG 1EY5A 3SR1A 3S15B 1STEA 4DNIA 1KXLA 1SE2A 2XVSA 5E1FA 1Q8KA 3D0FA 1Q7YC 2K4KA 4BY7H 4DR5Q 3PUYA 2ZTEA 2ZM6Q 3J81E 4XIGS 1VQOA 3HOYB 1ZKOA 2A69D 3T1HH 5C6AA 4JBKA 4OX9L 5E3FA 4ZLTF 3PIO3 2LSSA 4ME5A 3CCLA 1CM9A 2OPUA 3QD7X 3K5MA 4B3TH 4ZAIA 4GN5A 1VQ9A 2D0OA 1JB3A 3I4MH 1WJJA 4PZ6A 4OD6A 2R7DA 3BVZA 2K14A 4OX9H 3I4MG 2K5WA 1STNA 3I4NB 1MSGA 3CXCA 2ZJQA 3OSOA 1NXUA 3T13A 2CHBD 4K5XA 1UE7A 1I3QH 1Y1VH 1IW7C 1NMGA 4P71A 5JPMC 1L2FA 3CAMA 1MGSA 5LMUL 1PH2A 1QUQB 3A55A 4FF2A 3GTMH 1KLUD 2CQAA 2NUCA 4GOPC 1HUMA 2TSSA 1SNPA 1I4RA 3UI2A 1O7YA 2IWHA 3B6YA 4IPDA 1NSNS 1EY6A 3S1NB 3K58A 1A63A 4K2KA 1KABA 2K05A 2K5VA 2PZTA 5IT9c 1AFPA 2RSNA 4NXNQ 3L7ZC 3PF4A 1RTOA 1LT4D 3G7LA 4A3IH 2JJQA 3W2DA 3KK7A 2A6ED 2NVYH 5LMUH 5D14A 2HH2A 3H3VC 1WCMG 3KF6A 3K80C 4L5SA 1HPCA 1L0YB 2OEOA 3D31A 3UE0A 4HAEA 2MJ8A 5CV6A 1HNWQ 3PGZA 5ELFA 1OXUA 3KJOA 4ULLA 1MBYA 4IJLA 1UE6A 3RN5A 3DXJC 2Z8LA 2QILA 5E4WC 4UHVA 2VL6A 3HKZG 5DM63 4YCVA 3OHXC 2QEXA 1XX8A 2LF0A 4JW0A 1S5ED 1WTJA 5JJIA 3CCQA 2JK8A 2KHIA 2Z4IA 1K3RA 1EU3A 1LTGD 3HFZB 2K5QA 4HMJA 3HOZG 1GJXA 1Y8NB 4G7HC 1VQ5A 2C35B 3U4ZA 5JPNC 4GZYC 3EA6A 3MA2B 1ET6A 3U9SA 4DR1Q 3GTLB 4QB4A 1ICWA 3GTQB 4JI6Q 3BDLA 1HTPA 3BVMA 3M3YB 1A15A 3U9OA 4R8NA 4BBRH 3SDZA 1BNZA 5CGKA 1T5EA 3GV6A 5JEAJ 2EOTA 5IT9W 3F2DA 1ZZIA 4LUZA 2PZWA 5EJWA 2BCOA 1CI3M 3HOVH 5GAGC 4A3MB 4JC0A 1IYUA 2CTJA 2KEDA 3DMUA 3BJUA 4K8IA 1F0XA 1TWFB 4LFAQ 1KDAA 2HCCA 3DEOA 1X3QA 4IN3A 4LNQA 4DV0Q 1Y1WG 5I2YA 4LF8L 4KMUC 2G9HD 2RDHA 3KF8A 3TP7A 4DV6Q 1AW7A 1S4ZA 3MFGA 5I9OA 4MZ9A 1V8QA 3CC4A 2JA6G 2IX1A 2JYOA 4EC5A 4OONA 2R7ZH 3SGIA 3CU7A 3KUPA 3PSIA 5EKKA 3SHLA 1K8OA 1ZXTA 3I4OA 2HQLA 3U50C 2HUGA 1CSPA 1Q90A 1X55A 3PO2H 3VR6A 4CDCC 4K14A 4BBSG 4U68A 4C1NI 1Q86C 1IXRA 3RUZA 1C4QA 1A2TA 4HSPA 5F2DA 1HNZL 2KA7A 3TP6A 2VQFQ 2XNAC 2PI2E 3S1MB 1UE1A 4LF8H 1PDQA 5KNCA 1EY8A 4XQNA 2F4VL 3Q0AA 4K5VA 2M6QA 3S15H 3F2UA 3T1YQ 3N52A 1Q12A 2E8GA 1N34Q 4XQQA 4QY7A 3LWUA 1F9QA 3H15A 3PMFA 2UXCQ 4ZRZA 1UUPA 1CHPD 1VQHA 3KLSX 2CCZA 2F3IA 5IGBA 2YYZA 3G71A 5JJKA 3K81C 4QIWB 5JJZA 3HOYG 2JE6I 5GAEC 2PW7A 4R4OA 2PMZB 3RR5A 4A3KB 4B3SH 2F4VH 2F0EA 4KKUA 5CC4A 4C1NK 3PUXA 4GN4B 2MPMA 1O7IA 1SEIA 1IL2A 4JI1Q 2NTSA 2B3GA 4C3IB 4YCUA 1HHVA 4POFA 1VMCA 4B3MH 4DV5Q 2V4DA 3I4NH 1W6JA 5A2QW 1AH9A 2FHTA 1E3PA 3UOEA 1HNXQ 5D3IB 4MN3A 2OT2A 1PH7A 4JI5L 2F52A 3C3LA 1FGUA 2IX3A 2UUAQ 1SNMA 5ELCA 2NN6I 1KDCA 2FMRA 3PF5A 1BCPF 5A35A 2YTYA 5C3EG 2JEAI 2ICIA 1OXVA 4DV4L 4PMWA 2NB0A 3KYHC 1GHKA 1GO3E 3S1NH 2EXZA 5BR8H 1K3BC 2RSOA 3NBHB 3RLNA 4EQNA 1RJTA 3CCMA 1CT1D 1U4MA 5AJ3L 5IYDH 3MTSA 1CQFA 1SE8A 5LMNW 5HY6A 3X3NA 2EYMA 3V2TA 4DUYL 1VQDA 1R4PB 4YIJA 4DV4H 1DGSA 4FXGC 1EWCA 4AQYL 1ODHA 4YY3H 2OF1A 3A8IE 2IY5B 1BOSA 4HIKA 1E2ZA 2K01A 2WB1B 4UP7A 2WAQB 2VQEQ 2K5NA 3RLOA 1S3OA 4F87A 2R3ZA 3ICEA 2R92B 1NBWA 2J7ZA 4DR3Q 1V9NA 1HXYD 5C4XB 1UG8A 5KEEA 4WANA 1SNCA 4DUYH 2RF4A 4J8QA 1HFNA 4L63B 1G2TA 4AQYH 1B8AA 1X3EA 1CK1A 1V1PA 2ZJRA 2JA7G 5GQOA 3GTLH 1GXDC 