2JELH

Jel42 fab/hpr complex
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
218
structure length
218
Chain Sequence
QVQLAQSGPELVRPGVSVKISCKGSGYTFTTYAMHWVKQSHAKSLEWIGLISTYSGYTNYNQKFKGKATMTVDKSSSTAYMELARLTSEDSAIYYCARVMGEQYFDVWGAGTTVIVSSAATTPPSVYPLAPGSGGQGNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLAADLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIAPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The 2.5 A resolution structure of the jel42 Fab fragment/HPr complex
pubmed doi rcsb
molecule tags Complex (antibody/antigen)
molecule keywords JEL42 FAB FRAGMENT
total genus 43
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 1998-02-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2jelH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2jelH02
3BQUA 5CFHA 3MREA 3EYSL 5D7KE 2D7TH 4FABL 3G5YB 3VI4E 2CGRH 4S10A 3U36B 4OD3L 5D1QB 5EUOF 1PKQA 1BJ1J 1ZV5A 1J86A 4PJXF 2VO5A 5KVDH 4PB0L 4BZYA 4M6OL 1U8KB 3GMOA 1P7HL 5DT1L 2R1WA 5EZLB 3UO1L 3U9PL 4IRSC 3AAZB 4AJ0A 8CGTA 3HB3D 2V6HA 4WHCA 3Q3GB 3H6JA 4U0QB 4P5KB 3BMVA 1H5BC 4L4TE 5BXFB 3HMXL 5EPMA 1QFHA 4WEMB 3CFIC 3DI3B 5GGRA 2OS7A 2JJSC 4G7VL 2J8UB 2IBZX 2D3VA 3RGVB 3A6CH 3VFNB 3RBSA 4YHPA 3QWOA 2FGWH 2L0DA 1A6VH 2GAZA 4HLJA 4NP4H 4D94A 2YA2A 4XC1H 3HCVA 3NIGF 3RZCA 2EDLA 4C56E 3CSBA 5C2BL 3U0WH 5DZLA 3QEGH 4YHLL 2PTTA 1TQBC 5DJ2A 2HJFB 2BNQA 3MRHA 2BCKB 1P5VA 4PJ7B 5T5FL 4J6RL 1F8TL 4PY8J 5E94A 1GZPB 1S7VB 2MFNA 1IGCL 4JREC 2Z31B 4N0YH 4MA1C 3ARDB 3RI5F 4P23D 4OZHB 3H7LA 4PJDE 3NFSH 3R8BB 1FL5B 5I1GL 1HXYA 1WFOA 4ODWB 2H32B 2L7JA 5L2JB 4BSVB 2DJSA 1YQVH 1M7DA 5JR1H 1WIOA 4U1GC 2E9BA 5BCAA 4M7ZB 5FCSH 1TDQA 1MJUL 1RZ7H 4OZGA 1OPGH 4LPTA 2ICEA 5GRUL 5GS3A 1A14L 4MZ3A 5T33L 3DIFA 1ZSDA 4X6CA 1P2CA 4WFGD 1P7QA 1GGCH 1T80A 3LD8B 1U6AL 1S9WB 3GKWH 5D71H 5ITFB 3ARGB 3KLSA 1GGCL 4K9EL 4WY7H 3ARED 4LP5A 1Q9LB 4YDKH 4E0RB 5DURB 2IGFH 3MPCA 4K9EH 4XPTH 3IXAB 4X4XA 1E4XH 1TCRA 5C86A 4XVTH 5IFAL 3EO0B 4MD0A 2LVCA 4LKXA 3U36A 1IGTA 2EXWC 4XPTL 4KUCF 2YD1A 4EUPB 5HVHB 3V6FB 2QEJA 3UTSE 3DXAA 2C4XA 3T0BA 2XT1B 5F70A 5T3ZD 5KSBF 1L9NA 1DANT 4W6XB 2VSDA 5DD6B 2Q76B 5KSAB 5MI0C 2B2XL 3KPSA 5C09E 2IFFH 4MQ7A 4XH2A 4UQ3A 3X11B 5GRYA 2VQUA 3O8XB 1JNJA 3JWDL 5E99L 5IB3A 2P24A 3D69B 2C1PA 3LN4B 5IM7B 2AEQL 3A0OA 4CGTA 1HHHB 1QO3A 5EIQA 1IBGH 1QYGH 5D7JD 1MAKA 4P48A 3FAWA 3MLPA 1Q9KA 1FYHB 4JPWH 3R4DA 5EN2A 3QHZH 3S96B 5CGMA 3LN5B 4GAJL 1DN0A 2APFA 4Y4HA 3QHZL 4XP4L 5HHPB 4P59H 4XZUA 3WFCH 1G6RB 3BZEA 1PG7H 4G9FA 3QH3A 2NY2B 4S2SB 1LNUA 5JW3L 4Z5RB 3ARYA 3VXRA 3PGDB 3WEXB 1YEIL 1HXMA 2HT2C 1FNEA 4X99A 1WZMA 2F19L 3TH3T 1XF3B 1MVFA 4HK0A 3RWIB 3OKLB 1JPGA 2DQFA 1HH6A 3QQNA 1NFDE 3SCMB 4KZDL 2BNUB 2M1KA 5D1XD 3ULVL 5L9DL 2FBOJ 3Q5OA 3NZHH 3QNZB 5IUSA 1ZK9A 3GNMH 4OI9A 3QQ9D 4BQCA 2Q7NA 3P4OB 5I1EH 3BQUB 4GRMB 4I77H 4KKCC 3RA7H 4E5XB 4ZFOL 3SGEI 3B8SA 3H7BA 5GS2D 4CADB 1Q0YL 2GJZA 4GSDL 3U30C 3RA7L 4L4VE 2ICWA 1I3GL 4GAGH 4XWGH 5HHQB 4GOSA 15C8L 5IW6B 4B5EA 4J1UB 5B8CB 3FQRB 1EFXA 1T7VA 1MRFL 3TJEH 3OR7B 4BELD 4JFXB 2M26A 4MXVF 5CJXA 4LSSH 4Y4KC 4I0PA 4HWBA 5HYSG 4X6DB 1T3FA 1BBDH 5I71B 4PJ5D 5K33A 5BXFA 1V7NH 2GIYA 3WNNA 1RUKL 3VE0B 4CNIA 2FH8A 4NO5B 3TBSB 2OR9L 5GS0H 3O8XA 1K6QL 1YEGH 3V5HA 1A6AB 3L3JB 5FF6B 3ZDXE 2R56H 2HT3D 3KPSD 1ZGLA 1K6QH 1YEGL 2GYSA 2WBWB 2AK4B 4OGAD 1P7QB 2B7DT 4LEXL 4G3YH 4NBZB 1FFPA 3FT3A 1ZMYA 2OXGA 3NH7L 4K7PY 4WU7A 4WFEE 5BOZG 4JG1H 4KKBD 1YMHB 5A1AA 3WXVL 4DN4H 4NDMB 5ALCH 4D9RD 5ISZB 2V5TA 4YXHH 2EYTB 1A6ZA 3EO0A 4MD0B 4F7TB 1IC7L 5EU6A 1RZKH 4ODWA 2VIRB 1UB6A 4MNQE 4GG6E 1V3LA 2AS5M 4N8VB 1P9MA 4ZFZB 3RNQA 1TJIL 5EO1A 3WYRA 5ID1A 3MRHB 5GZND 3J7HA 1KPVA 5E7BA 2P8LB 5F1SA 1AC0A 1IGML 5K9QG 1FDLL 1YECL 1JV5B 1KEML 5IF0A 1NFKA 3QUZD 4Q0XH 1OAUL 4JFHD 4Y2OA 5GRVL 4EOWH 3OKYA 1IGMH 4LCUB 3U4AA 1S7WA 2H32A 1SBSL 1TCMA 2R15A 3MROA 3ZE1E 2F53B 3PHQB 4MJ5A 5EU3B 1U2HA 4IRJA 1FJ1B 1YC7A 3WS6A 1OTSD 3NIDE 3VGGA 1OSZA 5DMGC 3GHEL 3C08H 3H9HA 1OARH 3V0WH 3O3BA 1QPXA 5DQJB 3C6LA 4RFOL 2B39A 3D39A 1KENL 3MA7B 2N1KA 4E42B 5A2IH 2VLLB 3PG2A 4QXGL 4NZJA 1YPZE 1KXQE 4JDZB 2EC8A 5CD3A 5FEBA 1JPGB 4JFZL 4WUKL 2ADJB 1DZBA 1SJVA 2DKMA 5FM8A 3QIWA 1X7QA 3IJYB 1EBAA 2KKQA 4ODVH 4ODHL 5F9WB 4DCQB 3UJIL 4IOSD 1FIGL 1A47A 4UI2A 2DQUL 4HPOH 5K9KA 4LQFH 4LPYA 4JO2L 4XBGB 1CZ8H 2EIZB 4Y4FC 1ZVHA 4XNYH 4XC3H 4XZUB 1WWAX 3R1GL 4R3SB 4OGXH 2EO9A 4LRNH 1CZ8L 2RFXB 2PW1A 2D03H 1VFMA 5IK3B 1T1YB 2F54A 4X6DF 1CGSH 4K94L 5J11B 3FQNB 3MNZB 1T1XB 2QHRH 5JQ6H 1LDPH 5IB5A 5CLWA 4Q9QL 5C0BE 5IV2A 4XGZA 4YHYB 4JRXE 4GAYB 4Z7VA 1HHHA 5M95B 2CLZB 3NA9H 1F11A 5BMFL 1XZ0A 5FHAL 2DYPD 2ZWLT 1NUDA 3JWNC 1N5AA 3BGAA 4OZ4A 4QRQA 4Z7NF 1CXHA 1MLCA 1NLBH 2Z91B 1ACYH 2E9IA 3FOLB 2EE6A 3RQ3A 4WWKA 4JR9H 3MO1A 1IGJA 3NA4A 4MB3A 3T0DA 4IMLB 3UTTE 1TJHH 2NLJB 5DJAA 1A3RL 3DMMC 3TN0D 3AY4C 2BNRD 3W0WA 1WWCA 2VXUL 1QHPA 4UB0L 1F45A 3GB7B 2GTZA 3GMMB 1R5VB 1S7WB 1FNSL 1RMFH 2PYFB 2PF6A 3OZ9L 1DLHB 4RCAA 2GUOA 4ZS6D 5D2LA 3BPLB 1NFDA 5KTEL 1T2QL 5I1HH 3GGWA 2BNRB 1MCHA 3H8NA 2C3VA 1MJ8H 3D69A 3O2VL 1CK0H 2NW2A 4LARH 1O0VA 4FNLL 5DS8A 4H0HB 