2JELH

Jel42 fab/hpr complex
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
218
structure length
218
Chain Sequence
QVQLAQSGPELVRPGVSVKISCKGSGYTFTTYAMHWVKQSHAKSLEWIGLISTYSGYTNYNQKFKGKATMTVDKSSSTAYMELARLTSEDSAIYYCARVMGEQYFDVWGAGTTVIVSSAATTPPSVYPLAPGSGGQGNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLAADLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIAPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords JEL42 FAB FRAGMENT
publication title The 2.5 A resolution structure of the jel42 Fab fragment/HPr complex
pubmed doi rcsb
molecule tags Complex (antibody/antigen)
total genus 43
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 1998-02-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2jelH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2jelH02
3FKUS 5CZXC 2PTUA 1F2XK 1A3RH 5ERWA 3BWUC 4UU9B 1S5HA 2JF1A 2P24A 2ZCKL 4X7TA 4RGMC 1YQVL 4UIKL 3MLXH 5HPMA 4ODBD 4FNLL 4O00A 2BSSA 3R4DA 1D6EA 4KTEH 3STZB 5DRNA 3UYOD 4XBEH 1T22B 3MRHB 1EIBA 1GL4B 3ULSB 3TESA 1QEWA 1L7TL 1XT5A 3WN5B 1CXLA 2GK0A 5C0CA 1EO7A 1AXTH 2BNUA 5DK0A 5JW4N 2E6QA 4PRNB 2VDMH 3LHPH 3W0WE 5DHVB 5BQ7B 1CL7I 1TMCB 1WZKA 1C7SA 1N3NB 4F7PB 4JY6B 5CEZE 3S8WA 2BSRB 3GSRA 5ICYA 3MNWB 1I3VA 4JHAH 3VXME 3L5HA 4KHXL 5EBLB 3T0BA 3BH8B 5HVHC 5TPWH 1LE5A 2KPNA 2B4CL 4D94A 4X6DE 5FK9A 3X11A 1A7NH 1CICC 1MWAB 3DWTA 2LVEA 1L7IL 5M94B 5TDPB 3MRKB 2G9HB 2RFXA 1WVZA 2A74B 4K3EL 1JHTB 3Q48A 4I4WA 4ODHH 4M48H 5J0BA 4ZUSB 2NY5L 3FRPG 1JK8A 3VGHA 3BW9B 1IFHL 4L3CA 3FN9A 2N7BA 3LDBB 3KPPA 4B41A 4YHLH 3PWPB 3QDAA 4OLYL 5KVEL 4NZRH 3KLHD 5DRWA 4BSWA 1CXFA 1FNEA 2AV7B 5D7LE 2WBJC 1TZGL 3OR6A 1PEWA 3OKLA 4ONGH 3ARDB 2V2WB 4NO5A 3L3OB 2NY6D 2YD1A 5FYKE 3WUWG 4P2RB 1OAQH 2YBRB 4LCCA 4N0YH 4CMHC 4TVPH 5A16B 3KYMA 2DQHH 3NCYS 4MNGB 1I8IA 1PLGL 4XP9L 2VLKD 4F7MB 3V7MA 1PG7X 3NZ8A 4WW2C 1U36A 1UA6H 4XC1L 1HXMB 1T6WA 1XGQA 2GTZA 1YMMD 1Z3GL 3B9KD 4KAQL 1YC7A 1KCVH 4PJ9A 2QKIB 1CD8A 1RHFA 5FGCE 1KV3A 2UYLA 3VMNA 4Z78A 1MHPL 4G8GB 3HLAB 2HLAA 2VDNL 1FYTD 2EC9U 3MCKA 3BHBA 1EEZB 3PWJB 3MLYH 5MERA 2ICEA 1LO5B 4Y89A 3TO4D 4X6CB 3WFDL 3L3DA 3INUL 2P1YA 3JV4B 4JM2C 1JMXA 3UDWA 3FFCA 5D8JL 5T1MA 1XGPA 4LAJH 5BW7A 2A9NH 4Y2DC 1T80A 1WTLA 2BNRD 2QADD 3JWOL 3NCEB 1BIIB 1NBVH 1CDYA 4UBDD 2AEQL 4X6CF 5DEFA 1EV2E 5GHWH 4DTGH 1OP5H 3MV9A 4Y4FA 5HJ3A 2DKSA 3MLSH 5D96B 1RVFH 3GK8L 4TVSa 3QIUC 1G7MA 2R56L 3B43A 5ESAB 5J1AB 4OCRL 5DVNA 1EHNA 1FZOA 3D3VE 1GIGL 2NX5B 5GS0H 1NFDA 2VN4A 5MEOB 5JR1H 2BVEA 3GBNL 3G6JB 5KZCB 2ENSA 4UB0L 1X5YA 3GJFH 1VGEH 2IFFH 3MRMB 3G6JF 1N26A 1HINH 3FRUA 4X8JB 1CT8A 2MWCA 3V7AG 4K7FA 1W8OA 3SE4C 1SMOA 4Q9RL 2D9CA 4KVNL 5ADOH 5BV7C 1N2RB 3RGVD 3QIBD 3OKOA 5JOPE 3C5JB 3FOMB 2DI9A 4RGOL 4ALAL 3QUYA 3IDXH 2IG2L 4YZFE 2H32H 2NZ9D 3QFDB 5HGBB 1SJXA 1LEKA 3QWOB 2ZUYA 3B8SA 2Z4QB 3JWDL 2ORBH 3KYNA 4HKBB 3MV11 1M7XA 1AFVL 2XT1B 5J6GB 1EVTC 3CK0H 2KKQA 3MRPA 3G5VA 3QXWA 3DETD 2JB6A 4MJIA 5FKAA 3EYQC 3VFMA 2VABA 5FUCC 1JIBA 2ED9A 5IK3B 4D9RD 2OI9B 2AJVL 4KUZL 4R4NC 1NSNL 4TN9A 5DJ6A 4WI5A 5DSCB 2EDOA 4MZ2A 4P23B 4HUVB 3N0PB 1BBDH 1NGWB 5LAXB 2Y6SD 1W0VB 1CK0H 4YQXL 4P4KA 5CHNB 4KPHL 3ZE0F 2YPVL 1QFHA 2IMMA 1I85A 5T3XD 1NCWH 4RCAA 1DVFD 1F4WL 4FFZL 1OWWA 35C8L 1KPVB 3BX7C 1RZJC 1YYMH 4U1MA 4XP4L 3MJ7B 5IMMA 3O8XD 1FVCA 5J56B 4F2MA 1H3PH 3EO9L 2ZJSH 3P30H 3MRIB 4WW1A 3DROA 1C5CL 2OZ4L 2UY7A 2UZIL 4QOKB 2DYPA 3V6FB 1ZA6A 1QSZA 3QCTH 5D1XA 3U36A 2CDGB 1KTDA 2DL9A 1T0NB 5HYSB 2R0ZL 1FC1A 2DWDB 1U58B 2JCCA 2CLVB 2WQ8A 2PYEA 3VRJA 4HX1A 1HI6A 4F33B 5T5NF 4N1HB 4KTDL 1ORSA 5DDHB 1OHQA 