1XNRH 4K5WA 1U4LA 1QNUA 3GTQH 1KTKA 1LTRD 4CJ0B 2VKCA 1TWGB 2HH3A 4KHVA 3Q8DA 3M3YH 3JAML 5J1ZA 2V1CC 4Q5VA 1A6XA 3GKUA 1P16A 2FFMA 1EEFD 3OWEB 2K5HA 5C4HA 1LLRD 5TSSA 4A3FG 2VUMG 2KCNA 4DXGA 1F9SA 3M7NA 2AUJD 1GUNA 1VQLA 3CCUA 1SBBB 5EAYA 4LMQD 3CMEA 4A3MH 3EVQA 1K28A 3RF2A 3O13A 1XPRA 4UDUC 4DK3C 3GTKB 3E5SA 4LF5L 5G3LF 1TWFH 1B44D 3CCSA 4A3MG 5FO8B 2O4XA 4OIKA 4WJWA 4F88A 2E5LQ 1A62A 2N3SA 2Z4HA 4PZ8A 4B3RL 2F0HA 3SEBA 1EEID 1YJNA 4IPGA 4DR7Q 1CKNB 4O1NA 3DWQA 2HDLA 3TS0A 2I0QA 3CW2C 4RHRA 5CMDA 5JVG3 3NWTA 2FFKB 1AZPA 1XWEA 5DNFA 3MAQA 2B63G 3UDIA 5D65A 4IFDI 1VF5C 1BVSA 4E6IA 4AM3A 4GKKL 2F3WA 4L5TA 4JV5L 1TUAA 4QIWE 1R9TB 4KHPL 1I5FA 3M4QA 1ONLA 3I7FA 4UP8A 1A3UA 2DY8A 3S1MH 2PMZE 4XT1B 2XWBB 1EC6A 4HCSA 4B3RH 3QG1A 5FLMG 3J80W 1DCZA 4KJNA 4P2CB 2DY7A 3QB3A 1DONA 1JWMD 5IGEA 3FHWA 1O7ZA 2NVXB 5LL6X 1MKHA 1XMQQ 2AQ2B 4G08A 1YNJC 4R9WA 1XMOL 1L1OB 2LTLA 2UU9Q 5JJLA 4GKKH 4JV5H 1VIGA 1LT5D 4AH6A 4KHPH 4RGNA 4X3SA 4CJ1B 2NN6H 3SE0A 3SXHA 1EQVA 1K0RA 3W3AA 4XDXA 4A3KH 2ZM6H 4N9PA 2FJ2A 4KTAA 4WRDA 2LY7A 4AYBE 3C1FA 5FO9B 5DLQE 3GO5A 3P1HA 3RD4A 2GVBA 4DR6L 1FL0A 1GD7A 4DUZQ 1SMYC 4LF6L 1ENCA 2IPKD 1HRJA 1XMOH 5FK9C 4IZ8A 2F03A 5EBCA 4EQOA 3A74A 4C3IG 4AIMA 2PW5A 5IP7H 2K28A 3TSSA 2PYKA 3D4WA 3DHQA 1N32L 4ID6A 5C3WA 2Z9HA 1D2BA 1NTGA 1TVXA 4DR6H 1AP0A 1EWHA 1TWHB 4ZUIA 1Z47A 3K8AA 4RA8A 1CHQD 1GKHA 4LF6H 3S2HB 3CPFA 2B2TC 2MO0A 1IBLQ 3F8TA 2WB1E 1V1OA 2R61A 2WAQE 3ITPA 3PIPA 1PQXA 2NBFA 3J81c 1JMCA 2N78A 5I6WA 3MC0B 2SOBA 1HR0Q 1N32H 3W1BA 4IUTA 3C46A 3K5NA 1CKMA 2FINB 4NXMQ 2EXDA 1IBMQ 4LF7L 1II3A 2FXQA 4LFBQ 1SAPA 1HA5A 5K36G 1N36Q 1VQBA 1WTPA 1WE8A 3HKZB 2HQEA 2XTIA 1MHWC 3H94A 2JEBI 2R92H 2HCIA 1PLFA 1ZYRC 5IY0A 1D5ZC 3IKJA 1K0SA 4K6LA 3OETA 3L2PA 5FJ8H 3G48A 1SNOA 5C4XH 3MXNA 3HOZB 1TWCB 1YHAA 1FKAH 1A8VA 1KL9A 2UUBQ 1TU2B 2HD3A 3NK9A 1PXUA 4LF7H 1SDFA 5JOBA 3Q23A 3OMCA 3STBD 5C4XG 4MHEA 1Y8OB 4R4QA 1XXGA 4UAIA 2EE1A 5T1IA 3S17H 4OWTB 1I94Q 1QE6A 1PH4A 1JOQA 4IUPA 1TWGH 2KEEA 2ANRA 2XN9C 3NCVA 1Q46A 1IKLA 4C3JH 3LGJA 1F9RA 1EYDA 3NSWA 3GTGB 3J81W 1X6OA 1TS2A 3OIQA 1KLGD 4FP5D 5C0XH 1V8CA 4DR1H 4CDDC 3KLSA 1PYSB 1UNSA 1SE3A 2KJXA 3H3VI 4YHHQ 1EY9A 4IFDH 1ESRA 3SVMA 3GTKH 2DNEA 4OHJA 2UXBQ 2CKZB 5K5PA 1X54A 1STHA 3OTOL 1LT6D 4DV6L 4LWCA 4PZ7A 1X0AA 3QOJA 2G9DA 1KAAA 3VA7A 1Y1WB 1XRHA 2A8VA 3FEWX 5IWAQ 2MHVA 1S5FD 2UUCQ 5I6YA 2H1EA 5FLXc 3EFXD 5M3MG 4I65A 2JA6B 1X9ZA 3ULPA 2VB2X 3GABA 2CW0D 4DR4L 3D4RA 4NW2A 2EYLA 4B9WA 5EPKA 4DV1Q 1QJOA 2B2UC 4C3HG 1WTRA 4BBSB 1H9SB 1L1OC 1SN8A 2F0SA 4X62L 1XPOA 3OTOH 1SNQA 4DV6H 2OQKA 1R9TH 1PZJD 2Q8IB 3T16A 3I70A 4YWMA 4A3EH 3VA5A 1Z7TA 5GAHC 2L11A 4DA2A 4R8IA 1RIPA 3NTHA 1GUWA 1LO5D 1GUOA 4DR4H 1S03G 2WINB 4JK1C 2NVXH 1YNXA 1ICFB 4B8CD 1NR4A 2JVZA 1D5XC 5CV8A 2A19A 1LM0A 4QMGA 2KCTA 4JI7Q 4K0KL 2CPQA 4X62H 2Y0SG 1JICA 2QDLA 4YWKA 5KIXA 1PH9A 2KHSA 4HJ9A 1KIXA 4CKCA 2B2WC 3CC2A 2AUKA 1XNQQ 4NP5A 3QIAA 4P75A 5FLXW 2D0PA 3M9BA 4DV2Q 1K8AC 4IURA 2MFIA 1PTOB 