3VA2C 4G8GE 4G8EB 1ZHLA 4YHML 3JWOC 4C57C 4LARL 5EU7C 5D2LF 4YHKL 4Y8DC 2QHLA 4HKBA 3UBXA 2Y36L 3O3DB 1VSCA 1NH6A 2Z8WC 4RWYL 4WI6A 4XPHL 4XP1H 1HCFX 4G8IA 2NTSP 4DFHA 3CJJA 2DL9A 3DXAD 4JZJB 3MC0A 3PGDA 4YHYC 3PQYE 1ZLUK 4Z8FH 2JIXA 4ZSOB 1J88A 2NXYD 2BX5A 5J12C 3WFEL 5IWLC 4LPXA 3FRPG 1LK3H 1LE9B 4U1MB 4HWEH 5ISZE 4YWGH 1ZOXA 5C07A 1AD9A 1CN4A 5L0QB 1TENA 2ESVA 2ESVE 3C8KA 4R4BB 1XF2A 4HWEL 4NN7C 1UCBH 2BNQE 4YFEA 3P0YL 5C2BH 3SGDI 3MUHL 2NX5D 5L2KD 1N6UA 4FQHB 5L0QC 4MLSA 2J3SA 2X4RB 3U9UB 2ZOKB 1MCQA 2FX8L 3RVTD 4TNVF 1MSPA 4C54A 4K55A 3PGFH 1QLRA 3T3ME 4LIQL 4KTEL 4ONHB 2NNAB 2NY1B 4NQVA 3BD3A 5CSGA 3PGFL 5DFVC 1NJ9B 1KJ2A 3T77A 3BEWB 5T1KB 5C70A 5CP3H 2WBJA 5C0JB 5DSCB 5C71A 1XIWD 5ENWA 1A4KB 3KYKH 2V7HB 3RVXC 4HK3N 1D9KD 3RWGA 1MJUH 1H3PH 4HEME 3V7AE 1UM6H 4X6FB 5A2JH 4JRYE 4NQCD 4ODSH 4UNVA 2VTFA 2GSIA 1HHKB 4ZNEE 2MPAH 1NFDF 2W91A 4MNGA 2A9ML 3VXSA 1MREL 4WUUE 2FEEI 2NY0C 4WTZG 5E8OB 1YEHH 1EGJA 1HNFA 3MNWA 4HUXB 5H37G 2X9WA 4U6HA 4QXUH 4JRXD 5JOEA 4L5FL 1YJDC 4KJQC 1BVLB 1CFSB 2CIKB 3BEVA 4JANA 5IFAH 5A2LH 2LE9A 4FXGA 4NQCA 5HHXL 3IU4H 43C9B 1JBJA 1Y6MR 3ALWA 4LVOC 2NR6D 4ZFOA 3VXTA 2F8OA 3W82A 5LGJA 5HHXH 4RZCB 4JVWA 4KK8D 4M48H 1N0LA 1JWSB 4F9PA 3RUGF 4MDJA 6CGTA 1N5YL 3TT1L 2HAZA 4NFBA 1XIWC 1EJ6A 2ICCA 4G6JH 2MQ0A 4XP6H 5DYOA 1GH7A 3MRRA 4XGZB 2GTZB 4X80H 5ID0A 3INUH 4PJCA 2YXMA 3BVNB 4HS6A 4GH7B 4XI5C 1WITA 3B2UD 2AEQH 4JRXB 4RAUB 2VLKA 2P5WA 2UUDK 5ACLA 2LAAA 1UACH 3O3EA 2NXZB 1FHGA 5ANME 4PLOB 3K46A 3PNWB 1J11A 5M7QA 2E3VA 3X3FL 4U1JB 5GS1B 2BOCB 4NBYB 3QDGD 1QSFB 1A6ZB 5C07D 4PJEB 4BH7A 5DRXA 3U6RA 4PJCE 4MAUH 2X4UB 3NN8B 3SCMD 5C8JA 1D5MB 4EI6A 4MHHI 2Y23A 1BVKB 5KSAC 1DVFC 3VRJA 2Q6WA 5I0DA 4PBVC 4UT6L 4MGXA 4RAVB 2F19H 5C0ND 1A5FH 3ELAT 4L9LC 3RWJB 4Y88A 1I85C 3VRLE 3LH2H 3T4YB 2AGJL 4KRPB 1DLHA 4U7KA 1YDPA 3HAEB 3V52L 4YQXL 2ERJB 2FX9L 3OTTA 1NCWL 3LH2L 2DIJA 3SDDD 3U7YH 4KQ4H 4X5XB 4K2UH 3OXSA 1NCCL 1U8QA 3EOYG 5DUBB 5LWYL 3OHXB 2C26A 3ULUL 1FVDB 1JPTL 1MFNA 4MJIB 4YO0B 1NBZB 1UM4H 4CMMA 1FVEA 3BD5A 4L3EA 3K4DA 5BRZB 2P5ED 3KGRA 5GGSY 5GGRY 4XMLL 1A7RH 2D7PA 1FNLA 1TZHB 3EJJX 3I6GA 1K4DB 3ISWA 4I5BB 5EWIL 1D6EA 3L7EA 2NY1C 5EU4B 3G5ZA 5HHNA 1KCVH 1V7ML 3VCLB 1C1EL 1KCUH 4MA3A 1NLDH 4LSVL 5KSAD 4PJ9B 2DICA 3KR3H 4KXZH 1KC5H 2BSTB 1JZ8A 4IOIA 3Q0HA 5FCUL 4RGND 5IV2B 3FQTB 4KKCD 5IMLA 2HLFD 4PREB 2HMID 3MCLL 4XNXH 1N59A 2X4NB 4XP9H 2Y5TA 3KYMB 5MENE 1OHQA 4XCYA 2OR9H 3O3DA 1H3XA 4LU5H 1FZOB 4XP9L 1REIA 3V4PH 1G0YR 4UTAH 2YOCA 1E4WH 3P77A 5FKAA 5DO2C 1SYVA 1UJ3B 2AK1H 1A0QH 2VC2L 4NJAH 2NLJA 2ZSVA 3DVIA 4XTRC 5B39A 1KTDA 2AK1L 3WIHL 2P5WD 3S37X 1WGOA 4JM2D 3G08B 4Z7WF 4I3GA 3D9AL 3TJHC 5CHNA 4FQIH 2CUHA 3G6JB 4I13B 1MWAL 1RUPL 1MCWW 3MYJB 3FQXB 4LLQA 3V4VH 1KIQA 4NO0A 4TVSa 5LQBH 4PJAF 5F1NB 4DGYH 1I8IA 3M07A 4AM0A 2XQYK 1H15A 2DD8H 1AP2B 4P4RB 1IZKA 4UDUA 3DARA 1ZGLP 5MHSE 3A67H 3O4OB 4YPGA 2Z9TA 5CP3A 1ND0B 3RBGA 5IROA 1DL7L 4TVPH 5FGRA 3C5SA 2R1YA 2PXYC 4ZTOH 3SGKC 1KJVB 5T5FH 3QWRA 4ZAKD 3CZFA 1X5LA 1IGCH 35C8H 3ARQA 2VQ1B 3GMNA 4HIHA 1ONQB 4JRWA 4L4VB 4LSPH 3SKUD 2CLRA 2YA0A 5CCKL 3WIIH 4WHTB 3BDYL 1NSNH 1LMKA 4JM2C 3VGFA 2AJUH 3P4NB 4FHBD 3R0NA 1CICA 1QR4A 1P4IL 4L8BB 4OZGE 2X4UA 3HLAA 1MJJB 5C2UB 1JYNA 4L1DA 2A6IB 5GIRA 1GCFA 2OI9C 3THMH 4JQVC 5T1LA 5IT2H 1RZ7L 3ARGA 3AS3A 4JCMA 1WEJL 5FYKL 3UZEA 3BE1H 3KAAA 3RDTD 1XF3A 5IT2L 1FORH 1VEMA 4LCCA 4EN3A 1BWMA 2CPCA 3BE1L 4MXWL 3BEVB 4JANB 4PRPD 2VLKB 3MV9B 4WO4B 1JYVA 3PP3K 4MXQC 5E00A 2X4QA 2FSEB 4N5UA 3G6AB 2HKHH 1IM9B 1CICD 1JMXA 3B9KB 3MLXL 4YDKL 4HFWB 2H2PD 1MVUB 1QSFA 4M3KB 4KI1A 4PRHB 1IAOA 4X4YA 1CFVH 3RGVD 1DN2A 3RY6C 1MCDA 1HHKA 4MDJB 4S1SL 3O41A 3IKKA 1CFBA 4C4KO 3OF6A 3H7BB 4Y2DD 3DO3A 3MJGX 3ZTJH 2JJWA 32C2B 4JO1L 1FL3B 2OCFD 3BGMA 5C0AE 4BKLB 3TEUA 4X99B 4JO1H 5DJ2B 2FBJL 1L6ZA 4OKVB 5TE6H 1KCKA 2HRPL 2OZ4L 1K2DB 4PGCA 3OJVC 4Y0GA 2B2XH 5DJXB 5FA3A 4BFIA 5F8QC 5GGVH 1EJOL 1KCLA 1WICA 2DWDA 2VABB 2DQTL 5E99H 4JKPL 1NL0H 5LGJB 1MRCH 1TJGL 1I3VA 2AQ2A 4WI4A 4JKPH 4OZHE 4L8SA 4OZHA 1CDCA 5MERB 5ACZA 1CDGA 3O0RH 3M17A 4NUGH 1NL0L 5GSVA 4X7CC 4LSTL 1B0RA 1OAKL 5HVGB 3T8XA 2E7BA 3IDIA 1LEKB 3OKKA 2EH8L 3V5DB 5E8DH 1A4KA 1P6AB 4HFUH 4PLKC 4PGDA 1OLZA 2V2WB 5I1JL 1NC4B 2VSCA 3BN9C 1BEYH 4POZC 5C3TA 5HSFA 3WO3B 3I85A 1NBYA 5TH2A 4V1DD 1G0XA 2XTJE 2NMSA 2VZUA 4UIMB 2BNUA 4G6ML 3PL6B 3OJDB 4M1DH 1LP9B 2MOVA 2HJLB 3ZT6A 3G5XB 3ZL4H 4LNVA 4Y89A 2AQ3A 3MRGB 3VXMA 1UZ8A 3ZL4L 1XGQA 5CWSB 3T4AB 5JXAH 5E9DB 5LCVL 5IB3B 3JUZA 3BQUC 3RWCA 3RTQA 5J0BA 1TQCC 2BVEA 4YEFA 3UX9B 3IFPA 3D6GA 5L9DH 4LLYB 3T0AA 2J6EL 5FOBA 3I6LD 4N8CL 3RWEB 4DKEL 4UNTA 5HHQA 2AJZA 1KCSL 1X3DA 5FIEA 4XPBL 4HJ0D 1CD1A 5I8EA 3DNKA 4JY4A 4EDXB 2V5YA 2OMNA 1TXKA 1MHEA 2HJKB 4YBLB 1CLZL 2YD5A 2X9YA 3TA3C 4ZTPL 2IPTL 1RQ5A 4XPHH 5JHDE 1NBQA 4P2RD 3UTZB 3FB8A 3TBYA 2BC4A 5J89A 1BBJB 1G7IB 1T0NA 5A43C 4EQ3A 2H8PA 1Z9MA 1WC7B 4GJTB 1QSFD 2BFVH 2NY4B 2GJ6D 1FZJB 5HYEA 4PLJD 4HW6A 1EFXB 5CJ8A 1EPFA 1RZ8A 2UZYB 4LSSL 2FNBA 5FGCE 5FKPA 4DAGH 2R4RL 1UXWA 4TNVK 5AWNH 4JB9L 5CEZD 5D5MF 4ZYKB 1ED3A 3DUHA 1NCTA 2VR5A 4C56A 5E70A 4R4FH 