1U6AL 2OM5A 4KI5F 4EBQH 4YNYB 1JNHA 1F4HA 3QXAB 3W9DA 3WFHA 4R97C 1Y0LA 3IT8D 1EUTA 3ULVH 3PL6B 2FD6L 5HY9B 2N4IA 3MR9A 2RHEA 5BRZA 5C9KA 3WFEH 3T8XA 1A1NA 4LLQA 2C3XA 2YD6A 1E27B 4XMLH 1WF5A 5KSAA 1HKFA 3PWPE 1U2HA 4HUKB 2Y4SA 4PBVC 1KEMH 3DGGA 4H8WC 3LQZB 5DT1H 4Z0BL 4QGYA 4O4YL 1RSFA 1D5BB 3SEPA 1CFSA 4QYOB 3BRGC 1XAUA 4QRSA 4HS6A 4L3AA 5JOEA 3U0WH 2BY1A 3ILQD 1A6WL 1KPRA 1JV5B 3GEWB 2AJSL 3I02B 4S1QL 2R9HC 4XP6L 2P5EA 2XPGB 3BMWA 1RIVL 4U1IB 4LCWB 4XXCA 3EYSH 1D5XB 1OVZA 3QNZB 4X6EA 4MNGE 3O3EB 4G6KL 1QQDB 1JZ7A 1X6LA 3R8QA 2OL3B 4QRPA 1L6ZA 4UNTA 3GSXB 2NLJA 4CVWA 5LXGL 5EC1A 4KROB 3RRQA 4FXLA 3TYGH 3QDHA 5IFAL 3O0RH 4JVUA 4NQCD 1U8JA 3DIFB 4NJAL 3BP4B 2NCMA 3VFTA 4G8GE 5IKCB 5CSZB 3OGCB 2NY3B 1EJOL 3SGEI 3LKQB 1QG3A 3ZTJG 5KSVA 4JB9H 1E4XL 1ORQA 2XKNA 4L3ED 1A6ZB 4X6CE 4E41A 4ZQKB 2R1WB 5I75B 1QVOB 1A2YB 4PJDB 4HXAH 4CAGA 1GC1L 1OLLA 1G7PB 5DMGD 2HVKA 2D7NA 2EIDA 2XA8H 3WNOA 3FT2B 4QRQA 4GBXA 1BOYA 1A9BA 3FB7B 4C54A 1CD0A 2VDQH 3RWIB 1S9WA 1MCRA 1PKOA 2FRGP 3REVB 4PJDF 2W9DH 4CMMB 2VLRB 2QSQA 3SGKA 5GRYA 3ZKXB 2DJUA 2C1PB 4W4OC 5I1AA 4HZAA 1OAXH 2NX5E 1MAML 2CR6A 5I8KL 3G6JE 1UZ6E 2F8OA 3ZE1F 5F9JB 3P4MA 3PXJA 1JPSH 3K8KA 5ANMA 1V7ML 2NXZC 1AGBB 5IESL 1NBZA 3VW3L 1B2WH 4JFOB 1VSCA 4X80H 2BRQA 4ZTPH 2FZ3A 4KJYB 5FGSA 3RIFK 2FSEB 3GI8H 5MENA 4JFFB 1P7QD 3MREA 1IL1A 3LKNB 1MY7A 3BSZH 1CQKA 3J7HA 3B5HA 3FFDA 3N85H 3ARGC 1B0RA 2ZUQB 4KKCC 4RMTA 4YDVB 3LD8C 2BOCA 3PWLA 4IS6B 1SY6A 3GSNB 4NC1C 4HPOL 5DQJB 1WC7A 4LLYA 3SKJL 5ISZD 2J2ZA 1F5WA 1UM4L 5DD5H 3MA9L 4O2CA 1JWSA 5SWSD 3BGMA 3VWKC 4N0FA 1I1AA 3LH2H 4LMQE 3KXFA 4Q0XH 2ZNWA 4OAWB 4L1DA 5JLZA 4ZYKB 2I60H 1E6OH 2B5IC 4W70A 2LU4A 3S98A 2EKJA 4P5MA 3S97C 3V0WL 1CN4A 3H2WA 3MV8B 3B2VL 3CJJA 5IGXL 5ESVB 3U6RA 3V5HB 4PJFA 1WAAA 4MD0B 4RNRB 4Z18A 5JW3L 2R4RL 4LVOB 3TCLA 4XAWL 3L7FB 1WBYA 5D7JD 4ZXBA 1OQOA 2AVGA 1IC5H 1RJZB 4MNQD 3M45A 2CUHA 5HGGS 1JBJA 3U0TA 1FZKB 1E6JL 4JZJC 3U0PA 1QRKA 4TSAL 4QF1B 1NAMA 2QR0B 4N8VA 3C6LA 3EOTL 3IDNB 4NKMA 1J0IA 1AXSB 3MLWH 3VWJC 2QSVA 5DQDH 3BDXA 1CI5A 5F96L 4NM4L 4QOKE 1AD0A 2EDBA 4NUJB 3CSYA 4ZOAA 2C1OA 5I6XC 1XF5A 1AH1A 1AE6H 3EYUH 1ZT7A 4UQ2B 1ZLUK 5GGUB 4KJQC 4M61A 4CDGC 5I15L 3V6ZB 2Y72A 3C60A 2VYRE 2CIKA 1IE5A 3RPKA 2X9YA 3CX2A 2GSIB 4H1LB 1QFWI 2BRRL 4HPYH 4KZEH 3ROOA 4YHYC 5BVJA 4MAYC 2YOCA 5LQBL 5ILTL 2VWEC 1DZBA 2QTEA 4ODSL 5EO9B 3RY6C 5J12B 3BKCH 3I84A 2GAZB 1NCCH 3ZTJH 4XBGB 2H8PB 2CRMA 3OKKA 3PWNA 3D39D 1P4LB 3LEXA 5C1MB 3V6BR 5FDYA 3T77A 5D1ZC 3RDTA 3BXNB 4PJGA 1J10A 3L3GB 1WWBX 2FX7H 3TN0D 1QSFA 4OF6A 4BH8B 1IGCH 2R0LL 5EWIL 3ARSA 1JYXA 1QKZH 1XCTB 3BO8A 4DCQB 2DBJA 1K8DB 5D70L 4LCWE 4HKZA 3OAYH 5IW6A 4ZPVB 3FQUA 3BKML 4XHJD 1OCWL 3K8MA 1VA9A 3KPLB 4MVBC 2AKRA 4WO4B 4Y16C 1DQJB 1NFIA 2VAJA 1MCPH 3V4VH 1F45A 1I3UA 4Q97A 4RGND 3CDGA 4NQEB 3TIEA 3HNVL 5F9OL 3MYJB 3OB8A 2WWKO 3VG9B 2H26A 3PQYD 3BE1H 3HUJB 2CDFA 4PS4L 5IVZA 4HJGB 3V0VB 5MP6L 4X4ME 2PCPA 5JXED 2C9AA 1AC6A 4DGYH 3HUJF 4JKWA 1OARH 5CEYB 5L9DH 4PJDE 4M6AA 2EZ0D 1K5NA 5BV7H 2Q8AH 2ADJB 3H42H 3TA3C 4GXVL 3HPJA 1V3KA 1S7QA 4JREB 3CX5J 1IQDB 3ZE1E 4FXKA 1Y18B 2VLRE 2VQ1B 2QEJA 3FO1A 2OK0H 1QFPA 2BXYA 3OZ9L 4MD4A 2V7NA 1HE7A 3BP7B 2LQRA 1G84A 3CMOH 4LIQE 3K3QA 6FABH 3C2SA 3W82A 5CJQH 3TGXA 1UWGL 3U2SB 1F6AA 4Y5VC 3FQRB 1CZ8L 4OGAC 5C9JA 1TVHB 3MBXL 3KLHC 1MQKH 2LTQB 4U1NA 3SDCC 2VKXA 1LEGB 1KB9J 4W81A 3QUXC 1G6VK 1FN4B 3IU3B 1AGEB 5E5MA 1I3GL 3VFWB 2DIAA 2GI7A 4PRIB 1INQB 2GIYA 5I8OH 3ARED 2NY6C 4O5LH 2JELH 5KSUB 5KSBA 4JFFE 2XTJD 2YD4A 5HI5D 3O2DH 5KBNC 4NSKA 4PTUA 2K9UA 4QXTB 3RWCB 1PVHA 