3ND8A 2WKCA 4LFCL 4POGA 3H0GB 4K0KH 3M4PA 4X64Q 4NKLA 3I73A 4LF4L 2YTXA 4NDXA 3J7AV 1UEAB 5IYCG 1RTNA 3J81j 3D6WA 2PQAA 2L1BA 3MEFA 1A3VA 3OOCA 1D8LA 1PFNA 3NELA 4DU9A 2M8WA 1VQAA 4HIMA 4RFBA 2X69A 4GLXA 1WI5A 5C3EB 2QDBA 2PI2A 1FVIA 2BOSA 3V96A 1TWHH 1HNXH 3FDTA 1STAA 4LFCH 2M9VA 3A54A 1IBKQ 4NBQA 1KRTA 1YHQA 3I56A 3KLWA 1OXTA 1I6VC 4LF4H 4L8JA 1JWSD 2AMCB 3HKZE 2NYZD 4DV3L 1JE4A 2NZHA 2B29A 2NVQB 3CHBD 3OPOA 4JG2A 3RNUA 1JOKA 4CDEC 4K6DA 4KV6A 1WCMH 4JI2Q 5BN4A 1D6EC 2K6AA 1QZGA 4RWSC 1X3GA 2EYPA 2LXKA 3HG9A 3VR4A 4A3LH 4N9TA 1M90C 3RN2A 1H95A 2IX0A 3QJYA 1SYBA 4FDBA 4ABNA 4G4KA 4JPBW 4DV3H 1PHJA 3DUZA 4A3LG 1B2TA 1I4GA 1J5EQ 1EQQA 1FJGQ 3KDGA 3J7AK 3SK8A 2HT1A 2HHHQ 1MIUA 3HOZH 3RZOB 2EQSA 2CTEA 5JEAG 4HIOA 1QCBD 1JC7A 1HQMC 1B4OA 5ELEA 2QKIC 2JA7B 3H3VH 2CQOA 2Z6BA 3PCOB 1JQYD 1CA6A 3CKIB 3KBGA 1RD9D 2N55A 4DR3H 3TEHB 1M4VA 4BS9A 4A3CH 1Q82C 2UXDQ 4NZRM 1PYBA 3VDYA 1EZ6A 2A74C 4DAYB 4A3FB 2VUMB 2I5HA 3I3CA 3NUCA 1O80A 1TWAH 3RZDH 2E2JB 4HN7A 1Q81C 3GTGH 4A3CG 4A93G 4FO2A 1B3AA 3S1RB 4A76A 5AFWA 3HOUG 3LWEA 1F2LA 1RL2A 4B8TA 4CBVA 1U9RA 2JA8B 2B2YC 3VR3A 4KHZA 3H91A 1LTTD 1NNXA 2D9UA 4DR2L 2Y3MA 3WWVA 4OELB 2Q8RE 4P74A 2M2LA 4JVHA 4H8AA 3FP9A 2EJFC 4X65Q 2F0QA 1VQ8A 1Y1WH 1X65A 4DV7Q 3G6EA 3IAYA 1HTLD 2IHEA 4QCLA 3DM3A 4JI0L 3ND9A 2BA1A 1V9PA 2JA6H 1B1ZA 4G7ZC 2OTLA 3DWPA 2R93G 1WD0A 1HR0W 1Y14B 1WTVA 4DR2H 4X3TA 4EVOA 4BBSH 1JORA 3JAMi 3I2ZA 3E0JA 3HOXB 4X66Q 4JI3L 1TIID 4HSVA 2ZT9C 3CCEA 1PH3A 3WOEA 1U5KA 2OWOA 1ASZA 4JI0H 3TN2A 4S3SA 1ZZKA 5J22A 3V05A 3PIP3 1H9MA 4B3SL 1JT8A 2CTMA 3TZUA 2RDFA 2UU9L 5BN5A 4IPHA 2Z6KA 2PNHA 3J7ZC 3I72A 1RODA 2B2VA 3UE1A 5KGUA 1PTOC 1VQCA 4DF7A 3G4SA 3HOYH 2B63B 5EGTA 4JI3H 3GV3A 2YV5A 2BDNA 1BCPD 2KVMA 3DWAA 4O2DA 4B3ML 5I9PA 3HOWB 4JYAL 3TDQA 2DJFC 3H09A 2C5CA 2F0LA 2KCMA 3OMGA 4GNXB 1LYLA 2HIVA 2JA5G 3T1HQ 1B70B 4JOIC 3MZ5A 5CBEE 2UU9H 4L6TB 2N88A 3MFYA 1PTOH 4B3TQ 1EOVA 4KY6A 4JBMA 3WDNA 1VQIA 4V190 1CA5A 5IT9L 3I4LA 2CH4A 1J8IA 1PRTB 4JYAH 1IYJB 2EZVA 4A3BB 1U4PA 4J1MA 3H0GG 3AMUA 1F2ZA 2EVBA 5BR8L 1GM5A 3M4OB 3L3OC 4OX9Q 1E7ZA 2EJMA 5C3EH 3CP0A 3ZJYC 4DAVA 2ZTDA 3M7GA 3LNNA 2YQRA 1BO0A 5JAVA 1QOHA 4IALA 3RMHA 4RCOA 4ZK9B 4Y7NB 2AWNA 1W3SA 1JB7A 3T56B 1M8AA 2ZQEA 4YY3L 3NEMA 2MNAA 5C44B 1I6UA 1TY0A 3Q6SA 1CSQA 4CKBA 1FD7D 2NVQH 1KDBA 4GKJL 1CZWA 1ILPA 3K0YA 4ALPA 2LMCB 1EOTA 2G8YA 2L9HA 1YITA 2AKWB 4RKBA 4DAMA 1C9OA 3E3XA 2XSCA 3VYSA 2GN5A 3FPUB 2K7VA 1BR9A 5C4ZA 5IYBG 1GOZA 5LMUQ 3OW2A 1XNRL 3VYUA 2BDOA 2LRRA 5C4JB 3GR5A 3T53B 2E2DC 3MHBA 4KN4C 4GKJH 1CQVA 1Y8PB 2FPHX 4LFBH 1ET9A 1QZHA 4R4TA 1PFBA 3EQLC 2HDMA 4OCHA 3RZOH 3NBHA 3VR5A 1D1IA 1LTLA 3VKEA 5G3LD 1MSZA 2JA7H 2BA0A 1V1PB 1IW7D 5L37A 4FJSA 2Q2TA 4CJ2C 1STGA 1YHBA 1JR0D 4IQZA 1SEBD 4PG3A 4B9XA 2KOLA 3PUZA 1FNWA 4QUFA 1VQGA 1OXXK 2Q2UA 4OO1G 1PVOA 1JOOA 2O5IC 1G6PA 4A3FH 2CWAA 2VUMH 4BA1I 4CHTB 2E2JH 1W2BA 2B2TA 2A1AA 2L4NA 3X3MA 3JAME 1FYCA 3E0EA 3J80c 3S1RH 4I7ZC 5A2QL 4LAAA 1E2VA 4A3JG 3KFUA 5A2QE 