4MNQD 4NN7B 4LASH 5AWNL 4DOHB 3EO1B 3BQUD 5DDHB 5IJKC 3AFLA 1JPSH 5IGXL 4LASL 4JFEE 4G7YL 1HQ4A 3VJ6B 3FQUB 5A2FA 4TQEH 1KT2B 4NO3A 2R56L 4PTUB 3PF2A 1ACZA 4K07A 1KLGB 5HYQB 1B0GA 4HIXL 4OD2B 4KTEH 2EKJA 4X8JA 3HMXA 4OCMC 4W68A 1DBJH 4A2LA 5EORL 4P2CG 1HH6B 3SCMA 3C8HA 3T0VA 4JG1L 5HVWA 5DJ0A 5EIIB 3GMNB 3QG7L 4DZ8A 2X10A 5E5RB 3S6CA 4M9PA 2XZQL 3NAAL 1KTLB 5GHWL 3DURA 1JUFB 1IC7H 5D72H 1DBKL 1SYVB 1UJ3A 3RVTC 1A1OA 3BYYA 3NAAH 1YNTA 5SWSE 1VKXB 3H9YA 1HZHH 1EBPA 2GCYA 5ADOL 1I1CA 2W0FA 3GUTA 3VXSD 3QISA 2UWEE 1OP3K 4YXLH 1QRNB 4KROB 2VERN 4XCYB 3WJLA 3K8LA 3NABH 2JCCB 5DK3A 5C0AD 4I18B 1JK8A 1H3VA 4OI7A 2WWKT 4PJXA 4M8QA 4WI7A 5E9DA 3V0VB 1F11B 3E0GA 3LKOB 1QFUH 5CP7A 2A83B 3I2CL 1R3HA 4QO1A 2J8UF 4PJ9A 3RTQD 1T7YA 3TA3D 1JYXA 5DQDL 4LSRH 1F58H 3PGCA 4XCEB 2Y4SA 3DX8A 1UT9A 3MRQA 4WUUA 2VZ3A 5SWQB 2CK0L 3TO2A 5IG7A 5KS9F 3TBSA 1NGQL 2FJGA 2D7QA 4BH8B 4D3CL 3QUZC 2W1NA 4FQQA 3QZWA 3HI5L 1UZ6F 2Z31D 2Y07L 4ODXA 4OZIB 3VXPB 3RVVC 3O2DL 4HC1H 1ZT4A 1QSEE 3PABB 1OGAD 3WSQL 5FKAB 2MTPA 3VWJC 5F1NA 3KPPB 1PBYA 3QIWB 4JN2A 2AK4D 2ZPKL 1BM3L 3CAFA 1XR9B 5FA4B 2Y6SC 5AYUH 4FFWD 1PD6A 2DAVA 5EOTA 4QXGH 4E42A 4KHTH 5AYUL 1SEBA 2QQLL 3EYOB 2LQRA 4XHJD 3GM0A 4QYOB 1G7JA 3BP4A 4KHTL 4HXBL 4D0BB 2VLRE 2R39A 4D8PA 1S3KL 3T8XB 4HXBH 4RMTA 1JN6A 3BPOB 3X12A 2P49B 4HG4K 2F53A 4TTDD 2CLRB 3OJ2C 4Y1AA 1QFWM 3EFDH 3S7GA 4OGXL 3VXQA 2BNRE 2OTUA 3NCBB 1NGZB 5DJDA 5DF0A 2ZJSH 3WO4C 3H3PL 1OAXH 4QRRE 2B4CL 2ZJSL 2AJ3A 5IW1A 5HDLA 3GMLA 3V52H 5K59F 1VERA 4OLVH 5MEQB 2DQIL 3LPWA 2LU3A 3QUYA 4NHCH 5LXGL 4K2UL 3QJFA 1H3GA 4JE4B 3T04D 3DVGA 2XKNB 5KSBE 32C2A 2ADJA 3Q6GL 3VH8G 2CSPA 3IDNB 3MGOB 3QEUA 3BP7A 3VWKD 1RFDH 2DQHL 2OL3A 3ESUF 3W9EA 2CLVA 4FFVD 1IAOB 4EZMA 4X4YB 2GITB 3C6LB 2Z4QA 1KGCD 4H88H 3CK0L 1BZ9B 1H0DA 1EHLL 1FAIH 3F7YB 2ENSA 4UOW1 1U8LB 4F2MA 4GMTH 1V7MH 4UTBL 2EH7H 4D9QE 2VAJA 4G43B 2I9TA 5E6IB 3QUXB 3HC0B 5F9JB 4L8CB 5CBAB 3FO9A 4DTGL 2H6PB 1EGJL 4BH8A 2QQKH 1G7LB 4X6BB 1UXWB 1P7KB 5KTEH 4RQQA 3HPLA 1MLCB 1JHLH 4NN5B 3LMJL 4M7LH 3L95B 1MJ8L 4FQXB 3FJTA 3LMJH 1MCWM 2CGRL 3A6BL 1PFCA 5D70H 3OKNB 1E4WL 4PB0H 1KELH 3CFJA 1EO8L 1T1XA 3MACL 2OTWA 5C08A 5K93A 2ZKHH 1MFAL 1JK8B 4I18A 1FIEA 5DVKA 4WRLA 3IDXH 3L3HB 5D7IE 3TBVA 2EDQA 1RJLA 4R6UA 4U4BA 4ZO8A 4WJ5B 2AKRA 1YEKL 4FP8H 1OW0A 3DURB 5IBTL 3VFRB 4I48A 3STLB 2P1YA 4NUJA 1YYML 3DSFL 1CXEA 5HGDA 2VITB 1U2CA 2DWEB 5DHVA 2NW3A 5F7FA 1A6VL 4Z7OF 5F7YC 5I1AB 5TE4H 4DUXA 5LVEA 3BESR 4MNGB 2B1HL 3UYOD 1GHFH 2F74B 5E2JA 3QHTC 5TE4L 3IF1B 3QIUA 4UINH 3MV7B 5I9QB 4JZJC 5HYQA 2VDQH 1GHFL 3LHPH 3VH8A 4UINL 4Y4KB 4QHUB 1BX2A 3TFKD 3ME0A 4TTDC 3GMQA 1LVEA 1KN4H 2GKIA 5T3ZL 35C8L 1WFUA 3GGWB 1CLYH 1XGRB 2YPKB 4FMKA 4LF3B 1A64A 2MCPL 5EBWA 1FYTA 5J1AA 4W4NA 1K8IA 1KJ2B 5JIHA 4HUWB 3P0VL 5T1DH 3ZKNC 2BXZA 3TBWB 1QRNA 3CX5J 5HYFA 2ZUQB 4A6YL 4BSVA 4L4JA 1S7XA 4OLWH 4U1IA 1UM6L 1MPAH 1JGDB 3VMPA 1J8HD 1S7VA 4LMQI 1HHJB 2CUIA 1D9KC 2ED7A 4DKDC 5BO1L 4R0LB 2WAHA 3BT2L 4OFIA 1A6TB 3SDAB 4NQSA 3EBAA 1KXTB 3VG9B 3WD5H 3D3VD 2VLMD 3ARDC 3BEWA 1F4WL 3WDIA 3DTXB 1EX0A 2YXFA 5HHVL 4L3EB 1XT5A 1G9NC 5A2KH 4ZSOE 3QR2A 1GIGL 2P47B 4Q2ZA 2YN5A 4HGWB 1ZT1B 1ZT4B 3O8XC 4H25A 1U8OA 5GJTH 4F33A 3NCMA 3TT1H 4OFKA 2GJ6A 3WXWL 1E4XI 1NAMH 3KPSB 4OZFB 1U8JA 1KGCE 2YKLH 3WXWH 3FZUC 3AGVA 3UC0H 1FG9C 1WTGT 4QHLB 4XNUL 3KPLB 4N0RA 2FIKA 4FQCH 1IKNC 4E41A 1DLFL 5KSBA 3VI3F 2EDHA 2ED8A 3GSWB 2I26N 3EGSA 1MCOL 2RJMA 1I3RB 3QA3A 3ULSB 4XB7A 4OFDA 4NQCE 4JFFA 4FQXA 4OT1H 5HJ3A 2PNDA 4HX1B 3BHBB 2V2XA 1F4AA 1JMZA 1Q0XL 5L88L 1I1AB 4JO3L 3PHOA 1Q0XH 1SJHA 3LQMA 3TO4C 4Z95H 5I1KL 4MWFB 5FO8A 3SDXF 4I2XA 3PWPB 3C09B 3L3GA 1A5FL 1RJZA 1RU9L 4HUXA 3MYZA 1WTLA 4NQXA 2HJFA 5FO9B 2LTQB 5F7LB 3O3AA 3H9ZA 3C60D 3FHQA 5D1XB 4P4KB 1S9XA 4LOUD 3TWCH 2DL2A 2CLVB 3NPZB 4K9EC 3AB0C 4JVUA 1JZ2A 4RDQF 2BVQB 5F93C 3S88L 2ORBH 1ORQA 4HIEA 2YBRA 3G6DH 4P5TD 4R2GD 1HXMB 1JZ4A 3KYOB 3C6LC 1S7TB 4UQ3B 3X11A 2QSTA 3PL6D 3U0TB 3KLHD 3PWLA 1GGTA 3LB6C 4TULH 1G7LA 3TBVB 4D2NA 4G6FB 2NTFA 5EB9A 5IWLA 1BBDL 1P53A 4ZNCD 8FABA 5C07E 2BVYA 1I8IB 2X4PA 4DAGL 5L2KA 1XF5B 1W72A 1RUKH 2DKSA 3ZKXC 5DUBA 2DQEH 4OFYA 4GMSH 3BI9X 1MHHA 3OKMA 1QA9A 2DTMH 5DD3L 5JHLL 3C60C 2UZIL 4G9DB 3BXNB 4HKZB 4N90E 3KPLA 2UZIH 4POUB 4L1HA 3NIFE 1T2JA 2A6DA 4R4NC 4ZUUA 4WEBL 4X7DC 4NJAL 5C7XL 1MF2L 3QI9B 2X7LB 1G7QA 3RIAK 3QFJB 2H9GB 5ICYB 1ONQA 5D7IA 1IT9L 1FO0A 4TSAH 5DO2D 3OKDA 5F7KC 4NO0B 3BZFB 3D9AH 3D18B 4TSBH 2PW1B 3MGTA 4YHIB 4HJ0C 2V5SA 5JXED 5C08E 1HDMB 4HUVB 2DQGL 4TUOB 3QSKB 4GW1B 1N59B 3V8CA 2IH3B 1RJYB 3JTSB 5D6CA 1XCTB 2W92A 4X83A 4HWNA 5CGTA 4QRUB 5DUPH 1U3ZA 3QEUB 4XAWL 3TF7C 3WNMA 1DE4A 5ID1B 3SEPA 1ZTXH 2DMBA 1U92B 1BLNB 4PJAA 2FECI 4PP2A 2ZOLA 3LCYA 1G1CA 1FFNA 3RAJH 1T21B 2OR7A 4PB9L 3WFDH 3QJHB 1IILE 2RBLA 3SY0B 4EIZC 4M8VA 1A4JA 1MH5A 5F88A 5I30L 3OB0H 3OKLA 2X4NA 4KHXH 2YPLE 3FN0H 1M05A 4W4OC 5I30H 2IALA 1VADB 3BDYH 3RL1A 3PHQA 4MJ5B 4D0DB 3CLFH 1F42A 1LO5B 2WLZA 5JPNA 4BQBA 3C08L 2AK4A 1BF2A 1OY3B 5EBLA 4IDJL 1IEBA 4ZXBB 4QWWC 4Y4HB 1XEDA 3WJJA 3AMLA 4AZ8A 5SWZD 1U95A 4P3DA 4OZFH 4M62H 1CCZA 2BSRB 1JWUA 