2AJUL 1C8PA 5C0RL 3S5LB 5E9DB 3S88L 2APBA 4GOSA 1I7TA 1OGTB 2XZAL 3NAAL 3ZDYF 3FQTB 1TJHL 3UTSB 4WWKB 1FVEB 4GKZB 4HJJL 3ZSSA 3B9KC 4YHML 1FFOA 4GKSA 5B3JF 3HB3C 2VXUL 2X70B 3CIQA 5D1QB 3QQ9D 4NNXB 3UC0H 3WKMH 3HPLA 4KZDL 1PG7L 2XQBH 5EZOH 1XF3A 4NP4H 1KEGH 3TO4C 5E2VH 3MV8E 4MJ6A 2YEZB 5CUSL 2DD8L 1NGYA 2HJLA 2V5TA 4YR6B 3Q3GB 1W2KT 2IPUK 5EUOB 4M6OL 2VXTL 4MLIA 1T0MA 1OF2B 1D5ZA 4DKDC 4OM1H 4IOFD 2DBLH 4M4PA 3P11L 4PJ8A 1SJHB 3CXDH 4UILH 2VXVL 3MGOB 4JPIB 4WNQB 5EUOF 1KXQE 5GGVL 3KHOA 4KMTL 4YHPA 3KPMB 1BFVH 1MLCB 4I3SL 3KPSB 3M07A 2FH6A 1GH7A 4GMSH 4G9DB 1FO0H 4KQ4L 4M93C 4YDIH 3RBGA 4PLNC 1I3RA 4G6MH 4LF3B 4CADB 4H8WH 5E94B 4Y5YB 3DX9A 1XMWA 3HS0A 3TBSA 1R3LB 1JI1A 1EMTL 5IQ7L 3KWWB 5L7XH 3KPOB 1TPXB 1T66D 1ZGLM 4OKVB 3VXMD 2KZWA 3X13A 5KANI 3K4AA 4J1UB 5CIPA 1TJGL 2C7UB 4BKLA 3SDYL 2GCYB 4RMUA 5DJXA 3LZFH 3WS6A 1C16B 4TUKH 3RGVC 4NRYA 5FCUL 1ZHLB 1DBMH 2W9EH 1ZT4A 2DWEB 1KC5L 2BVPA 4UQ3A 4U2ZA 4WUKH 4XZUA 4CNIB 1KCRL 5CWSB 5INDA 5I30H 3BAEL 5C07D 2ZNXA 2DM2A 1QBML 1U3HA 1JGLH 2I9LA 2DM3A 1ZMYA 4F7TA 5DJ2A 2GYSA 3BP5A 3BT2L 2V7HA 4WV1B 5I71B 1KTKE 3CX5K 5C0JA 5DD6B 1KACB 4G6FB 3OWEA 5C08D 2MCPL 5DWUH 2AABL 2ICWJ 2P48B 1YN6A 4BSVA 1SJEA 1MCHA 5DD3H 3OKNB 3FOLA 4K55A 1IT9H 1NJ9A 5I1EH 5FF6A 4PJAE 5FYKD 2BJMH 4L5FH 2APFA 4TSCL 5L2KA 1L9NA 4E0RA 4IRSB 4EUPB 1B0GA 1GXEA 4UT6H 5I1CL 2F54B 4I2XB 1DVFC 2XFXA 2FYYA 2A2QT 3T2QA 3MC0A 3VXUB 5FYJH 1CLOL 2HFGH 2HKHH 3TFKC 4G7VH 5IOPA 2C5DC 4HBQA 4GG8A 1RZFH 4R2GD 4NQEE 3FO2A 3QNXB 2ID5A 3CFBB 1Q0XL 4Y4KA 1IKNA 1D9KA 3RWEB 3VXPA 4Z77A 3EHBC 1HHIB 4BELD 2LABA 4P59L 3HUJE 2MKLC 4MXWL 3MRLA 1NFKA 3JUZA 2YXMA 4CN4A 3KVQA 1JZ4A 1F58L 2DJSA 5IBUG 5CJXA 2FGWH 4JPVH 4DGVH 2PW1B 1IAKA 4XVJL 3RVUD 1BLNA 4U1HA 5KOMC 3KPQB 5E1AB 5JORA 4F58L 1INEL 4OZFG 5CGTA 4P3DB 5C0BE 1GYAA 1KENL 3W5NA 1HSBB 3UPRB 1JPGA 2Z93B 3HC4L 2OJEB 3AXLB 1S7WA 3ZKMC 4NO0D 3JUYA 1U41A 1AR1C 1IAIL 1KJVB 3EOBA 4U6XB 1F8TH 4M1DH 1F00I 4CN1A 2P7TB 3QR2A 3VH8A 4OQ1A 3KJ4B 3LSOB 1MCOH 1A22B 1FIGH 1AD9A 1W0WB 3KLAA 4ORGB 1U8IB 1UJ3C 2D7TL 4FFVD 4R7NB 5CJBA 2OS7A 3WKNA 4CRPA 5DLMH 2FX9L 1KFAH 4B5EA 5BCAA 4NZUH 2A6IB 1XGRB 4Y2OA 5E4IA 5J11C 2W0FA 4LKCB 4JDZB 4PRIE 1I1RA 1ZEAH 1EEUA 5EU7E 5EA0L 1IILE 1MHEA 1OP5K 3M17B 3ZDYE 3I3DA 4XP5H 4NN7C 3OXSA 3P77B 2HJKB 4AEIH 1LP9B 5JOPD 4P5TA 2FLBT 2H41A 1VB9A 5DYOA 5E9DE 4M7LH 1GZPA 1X5KA 5BJTB 1ZVYA 3QUZA 4X5WA 4PR5B 3TEUA 3UTSE 3GBMH 5IUSA 1LP9F 1DBJH 4JO1L 1UM5H 5LGKA 3I85A 2FBJL 2EDYA 1LDPH 4YJZL 8FABA 5FA3B 1A6VL 4GG6A 3QHZL 3TO2B 1AO7E 1M05A 4YGVA 2WWKT 3EYFB 1RJCA 4YIQA 2AK1H 2XWTB 4UV4L 5ALBH 4PJ9D 1HNFA 4X9HA 5J4MA 1KIPA 4MAUH 3RNQA 3EDKA 4IIQB 4E9LA 2DLFL 3MNZA 3EFDL 4TSBL 4PJEB 1J8HE 3ARBD 3U30C 3TYFA 3C5ZD 1CG9B 4OCXH 3BH9B 4LGSB 1F11B 1F3JA 4HZLB 1OT2A 1QO3A 5E2WH 5EUKA 2XWJA 2VZSA 1A4KA 5AZ2L 3MUJA 4JDTL 3RL2B 1OTTD 5K33A 1GOHA 2LAAA 2DQEL 4NKIL 3RZCC 3GSQA 4PJEF 2JK5A 4O51A 4PGCB 3RA7H 3IDIB 3U48A 2LFGA 3O4LE 2FIKB 3VXQA 2O5XL 1YC8A 5E70A 4WFHE 5CD3B 3MV9D 4U6TA 1S78C 1QOKA 5ERWB 3NPSC 2P24B 4B50A 5FOBA 4GRLD 2O5YL 2WUCL 3IDYB 4X7TB 3K1KC 1YUHB 5HPMB 3MRGA 2YA1A 4CVZA 1D6EB 3HMWL 5DRNB 3MTRA 2AV1A 3ARYA 5F7HA 1TLKA 4WHTA 1ZGLB 4LKXA 5C0CB 2YXFA 1BZQK 4X9FA 5DO2C 1OSPL 1HNGA 2KQMA 1JRHI 2Q7NA 1YECL 4H20H 3SKOB 5I19H 3REWB 2EEDA 1T4KA 1X9QA 3GSRB 1A1MA 3BMVA 3HTLX 3Q6GL 4UDTA 1L9MA 3IFNH 4NKDB 3KNBB 5D72H 3P9LA 2Z8SA 3HAEG 5TDNA 1TDQA 2FEEL 3VFPB 1OW0C 1ZVSA 4GAGH 1UYWL 4NPYA 3X11B 3QUYD 5B39G 5HI4C 1PX3A 3MBEA 3F6IA 2X1XR 4HAFA 4JO4L 5FYLE 1JK8B 4K3DL 3KHQA 1QACA 1TZIA 2VL5B 4J8RB 3D2UB 4L3CB 4OZFH 