1G291 2JA8H 3MXUA 3R2TA 1WVNA 1SFOB 3A8JE 1K8MA 1S72A 1EIFA 4JI4Q 5LL6b 2FMMA 3TZDA 4NZTM 3CQZB 2JA8G 1EU4A 2DUDA 1TY2A 3C2PA 1STYA 5ELNA 4FNFA 4FVMA 1E0BA 4M8AA 1F77A 4JI8L 2X06A 5M3MB 2KQ3A 2IT1A 4HCEA 4RH6A 1I4XA 4K2LA 3TP8A 3K7UC 3M4YA 3I0PA 4C3HB 5C0XI 1QVGA 4RGTA 2A69C 1HZ9A 4RGOS 1N9WA 2PCFB 5LMNL 5H1SE 1AN7A 4XYQA 2NZ1D 4HR7B 4LF9L 3FAUA 1CFMA 4F8MA 1TKWB 4Z9CB 4JI8H 3BYYB 5FLMH 4H13C 4GNXC 3HOXG 2K5DA 2EY2A 2F0UA 1NMFA 1QVFA 2PY9A 4DR5L 1HH2P 3UDGA 2ZJPA 2ZM6L 4OL7A 4YWLA 1X4NA 2ATWA 4IUVA 2E2HB 4CKEA 4A3GG 2FMCA 1CUKA 1X3PA 5LMNH 4LF8Q 2Y0SB 2B63H 3AEVA 1CKNA 1Q3LA 3A7LA 1XNQL 1GUTA 3HOWH 1FR3A 3SK6A 4LF9H 1R4QB 4U673 1VQ4A 1PRTC 1KHIA 1S5BD 3VYTA 4M1UB 4H44C
chains in the Genus database with same CATH topology
2YU9B 3HOWG 3PUVA 2B8FA 4LW1A 1TS4A 2A6HC 2XRSD 3GTJB 3U1KA 1X9NA 1B50A 5BN3A 1BKBA 3TBIB 1HNZQ 2OCEA 3ONAB 3GTOB 2BH2A 1H9RA 3TQYA 3HEJA 4C3IH 2F4VQ 2L55A 2RVLA 1OXSC 2MQHA 2MO1A 4X3UA 2B2UA 1EIYB 1L1OA 2QCPX 3BDCA 4L5QA 4A3BG 1SROA 3AFPA 2E2IB 3OW7A 2EYOA 1WOCA 2KUMA 1HQRD 5M5YB 5EKLA 4Y7NH 3BG3A 1YVCA 3DLLA 1NAPA 1VQJA 3S16B 2QA4A 3D8GA 5C44H 1G91A 1B7YB 4YCWA 4NXNL 1EYAA 1K73C 1QB5D 1RKNA 4WJ4A 5C44G 4H7BA 1PH8A 1K83B 1DD2A 3T51B 3CF5A 3HGBA 3F2BA 2CTKA 1HCZA 2B2WA 2AXYA 5K36H 4QF4A 1HNWL 3TREA 4O0AA 1S40A 4JI5Q 4AYBG 5CV5A 3D4DA 1SMXA 3S2DB 1ZZJA 1LTSD 4KK7A 1D5MC 3TRZA 1DZ1A 4ODGA 2H4OA 5CR3A 5C4JH 4LJZC 4DV4Q 1KNEA 2O2LD 3G6JB 4WALA 3ERQA 3URYA 3CCVA 1PV4A 5M5WB 2I5MX 2PQEA 2D5DA 2P2RA 4TSSA 3KJPA 5IP9G 1CTMA 4BA2I 2MJHA 2I46A 4FF3A 3J7AF 3NWSA 2E75C 1PTOF 2IHFA 1WD1A 1HZAA 5AJ3Q 4DR1L 1LABA 1QWYA 1KC8C 3K6OA 4JI6L 4LUVA 3N6RA 4EQPA 4PNYA 5GADC 3Q22A 2WKDA 4DUYQ 1SR3A 1M1KC 2E74C 5LHY1 3RLFA 4GOPA 4A93B 4AQYQ 4ZKBB 1KQSA 2PO4A 3HOUB 3U58A 1EIGA 2X6GA 3PUWA 3R2IA 3MVVA 1Z9FA 3UDFA 3EIVA 5HGQA 2ID0A 2ES2A 1I4HA 1I50B 5EBDA 1JJGA 1SFOH 5M9OA 3A7AB 2GVAA 4KKTA 4DV7L 3CQZH 4LFAL 5ELOA 4TRDA 4X6AH 2Z1CA 4A3DG 1PZKD 1YI2A 4QGUA 3PO3B 4P73A 4DV0L 1VCIA 1YJWA 5M3MH 2L0CA 3NQTA 4HJ8A 4L5RC 2R93B 5M5XB 4WORA 2RQXA 1A0IA 1DTJA 4FXDA 4DXFA 4PMCA 1B53A 5DAUA 1BDOA 2XIWA 4C3HH 1LT3D 5CV7A 5C5LA 3F1ZA 1EY0A 5CORA 3HOVB 4BXXG 3F2CA 1JJ2A 5M3FB 2VQFL 3EN2A 4RMFA 3S24A 5C5MA 1KRSA 2ICEC 2KENA 3T1YL 2DN8A 1N34L 2EYJA 2DGRA 4LF5Q 1LV9A 2UXCL 3GD7A 3E9IA 1SSOA 1YZ6A 1EYGA 2E2HH 4G57A 3MEHA 1BUVT 5C0XJ 3MWYW 1DOMA 5D3DA 4B3RQ 2JA9A 4TQUS 1UWVA 3FKIG 2JA5B 1J6QA 1U0LA 4BY1G 1B9NA 2VY3A 2H5XA 1H9SA 4IFDJ 2YU9H 1PFSA 4DN4M 1UEBA 4IOAA 1I6HB 4JI1L 3KDFA 3FRPB 4GKKQ 3GTJH 4JV5Q 4OWWB 1FNUA 5LL6S 4KHPQ 4DV5L 5I4DA 3GTOH 3A8KE 3J81L 1HNXL 3CRKC 1TR5A 5IYCH 1EIHA 1FNVA 1T9HA 1L0XB 3LX0A 2PQAB 2UUAL 4BY7G 1PMRA 2ENBA 1XJVA 1MI2A 3ERSX 2VZAA 3HZXA 1XMOQ 4A75A 2ALYB 2E2IH 4HEDA 1PFMA 5M5YH 1KNAA 1ASYA 5CYUA 2PZUA 2RBMA 4OXPA 2OTJA 3S16H 4LK1C 2L15A 3S2HH 1LUZA 1LTBD 4DR6Q 4KN7C 1J5KA 4X3KA 1YNJD 2J4XA 5CV4A 4LF6Q 1PRTD 1J9OA 3BU2A 1K83H 4CGYB 1IKMA 1H9KA 2SDFA 3K59A 5KYLA 3NQIA 3KF6B 1Y1VG 2A6HD 4KJOA 