1GOHA 3RX8A 4YAQB 1ADQH 4W70A 1RULL 2EYTA 5FO9A 1K5NA 3ZDYE 2JJSA 4S1RH 3HNTH 3MFFA 4MJ4A 2BERA 2VQ1A 1G7PA 4PRAB 4AL8L 3W0WB 4LDEB 4YDLC 5DD5H 3CFEA 4HD9A 3B3IA 1CE6B 1CD1B 3R1GH 5I8EB 4AL8H 3NTCH 4CMHB 1FZMB 1UM5L 3OGCA 3RZCC 2I24N 1XGPB 4R3SA 5EC1B 1MAMH 3V6OC 3JTTA 3S4SG 1RIHH 4G42B 4XBGA 4CVXA 2N4IA 4BJLA 5EC2A 4K94H 1AKJB 3CDGB 1LDPL 4P4RA 3D0VA 1A22B 3ZYZA 4L9DA 3O9WB 3OKDB 2B4CH 5IF0B 5TF1L 4X9BA 3FT4B 5B22A 2DIBA 5BZWB 1D7FA 3DBXB 3JV5A 4OBSA 2FO4B 1AIFB 3SKOB 5F96H 3QQ9C 4UIKH 3ARFD 5CEZH 4ORGB 1XH3B 1IGFH 1S9KC 3CUPA 4X98B 4L3CA 1MI5E 2DQTH 2HT3C 5CEZL 1ACYL 3IAPA 3GSUA 4LLMA 4JY4B 4EDXA 1E28A 1MRCL 1TJGH 1CFTB 2VZTA 2Z35A 3FRUB 2Q86B 4JLRB 2VNCA 2OR8A 3EJYC 3OXRB 3BZ4B 1TJHL 4YK4B 1JNNH 1UWEH 1CWVA 3QUXD 3PP4L 4KV5E 4XCFL 4MWFA 5FO8B 1WZLA 4G8FA 2EECA 3QDAA 3MRJA 3WDJA 1KB5A 4H88L 1N0XH 1SJHB 1BREA 2XN9D 2YBRB 3CU7A 4QRSB 4R7NA 5F3HA 1T0MA 3VFOA 3VXMB 4LLVB 3TYGH 2VZVA 3JV4A 4GMTL 4UTBH 3DRQB 4HKXA 1I1FB 1NMAL 2VWEC 5ERWB 5GRXG 4CW1B 5JHDD 2OK0H 4NN5C 4DTGH 5TH2B 3HMWH 1NMAH 2CDFB 2IPKA 3DXAE 1UKSA 1RK0B 5I8KL 4OJFL 4NYLB 3U2SB 4A6YA 3ZLQC 5F7DA 1CK0L 2Z93B 3QXAB 4KGJA 2APTA 3IFLH 4KK5D 1YN7B 4MJ6B 4XNQB 5KSBB 4JO4L 1A6UH 4KI5F 5DTFB 1J5OH 3IFLL 5C92A 3KLAB 5GS1C 3HPJA 1HHGA 1LILA 3MXWH 1J5OL 3HZMB 3OG6B 4PTTA 5EU6D 1KIRA 3MACH 5F6HJ 1SJXA 4OIAA 1KJ2H 1VFAB 5E8EB 2OJZH 1GC1H 4OB5H 4R26L 3OGOE 1OAZL 5FYKE 1VA9A 4Y2DA 4Y19B 2WZPD 4Y4FD 2E9WA 2YN3A 2RB8A 2OJZL 4FS0A 1GC1L 4OB5L 4YDVA 1FG2A 5H35A 1KPVB 4KJPC 4JJHA 4XX1E 4ZUSA 4OCWL 5IBTH 5C9JB 4WWKB 2EEDA 4N5EC 1T1WB 5DA0B 3SDCA 3VFPA 1CD9B 1MUJA 3UP1A 1U8KA 3GMOB 4WENB 4KVNH 1UCBL 1RJYA 3Q6FA 5IROC 2B1HH 3SGJA 5E2UH 1ZKAA 2CDGA 5TE7L 1NEZB 3B2UC 4H26A 4NQDD 3P73A 1ZLVH 4PJAE 5E2UL 3KDMB 3MUGA 4G8IB 1CXLA 2XG4A 4ZPTA 1A7OL 1IE5A 4LHUD 5D1ZA 43C9A 3EDEA 8FABB 2HJKA 1B88A 3QFJA 2F54B 3UPCA 1ETZA 1MWAA 4YDIL 5DRXB 2EYSB 3BH8A 1WFNA 4HIIA 3BD4A 4ONFH 1ZHBB 1CLYL 1D5ZB 3PQYA 5HYSA 4OZIE 4YDIH 4YIQA 1FL5A 3Q1SL 4FZ8H 1YNTB 2FRGP 3IAGC 1XAUA 4DVBB 2R0KL 1GSMA 4AMKL 4B7LA 3ULVC 1HI6A 3RTQB 2DF3A 3VU2A 2XQYG 5E6YA 4CDGC 1KTRL 3LSOB 1PZUB 5D72L 2EDDA 4LCCC 4EN3C 3EZ8A 4POYA 2BVQA 3PV7A 1L7IL 1RURH 4MZ2A 5DVNA 4LBEB 3GSNH 3MQIA 1RURL 3BH9B 1QVOB 1FP5A 2W60B 1HYRC 4LGPB 1CTNA 5CJXC 4ZODA 5HD8D 3REWA 5BO1H 1NANI 3HRZB 4UNUA 2VDOH 3FQUA 4KRLB 5K9OA 3NGBB 3QIUD 1YN6B 2D2OA 4K23H 5LG1A 5DHXB 4NQEA 1TFHA 3CC5B 5BS0E 1J8KA 1HHGB 1BQSA 4F57L 1E4KC 4NGHL 1XF4A 2R4SL 4M7KH 4P5KA 1BIHA 4C56B 1SEQH 4F57H 3V6FA 3F12A 3QDGE 5I74B 3BZ4A 3FHAA 3S36X 4N0UB 3I9GH 3DV4B 4JFED 3MJ6A 5E8PB 1NGZA 4D3CH 2WUCH 1YNKL 2Y06L 3B9DA 2ZG1A 3V0AC 5FFLA 4ERSL 3ZE0E 3OKOB 2K3TA 4BZ1L 3NGBC 4F15C 2YKLL 2YSSA 4QT5B 5J6HB 2FDBP 4Y5YA 2FLRT 3E3QC 5JW4N 4FQCL 3HFML 3I50L 1E6OL 4X5WA 2Q8AH 2BCKA 4M1GL 2AQ1A 1UWXH 3RVVD 5DSCA 5EOQL 5J06A 2JIXD 2DN7A 1JI1A 4NYLA 2BVTA 3U2SA 4GBXD 3Q3GA 4XNMB 1F97A 1NBVL 2IG2L 2OJEA 2CRMA 2F5BL 2IFGA 2IAMD 1T89C 4KJYA 3RGVA 2NXYB 3SKNB 2ADIA 3FO2B 2F5BH 4I0CC 3WHE0 5DRNA 5SWSB 5L88H 1AD0B 2XI9A 1RUMH 4LPVA 3MRJB 1V3JA 2FO4A 3L3KB 4UT6H 5AD0A 3L7FB 5DJCB 1FO0L 3AREC 3VXME 4PJCF 5HDQH 1RZIB 2VDML 3LN4A 5IM7A 4OKDA 4GBXA 3DX7B 5DEGB 3FB5A 3QUKA 1I9RL 2AXGA 4ISVA 4LSUH 4HJJL 2JTDA 3NCFB 1RU9H 1E28B 3FRUA 4KRPD 5HVHC 1NCWH 1PEZA 3OBAA 4EI5C 2CDFA 2IPKB 3O6FB 2NXZC 1ZS8B 3DMMB 2AXFB 1PSKL 3P9LB 4XNZC 5FYLE 3K8MA 2R9HD 4PGBA 5E95B 3SDXA 3WS6C 4KKNA 5IEHB 1PSKH 4HGMA 3OKNA 1JHKL 1LO0H 1D6VL 5F3HB 3UTTB 4WTXA 3QB7C 4X7SH 4XMLH 2O5ZL 1LO0L 5KG9A 3NFPB 3CVHH 2HVKB 4FZEL 3ARXA 4F7MB 3QNXB 4WNQA 4YBQD 1AD9B 2OTUB 5F44A 3VD5A 2WLYA 5MI0B 2H6PA 4TULL 3CK0H 3T4YA 1SHMA 1NLDL 4LSVH 5HPMA 4K94C 3QNYB 5ITFA 5EBLB 3ZZ1A 5C6TH 2CIIA 5KVFH 3T2PA 4DWHA 3QXAA 1RIUH 3FFCD 3DBXA 1JNHB 5A16A 1IEAA 5L6YH 1FL6B 1J1XL 3TPUA 4WGVB 3W11D 3V4PL 4O58H 3C60A 1QR1B 2VXSH 4ETQA 4R97B 2QKIA 4TPRL 3AROA 1C5DA 3BFOA 4KXZI 3AU1B 1QLFA 4P3CH 4RNRA 3VGHA 1DUZB 4R8WL 3L9RB 3LS5L 4TPRH 4OAWA 2V9TA 2AEWA 4J12A 4JVPA 2RCSH 3RX5A 5D8JL 4CJ1A 2KQNA 4P2RA 4JZOA 4TSAL 3BZDA 1QPPA 4L9LB 4QRPB 5CSZB 2GK0A 3L3HA 3RI5K 4UV7H 4JPIA 2HTLC 1LO4L 4DK6A 3F5WB 4TVPD 4ZS7H 3MRPA 1XH3A 4UOW0 2XZCL 4ETYA 3CZJA 3MV8B 4NNYA 4I3RH 4N0UA 2Q1EA 3RIAF 3OR6A 1HKLH 5T3XH 4JAMB 1HQRB 2UY7A 3QEQB 1PEWA 4X7TB 4G6KL 1YY9C 3PHSA 2W9LA 2EYRB 3OR7A 1PGRB 1Q72L 3BUYB 3L7EB 1EDQA 4TVPL 4G6KH 4Z5RA 5FUZL 3R06B 1WBYB 5AEAA 3K80A 4ZTOL 3RAJL 4MA1B 2VDQL 3L3DA 4BFBD 1AGBA 2ICWB 2IBGA 4OIIL 1R3JB 3IAQA 1JZ3A 1YEEL 1D5BB 4JFHE 1OP9A 1IAIL 4N0FA 1RZFL 4Q2ZB 4WV1A 2VR9A 4O4YH 2X1QA 5D2LE 2ARWA 2NX5A 2JCCE 2E7MA 2PYEA 4W4OA 4L4VA 3QNZA 2BVPA 2Q3AA 5DJ8B 4K71C 5BV7C 5EO1B 4MHHG 3S97C 2C3GA 4JFDA 4JPKL 4EI5D 2CJUH 2BSSB 2WMPA 3V79C 1MCJA 4QHLA 3TV3H 3CIQA 4QRTB 4F7CB 2XWTA 4RMQA 1T83A 4G5ZL 3C5SB 1MPAL 3ROLA 1R3LB 4AIZA 4DUWA 1Q9WA 3UO1H 2ZG2A 1ND0A 3X3GL 4YGVA 1P6FA 1JPST 5J56B 1WISA 2GJZB 1JPFA 3X3GH 2OX5A 1AE6L 3V9FA 4OCSH 1AY1L 4Z7UE 3FFCA 1X9QA 3ULVF 4LLQB 4XPAH 2XY1A 4GO6B 3HI1A 1Q94A 3TPKA 2C7UA 4OZGF 1OTSC 3HUJB 2Z8SA 4P5MA 5FYLD 1HEZB 5HHOE 5AUMB 5F6IC 1UM5H 1UH4A 2IBZY 5DI8A 5JLZA 4RX4A 5DQJA 2BC4B 