3CCHB 4OFKA 1QYGL 3KPPB 5JDSA 4PG2C 1S3KL 4MQSB 5F6HI 4NQVB 2F19L 4LVNB 4MQ7A 2ICWB 3NCMA 2F54E 4I2XE 2Q76A 4BSWB 4OLVL 1FNEB 5CZVH 2J8OA 3VXUE 4DFHA 4LDLB 4MCYA 5FAAA 5KJRH 1RU9L 2B1AH 3O6FC 4NO5B 4P4KD 3V4UL 4TULL 5ITBH 4ZMAT 1DQLL 2D7MA 4AL8L 3UZVB 4XTRD 2E8ZA 3PJSA 4JE4B 5GIRB 4I1NB 1I8IB 2IMNA 4OFDA 3O6LH 2DQCH 2DTMH 3ECBB 4GAFB 3QEQB 4PY8J 4W6WB 4DN4L 3B3IA 1YYLH 2R4SL 5J9PA 1XGQB 2GTZB 3DV4A 3IKCA 1UGNA 3NZHL 1WISA 1DN2A 3NCJH 4Z78B 2UYLB 5C7XH 1YEKH 4UT9L 4JPWL 1NQBA 1XGYL 2FX8L 4Y1AB 2ERJC 3MCKB 3MZGB 1S9YA 4X83A 5J3HC 3U7YH 3LY6A 2PYED 3IFLL 4LCUA 4QO1A 3RVWC 2DDQL 2R23A 4K94L 4ZDHA 1A7OH 1NCAL 1XF2B 3OB0H 2V2TA 2CIIA 3FFCB 4MD5A 5T1MB 2YZ8A 1MLBA 4LU5H 1YNLL 4XCCL 5GRXG 1SYVA 4M9OA 3X17A 3FAXA 1M71A 32C2A 3LIZH 5DEFB 5LGJA 4LQFL 4NUGL 5BRZD 2UUDK 1TJIH 4Y4FB 4XH2A 1JYNA 4M1GL 4ZD3L 3T4AB 4LRNL 1FGNL 2WUBL 1Y6MR 1FV1B 2NQCA 3RX5A 5SWZE 5H35A 1FZOB 1XIWA 5IJVB 1JGUH 2R2BA 3QRGH 4MCZB 1BZ7A 3RTQA 3HI5H 2NY1B 3ULUL 3C6SB 1DANT 4OLZL 3GJFA 3MLUH 4D3CH 2Q3ZA 4OD3L 3CVHH 5HVWA 4AMKH 5JXAH 3FRUB 1D6VH 1BJ8A 3EZ8A 5EO1A 5I74B 3UBXB 1IC1A 3KLDA 3S96B 3TH3T 5GGSA 4NBYB 2H32A 3SDAA 4POYA 1G9NL 1NEZG 4M3KB 1LEKB 1YEJH 4JANA 2X41A 1KLUA 2P45B 5KVDL 3NN8B 2DLHA 3KYNB 2H45A 3L1OL 1KJ3L 1B4JL 4PJEE 1DQDL 3G5VB 5DVOA 2JB6B 2MJWA 4HGWA 4KHTH 3N1QC 3MLZL 4Y19A 3MLXL 2WBKA 3HAEH 3OX8A 4JLRB 3I3EA 2Q8BH 5CLWA 3BPLC 1MNUH 4XBEL 2VE6B 5DJ6B 3WJJA 4LEOA 3AY4C 1TVDA 3U4AA 1VGKB 2BHUA 3A0OA 4GBXD 5CILL 2QLVB 3WFCL 3FRPA 4ETYA 3QSKB 3SCMA 2VDML 1OGAB 5SX4H 1U8MA 2X10A 2YWYA 3I9GL 4JHAL 3RX8A 4X4XB 1KCKA 4Q2ZA 4YXHL 4U1MB 3EFFA 1FVCB 1IZJA 4U1LB 4XMPH 3BQUB 3QI9A 1N0LA 1XR9A 1ROWA 3U7WH 3KAAA 4RFOH 4H25A 2G75A 2YMXH 4WW1B 4JY4A 4L8SA 3VXSA 1U8NA 4MNHA 4NQXA 3DROB 3S7GA 3NIFF 2DYPB 2NY0D 2EXYC 4PJXB 1ZA6B 5T3XH 2HLFD 4ODHL 5D1XB 2WAHA 3U36B 3MX0A 1KTDB 3WUWA 3VXRB 4JFZH 3E6HB 5J06A 2HH0H 2X1OA 5IM7A 5MEND 4HJ0C 3QYCA 4GQ9L 4HX1B 4I0CC 4K8RL 4PJXF 3CSGA 1UEYA 2XG5A 4OM0H 5DUPH 2WQRA 4F9PA 4IRJB 1AQKH 3UTZB 4NC2B 3MRQA 3WFHB 3QJFA 1Y0LB 1VFAA 1HK6A 3QXTA 3C08H 3I3BA 2EDHA 2I27N 3T8XB 4ONGL 1R5IA 4LLQB 4AENA 1I1AD 3EAKA 5KSAB 1IGYB 3B9VA 2ESVA 4JQXC 1FSKC 1EFXA 1V7NL 1XEDA 3DGGB 5EC2A 4PV8A 4P46C 1MI5A 5E8DH 2XRAL 3DUHA 4QRSB 5ABDE 4UV7L 4L4TE 4LAQL 4ZXBD 3QZWG 4HC1H 2K7PA 2D9QB 4RMRA 2P5EB 1J1XH 1KG0B 3BPNC 2MNUA 2CRZA 2DJ4A 4MDIA 5E24E 3K2UH 2HTKD 4Q6IA 3PE9A 5D2NB 3EDFA 3C6LD 5GRUH 3QEQE 4AT6A 3OAYK 2ICWI 2NXYD 4OIBA 4FABH 1OAKL 4QRPB 1TQCB 3ESVF 5ID0B 4GRWB 2J4WL 5EBMA 1OAZH 4GFTB 4LSQH 1IAOA 4Y1AE 5GHWL 4DTGL 1JN6A 4PJ7A 5JW4M 1Q9KA 2WWMD 1OL0A 2BVTA 4Z0XA 4GW1A 3P9MB 4GRWF 4E41B 5T1KB 1I7ZA 2B7DT 2Q3AA 1T7XA 4HKJA 4P5KA 3HZKB 3DBXB 1JNLH 4FS0A 3P0YL 3CFEA 1BP3B 1JF1B 4RFNC 2X4TA 1AQDB 2L7UA 1S9WB 1ZT1B 4KC3B 5GS2D 5FUOH 1IGJB 3QHFH 4J4PD 2IFFL 1HINL 2YS4A 5ADOL 5CINH 3EO0B 4WTZG 1SEBA 5GISL 1INDH 1IAIM 3MLRL 4HWEH 3RDTD 1JJUA 1G7JB 1LK3H 1WWCA 4G9FB 3IDXL 5F7LB 4X4YB 4Y5XC 3P4MB 4KQ3L 1QSFD 3DMMC 5ANMB 1Q8MA 1FORH 2AQ3A 4XWOC 2NY4D 2ZSVA 4OZ4B 4EVNA 2EO9A 4NWTH 4LCYB 2JLLA 3KJ6L 1X4XA 1E4XI 2J8UA 3CK0L 2FZ3B 5TGBA 1BF8A 4WUUA 1IL1B 2F74A 3WMSA 4K23H 4YH6A 4Z7VA 1WBXB 3TZVA 1I8LC 5JNYA 1LO2H 5K9QI 3GKWH 3CU1A 1CWVA 5BO1L 3S35H 4DKFH 3RVUC 4LLMA 4NZDA 3BGMB 5BS0A 4QRRA 2X4RA 1DN0B 3KXFB 2VR9A 4P4RA 5J1SC 2YR3A 2HYMA 4YO0A 5D93C 1WCBA 1XZ0A 2OSLA 3UBXI 2ZG3A 4N5ED 4P5MB 3GNMH 4NHCL 4NCC2 1YYML 5E6ZA 1ACZA 3PP4L 2UWEA 3QG7H 4I0PC 1TIUA 5DK2B 3BGAA 1RURH 1BM3H 1P53A 4V1DE 1OM3H 3P30L 1CICA 3NBNA 1J12A 4Z7QE 1BJ1H 2GJ6E 5CKAA 4Z5RA 3BOVA 1MRCH 1NGPL 3U83A 1OGAE 