4H02A 4JOIA 1PH5A 2F3VA 3OIPA 2VQEL 3S2DH 1N32Q 1AZQA 1V1QA 3S1QB 2WV6D 1O7LA 1SMYD 3GP7A 4ZQ3A 1QUQA 4DR3L 1ESFA 4MIUA 1GVPA 1FGBD 2WIIB 4GN3B 5JEAH 3H6MA 1H9JA 1C8CA 5IGCA 4EX5A 5M5WH 2SNMA 3EROA 1PA6A 1TWCH 4EGVA 2F0OA 3QOLA 1E2WA 2EY1A 1IYVA 1TS3A 1AE2A 3NENA 4DFAA 1QNKA 2MUYA 1OO9B 1BBXC 5E7NA 1N33Q 1XTDA 3CPWA 1C7YA 4A3IG 1PRTF 5FLXL 4OGQC 1N8RC 4LF7Q 3U4VA 2ZXPA 2ZTCA 1I4PA 1WTOA 3CMAA 3QO2A 5FLXE 4A93H 1L0WA 3HOUH 2F0JA 1LTID 2EIFA 4A3JB 4J6HA 2NWGA 1VQNA 2EY5A 3BZKA 2K52A 4JI4L 1I50H 1PH6A 1BBWA 3FPPA 1HZCA 1SRUA 4K8JA 1C0AA 1BQQT 1CZGA 5E4XA 1ML0D 4HMIA 2QEJC 4IUQA 4BWGB 3K57A 1HJPA 1HZBA 4OO1I 2E5LL 3PO3H 3K5LA 1EFID 4IUUA 2VXWA 2K04A 1VQEA 2R93H 3GQBA 5M5XH 2E76C 3KF8B 1MD2D 1X32A 1ZYRD 1SXTA 4DAYA 4HJ5A 3PO3G 4DR7L 1TQOA 2K50A 4XT3B 2ZXRA 3FVQA 1T5XD 2TMPA 2A68C 1YNNC 4BBRG 2Q2IA 3MXPA 2NTTA 4JVYA 3AFQA 1HA6A 5IGFA 3NTIA 5M3FH 1F2MA 4KI0A 2L5TA 1DOLA 3KLRA 4JBWA 3HOVG 1E22A 1ENAA 4QQBX 3CD6A 2KECA 1UE5A 3IFTA 1YEZA 3BYTB 3TS2A 5M3FG 1F2YA 1X4MA 2F1MA 1DT4A 4B08A 1E1OA 2M00A 1WVLA 2Q2HA 1EYCA 5EQ0A 5FOBB 2C9OA 3OTOQ 1AN8A 4A3GB 3S14B 1MJEA 1XMQL 3UDXA 3JAMc 3AB9A 2JXMB 3ZYYX 3L0OA 3MXGA 4MNOA 5FO7B 4UY8C 4DK0A 1NCVA 4IJHA 1G6ZA 2KBNA 2CVRA 2JA5H 4DR4Q 2R7ZG 1NR2A 3AU7A 2AHOB 3Q24A 5FKAC 3OYYA 1C48A 4JCVE 3ULLA 3IL8A 4TKOB 4WFN3 1I6HH 2N49A 4TVAB 3PO2G 3HS0C 3NP8A 4NPSA 4X62Q 4DUZL 5J3BA 4DNTB 1GUGA 1SYGA 3D3RA 2B39A 2K1BA 1J4WA 1B9MA 2BE5C 1WTXA 3H0GH 1VIHA 4R4CA 3VYRA 4RGMA 2EPBA 1VF7A 2CTFA 4OIJA 5CBAE 2O5JC 2F0MA 5IT9E 1ZTGA 2K32A 3DM1A 3AYHB 2MP1A 4FXKC 2QGQA 4K0KQ 2Q8TA 5COYA 1STBA 4GNXA 4IUNA 1EL0A 5ELDA 2IW3A 3JC66 2L12A 3P7JA 2F0NA 1NY4A 4RAUC 2LKVA 3R8BA 2XRQD 5DM73 1IBLL 3T4AC 2GA4B 1G51A 5EKIA 2N8NA 3I55A 1ENFA 1K9MC 4Q0FA 5HURA 3M85A 1HR0L 5EPLA 5IIFA 1WTQA 4PMBA 2BH8A 3A5UA 4ZKCB 2B8GA 1I4QA 4RG1A 5KYIA 4LFCQ 1RCVD 1VQ6A 4NXML 3I4NG 4O42A 1IBML 4DPGA 4LFBL 3R93A 4LF4Q 4AYBB 4H0LC 3STBC 1N36L 2Z0SA 2SNSA 4QL5A 5KRUA 5IYBH 3CC7A 1IL8A 3TP5A 1RHPA 4ZUJA 5NUCA 1EY7A 4A4IA 3R3OA 3S1QH 1PZID 4DGZA 2SEBD 1WFQA 2RCNA 3P20A 2ANNA 2EYHA 3EJIA 3TMEA 3A56A 2UUBL 3DEPA 1XYIA 5DEHA 1YJ9A 2LXJA 4IOCA 4DAPA 1QILA 2F0PA 1JE5A 4V0BA 4DV3Q 1CKOA 1GHJA 2X6LA 1E1TA 2VS1A 1I94L 5IYDG 4OO1H 1X3FA 2PQUA 1Z6HA 3PIOA 5IOCA 4IO9A 1VDZA 1PYWD 3BS1A 4J15A 2RDGA 4DNRB 2A5HA 4A3JH 1F9PA 1UAPA 3W1GA 1VQFA 1EQTA 2CW0C 3K0XA 4YHHL 4C2MB 4GS3A 3I90A 3ER0A 4KD4A 5IE8A 4KY7A 4XTCS 3J80i 2OQ0A 2UXBL 2VW9A 2MGSA 4A3DB 5JVH3 3S17B 3CRLC 1SJED 1JWUD 3BZDB 4HTHA 5IWAL 1EZ8A 2UUCL 4XQJA 2F0GA 2JP1A 2NZOA 4C3JB 1MSHA 1LACA 4C56C 4KKSA 4OWXB 3NHHA 4DV1L 2Z6KC 1BXTA 1KD1C 1X56A 2RHQB 2B2VC 2LFNA 4KD3A 1VS0A 1YBYA 1V43A 5KNBA 4R1JA 2AWOA 1NUCA 4NMZA 3IFDA 5CV9A 3HOXH 1G8ZD 2E3UA 4GLVB 4DKAC 3GTPB 4DR2Q 1DXMA 1VQMA 2BL5A 1K1GA 1ILQA 1GUSA 1VMPA 4F7XA 1SYCA 1HUNA 1EWIA 1Y69U 1S5CD 2NVTB 4A3GH 3S14H 3K7AB 1JCKB 4LIJA 3KOJA 2F0TA 3HP3A 3AEVB 4JI7L 5KNDA 4JI0Q 1SNDA 3EBEA 1A2UA 1XTCD 4QMFB 3FKIB 1BCPB 3IRBA 5IGDA 2CWPA 4BY1B 