3V6OA 3KS0H 3DJ9A 4MA7L 2XKSA 4O2EA 3WO4B 4NCC2 1HSAA 2VISA 4UT9H 5D7JC 4NM4H 4CNIB 4PGJA 5MEPA 2HRPH 4DVRL 4UT7H 1GGIL 1C5BL 5I1IH 1YEJL 3SDDC 3L7FA 3KXFB 4PJGB 3BDXA 5GGVL 1W8OA 1RZJL 1DEEB 3MGAA 1S9XB 3IGAB 5L8LB 4HWZA 4Q6IB 1A7PH 4JJ5A 4MD5B 1SYSA 4PV9A 1HQ4B 1FE8H 3HZVB 2HT2D 1EERB 5GJSL 1NCBH 3ALPA 1OLLA 4ZUWB 3GSRA 1A7PL 2PO6D 1QKZH 5IEHA 4HC1A 1UWEL 5CIPA 1OPGL 5DJAB 1DFBH 3UTTD 5IIEB 3W39A 5F21B 3ZKMC 5T33H 3IJHB 1KFAH 4AEHL 2XWBB 2WK2A 2WWMD 4Z18A 4HAFA 4JO3H 2K9UA 3TNNB 3E8UH 3IXTA 1LEIB 3EHBC 3MRBB 5D93C 4PV8A 3FQWB 5I1KH 1VPOL 5JXAL 4QNPE 1KULA 2Y7QB 2OLDA 3ARFB 1ORSB 3ARTA 5GSVB 4ZPVB 3IDYC 3UTTA 5C6WH 4E41E 1K8DB 4KK6D 4M6NH 5IR1B 3MRGA 2ADIB 4H5SB 5CS7A 4NCDA 1LD9B 4M6NL 4X6CE 4KK9C 1KCSH 5CEZE 4CRPA 4NN6C 2D0GA 2AJSH 5EZIH 3D1MC 4GLRI 4LLYA 2V9RA 1CLZH 4F33B 4ISVB 5HJ3B 4NQED 2PO6C 3JV6A 3VWJA 4XCCL 5GGVY 5KVEL 5I2IA 1AC6A 2C3VB 3LRHA 5FHBL 2VL5B 3FB8B 4XMKL 1H3WM 2O5YH 3MV9D 5D1ZD 2BJMH 3LQAH 2G2RB 5IB5B 5CILL 4Z6AT 4KDTA 1MHPL 1UZ6E 4NNPL 4N0FB 2GAZB 1F3DH 1M1SA 4JB9H 2XTJC 2RGSA 2FHCA 3B9KA 4QOKB 4GAJH 5TFSH 3VWJD 3L6FB 3LPGA 2DQEL 4XVSL 1IKFL 2K7QA 4KTYA 4YHNA 5TFSL 4M7LT 2A9NH 4RMUA 1QHOA 2L4OA 3MCG1 3MXVH 5TDOA 3VXNB 4U0RC 1MCLA 1NPUA 2E5EA 1OQOA 3S34H 3MXVL 3MRMA 2GFBA 1M71A 5EBGA 2QQQA 4BFGA 5F88B 5LBSH 5EORH 1GAFL 3K81A 3SY0A 2VLLA 3ZTJG 1T22A 3MBEC 3UYRL 1MF2H 3MUJA 1OGTB 2VXVH 3ARBC 4JPVL 5GRJL 1ZHLB 3QG7H 1HHIA 3RJQB 2PYEB 1UWGL 2XZQH 2MHAB 4JPVH 1HWHB 3MSPA 4TSBL 5D7LB 3GNML 3ULUC 5FV2A 2GY7B 1HZHL 5FUCC 5ADOH 5C0FB 2X09A 3MLYH 1MIMH 3NIFF 2J88L 2GK2A 3L3DB 4IJ3C 1R3LA 4AIZB 1WBYA 4GAGL 4XWGL 4FA8A 1OGAE 5JPMB 3GMMA 5CUSL 3GM8A 1QFPA 4ESKA 3VD9A 5E2WH 5J12B 3MLVL 2AVGA 5H2BA 2VXTH 4I3SL 1CIDA 5CUSH 2VDPL 5ICZB 4DW2H 5MP6L 1PDKA 4PB9H 3WFDL 4MAYB 1PQZA 3E6FA 3QHFH 4LSRL 1F58L 5LJYH 2ESVB 3QI9D 3OWEA 4FFVC 4G8GD 2WW8A 3OPZH 1EEZA 4LNRB 1IAMA 2JLLA 3WLWD 4CVXB 2BSSA 4N90D 1S9WA 2CRIA 5JNYA 4K7FA 2DM4A 2WUCL 4BQ8A 3LKRA 1NGXB 4L8CA 3S37L 3QUYB 1DUZA 3QEQA 4I18C 4PJXB 1G7QB 1MLBB 2I5YL 1SJEB 3MLRH 1Y0LB 1JGEB 2E7LA 4U6TA 3GRWL 3MLTA 4DN4L 4LHQB 2ZNXA 1VFBB 1DEEA 4LDOB 1X5JA 5EA0H 4JLRA 5IG7B 4RAHA 5FB8A 3W5NA 1RZKL 2GK0B 1P4LB 4XPGL 2ITDB 3D85D 1C12A 3EYUL 5DD5L 4LIQE 1BHGA 3DX6B 1DBBH 4R2GB 4WTZA 2YD2A 2Q6WB 4AK1A 2DMKA 1A8JH 1TJIH 1RUML 3PDDA 4OQ1A 2E8ZA 4OZFG 1DBBL 4N8PA 5JORB 3O6ML 3QIUC 3KPRD 4RIRB 5HDQL 5ILTL 3O6MH 4AEEA 5EC2B 2BOCA 1FH5L 5DJDB 1U8NB 2X41A 4ZFOB 2XG5A 2VITA 1X44A 5CIPH 1NCAL 4OM0L 3WIHA 5F96L 5C0FA 3X14A 3IJSB 4HWBH 1JPFB 1U8QB 3AB0B 1DQQA 3N1QC 5IHUL 4HCRH 5DTFA 2IALB 1LNUB 4PRAA 2AJYH 4YBQC 3H9SE 1HSAB 2VLJB 4CVUA 2EDFA 1JZ6A 1DUYA 1RZ8B 4AIOA 1J0JA 1J87A 1YMMB 3EYQC 4GXVH 3Q5YA 4Z7OE 1FAIL 4Y7MA 5JA9A 1AO7B 1IEBB 4ZXBA 3MRMB 4UOJA 3TYFA 3ZTNH 4R90L 5IB2A 1D9KA 1EUUA 4JFZH 4LPCA 3ZTNL 3FCTA 3U6RB 2QQKL 1G7JB 1P84K 5MEQA 4ODHH 3DV6B 4KKLD 4P49A 2M8XA 3GSOB 1P7KA 1KIPB 5D9SA 5IHZA 5F89A 4N9GA 1J1XH 4RRPA 3VMNA 1S5HB 2IANE 3V5HB 4MB4A 2Q76A 3GBML 4V1DA 5MEND 2OM5A 4U33A 5I73C 2VZOA 3O4LD 1BAFH 3S96A 3DVFA 1DQML 3B5HA 1C16A 3W0WE 5K9JH 3BW9A 4P46A 1DQMH 4IOFC 4J23A 3WDHA 2W0LA 1UEYA 4FFZH 3DTXA 4ZFGH 1T7ZA 2WANA 5JXEA 4I2XE 2NY3D 3VFGL 5EH1A 1I8KA 3IETB 4MA8L 4WI9A 1DQLH 3VGAB 3QDJB 1BD2E 2WBJD 2YMXL 3RWJA 4NO5A 2FB4H 1MELA 1JZ5A 3RJDA 3N9GH 5GS0C 4U6YB 3DVGB 3HKFA 3QFJE 1DBAL 4GKZB 3L5XL 1A02N 3ZT7A 2AI0L 4FG6D 2A83A 4WW2A 5DLMH 3WE6A 3SO5A 1UJTA 5L8KB 3AS0A 1AFVL 1XR8A 1IAKB 1VGEL 1H15B 3B9EA 4X6CF 2BRRL 1J8HB 4PRIE 4FQXC 3BZEB 1HKLL 2VDKL 3NN8A 4XVJH 2XV6B 1KIUA 2BRRH 2ZG3A 4HS8H 4Y4HC 1ADQA 4EQ2A 4PRBB 5HY9A 4UB0H 3BH9A 5KBNC 4HS8L 5D96B 1BJ1H 1A21A 1WV7T 1KN4L 3QULA 5DVOA 1LWRA 5T3ZH 4KY1H 1TZIA 3RTQC 5GGQL 2SEBA 4J3OC 3A6OA 3ZSTA 2YA1A 4M1CD 1PKOA 1GYAA 5C0DB 1YYLL 3QIBB 4A6YB 1TZGL 3DECA 3U1SL 3GMLB 3VI4F 1QRNE 2DLFL 4AMKH 2P5EE 5IFHL 2ICWJ 1XCQA 3TBTA 4HHAB 2W38A 3ARRA 1FLTX 3RL2B 2XWJA 1FYTE 1LD9A 1QEWA 1U42A 5I1AA 1QVOA 2GFBB 3KYMA 2Y5TB 1KIRB 1J1PL 5KZCD 1MY7A 3ROOB 1CLCA 4PGZA 3WBDA 1Z9SA 1N2RB 4NRZA 3NIDF 4WDIA 2X42A 4PY8I 2DQDH 1LE5B 3C5ZC 1RUQL 4X5WB 1NEZA 4CVZA 4GT7A 3FT2B 1T20A 4P2QA 1RJLB 3UMTA 3UTSB 3HMXH 5KVMC 3U7WL 2DBJA 2VOTA 5FYJU 4JFQA 4BSWA 1F4WH 4LNRA 2W60A 1U36A 3QDGA 4HX1A 3A6CL 4N0UE 1ES0A 4QTIL 3ULUF 5E9DE 4L8BA 3VE0A 5HYIA 5EU6B 2FGWL 1U8PB 1J05A 3SJVE 5IFJA 5I1LB 4MDIB 4WW1B 5IJKA 4M7KL 5H94A 4JQXC 3H9SD 3U0WL 3KPNB 5IBLD 5E4EC 1JL8A 4PJ8B 3HR5A 4WI5A 4U6VH 4NHUA 5IQ7L 4J6RH 5D7JA 3S4SB 3L95A 5BV7L 5HYJE 2PXYD 4YHNB 2P5WE 3WLBA 4S11A 4RMSA 1F13A 1R6VA 5E7FA 3MRKA 4JFDD 4OM1H 3UC0L 2A74A 4GW5B 4ELMF 4YPGB 4NQSB 4UZGA 5JHDB 1D5ZA 3PQYB 2YPLA 5ESQB 4HT1L 4PRDB 1B90A 4M5YL 4AH2A 1MCOH 3P40A 3CH1A 2VLRB 5EOQH 3KYKL 5E4IA 5GRZA 1U3HB 4L8SC 3BIKA 5GRUH 1EVUA 2ZUTA 1B0RB 4GG8B 5E5MB 3TM6A 4M61B 4XHQA 1S7XB 4CMHC 1WAAA 3C6LD 4ZOCA 3B9AA 2X2YA 4KMQA 4R4ND 5SX5K 5KANG 4P2OD 2MPAL 4K3DH 2X1WL 1OOAA 2W9EL 4WY7L 4JFYA 1OSZB 4KKBC 2X70B 3GIZH 1HNGA 2PN5A 2DI9A 4IMKC 3BPCA 4CADA 1JGUL 1ZLWK 4Y1AE 5KANI 2I60L 2DIAA 4AENA 3MO1B 1FGNH 2GJJA 1MFDH 1X7QB 2EDYA 4NRXA 1YN6A 1CDJA 3DVNA 1CT8B 3QEHA 2ZCKH 