4F7CA 3OKDA 1BHGA 3U0TB 3QCTL 1D5IL 1WAAF 3U0PB 4BQ6A 3BJLA 1EK3A 1HH6B 4J3XA 3HE7C 1NAMB 2Z31B 1PAMA 3NIFE 1C5DB 5ITFA 4LNVA 1NUDA 4JRYB 3KS0H 3WJLA 3OJ2C 4CJ0A 3H8NA 3UTQB 4RSVA 1XR8B 4DOHB 2RJMA 2XN9B 4PJXE 5KVFH 4JN2B 2ITDB 4MA1C 4PRPB 4S1RL 2CGRH 1KB5L 3VXRE 3MGTA 5DI8A 4NO3A 4ODWB 2OR8A 5D9SA 1KGCE 5C0FA 1ZHBB 3SY0B 3HR5B 3D9AL 5KN5A 3MXVH 3QFJE 2F5AH 2W59A 4LSVL 4PJHA 1U3JA 2CIKB 5EIIA 3FJTA 1X5AA 4GAJL 3QDMB 4FQHB 4PJIB 1JNNH 4P3CH 3CH1A 4DVRH 3L3HA 3ROOB 3NACL 1DL7H 2X44D 1ZA3B 1S8DA 4L9DA 4WW2A 3L3KA 5IHUL 1PY4A 5C6WH 4F57H 3PV7A 1WUNT 1NC2A 4P2OB 4PJIF 4XI5C 1EBPA 1HOCB 3O45A 4TUJB 2VL4A 4MMXC 3EYSL 3KDMB 4OFVA 3C5ZC 3PWNB 4K9EC 4CU7A 3UO1H 3LEXB 3T77B 2PYFB 4X98A 1NUGA 3BN9D 4KV5F 3GSUA 5HDOA 4GXUN 1V5JA 1CFBA 1ZAGA 5EBWB 3VI4E 4JY5H 1UH2A 3BO8B 4M7JH 4FXGA 4ZO9A 4PJ8D 4HKZB 5JOFB 3BIBX 3O0RL 4Y2DA 5F7DA 5HVFB 4ZFOA 3QPXL 3IRZA 3FQUB 2VKWA 1LE9A 5FEBA 4GRLC 5D2NE 2AKRB 3FB5A 3QIUA 4UI2A 3JWNC 5DHYB 2D03L 1JFQL 1U8HB 4XRCB 1JF5A 4RDQG 1WIUA 3RVXD 2ZOLA 3CDGB 2ZSWA 1DQQA 3TIEB 4HK0A 4EN3B 3W39A 5DRZB 4GRWE 2R8SH 1FPTH 4NFDA 2XA8L 5C0BD 2I9TA 5ACLA 5I66B 2CDFB 2FL5A 1DBKH 4JPKH 5IVZB 3O4OB 2GW5A 3MUY1 3B5GA 1JGEA 4Z7WA 2W9DL 2PCPB 3E2HB 1LNUA 4E41E 3RWGA 1MJJA 3QA3B 3SE4A 3MRJA 2YRZA 3HRZB 1T89C 4EIGB 3LDBC 1S9XA 3W81A 2Y07L 2XKUA 4YWGL 4ESKA 2AK4B 3UZQA 1MFCH 5JO5A 1JPSL 4NWUL 3HPJB 5AAWA 5MI0B 1S7QB 1JPFA 4XPFH 3GHBH 4FXKB 3VDBA 2J5LB 1CR9H 3VFOA 5EB9A 5DMIH 3ARDC 4KDWA 5EZJB 2XY2A 1IQWL 4JKMA 5LBSL 1JVKA 3GI8L 5GRZA 3T0WA 1QSEB 4OV6F 5EBGA 4G9FE 3CFCH 2V9TA 5IP4A 4PPTA 1ZGLP 3N85L 4HEPG 3B6SA 5DUBA 5CJOL 2DQTH 1OWRM 1T03L 3DNKA 4ZS6D 2EE2A 1JI2A 2NY2B 1BEYH 1S9KC 5C2UB 2ZUWA 3RIFF 3BPCA 5TFSL 5HI3C 3O2DA 4Q0XL 5KSBB 5F1IA 1UM6H 1FLTX 3H9SA 4M8QA 1E6OL 1AO7D 1P6AB 2H9GA 5EOCJ 1EZVY 3VFNA 1I7TB 3HE6B 4R4FH 1KPUA 3U9UA 5KSBF 3CC5A 3LN5A 5JW5B 5DD0H 4PB9H 1C5BL 4GKSB 2Q20A 3HN3A 1FDLH 5ACMA 1D5MA 1J8HD 3HMXL 5ETUA 1CIUA 2XIDA 3A6BL 4UNVA 5EN2A 1G7LB 1VADA 4JO3H 4DFIA 2AAVA 2BCKA 1XF3B 4PGDA 5D96C 2ILLA 4XNYH 4PGBB 1J0YA 1OD7A 1KUMA 1IARB 5DFVC 3O4LD 4U3CA 5I0DA 2GJZB 1T0MB 2DM7A 2UZXB 1D5ZB 1NL0H 5I1GL 3QQ4A 1OB1B 2CR3A 3AM8A 1IKFH 3IJYA 1DUZA 1RZKL 4JRYE 1K9TA 1FO0A 2BVYA 3RGHA 2YPKB 1I3RB 1VKXA 3ARTA 4NO2A 1LO4L 4WI6A 2IF7A 4A6YH 5I1DA 2Z8RA 2XN9E 5C0AA 5FYJU 3TBSB 1OAYL 1YMHA 4PRPE 5HTSA 5DEGB 5T5FL 1UVQA 3O9WB 3IDGB 3WXWH 2ZOKA 5CIPB 1NCTA 2IADA 4TOYL 4BKLB 5DJXB 3BKCL 4P5TD 1IJ9A 4S11A 1NCCL 1YNKL 3BWAA 1E0OB 3QDME 5HHVH 4PJIE 3Q5YA 5DJDA 4WY7L 4FZ8L 3QUZD 2BVPB 1CGVA 2PTVA 4J3UA 5INDB 2OI9C 4ONHA 2JJVA 2FX7L 4JFDA 1NGZB 5FYLD 1M7DA 4JKLA 5LCVH 1U3HB 5E8OB 2A6KA 1H8OA 2I9LB 1QKZL 4KV5E 4EI5B 4F7TB 1AKJA 4NKOB 5DJ2B 2V7HB 4G80A 3PP3H 1RIHH 3F6LA 1GAFH 2FEDD 5KTEH 4PUBL 4EDWH 5CCKH 4HQQH 3CDCA 4XNXH 4HWBL 1MCPL 5BXFA 1I9JL 2HFEA 1Y6NR 43CAA 1M1SA 3K1DA 3ZT6A 3TBWA 3FB8A 4U3HA 3HNSL 1XCQB 4KKNA 5L2KB 2O61A 2R1YA 4E0RB 3TLRA 4HW6A 1KJ2H 2OP4H 4LCIL 5BZWA 5D5MB 1FFPB 2XFXB 2FYYB 1G6RA 1CU4H 3X12B 4G5ZL 2OQJA 1CL7L 3L5WA 4ZG1A 4W4OA 4DGYL 1UEMA 3ZHDA 1G1CA 2V17H 4Y4KB 1D9KB 5D5MF 1HEZA 3VXPB 5FYKH 5DJYB 3N1GC 1MRDH 3D25A 3MRLB 1X5XA 2NY0C 5I1LB 5DRXA 4L4VA 3PL6C 2XKSA 2VH5L 1IC7H 2LVCA 1IAKB 2VXSH 3TNNA 2WMPA 1BLNB 4U1HB 3LPGA 3CFDB 1R6VA 1RULH 2APXA 2VC2L 4FFYH 2VLMD 4ZFFB 1FAIH 2IJ0C 2O93L 1YEEH 1X3DA 2AK4E 4KK5C 1JPGB 3T0EE 4ISVB 5IW1A 3ARGA 2H2PD 3IB4A 3D85A 3TP4A 5IMOB 2B2XL 2E9IA 2EDRA 3EOBB 1K4CB 3ET9F 2JB5H 3OAUH 2VQTA 2AJ3A 5I8OL 3VWKA 5SWZD 1E4JA 3T4YB 2JELL 3VH8B 3P4OA 3LEYH 1XGTA 2D7QA 3MBED 1QSEE 1MPAH 3O2DL 2E9JA 3ES6B 