2OXPA 5GROA 1DJRD 2OPVA 2F0VA 1ZEQX 4RHSA 3VR2A 4RKLA 4APVA 4A3EB 4DV2L 2CFMA 2R6GA 4JI3Q 4ME3A 2JQOA 2RKSA 1W6KA 4X64L 4UPAA 1VQ7A 2I5LX 1EQRA 2A68D 5HGTA 1YNND 5ELBA 4BY7B 4B3SQ 3QWNA 2PPBC 1SJHD 4DK6C 1RF2D 4EQ5A 1D7QA 5C3XA 4A3BH 3W5OA 3M4OH 4KY5A 2AQ3B 4HIDA 1IZ6A 4B3MQ 2JSOA 4JYAQ 2A6EC 1IBKL 3WOFA 1QVCA 2NN6G 4ZYSA 3PV0A 4A3KG 4HJAA 2CTLA 2F0DA 4XYOA 4IPCA 2VB3X 3I4MB 3C1EA 2K75A 2DNCA 1IHZA 4GLAC 2QF7A 1PTOD 4Y52H 2XWJB 4JI2L 2PNRC 2IL8A 1HFGA 2KHJA 3A0JA 1I3QB 1Y1VB 2D62A 4XXEA 3J81i 2AQ1B 5IP7G 5BR8Q 3KBXA 4R4IA 3BDOA 3SK5A 1P8LA 3GTMB 3S9WA 1TXYA 2ASBA 1J5EL 1FJGL 4UP9A 2HHHL 3NXWA 1SYDA 2F0WA 2BE5D 3J80L 5IODA 3J80E 3HRZC 2J0TD 4RCNA 2KCCA 1DOKA 3MXNB 5IP9H 1U4RA 4DK1A 2HIXA 4YY3Q 1RDPD 1Q1EA 3I91A 1D1KA 1N33L 2YTVA 1WCMB 2R7FA 1LTAD 3SK4A 1O78A 4LUOA 4A3IB 3CCJA 4GKJQ 2NVYB 2JZXA 2UXDL 3GDEA 3D6CA 1TS5A 1Q1BA 2K03A 1XPUA 4GOPB 3BVGA 2D2CC 1K8GA 2RA4A 3J7YW 4PV1C 4QUCA 1SLJA 2EYFA 2WACA 1SYFA 1S5DD 3J7A5 2XGTA 3NPPA 2WB1G 2WAQG 1Q8IA 2F0FA 1XNRQ 2R92G 4C2MH 5IGGA 1WYDA 2EJGC 1VQKA 5ISRA 5FJ8G 3FMCA 3I8ZA 1NJIC 1WTWA 3V69A 4A3DH 4X65L 2A73B 5T1GA 4JBJA 3OWFA 2LS01 2RHSB 1NE3A 3E9HA 2QNDA 1DYQA 1KAWA 1PH1A 1BBUA 4QJFA 3RZDB 1TWAB 2EDGA 3A5ZB 1YIJA 4MTNA 4BBRB 1EUJA 4C3JG 3P75A 2F0KA 4BXXH 3ULJA 4HJ7A 4X66L 3E6ZX 5C0XG 4PQXA 1BCPC 1AEXA 1AE3A 1A3TA 4KLKA 2VNUD 1SYEA 4FF4A 3CCRA 2Y0SE 1EFWA 2ZXOA 1DM0B 2F4IA 3GTPH 4ILWA 3HKSA 1E24A 4IFDG 1BF4A 4G7OC 3K5OA 4FYDA 2NVTH 1KHMA 3K7AH 3NE5B 4JI8Q 2K33A 1QG7A 1JJCB 3AQQA 1SE4A 1TT2A 1OTCA 3FKIH 4P72A 4BY1H 2R7ZB 3NBIA 2B2YA 1G2SA 1VQPA 3T1HL 4WJ3M 3PO2B 1MJCA 4NB3A 3KDFB 2WFWA 1EY4A 2I07B 5LMNQ 3BZCA 5I2XA 2WP8J 4FF1A 5J39A 2DGYA 2F0IA 4LF9Q 5EPJA 4B3TL 2IJ0A 2EY6A 3L9AX 3NTKA 4A3EG 1EY5A 3SR1A 3S15B 1STEA 4DNIA 1KXLA 1SE2A 2XVSA 5E1FA 1Q8KA 3D0FA 1Q7YC 2K4KA 4BY7H 4DR5Q 3PUYA 2ZTEA 2ZM6Q 3J81E 4XIGS 3HOYB 1VQOA 1ZKOA 2A69D 5C6AA 4JBKA 4OX9L 5E3FA 4ZLTF 3PIO3 4ME5A 2LSSA 3CCLA 1CM9A 2OPUA 3K5MA 4ZAIA 4GN5A 1VQ9A 2D0OA 1JB3A 3I4MH 1WJJA 4PZ6A 2R7DA 3BVZA 2K14A 3I4MG 2K5WA 1STNA 3I4NB 1MSGA 3CXCA 2ZJQA 3OSOA 3T13A 2CHBD 4K5XA 1UE7A 1I3QH 1Y1VH 1IW7C 1NMGA 5JPMC 4P71A 1L2FA 3CAMA 1MGSA 5LMUL 1PH2A 3A55A 4FF2A 1QUQB 3GTMH 1KLUD 2CQAA 2NUCA 4GOPC 1HUMA 2TSSA 1SNPA 1I4RA 3UI2A 1O7YA 2IWHA 3B6YA 4IPDA 1NSNS 1EY6A 3S1NB 3K58A 1A63A 4K2KA 1KABA 2K05A 2K5VA 2PZTA 5IT9c 1AFPA 2RSNA 4NXNQ 3L7ZC 3PF4A 1RTOA 1LT4D 3G7LA 4A3IH 3W2DA 2JJQA 3KK7A 2A6ED 2NVYH 5D14A 2HH2A 3H3VC 1WCMG 3KF6A 3K80C 4L5SA 1HPCA 1L0YB 2OEOA 3D31A 3UE0A 4HAEA 2MJ8A 5CV6A 1HNWQ 5ELFA 3PGZA 1OXUA 3KJOA 4ULLA 1MBYA 4IJLA 1UE6A 3RN5A 3DXJC 2Z8LA 2QILA 5E4WC 2VL6A 5DM63 3HKZG 4YCVA 3OHXC 2QEXA 1XX8A 1S5ED 5JJIA 3CCQA 2Z4IA 2JK8A 2KHIA 1K3RA 1EU3A 1LTGD 4HMJA 2K5QA 3HFZB 3HOZG 1GJXA 1Y8NB 4G7HC 1VQ5A 2C35B 3U4ZA 5JPNC 4GZYC 3EA6A 3MA2B 1ET6A 3U9SA 3GTLB 4DR1Q 4QB4A 1ICWA 3GTQB 4JI6Q 3BDLA 1HTPA 3BVMA 3M3YB 1A15A 3U9OA 4R8NA 4BBRH 3SDZA 1BNZA 5CGKA 1T5EA 3GV6A 5JEAJ 2EOTA 3F2DA 1ZZIA 4LUZA 