4R0LC 3U48A 4WHYH 5C0EB 1FFQA 3HG1E 2EEBA 5D7SL 4OZ4B 4Q6IC 3QUZA 4ORZC 3UCRA 1T6WA 1FRGH 4RMRA 1TNMA 4PRHA 4PGCB 4P2OB 4WHTA 3O3BB 5SX4I 3G6DL 2IFFL 3D2UD 1T5WA 2HRLA 4F8QA 2PO6A 2CIIB 3QEQD 4NBXB 4M43H 1MCEA 2YUVA 3AVEA 5IK3A 5CINL 1BQLH 1UEMA 1B3JA 1X5FA 4OIBA 3SDCD 4OV5A 3NCCB 1IMHC 5IHZB 3T0XA 4JPWL 4LVNB 1NQBA 3VWKA 3QWOB 2R2HB 1FFOB 2YHGA 1JGEA 5DHVH 3TNMB 3ZO0A 4QRQB 1QR1A 3LEXA 2VDNH 2APXA 4IHOB 5JTWA 4NKIL 3BAEL 2AV7A 3DGGB 3CH8A 3QCVL 1PG7L 1TNNA 1XR8B 2VUYA 2FIRT 2OP4H 1NGWA 3G5YA 1IKFH 1IARB 1I8LA 2D0FA 1FYTD 1Y6KR 2CMRL 3BUTA 2ITDA 1ZGLM 1CG9A 4Y16D 1IFHL 3GI8H 3GRWA 1DUYB 2R1WB 1FPTL 5L8JB 1NUNB 4C4KT 2MNUA 3LS5H 3T77B 1IFHH 2OSLA 4RA0C 3QCUL 1I1AC 4M4PA 1RZIA 2HVKA 3FO1B 4GAYA 3CXDH 3WHXB 4YQXH 4C59B 4HH9A 3IB4A 3NZHL 1WZ1L 4QF1B 4KQ4L 2JB5L 5GGSB 3QXTA 5EPMB 5D7IB 1KTKE 1AKJA 5CJOL 1WLHA 2QSVA 4P4KC 3VMOA 1PKQE 4JPIB 4TOYH 1KIPA 2D4FA 15C8H 3BO8B 4G8EA 3ZHLA 4M4RA 2FEDC 3VI3E 1S7TA 5T3XL 3EZJB 4C56D 1ODAA 4HF5H 5DEFB 1XF1A 4L3CB 5HYJD 1AXSA 2FH6A 4Z7VB 3S5LB 1R3HB 4WHYG 5JOPE 1AHWB 4LCYA 1AO7A 5CP7B 1U58A 4DW2L 4Q97A 4PJGE 1W72B 4XB8A 4Y16C 3RWFB 4R96B 4G80B 3FTGB 2JK5A 1SYSB 3O45B 1WWBX 2LABA 1MQKL 1W0VA 3C6SA 4HDIA 2IF7A 4CJ0A 1OSPL 2Y25A 1Z0NA 4FQJL 3EAKA 4YX2H 1U8IA 4NQXB 5LGKA 5D9SB 2GCYB 3VFOB 1OSPH 1FL6A 4FQJH 43CAA 1A2YA 4PJGA 4S0TD 3OJMB 4OZIA 3MV01 1U92A 2HVJB 3JWOH 2CJUL 3PJSA 3RY5A 4HV8A 2XPGA 5EUKA 3U9PH 2FD6L 1ZA3A 4M62L 3JWOL 4JY5L 4OLUL 3BHBA 4F58H 2AK4E 1P84J 2EC9T 1L0XA 4ZQKA 1WBZB 4JY5H 5IVXB 1O7SA 1S5IH 1T0PB 5C6PB 3TJHD 3QDJD 1HEZA 1B0GB 2X89D 3TBYB 1X4ZA 2ZUQC 3P9WB 4TVPE 5DMIL 2EE2A 4OCSL 4S1QH 1RHHA 1QTYT 1ZLWH 3VXOB 5KW9L 4EI6B 1LO3L 4K3EH 5DZOA 5IVZB 1AQKH 2VLRD 3ALXA 1ZEAL 1J0IA 2V7HA 3NTCL 4R7NB 5DMIH 1BZQK 1U3YA 5LQBL 3VXPA 2F8XC 1MCSA 1AQKL 4MXQD 3PXJA 4XC1L 1YY9D 2XFXA 4UUJA 1T5XB 2DD8L 1T03H 2IEPA 4HIJB 2A74B 5MENB 1JRHH 4YHLH 1KEMH 1A1OB 2GT9B 1H3UA 2IQ9H 5FECA 5I16B 2NY7H 5ILTH 3EO9H 4OCYH 2EYRA 1JRHL 4LOUC 4OF5A 5F7EL 3BXNA 5IB1B 2IQ9L 3QEQE 3U4BL 1FH5H 5DD1L 4EXPX 2AV1B 2IWGA 2APBA 4OCYL 2JCCF 1II4E 2A38A 1NCAH 3HE6C 3RVUD 2F8VA 4YAQA 4UAOC 1BFTA 1CE1L 4MQXC 4C58B 1KLUA 5A40E 4X8JB 4HCRL 5CCKH 4MCZA 4IHOA 3EIFA 3S3JA 1BZ7A 2ARJB 4A2MA 3VG0L 3I6GB 1FNGB 1E6JH 1MI5A 2R69L 4XCFH 1RV6X 2AXHA 1A6PA 1LK2B 1NCUA 4U6XB 3E1F1 3Q2CA 1K3ZA 3G5VB 3VXRB 5INDA 5D7IF 3MRFA 1AQDB 4LLWA 4NPYA 4FQ2L 2YD3A 1B4RA 3OAZK 3K4AA 3OSKA 1HHIB 4FQ2H 5JOFB 2DLTA 3T0EA 4HPOL 1HCVA 5EUOE 2CR6A 3LRSA 2G5RA 4ELMB 2YEZA 3L3JA 5FF6A 4XNYL 4GRLB 5J1SC 3NCJL 1I7UB 2ZUUA 2FWOB 3KPRB 1ZLSH 3VXTB 2D03L 2J4WH 3I3BA 4AH2B 4MQXD 4WFGE 5CIPB 3HI6H 3WEXA 1D3CA 1D5MA 4P46C 3RZCB 4OZGB 2FHFA 2IH3A 4R26H 4NQDE 4NKOB 2FX7H 1B4JH 3MNVA 2ATKA 3LS4L 5B8CA 1ZWIB 3DRQA 3H42L 4LCWB 3KXFE 4JHZA 1PVHA 2X1XR 4WHDA 4NKMA 1N6QL 4LQ1A 1IBGL 3LS4H 4FXGB 5GGUA 5J3HD 2BJML 3LQAL 2Y7QA 5CILH 3HZYA 1D5IH 4QGTA 3WFHA 2PR4L 3BPCB 2B20A 4PJ5E 1UXSA 2VLKD 3GMRA 1OGAB 2Y72A 4GRMA 4M93B 5JNYB 3V2AR 3P2TA 2RR3A 3WKNA 2ADGA 2EDWA 4ZUVB 1RPQA 3IT8D 4I4WB 2VDKH 2G9HA 3TO2B 3BP4B 1X5ZA 5D2NA 3B2VL 3PWNA 3CSYB 5F1IA 3EDKA 1A1NA 4Z7WA 3BKMH 3TT3H 2F74A 4XVSH 3SKJH 5IIEA 1QBML 3VXRE 2CQVA 1IJ9A 4KMLB 3MBEB 5BRZA 5KSAA 1I1FA 4DKFH 2P48B 5TGBB 1QG3A 1FC2D 3TA3B 3EJYD 1VEPA 4G6MH 1EVTC 1CI5A 3GHBH 1OP5K 4DKFL 3WL9B 4EEEA 1EEQA 4U1HA 3D0VB 1EHXA 2KH2B 3GHBL 1N7ML 1I9JL 1CVRA 4EI5A 2O61A 3UYRH 5LCVH 1X5KA 4U6XA 1N7MH 4K7FB 2VJXA 4Y4HD 2X44D 3T1FB 4QWWD 2OQJB 2ICWI 4UU9A 4PY7B 5LAXA 1DEDA 1AGDA 4PJDB 2Y36H 3EJZC 4XPBH 4EKXA 1IQDB 4MYWB 3AXLA 1E0OB 2JJVA 1Q0YH 3ORJA 3QI9C 4DEPC 3HZKB 1JGDA 3C5ZB 3TLRA 3WNLA 1CL7L 1KOAA 4I0PB 2R0WH 2YRZA 3JV6B 3O4OC 1WZKA 1CL7H 2VDOL 1WFTA 2F58H 2EKSA 4Q58C 4I0PC 3KPOA 1G9NH 3UAJC 4H8WH 4HK0B 3RWIA 4EBQH 4ZUTB 2NY4C 4RFNC 4OV5B 1R5IB 3QXVA 1RIVH 2JF1A 5ITBL 1B2WL 1SEQL 3UPRA 3MROB 4NKDA 1BJMA 3CC5A 2AKRB 3M8OH 5B21A 1FL3A 2H1PH 4JQXA 4U1IB 4Z0XB 5DC0A 1KB9J 1JWMA 1LEGA 4YH6A 5I6XC 4Z7QF 5IQ7H 2LAGB 1CFTA 2Z35B 5DRWA 1TVHA 3NCEB 4ERSH 4LL9A 4K71B 1N5AB 5DJYA 5JIIA 1GZQB 1CGVA 3VW3H 3S37H 3O6KL 3QO0B 2IC2A 5DR5L 1KXVC 3LQZA 1MJ7H 4M1GH 3VW3L 3WXVH 2HMIC 4IM8A 4V2CB 1I7RA 4Z77A 5DXWA 2GI7A 5CEXB 2UWEF 1MJ7L 4RGMB 3QXWA 1J9CT 1L4IA 3TGXA 4KAQL 1A2YB 2R0LH 3VFTA 2P8MB 3IS1X 2HT4D 4N0CC 2A73A 2IQAB 5F9AC 5TQ2L 2V5MA 1AGCA 1UCTA 1X5HA 1WAAE 2XFXB 5IKCA 5ADPL 5CBEB 3ZE2F 2A9MH 3EYUH 3TZVA 6FABH 5FDWB 2UWEA 1NBZA 4S1DC 3JWDC 1IQWH 4HUUA 4WO4C 5CJQL 1CGTA 4XRCB 5IOPA 4QXUL 4HXAL 1FDLH 3FQNA 3MNZA 4U1KB 2HTLD 2W65B 4EOWL 3SDDB 5I1CH 2PXYA 1I7TB 2HLFC 3B6SA 5HHOB 4GRLA 5I1CL 3O2WH 4R0LA 3LRSB 4P2OC 2EEAA 2O5XL 2FR4A 5F7UA 1T5XA 3MLTB 1EHAA 1JHKH 2NPLX 1D6VH 2HN7A 1H8OA 1WCQA 4I0PD 4OAWB 1BF8A 1DCLA 2ZUXA 3QUMB 4NOFA 2MWCA 4LLWB 4NPYB 1J8HE 1NAMB 3DMMD 4XX1G 2OI9B 4HC1L 5I74C 1U8IB 5F1KC 4RFOH 3K2UL 2DLIA 1PY9A 4JQVA 1RVFH 5HDBE 4XWOD 5FUOH 4UILL 3K2UH 2N56A 4YHZL 4RIRA 5BJTB 4N5ED 3WNPA 2V9QA 2V5RA 5FK9A 5K9KB 4UILH 4YHZH 1YNLL 5DK0A 4YEEA 4HBCH 1CD0A 1F90H 4KDWA 4AEFA 2DQCL 4Y5VA 3VXUD 5EZOL 2C9AA 3RKDC 2DQJL 3LV3B 1F90L 3OKMB 2ITCB 3IJSA 3NZ8B 3QFJD 4Y5XC 2P4AB 3GDBA 