3KLAB 2HWZH 2XZQH 4KJPD 4L1HA 3L9RB 5CFHA 4QXGL 4G8FB 1EERB 2W91A 1EEYA 4OT1H 4JQIH 3TPKA 4MXQC 4ZUVA 3OHXB 2YPLB 1S7XB 5JIPA 1QLFA 2D7PA 1Q9WA 4X99B 3CLFH 4YBQC 1CCZA 5F6IB 4HS8H 4KROC 2APWA 5KSBE 2ZUSA 2GSGB 5IEHB 3TVMD 2JJUA 1CXIA 2E9BA 2M2DA 3UC0L 2R2EB 3NTCH 2NY3C 4U6HA 3MJ9H 5DYOB 4JZJA 5GS3A 1F42A 1GZPB 5F7WC 2R0KL 4NP4L 1KEGL 3CFJA 1VHPA 4JRXE 1G0XA 2NXYC 3HZYB 4TVPD 1KTLA 1PJ9A 5I75C 1IAII 1JTTA 1FZMB 3LKRB 3VWJA 1MY5A 4AYFA 4GG6B 2DBLL 1WBZB 5HGDB 2Y5TA 4OLXH 1RUPL 5KW9H 4YIQB 3NCBB 4NCDA 2B1HH 2JJWA 1LO3H 4GG6F 5TE4H 3ULUF 3ZKXC 5I1JH 3FMGH 5FHBH 5JW4R 3GUTB 2DQIH 4I3RH 4HFUH 4G6ML 3PWUA 4JR9H 4R3SA 1NC4A 2OXGA 3BIKA 1WEJL 5EUKB 3SJVA 1UJTA 5TQ2L 4X4ZA 1ITBB 2VJXA 1DEEA 3VFVB 1BIHA 3SGDI 4MAYA 4J4PC 3GSQB 2JK5B 4NNPL 1X5IA 2M26A 4J3OC 3RY6A 4OIAA 3N9GH 3VXQB 1NCBL 1DBBL 4TUKL 2HT3C 1P2CB 2Q86B 2W9EL 1DBML 4Q7DA 5C09A 4ZFZA 5D1ZA 3MUGA 1A9EA 2IBBA 5GRVL 3O3AA 5FOBB 1FVDA 3SE8H 3DURB 1CGSL 3QPQC 1LILA 5AD0B 5IBLD 2RAMA 3MRGB 4CVZB 4NQDA 3UPAA 3ARQA 3DUSA 1FL5A 4JFHD 3I75A 3RTQD 2GITA 2WNGA 5B4MC 4WHTB 1KIQB 5JIKA 3O6MH 5DHXB 4L8DA 5F7EL 1N7MH 3C8KA 5TQ0H 4WIQA 4Y16A 1AP2B 4D9QE 5DHVH 5DTFA 1RFDL 1A1MB 2D7OA 4UDTB 3FT3B 4APQD 1LD9A 3BISA 5DD3L 1T7ZA 2A9MH 3PIQA 2X40A 4DJMA 1DE4B 4H88H 2GQHA 4NPYB 1SEQH 3SDAD 2BJML 4I77H 4LLAA 4RAVA 4UT6L 4M7LT 3LN4A 5T3ZD 2VXQL 3K2MC 1XGUA 3ISWA 4OZFA 4KVCH 1CGXA 2HFGL 1TZIB 4HH9A 1IAMA 2QHRH 4G7VL 2A83A 4L4TD 5ID1A 1DLHA 2CKNA 5IR1A 1YJDL 5DUML 5L2KE 5EIQA 2G2RA 3GRWL 2A0LD 2F53E 1V05A 4WI8A 2Q76B 3QDJA 5D5ME 5D71H 2MMXA 1ODAA 3ZDZE 3MZTA 2XWBA 3QEGL 2VSCA 3DX7A 2VDOH 5IF0B 5T5NG 1U92A 4POZC 5DJZA 2VLLA 3G04A 3EDJA 5IMKA 3ARWA 1RHHA 3SGEH 3MLVH 5HYSG 2IH3A 4EDXA 4BQ9A 1YEIH 4Y5VA 2FEEI 4M7KH 5MHSE 4ETQB 3QUKA 3MACL 3SDCA 4DAGL 1P1ZA 4JVWA 4D8PA 2WBWB 3JTTB 3ETBF 3S36H 3QUXA 5JHLH 1O5DT 1M6OB 2BZDA 3AU1B 1PZUB 3B3IB 3OQ3B 1ZLVK 3P9WB 3BN3B 4M1DL 5J9PB 2ZUTA 5TF1L 4X9GA 3DV4B 3IKCB 3VXSD 3HFMH 3MCLL 4NZTL 5J12C 1SYSA 5FO8A 3DPBA 1MCOL 1TQBB 2Y7QB 1FIGL 4X5LA 2RIKA 5IFJA 2HG5A 2N7AA 5DLML 4TTGA 5F8QC 1MFBH 2ENYA 2WANA 1ONQA 3AMLA 1S9YB 1NEUA 4LCUB 2R23B 1BQLH 2NYYD 5A2IH 1F4XH 1ZEAL 3CSBA 3B9KA 3O3DA 1KTRL 2FB4L 4YBHA 3T1WA 1JGDB 2V2TB 2CIIB 4MD5B 1CXKA 1K3IA 3H7BA 4HDIA 3HC0B 1H3TA 3ULVD 2DLEA 3WEXA 1SYVB 4E5XB 2ARJQ 4JFQB 3I50L 32C2B 1FG9C 1FYTA 4MA8H 4M7LL 1HQRB 2DQUL 4FQJH 4XH2B 3BN9C 3WE6A 4MA3A 4WO4C 3TO4A 3QUMH 2YPLE 3GBML 2DQFB 1EFXD 1DBJL 3BFOA 5IB5B 3GMRA 1X5HA 4L8CA 5TDOB 5F70A 1XIWB 1YN7B 1J1PH 4PJ5B 2GTWB 3MFFA 4UT7L 2XQYG 2YUXA 4M1CC 1BZ7B 5I2IB 2DRUA 2VDPH 1JZ2A 3GJFB 4ENED 1OAUH 4WWID 4CBPA 2APVA 3CVHA 2AK1L 3S3JA 3CU7A 3VGGA 2AEWA 4MAUL 1YY9C 3MOBH 3PDGA 2BK8A 3RVXC 3RWHA 2ZPKL 3L7EA 3SE3C 3T0XA 1I8MA 4GG6E 4K7PX 4OCXL 3ULUE 1MIEH 3ZTNL 5J7CC 4Q9QL 5E2WL 4JAMA 4LNRA 5HHPA 3A6OA 5GGVY 4JFXA 1MCQA 4JREC 4JANB 4JFEB 4OGXH 1NCUA 4XCEB 4YBLB 4PRBA 1UB6A 3M1BA 1Q1JL 3FN0H 1RUKL 1MHCB 4YUEL 4V1DD 3RGVA 4HMCA 2GJ6D 1KT2B 2DKUA 4WDIA 1YEFH 4Y19B 4GRMA 4DZ8B 3HAEA 2LTQC 4OJFH 5EO0B 3LVEA 3V95A 3MRBA 4JHWL 3UAJC 1MIMH 4OKDA 4IOSD 4OQTA 3S3SA 5B39A 1DFBH 5EFIA 1IEAA 4PD4J 4IMLA 5EU7C 5IB4A 3BKJH 4KY1H 5E1HB 4ZUUA 3IVKA 2DAVA 1HHJB 3SCMB 1KIRA 3SE9L 3WL9A 2X4PB 2D2OA 1CFTA 4ZOBA 1CD1B 5DFTA 3ZYZA 1CBVH 4QHNA 1ZWIA 1FBIL 3K80A 3MRCB 4HUMB 1CFNA 3BI9X 4YXKH 3EFFB 3AB0B 4WWKC 4FQXD 3QI9B 4GAGL 4X5XA 3RIAF 2FWOB 1XR9B 1R5WB 2OMNA 3QFJD 4H25B 2G75B 2PTTB 4JY4B 1T3FB 2BC4A 4NQXB 4U33A 4F8TA 1DVFA 5D1QC 3FT4A 4WGVB 4UTBH 1BMGA 2JIXB 3ARFB 3BUYB 3IDJA 3WUWB 1JE6A 2YC1A 3UROR 1W72A 4F37K 5DJ8A 2VDRL 2ZKHL 