2PZWA 5EJWA 2BCOA 1CI3M 3HOVH 5GAGC 4A3MB 4JC0A 1IYUA 2CTJA 2KEDA 3DMUA 3BJUA 4K8IA 1TWFB 4LFAQ 1KDAA 2HCCA 3DEOA 1X3QA 4IN3A 4LNQA 4DV0Q 1Y1WG 5I2YA 4LF8L 4KMUC 2G9HD 2RDHA 3KF8A 3TP7A 4DV6Q 1AW7A 1S4ZA 3MFGA 5I9OA 4MZ9A 1V8QA 3CC4A 2JA6G 2IX1A 2JYOA 4OONA 2R7ZH 3SGIA 3CU7A 3KUPA 3PSIA 5EKKA 3SHLA 1K8OA 1ZXTA 3I4OA 2HQLA 3U50C 2HUGA 1CSPA 1Q90A 1X55A 3PO2H 3VR6A 4K14A 4BBSG 4U68A 4C1NI 1Q86C 1IXRA 3RUZA 1C4QA 1A2TA 4HSPA 5F2DA 1HNZL 2KA7A 3TP6A 2VQFQ 2XNAC 3S1MB 2PI2E 1UE1A 1PDQA 5KNCA 1EY8A 4XQNA 2F4VL 3Q0AA 4K5VA 3S15H 3F2UA 3T1YQ 3N52A 1Q12A 2E8GA 1N34Q 4XQQA 4QY7A 3LWUA 1F9QA 3H15A 3PMFA 2UXCQ 4ZRZA 1UUPA 1CHPD 1VQHA 3KLSX 2CCZA 2F3IA 5IGBA 2YYZA 3G71A 5JJKA 4QIWB 3K81C 5JJZA 3HOYG 2JE6I 5GAEC 2PW7A 4R4OA 2PMZB 3RR5A 4A3KB 5CC4A 2F0EA 4KKUA 4C1NK 3PUXA 4GN4B 2MPMA 1O7IA 1IL2A 4JI1Q 2NTSA 2B3GA 4C3IB 4YCUA 1HHVA 4POFA 1VMCA 4DV5Q 2V4DA 3I4NH 1W6JA 1AH9A 2FHTA 1E3PA 1HNXQ 5D3IB 4MN3A 2OT2A 1PH7A 4JI5L 2F52A 3C3LA 1FGUA 2IX3A 2UUAQ 1SNMA 5ELCA 2NN6I 1KDCA 2FMRA 3PF5A 1BCPF 5A35A 2YTYA 5C3EG 2JEAI 2ICIA 1OXVA 4DV4L 4PMWA 2NB0A 3KYHC 1GHKA 1GO3E 3S1NH 2EXZA 2RSOA 3NBHB 3RLNA 4EQNA 1RJTA 3CCMA 1CT1D 1U4MA 5AJ3L 5IYDH 3MTSA 1CQFA 1SE8A 5LMNW 5HY6A 3X3NA 2EYMA 3V2TA 4DUYL 1VQDA 1R4PB 4YIJA 4FXGC 1DGSA 1EWCA 4AQYL 2OF1A 3A8IE 2IY5B 1BOSA 4HIKA 1E2ZA 2K01A 2WB1B 4UP7A 2WAQB 2VQEQ 2K5NA 3RLOA 1S3OA 4F87A 2R3ZA 2R92B 3ICEA 1NBWA 2J7ZA 4DR3Q 1HXYD 5C4XB 5KEEA 4WANA 1SNCA 2RF4A 4J8QA 1HFNA 4L63B 1G2TA 1B8AA 1X3EA 1CK1A 1V1PA 2ZJRA 2JA7G 5GQOA 3GTLH 1GXDC 4K5WA 1U4LA 1QNUA 3GTQH 1KTKA 1LTRD 4CJ0B 1TWGB 2HH3A 4KHVA 3Q8DA 3M3YH 3JAML 5J1ZA 4Q5VA 1A6XA 2V1CC 1P16A 1EEFD 3OWEB 2K5HA 5C4HA 1LLRD 5TSSA 4A3FG 2VUMG 2KCNA 4DXGA 1F9SA 3M7NA 2AUJD 1GUNA 1VQLA 3CCUA 1SBBB 5EAYA 4LMQD 3CMEA 4A3MH 3EVQA 3O13A 1XPRA 4UDUC 4DK3C 3GTKB 3E5SA 4LF5L 5G3LF 1TWFH 1B44D 3CCSA 4A3MG 5FO8B 2O4XA 4OIKA 4WJWA 4F88A 2E5LQ 1A62A 2N3SA 2Z4HA 4PZ8A 4B3RL 2F0HA 3SEBA 1EEID 1YJNA 4IPGA 4DR7Q 1CKNB 4O1NA 3DWQA 2HDLA 3TS0A 2I0QA 3CW2C 4RHRA 5CMDA 5JVG3 3NWTA 2FFKB 1AZPA 1XWEA 5DNFA 3MAQA 2B63G 3UDIA 5D65A 4IFDI 1VF5C 1BVSA 4E6IA 4AM3A 4GKKL 2F3WA 4L5TA 4JV5L 1TUAA 1R9TB 4QIWE 4KHPL 1I5FA 3M4QA 1ONLA 3I7FA 4UP8A 1A3UA 2DY8A 3S1MH 2PMZE 4XT1B 2XWBB 1EC6A 4HCSA 3QG1A 5FLMG 1DCZA 4KJNA 4P2CB 2DY7A 3QB3A 1DONA 1JWMD 5IGEA 3FHWA 1O7ZA 2NVXB 5LL6X 1MKHA 1XMQQ 2AQ2B 1YNJC 4R9WA 1XMOL 1L1OB 2UU9Q 5JJLA 1VIGA 1LT5D 4AH6A 4RGNA 4X3SA 4CJ1B 2NN6H 3SE0A 3SXHA 1EQVA 3W3AA 1K0RA 4XDXA 4A3KH 4N9PA 2FJ2A 4KTAA 4WRDA 2LY7A 4AYBE 3C1FA 5FO9B 5DLQE 3GO5A 3P1HA 3RD4A 2GVBA 4DR6L 1FL0A 1GD7A 4DUZQ 1SMYC 4LF6L 1ENCA 2IPKD 1HRJA 5FK9C 4IZ8A 2F03A 5EBCA 4EQOA 4C3IG 3A74A 4AIMA 2PW5A 5IP7H 2K28A 3TSSA 2PYKA 3D4WA 3DHQA 1N32L 4ID6A 5C3WA 1D2BA 1NTGA 1TVXA 1AP0A 4ZUIA 1EWHA 1TWHB 1Z47A 3K8AA 4RA8A 1CHQD 1GKHA 3S2HB 3CPFA 2B2TC 2MO0A 1IBLQ 3F8TA 3ITPA 1V1OA 2R61A 2WAQE 2WB1E 3PIPA 2NBFA 3J81c 1JMCA 2N78A 5I6WA 3MC0B 2SOBA 1HR0Q 3W1BA 4IUTA 3C46A 3K5NA 1CKMA 2FINB 