4O58L 4UBDC 1NCNA 1GGBL 3BKJL 1BQHA 4L8SB 1QFWH 2DM2A 1JGVL 3QDME 1SVCP 2ATKB 2CMRH 3MNVB 4OCRL 5EU7E 1GXEA 2K1MA 1BAFL 4M7JL 2WUBH 2E27H 3GFUA 4P2YA 3OF6D 3TVMC 3DETC 5D5MB 5E00B 2RCSL 4UDTA 5D8JH 4GKZA 3ULUE 2D7OA 3QXDA 4NNXA 2I27N 4MNQB 5TF0A 3PQYD 5HGBA 2XOTA 1VDGA 2FWOA 3KPRA 2QSCH 4WO4D 5ECJE 3N1PC 2DTSA 1IGYA 2HFGL 5CD3B 2B5IC 3REWB 1LO4H 2ZSWB 3QDMA 3MRNA 3SE3C 3T0EE 1GGYA 3Q6GH 1BOGA 4OGYL 2FZ3A 4Q9CA 3HCVB 4FFYH 4GW1A 1S9YB 3KYNA 2NY3C 4P4KA 5DLML 1KLGA 3V6BR 5KG9B 5EWIH 3GB7A 5E8NB 4PJAB 1C08A 2BY1A 3H9SB 3S8WA 4HJGB 5FUZH 3KR3L 4FQLL 1HWGB 4DGIH 2RFXA 4GKNA 2EH7L 5ESQA 4QKXB 2VDRH 4LAQL 4MNHB 4OIIH 3VFVB 4JFFD 4GRLD 4F8TA 1J7VR 2IADA 4QRRB 1IC4L 3MV7D 3C60B 1G9MC 1IC4H 4G9DA 1NAMA 4XCNA 3DHMA 4QCIB 4PJ8A 1YYLH 1I3RA 1OAYH 2FL5B 4JPKH 3RKPA 2NX5B 2HG5B 5D70L 4LCWE 3C8KB 4R4BA 5IFHH 1XF2B 1HYSD 4ZUUB 3IXTB 4OF3A 1LEIA 1ZHNA 2NZ9D 4IEFB 5DJYB 4XI5D 1Y6NR 1C5CH 5E03A 4BSWB 1CDYA 2UY6A 3RZWA 4JHWL 4OCNC 4F58L 1UH3A 5DT1H 3EW3B 3GIVA 1KB5L 4ONHA 4JHWH 2WINB 4I2XB 4CBPA 4JN1H 3UPRB 1F3JA 2JELH 2CRZA 2H2SD 3DUUA 3RL1B 1CR9L 3DXAB 4GAFB 4JRYB 5C0GA 5J4MA 5EULV 4S0SD 5C0RL 1WIUA 2JELL 3B5GA 3GKZA 4PRID 3P11H 3WIFA 4TSCL 5CBEA 4G7VH 4JG0L 4BZ2L 3SGJC 1Z2KA 1AGCB 1FBIH 1FV1A 4N1HB 4YFLF 2A77H 1IEAB 1T21A 5DGRA 4PTUA 2Z31A 3ARSA 5D1ZC 2NY7L 3VJ6A 2DDQL 4MNQA 1B9ZA 1W8NA 2Y1VA 1I7RB 2BMKB 4PJCB 2VISB 5JA8B 1F5WA 2AXJA 2Z0BA 4YE4L 4GKSA 1YQVL 1VGKA 4U3XA 5EFIA 5JW5A 4P5MB 3RZCD 1XGUB 4RGMC 5D6DC 1MI5D 2C7UB 5E5UB 5E24E 4ZO9A 4U1HB 2BHYA 2BNQD 2ADFH 1OTUD 1VKXA 2PTUA 2X05A 5F6IB 4I0KA 4ZOBA 2VLJD 3STZA 5DJ6A 4P5TA 5C0CB 2X6MA 2JJUA 4G6AD 2E8YA 3BIKB 4OLWL 1U6AH 2VL5A 2NW2B 4AEHH 1B6UA 2OSLB 4Q9BA 2P24B 4K3DL 3HC4L 1AGDB 4PJDA 5C1MB 1YEHL 5C9KA 3WJLC 1SBBA 1OT1A 5HHOA 3MLXH 5FK9B 2WP3O 2CD0A 3K1KC 3ESVF 4KKAC 1HYSC 2ZUSA 4L5FH 4W6WB 1R5WA 4EUPH 1N8ZA 3L5WB 2A1WH 4RGNC 1EZVY 1NMCC 4S1SH 2I9LB 1JF1B 4AT6A 3TIDA 1X5AA 3CH1B 1DDHB 4PV9B 3D2UB 4M48L 3KLHC 1U8HA 5FDWA 1GIGH 1NKOA 4ELKB 4ODXB 5IFJB 1M7DB 5T1MB 2FBJH 5TE6L 3RWDA 3KPQA 3QO1A 2OZ4H 1M6OB 3NCYP 5GJTL 3ARUA 4PTTB 1PAMA 5D96C 1LO2L 3OGCB 3VGBA 3O3EB 2FX7L 2A2QT 1I7TA 4GRWE 4JRXA 1LO2H 2BP3A 1S9VB 5FOJA 4X7TA 2BY3A 4TN9A 5CGYC 5FYJL 3JWDH 2MHAA 4FQHA 2VYRE 2DM3A 1DQDL 1WVZA 1MHPH 4J4PD 5H35B 2AEPL 5IMOA 4XVUC 3F65A 1D5IL 4OCLC 2A6KB 2WIIA 1U93A 1CFQB 3IVKB 1FV1B 2BSRA 1NGYA 3ZE2E 2R0ZL 4QLRA 4B41A 1N3NA 3U46B 5D2NE 1F00I 4X5LA 5C0IB 4HFUL 2R0ZH 3MGOA 3SDCC 4P99A 2A73B 2IQAA 1YEIH 4ODUB 3C9NA 3D25A 1EXUB 4X6CB 3MBXH 3GSNA 4OUUB 4XP4H 1KJ3L 1CE6A 3WFCL 4RAUA 4DFIA 1A6WH 2BZDA 4PRNB 2F53D 4HJGA 3WNOA 1OTUC 3OAZH 4S2SA 4Y1AD 2YRPA 4ZPTB 1M4KA 4OV6F 1ORSA 1CGXA 2Q8BL 4O2EB 1S7QB 4GG6F 4XHJC 2HKFH 4QRTA 3ULVH 5KJRL 3N06B 5DVLA 5E2TH 4ZAKC 5GRJH 4QRPE 4XP5L 3VFUA 4XXDA 3MJ9H 2YRLA 4KZDH 4CW1A 1YEDA 4B7IA 4DKEH 2XZAL 5CHNB 3IDJB 4XBEH 2JB5H 1OTTC 2XRAL 3RDTC 1Q38A 4HV8B 3FFCB 4J4PC 5AG8A 5DC9B 5KSVA 1BGXL 1HHJA 4NQCB 4KROC 4I48B 3STLA 4ZFZA 2ORBL 4QHUA 1FLRL 3G5ZB 1KN2H 2J88H 4KUCD 5I8CB 3EYVB 5GZOD 4ZTPH 4Z7VE 5F9OH 1K4DA 4TOYL 4P9HC 5KOMC 3MV8E 3DX9A 2EIEA 5TDNB 4Y16B 1VFBA 5F9OL 3MLVH 1C1EH 2QR0B 5FUCE 2DOCA 4O2CA 4G43A 1DP0A 1BJ8A 1S7UB 4MJIA 2R4RH 4PREA 2HP4A 4LLUB 4LRIA 3EJZD 3KXFA 2FL5A 1AHWA 3SN6N 4PFEA 2R1XA 3BGMB 4BKLA 1MRDH 1F6FB 3QQ4A 4GQ9L 4G7YH 5D5ME 3WUWG 3L1OH 1MRDL 5DJZB 4QYOA 5EU6E 5IB4A 3SDCB 3VFPB 4BK5A 3L1OL 3ET9F 1IL1B 3MRLB 3NFNA 2AAVA 5FYKD 3LDBB 3CFJB 1VENA 4HIIB 3J8F7 4RBPH 2YD9A 5E6IA 3M17B 2H3NA 3SGDH 5C7XH 4RGNE 2VUOA 3BP6A 5JXEC 4RA3A 3KDMA 3MUGB 3DUUB 3LKQB 1WT5C 3CZFB 3NH7H 4OLYL 3MV9A 3FT3B 1A9BB 1G7HB 2UUDH 4WCYH 4YHOH 5HGGS 2OJEB 2XQBL 4Y4FB 5ALCL 2YUXA 4XNMA 4XPGH 3BRGC 1FYTB 1WAAF 3FO0H 1MI5B 4H1LG 4KMTL 2EE9A 1JJUA 3H9HB 5KS9E 3D0LB 4C83A 1T2XA 4KU1A 3RHWF 5I75B 1G9MH 2X5PA 3CSGA 2AW2A 2BMKA 4XVUD 5DJCA 3DOSA 3K1DA 4JKMA 5J57B 2PETA 4C55A 3TO4A 4IJ3B 1INDL 1WIPA 5GQBA 3JZ7A 1BIIB 1Z3GL 4QHMB 1U91B 4OSUL 3G6JA 3EHBD 1BFSA 3MZTA 4X0KA 4F9LC 3FQRA 4N0CD 1S5HA 3OG4B 5DJXA 5FA3B 4BFIB 5J1AB 3CFCH 4JCLA 5IHUH 4QXWA 2B8OT 4KK8C 3CFCL 3W9DB 2Y07H 1MEXH 4NQEB 4AYFA 1OARL 3UBXG 4OGZA 1L7TH 5EO0B 1UKQA 3TN0B 3DUSA 2ATPB 3THML 4U1GB 3QCTL 2YSSB 4QT5A 5J6HA 1E6JL 3QULB 2ARJA 1I8KB 3IETA 4DZBA 3EUUA 4P2QE 3IKCB 4Q6YA 5ICXA 1RVFL 2Z92B 3HNSH 3QYCA 1MVUA 2XTJD 2F53E 2NXZD 1CDUA 2UYLA 4NQTA 3C5JA 3QDJE 1S7QA 1FIGH 3HNSL 4K8RL 2HTKC 1AQDA 1YMHA 3KXFD 1J8HA 1KTDB 1C12B 5IB1A 1LDSA 3EO1A 4JO2H 2CKNA 2VXQH 2XNAB 4K8RH 4KJYB 1P4LA 2OQJA 4L29A 4MSWB 4GXUM 3SE4A 4XXCA 2P42B 4N9GB 3ZHKA 4AIXA 4Y5XA 3W5MA 1UB6B 2QQNL 1X5IA 4LQFL 4BQ9A 3GSOA 3DYOA 3D3VA 1CGSL 3I6LE 3I3DA 1S8DA 5HPOA 1MFCH 3QDHA 2GTWB 1EEZB 4PRHD 2DI8A 1ZT1A 5DEGA 4JFFB 4AM0B 3Q5TA 1BMGA 3WL9A 5D7LA 1MFCL 5F97E 2KZ1B 1CF8L 3NA9L 5BMFH 2IPUK 5TF1H 3CPLB 5JDJA 3VFGH 1LP9A 1I1YA 5BQ7A 4GW4B 3FB7B 1NLBL 2E7CA 4QOKD 1N4XL 4RFEA 3EDFA 2YUZA 3NACL 4UU9B 2QSCL 4JR9L 1QFWI 3ULVE 1N6QH 4I4WA 1YMME 4XAKD 3WN5C 1AXTL 3O0RL 2AI0H 4NUGL 5BOPA 3SE3A 4QXTB 3G04B 3KPQB 3QO1B 1ZLUH 1PYWB 1FJ1A 1PLGL 1UYWL 4NZTH 3HZYB 5CKGA 3OAUH 3BPNC 4WDIB 4OI8A 3VRIA 1PLGH 