1MH5B 3TH4T 3O8XA 5CZXD 2CK2A 5IM7B 2R0WH 3TPUA 5K59F 2VUYA 5J89A 2B0SH 3DXAB 4LOUC 3IFOA 2IBZX 2Y23A 3OJDB 1KB5B 1TTUA 4NIKB 1F2QA 3NH7L 1BPVA 5KANG 5BS0D 1R5IB 2HRLA 1KLGA 5FA4B 1MJ7H 3MGAA 2ESVB 5ITBL 5FKPA 4RWHA 3IFPB 5HGHB 1EGJL 1A7RL 1RPQA 1MI5B 2IALA 1SY6H 1QRNB 4ODVL 3PV6A 5IFHH 1VPOL 2DQCL 2DTML 4S0TD 2K7QA 1K6QL 4HC1A 1TPXC 4Y0GA 2MTPA 1FE8L 2BNQE 5IIEA 2DMCA 2FATL 1RZ8B 1UQSB 4NT6A 2FLRT 5DZNA 4PLJC 1CXHA 4P9MH 3ZT5A 1UJ3A 5C7XL 3GB7A 4MDIB 5TF0A 5I73C 1UZ8B 4QHMA 4FTVB 4Q6IB 3L5JA 4XPTH 4QTHA 4JCLA 4R90H 1QFWL 5IMLA 5ENWA 2OL3H 1QPPA 4J3SA 2IQ9L 5C0EB 4LU5L 4MQTB 2ADFH 3DHMA 1GPOH 5I71C 2V5MA 2WBJD 3LIZL 2X4UA 5EBMB 3PWVB 5C0NC 2W60A 5SX5K 3EJYC 5HHMD 2XZCL 1TJIL 4F7EB 1JN6B 2OJZH 3GFUA 1Q9KB 5HDQH 4MHHI 2N56A 1RJLA 3HC3H 4S1DD 5GSVA 3KLSA 4OB5H 1EHAA 4X6FB 5I8CB 4Z0XB 3VI3F 2D4FA 3FQNA 4RZCA 5CBAA 2B4CC 2DKMA 2A77L 4QHKI 4YC2B 3MYZA 1NEZA 2VAAA 5E8NA 1HHKB 2PXYB 3BEWA 3B4NA 2Q6WA 1X7QA 3T1FB 1TTFA 5B38G 3HI5L 3WLBA 1A0QH 1ITCA 4PG9A 4IRSC 4MJ4A 4FZEL 3CFEB 2BSTB 5IVXE 2X4TB 5CSBA 5E5UB 2NY5C 5HXMA 2VIRB 3DRTA 4GKOA 1NC2D 5EOQH 3KPNA 4AMKL 3QCUH 1EHXA 3QIWB 3QEUA 2NY7H 2QQQA 1UB5A 4AY0A 2F5BL 4AH2A 1NKRA 1FH5H 4PJ5E 1JPTH 3T2NH 1QNZL 1SEBB 1URLA 4LIQH 4LLVA 3AS1A 2EC8A 4LDOB 5IEKA 3P4LA 3Q6FA 5DGQA 3C9NA 3S4SG 3F7YA 4JM2D 5ALCL 5EU6E 5GS2H 3RZCA 2VZ1A 2ZSVB 4YHOL 4HCRH 4UIMA 1SBSH 1F90L 4O58H 4Y2DD 3TBVA 3ELAT 2NTFA 4YAQB 3ZE2F 2P49B 2J8UB 4KI1A 2H2SC 2P46B 4XPAH 1MFEH 3X3GH 4AJ0A 4GW5A 1AR2A 1CDJA 4O2FB 4WUUB 1CLYH 3DX6A 3DRQA 3QIUD 1N64H 4KHTL 3ROLB 3QXUA 3PHQA 1MCKA 3NGBB 1GGTA 4KXZI 1UKQA 2X4QA 3TZVB 2Q8BL 2J8UF 5AYQA 5D2LA 2CDEA 2FBOJ 1AIFB 3GSNH 4JFEE 4QRTA 1YEDA 5E7BA 1Q9OB 1TITA 3CZJA 4HBCL 5DD1L 4ZS7L 5CEXB 4WCYL 3RNKA 4LLMB 1R5VA 3WIFA 4Z7VF 1MHHB 4YHIA 4QRRB 1TTGA 3WNPA 1P7QA 5DZLA 4PLOB 1N5YL 3KJ4C 4OLUH 1NLBH 5E2TH 3STLA 1HSAB 1U9KA 4YO0B 1LK2A 5EULV 5B21A 5T1LA 3OPZL 2Z9TA 2OSLB 1XZ0B 4Y19E 1UFUA 4XT1C 5A1AA 2L7JA 1S7RA 4JZNB 4LASL 5HVHB 1H3VA 3VRIA 5E8EA 1QR1A 2IAND 1OW0A 4HD9A 5AWNH 1X5JA 3AAZA 2R29H 1CICB 3U7WL 5I76A 4RFOL 3VXTA 2YMXL 4Z5RB 1HHHB 1P6FA 3JWOC 5HGAA 1H5BB 1PG7W 2DIJA 3LRSB 4R8WH 4F7CB 3OKDB 5T3XL 1U8PA 1MCJA 1I9IH 5DS8B 5I18L 4C55A 4C56D 1I8KA 5DA4A 5L6YH 5ITFB 4PG2A 3S5LG 2Y25A 1R3JB 3GSOA 1RI8A 1AGDB 4OM0L 4FMFA 5DUPL 1ZLWK 3EYQD 4FQ2H 2V5SA 4MNQA 1U8OA 1KCSH 2G60L 1N59A 3V5DA 5K59E 4R4ND 5B3NA 4WGWB 2EDDA 5CZKA 2Z8VC 3C08L 1PSKH 1BQSA 5ACZB 1A64A 5D9SB 5C0FB 3O6FA 2EEAA 4IIQC 5C0DB 3FZUD 4N8CL 2OTWA 3C09C 4ZNEE 4Y4HB 3H9SD 5E7FA 2DB8A 4PJHB 3LKPA 5FO7A 2MOVA 2EIZA 4R96B 3DXAE 4TNVF 1QA9A 4YE4H 4C4KO 3PHOB 4CMHB 3MA7A 1K4DA 1GOGA 1LHZA 3SDDD 5E8DL 3CH1B 1DDHA 3LKOB 4FQLH 3TBYA 4HIHA 4NRZA 4PJHF 1S8DB 5D7KE 3UJIH 4LSTH 4GMTH 1EO8H 3JWDC 3VD7A 4HK3J 5D6DC 4CN6A 1RV6X 2BFVH 4KMQA 4P3WA 3GIVA 2LAGB 4K3JH 4U6YB 4LARH 1QRNE 4NHUA 4XVTH 2QQLH 4O9HH 4GKNA 3IXTB 2W07A 5CGMA 3GSUB 5GRUL 4JZOB 3UTTB 1QFUL 3C5SB 1XH3A 3PP3K 4P2QE 4OSUH 2F15A 4KFZC 5E56A 4XAKD 1TVBA 3UYPA 1OAZL 4PRHB 1MFDH 4EKXA 4FTVE 1NLDL 5JMRA 4MXVF 4HIEA 1ACYH 3ZT7A 1B3JA 5KVGL 2ZOLB 4KRPB 2FJGB 3W39B 2ZCLL 4XCYB 4X7EC 2V2XB 1Q9LA 2I9TB 1K3ZA 2FL5B 3T0ED 4C57C 2XNAA 4WFFE 2FJFB 3BKYH 3QISA 5EDXA 5IT2H 4OCLC 3QDGB 5F88A 1JGEB 3U46B 4Z7WB 3TBTB 2R9HD 3GMQA 5FUOL 2DICA 3QHFL 1T2QH 4APQC 1LNUB 1KNOB 1MJJB 3MRJB 2AQ1A 25C8H 4LSRH 3IRPX 5BV7B 3LN9A 2FO4A 1INDL 3HG1E 4XNZB 4Z7WF 4LVNC 1PKQA 1ERNA 2OCFD 1OD9A 4JFDD 4ELKA 4C59B 1Q0YL 3IXAA 2NW3A 3GGWB 1PFCA 1JPFB 3UZEA 4EUPG 1J5OH 1U91A 1JWUA 4WU5B 4NWTL 2YD5A 4PV9A 2QQNH 3BVNA 2BVOA 4ACPA 1RY7B 3TH2T 