4NXMQ 2EXDA 1IBMQ 4LF7L 1II3A 2FXQA 4LFBQ 1SAPA 1HA5A 5K36G 1N36Q 1WTPA 1VQBA 1WE8A 3HKZB 2HQEA 2XTIA 3H94A 2JEBI 2R92H 2HCIA 1PLFA 1ZYRC 5IY0A 1D5ZC 3IKJA 4K6LA 3L2PA 5FJ8H 3G48A 1SNOA 5C4XH 3MXNA 3HOZB 1TWCB 1YHAA 1A8VA 1KL9A 2UUBQ 1TU2B 3NK9A 1PXUA 1SDFA 5JOBA 3Q23A 3OMCA 3STBD 5C4XG 4MHEA 1Y8OB 4R4QA 1XXGA 4UAIA 2EE1A 5T1IA 3S17H 4OWTB 1I94Q 1QE6A 1JOQA 1PH4A 4IUPA 2KEEA 1TWGH 2ANRA 2XN9C 1Q46A 1IKLA 4C3JH 3LGJA 1F9RA 1EYDA 3NSWA 3GTGB 1X6OA 1TS2A 3OIQA 1KLGD 4FP5D 5C0XH 3KLSA 1PYSB 1UNSA 1SE3A 2KJXA 3H3VI 4YHHQ 1EY9A 4IFDH 1ESRA 3SVMA 3GTKH 2DNEA 4OHJA 2UXBQ 2CKZB 5K5PA 1X54A 1STHA 3OTOL 1LT6D 4DV6L 4LWCA 4PZ7A 3QOJA 2G9DA 1KAAA 3VA7A 1Y1WB 2A8VA 3FEWX 5IWAQ 2MHVA 1S5FD 2UUCQ 5I6YA 2H1EA 5FLXc 3EFXD 2JA6B 4I65A 5M3MG 3ULPA 2VB2X 2CW0D 4DR4L 3D4RA 4NW2A 2EYLA 4B9WA 5EPKA 4DV1Q 1QJOA 2B2UC 4C3HG 1WTRA 4BBSB 1H9SB 1L1OC 1SN8A 2F0SA 4X62L 1XPOA 1SNQA 2OQKA 1R9TH 1PZJD 2Q8IB 3T16A 3I70A 4YWMA 4A3EH 3VA5A 1Z7TA 5GAHC 2L11A 4DA2A 4R8IA 1RIPA 3NTHA 1GUWA 1LO5D 1GUOA 2WINB 4JK1C 2NVXH 1YNXA 1NR4A 2JVZA 1D5XC 5CV8A 2A19A 1LM0A 4QMGA 2KCTA 4JI7Q 4K0KL 2CPQA 2Y0SG 1JICA 5KIXA 4YWKA 1PH9A 2KHSA 4HJ9A 1KIXA 4CKCA 2B2WC 3CC2A 2AUKA 1XNQQ 4NP5A 3QIAA 4P75A 2D0PA 3M9BA 4DV2Q 1K8AC 4IURA 2MFIA 1PTOB 3ND8A 2WKCA 4LFCL 4POGA 3H0GB 3M4PA 4X64Q 4NKLA 3I73A 4LF4L 2YTXA 4NDXA 3J7AV 1UEAB 5IYCG 1RTNA 3J81j 3D6WA 2PQAA 2L1BA 3MEFA 1A3VA 3OOCA 1D8LA 1PFNA 4DU9A 3NELA 1VQAA 4HIMA 4RFBA 2X69A 4GLXA 1WI5A 5C3EB 2QDBA 2PI2A 1FVIA 2BOSA 3V96A 1TWHH 3FDTA 1STAA 2M9VA 3A54A 1IBKQ 4NBQA 1KRTA 1YHQA 3I56A 3KLWA 1OXTA 1I6VC 4L8JA 1JWSD 2AMCB 3HKZE 2NYZD 4DV3L 1JE4A 2NZHA 2B29A 2NVQB 3CHBD 3OPOA 4JG2A 3RNUA 1JOKA 4K6DA 4KV6A 1WCMH 4JI2Q 5BN4A 1D6EC 2K6AA 1QZGA 4RWSC 1X3GA 2EYPA 3HG9A 3VR4A 2LXKA 4A3LH 4N9TA 1M90C 3RN2A 1H95A 2IX0A 3QJYA 1SYBA 4ABNA 4FDBA 4G4KA 1PHJA 3DUZA 4A3LG 1B2TA 1I4GA 1J5EQ 1EQQA 1FJGQ 3SK8A 2HT1A 2HHHQ 1MIUA 3HOZH 3RZOB 2EQSA 2CTEA 5JEAG 4HIOA 1QCBD 1JC7A 1HQMC 1B4OA 5ELEA 2QKIC 2JA7B 3H3VH 2CQOA 3PCOB 1JQYD 1CA6A 3CKIB 3KBGA 1RD9D 2N55A 3TEHB 1M4VA 4BS9A 4A3CH 1Q82C 2UXDQ 1PYBA 3VDYA 1EZ6A 2A74C 4A3FB 2VUMB 4DAYB 3I3CA 2E2JB 3NUCA 1O80A 1TWAH 2I5HA 3RZDH 4HN7A 1Q81C 3GTGH 4A3CG 4A93G 4FO2A 1B3AA 3S1RB 4A76A 5AFWA 3HOUG 3LWEA 1F2LA 1RL2A 4B8TA 4CBVA 1U9RA 2JA8B 2B2YC 3VR3A 4KHZA 3H91A 1LTTD 4DR2L 2D9UA 3WWVA 2Q8RE 4P74A 2M2LA 4JVHA 3FP9A 2EJFC 4X65Q 2F0QA 1VQ8A 1Y1WH 1X65A 4DV7Q 3G6EA 3IAYA 1HTLD 2IHEA 4QCLA 3DM3A 4JI0L 3ND9A 2BA1A 1V9PA 2JA6H 1B1ZA 4G7ZC 2OTLA 3DWPA 2R93G 1WD0A 1HR0W 1Y14B 1WTVA 4X3TA 4EVOA 1JORA 4BBSH 3JAMi 3I2ZA 3E0JA 3HOXB 4X66Q 4JI3L 1TIID 4HSVA 2ZT9C 3CCEA 1PH3A 3WOEA 1U5KA 2OWOA 1ASZA 3TN2A 4S3SA 1ZZKA 5J22A 3V05A 3PIP3 1H9MA 4B3SL 1JT8A 2CTMA 3TZUA 2RDFA 2UU9L 5BN5A 4IPHA 2Z6KA 2PNHA 3J7ZC 3I72A 1RODA 2B2VA 5KGUA 3UE1A 1PTOC 1VQCA 4DF7A 3G4SA 3HOYH 2B63B 5EGTA 3GV3A 2YV5A 2BDNA 1BCPD 2KVMA 3DWAA 3HOWB 4O2DA 5I9PA 4B3ML 4JYAL 3TDQA 3H09A 2C5CA 2F0LA 2KCMA 3OMGA 4GNXB 1LYLA 2HIVA 2JA5G