3SKMA 1HQRA 3B4NA 4HIEB 3FO2A 4P23A 3K2MC 5T3XE 5I0ZA 2VABA 4PGEB 2HJLA 3TYGL 3PE9A 3UYPA 4Y16A 1JZ7A 2H8PB 4OD2A 5T1KD 1EGJH 4NWTL 2A6KA 2WIIB 5SWQA 5JORA 3PWUA 1Q9OB 1K2DA 1MAJA 4NQUA 3K3QA 1KG0A 5BVJA 1R24B 4EN3D 4X6DE 2SEBB 3QWQB 4Z0XA 1HINH 1YUHB 1TZGH 4IRJD 5J9PA 3A6BH 5BV7B 2EDEA 4LVNC 3C87A 3GSNB 5GGUB 2X4PB 2D7NA 2XXMB 5EDXA 1CYGA 4NZRH 1RK1B 1XMWA 1KNOA 2NY3B 1AGFA 5KVDL 4IS6B 1MFAH 3DSNA 4K3GA 3BWUC 5HHME 3F7RA 3RWHB 4JZNA 3QIBD 2W9DH 4YHKH 4I9WE 1NDMB 3LB6D 1WC7A 1DVFB 3GJEA 1OP3H 4KJWC 4Z7WE 4MAYC 3L3IA 1XGQB 5CWSA 3UTQB 5KSUB 3KPMA 1KB5H 4NIKB 4RMVA 1YEKH 4LKXB 5CEXA 1GPOL 2YK1L 5E94B 2NQCA 1ED3B 1LK3L 5A3IC 1MHCB 4U6YA 3BOVA 4HMEA 5DJ0B 5EIIA 3KWWB 5C0RH 3GSQB 2JJTC 1WSST 1FC1A 3P0YH 1CXFA 1NGYB 3IRPX 4WFFE 4YWGL 5JW4R 3LY6A 1QLRB 2FX8H 4CUCA 3VXRD 3PIQB 2Y5EA 5D1QD 2E9JA 4L8DA 1N2RA 3F58L 1I8LC 3ZYOA 4LIQH 1YY8A 4HQQH 5CZXD 4O2CB 9CGTA 2JCCA 3EKCA 4OM1L 4J3XA 1D5BA 2HT4C 3G6JE 2WBJB 4H20L 3MBEA 1EXUA 2UVFA 4UIMA 4KGLA 4HT1H 1I1AA 5CLTA 3PNWA 3ILPB 3IS0X 4JM2B 4YUEL 4YR6A 1EHNA 2NY5C 1FZMA 2EKSB 4WUUB 5C0DA 3Q1SH 1Q1JH 1KTLA 2XNAA 4FZ8L 2R0KH 4JGJA 2JIXB 1UFUA 4ZSOA 3QAZB 2ADFL 3HG1D 3F7YA 3WHE1 4ACPA 1KBGL 4YFDB 3LVEA 5ELIA 4ZOEA 5EO9A 2ICEB 4U7MA 3MJ9A 5HD8C 4YXLL 2W9EH 3DLQR 2DRUA 5GZNC 4U31A 4PRHE 1ROWA 3HC4H 6FABL 4HKBB 3UBXB 5I75C 3IGAA 4JM2F 2FATH 5EG6C 5B38B 3ECBB 4ZXBD 3VRLF 2CXKA 3D85A 5ESAB 3P4MB 1MFBL 1RJCA 3O6LL 3AMKA 2P7TA 5DA4A 4HG4J 2ZCKL 2BHZA 4Z77B 5CJ5A 1CU4H 1G6RA 1KPRA 3MFFB 3QP3A 4EUPA 3OV6A 4KPHL 3F7VB 1YMMD 5I66A 4JZNB 1FRGL 1CU4L 2YC1A 1NGQH 4XP6L 3F5WA 5C07B 4YC2C 4M61A 1NAML 3QUZB 1BIIA 4HLZH 4DZBB 1N5YH 3BP7B 2Y06H 1JWSA 1EO7A 4G6JL 4LEOA 2X9XA 1YC8A 2IH1B 5T3XD 1GZPA 3QXDB 1HH9B 1KB9K 3WUWB 4NQEE 1DLFH 1I4FA 5ESVB 2VZ1A 2HYMA 3CDGA 4GG6B 3HC3H 1A3LL 2IANB 4PLJC 2AEPH 2R2EA 3H0TB 4XNZB 5SX4H 3O6FC 5CBAA 4LLDA 4QHNA 3P30L 3CMOL 4RWHA 5EZOH 2IG2H 5D2NC 3LKQA 3LN5A 1INEH 1Q9KB 5FV1L 4MAUL 5HYJB 3HG1B 1U8MA 3MLUH 4TRPH 2CKBA 3EFDL 3NZ8A 5I76B 1KJ3H 3SE8L 3MLUL 3MRBA 4TRPL 2FJGB 2GSGB 1FPTH 3VCLA 5KVGH 4L3ED 4OCRH 2JB6A 2P8PA 4KTDH 4I9WD 5JW4Q 4M7JH 3MJ7B 3PWUB 4PG2A 5CD5D 1MCNA 4YIQB 3CFDA 2C1OA 3SDAD 4ZAKA 4RX4D 3FO9B 3ULUH 5FA4A 4H1LH 5CEYA 5AZEL 3CFEB 2UV3A 5T3ZE 1PY4A 5CZKA 4XBEL 3SKMB 3DETD 2EDXA 3OQ3B 4MS8D 5I1EL 5AZEH 4CN4A 4J4PA 5D4QA 1S7SA 1X5GA 1FLRH 3ZKXB 3PUCA 4GSDH 3GIVB 2H32H 3UZVB 1WBZA 4LCWD 3HZMA 4F37F 3CFBB 1BQHB 3SDAA 1TETL 1A6AA 4Y1AB 2EIDA 3QUXA 4RAVA 4F80A 3TJEL 3PDOB 1K9TA 3BJLA 3QT2A 2ZUVA 3VXOA 4ORGA 4FXKB 3MCLH 5EU3A 5IMKA 1RUAH 5DD0L 4Y4KA 2EXWD 3C5JB 4PS4H 4LHUB 5EU4A 1FFRA 4LFHD 2H45A 1E4KA 4KROD 4X6DA 4O2FB 5F7MC 3DHJA 1XFPA 4H0GA 4YX2L 2R23A 3PWVA 1H8NA 1OT2A 5GRWA 4UTAL 5I16A 1KNOB 1CT8A 2NW3B 4PJBF 2VC2H 3DWTA 4Y5XB 2VXSL 1G6RH 2ILLA 4MSWA 4TTGA 4OD3H 4P3CL 3WIHH 3AM8A 3VGDA 4G3YL 3CGTA 4LCCB 4EN3B 2ZKHL 1Z5LA 3MV9E 4HH8A 1BX2B 1G6VK 5MEOB 4J3TA 5B8CC 4O51A 4I5BA 2NY1D 1RUPH 4JKKA 2E7LC 3V4VL 4JN1L 2VLME 4UMGA 5TDPB 5DFWH 3SKOA 5ISZA 1IGYB 1ZEAH 5DUPL 1T89A 4ZS7L 5F7NC 2XKNA 4PBWD 5SWSA 4JRYA 5C0GB 4TUJB 7FABH 4DN3H 5DEFA 4LMQE 4LK4A 4TSCH 4XMPH 4WO4A 4X8XA 7FABL 4CAGA 1PYWA 4KH2A 2C1OB 5HHPA 3QEGL 3LAFA 1INQB 2EXYD 3LHPL 5CAYB 2Z91A 1FZKA 3U4BH 3UDWC 4ELME 1L0QA 4LLAA 3I6KB 1Y0LA 3DI2B 3GO1L 2RHEA 3HE7A 4AQOA 2DDQH 1NGPH 1F8TH 1U3HD 4K7PL 3FTGA 1CFQA 3IVKA 1YEEH 5C0CD 5JIKA 1NGPL 3JVGC 4KHXL 3X17A 4N0YL 3UPAA 5I15L 1XGTA 2MCPH 2CXGA 3GSWA 1WCBB 1BFVH 3MJ8B 1KSRA 3FO1A 1DTUA 4QCIA 4JFEA 5T1DL 1W72H 5HVFB 3WIIL 1CGYA 1NSNL 3KPSE 3MOQA 5C09A 1NANH 2F5AL 3CX2A 3TNMA 1NC4A 3GHEH 2QADD 4IDJH 4PJHF 5DURD 1W72L 2A0LC 3HPLB 3DV4A 2OMBA 3QUKB 1MCFA 2F5AH 1T6VN 2BK8A 3W2DH 3V4UH 1WEJH 3VXNA 4K3JH 4EI5B 1EUTA 4PJ8D 4KK6C 5IQ9B 3QQ3A 4E5XA 1ADQL 5JMOC 3C8DA 3T3MF 4GS7B 2B0SL 4PR5B 1D9KB 5F9WC 3HNTL 4OCXL 4Z7NE 1NDMA 1ZXQA 4ODTH 4G6AC 2V2TB 1AY1H 3HRPA 2IGFL 3O9WD 3D39E 2ID5A 1NCDL 2DQUH 1E4XL 4QNPF 3ZSSA 5BW7C 1A1NB 2A1WL 4PRIB 2BVOB 4XXCC 2HLAB 1NCDH 3GZKA 5FM5O 1MAML 3QA3B 5FM4A 1ZLSL 5I73B 2J4WL 2VLKE 1F3RB 2YPKA 3GJFA 4LF3A 1CFVL 5J11C 5IVXF 1RZKC 1K3IA 3HI6L 1RD6A 3TVMA 1MHEB 5K59E 3W0WD 5JQ6L 3GEWB 4JDVA 4PJBA 1EJOH 1FN4A 5DRNB 3VFUB 1T04B 3IU3B 5T5NG 1I7ZB 4F7MA 5F3BA 3GBNH 1RZJH 1ZWIA 1SM3H 1MLBA 3RWCB 3F7VA 5CZVL 5FYJH 1OAKH 2HA1A 1SM3L 2PR4H 3WN5A 3QPQD 4RISL 4HKJB 5I8OL 5I8CA 1ITBB 3MTRA 4PGBB 2VLJE 4RISH 3TC9A 4Z7UB 1IGJB 1UQSA 5I8OH 3GSVA 1AKJD 3OAUL 3DMMA 2CO6B 1UC6A 1LK2A 3AY4A 3QRFM 3B83A 1DFBL 3B2VH 4LEOB 4YZFE 1CFNA 2W07A 5E2VL 3U83A 4HPYH 2J12B 4Y19D 5JQHC 5GSRB 2QV2A 2WWKO 3KPRE 4ZOAA 2B1AL 5K9QI 1OF2A 5F6HI 3M45A 4F7PA 1FNSH 5JW3H 4PLKD 3DYMA 3OKKB 4PJHE 4GBXB 3QNXA 4NQVB 4WNQB 3HE7D 1CXIA 5EO9B 5JMRA 3OMZA 4ZG1A 3FFDB 3CVHA 4PD4K 4GBXC 3BWAA 4RRPG 5I1HL 2FSEA 3CLEH 1FO0B 1OB1A 2HKFL 3ZHDA 3RDTB 5KJRH 1HINL 2X7LA 3ZDZF 3P4MA 4WW2B 4LHJB 2XZZA 4FQXD 3L5WA 4M6ML 2R8SH 1U9KA 4XP5H 3VD3A 2AXFA 3MJ9L 3P9LA 2DYPA 3MRLA 3NFNB 3DRTA 3MXWL 4HS3A 4PG9A 3RUGB 12E8L 2R8SL 1JVKA 1Z9OA 1QRND 3TH2T 2AJSL 4V2BA 3E6HA 4N8CH 1CGUA 2G9HB 4WI8A 2D9CA 5DS8B 12E8H 2JB6B 2P8PB 2ESVD 3RVWC 3VXSB 3UTOA