1EXUB 3HKFA 5BMFL 3CGTA 3Q2CA 5DQ9A 5F3HA 3BZFB 3ZE2E 1Z5LA 1Z9SA 3B6SB 5E6ID 3WXVL 5FECB 3HR6A 3AY4A 2VLJE 5F9WB 4DKFL 4JRXD 4OLEA 3RWJB 1QZ1A 4NYLA 4U0RB 5JHDA 2FECL 3BPCB 5I16B 2Y06L 4GLRH 5IB3A 2WLYA 1MCFA 4LSUL 4HIIB 4Y7MA 1MCEA 4I48A 4G6AC 4RFEA 4M8QB 4NQUA 4S2SA 4OD1L 2H3NA 3MV7E 1ES0A 3VCLB 4QRUB 3VFNB 1P7KA 3SDXE 1MVFA 3WIHL 1CE1H 2E7LC 3JTSB 2BDNH 3CC5B 4ZTOL 3QG7L 4KK8C 3VXOA 1S5IL 4XP1L 4QRRE 3EKCA 1R3IH 2X4NB 1D5MB 5BW7C 5I17A 3WS3B 2NXZD 3HZMA 4L4VD 3RUGA 2EYRB 1VADB 4JEGB 2BCKB 1NUFA 1TCRB 3S36X 2BP3A 4X0KB 4PRAB 3O3BA 2CK0H 1F4YL 2R2HA 3KPRB 4AM0A 1GC1C 3SGJA 1NDMB 1EUUA 3ARGD 1H3GA 5L0QB 4KKCD 5FM4A 3QQ4B 3V4PH 4YFDB 3V52L 2NY1C 5KVFL 4TYUA 2A1WL 4PIRF 2UZYB 5IV2A 5L88H 3ZKQD 1YDPB 2CGRL 1V3MA 4C83B 2FJHA 3VWKD 5FDWA 1DUZB 3U1SL 1CLZH 2AJXL 2MHAB 4XPGL 4XNUL 4JQXA 3MXVL 5EPMA 3CLEL 5I74C 2VITB 1U8LA 2EH7H 2DQGL 1S7TA 3OMZA 1UKTA 4A6YA 3UMTA 3F58H 2ITCA 4JG0H 4P46A 3L3JA 1MFAH 1WZMA 5C0AB 5I9QB 2ZUXA 1IGTB 3R0NA 5GPRA 5E4EB 1UVQB 1DL7L 3FO9A 4QTIH 2VISA 4FQIL 5FYKU 4F57L 3CD4A 3ZL4H 3DI3B 2QSCL 1MJUH 4EI5D 3MJ8B 1FNSL 1SMAA 2CKBA 4HIJA 5DJDB 3B83A 4UDUA 5MEQB 1YQVH 1OOAA 4B0MM 5EOTB 3HI1A 3VXMA 4GUPB 4KUCF 1IVLA 4M7ZB 2YA2A 3VWJD 4AK1A 3IF1A 2A6KB 1GGIL 4JY5L 5E8PA 4X6DA 1AKJB 3O41A 2F58L 1L7TH 4K7PL 5LJYH 4EI6A 4JGUA 2YK1H 3GSWA 4RIRA 2F53D 3MOAH 2PW2A 4HKXA 1BX2A 4KJQD 2V5YA 5C07A 3UTTE 5BXFB 1T5WA 5FYLH 1UH3A 2HFEB 3TIDA 1IGFL 3VD9A 43CAB 2B4CH 4MXVE 1GSMA 3BQUC 3QJHA 1NC4D 2HRPH 5HHNA 3TBWB 5ESQA 3FB8B 1RZGB 4TNWF 4JG1H 4PRHE 1L7IH 2R1YB 1WITA 5LGHH 3DUUB 3RHWF 1KCLA 4K3EH 5BZWB 1BECA 3NFNA 5KS9B 5AYUL 1BQUA 4PJCB 1JRHL 4M02A 3OGOE 1IFHH 1I7RB 4MSWB 4UUJA 1U95B 3RKDD 3VE0A 1KJMA 2K3TA 43C9A 2ZUVA 1B9ZA 4FQXC 5D1ZD 1NKOA 4PJCF 1MFCL 4IRJC 3D25B 3DMMA 1T1YB 1FZJA 4NQDD 1IGML 3QDGE 4N9OB 1NMCB 2DF3A 3CDFA 5LWYL 4JM4L 1TZGH 4XPFL 3GHBL 5A3IC 3DV6B 4JFPB 4ZAKD 5IHZB 1CQYA 2PO6B 5DMIL 5EZIL 3W9EA 3HZVA 4DUXA 4MVBD 3MRFB 4Y16D 3CMGA 4X7SL 1QFWM 5J57B 3CFCL 1MCBA 3T3MF 1C12A 3AFLA 5IW1B 4HGMA 1I8LA 2DQTL 4C4KT 1PLGH 1JCKA 4XP9H 4GW4B 3D85B 3PGDA 3G5YB 1G9ML 5T33H 3O2WL 3ZKSD 1BEYL 4XC1H 2BMKA 4WI9A 3SKNA 2AJ3B 2X89A 4KAQH 5FHAH 2GFBA 5CAYB 3WBDA 3P4OB 5B8CA 3N1MC 3MROB 3SOBH 3GHEL 4D0CB 1NPUA 4J23A 2VDNH 4NO0A 3P3YA 4XNMA 5D2NC 2EDQA 1UH4A 1AI1H 3L95A 5TJWK 4BJLA 4U7SA 3THMH 3WV0A 3WFDH 3JV6A 4FG6C 4I0PA 4X9IA 3MRNB 3INUH 1BZ9A 2E8YA 4XCNA 4GXUM 5DD0L 5HHOE 1Q9WB 1TQCC 3TA3D 5F3BB 3D3VA 5HHXL 2GUOB 5C0GA 1FDLL 5I0ZA 3QDJD 3GMNA 4BFIA 3JWOH 4F8QA 3MJ9A 2AEQH 4U6HB 3VFUA 4XPBL 3HE7A 1CFQA 3GK8H 3CFJB 2R56H 1N8ZB 4HFWA 4UINL 1BD2B 4YEEA 4OCRH 5EU3A 4OGAD 1GIGH 3NIDF 4OV5B 3SDCD 1RAMA 4GS7B 4LSPH 1AY1L 1NL0L 3GBNH 5F1NA 4PGJA 3QUXD 3FCTB 5HBBA 2Y5TB 4UB0H 2YN5A 3BDYL 4AEHH 4S1DC 1IRAY 2FDBP 4XMKH 1IKFL 2KBGA 3TJHC 5D7IB 4MDJA 3KPRE 1N6QL 1MF2H 4JGJA 4R3SB 5D7IF 4ALAH 3H3PL 4G3YL 4OZGB 4R4BA 3BIKB 3OL2A 1M7IA 4GH7B 3SJVB 2IG2H 1JNJA 3FONA 3ZKNC 1BVKA 3WNMA 2P5WE 1DEEB 3WDJA 3WXWL 4O2EB 1T21A 4MAYB 3HB3D 4F3FB 2WV3A 1ZHKB 3LAFA 3JWDH 1A1OA 4WFEE 4OZGF 3ARBA 1GCFA 3C5ZA 4OTXL 4BQ8A 5C09B 4ZFZB 4UU9A 5C0AE 1A9EB 3UBXG 3BP6A 5HYJB 3O3AB 1ADQA 2VO5A 4HUWB 4KUZH 2F8VA 3GMLA 3STZA 1NSNH 1T22A 3DUSB 1FL5B 3MRHA 3ULSA 4PJBB 3I75B 4YDJB 3T3PE 5CMAB 3LB6C 5DC9B 3F7QA 4YQXH 4PP2A 3C8KB 4PRNA 4GRLA 1GAFL 5KTEL 5DHVA 1JZ6A 5CCKL 1H3UA 4F7PA 2J6EL 1F4WH 2BSRA 4HQQL 4PJBF 5DTFB 4C58B 4XNXL 1DSFH 1FNGB 1LD9B 4LLUA 1L0XA 3CNKA 2DLGA 4K8RD 3W11C 3EO9H 5AUMB 1MWAA 3GJEA 1HXYA 3PNWA 4JHZA 5TDPA 4M6ML 2DQDL 3MRKA 2OZ4H 2UZIH 1KJ2L 5EU4A 2A74A 2OP4L 1JHTA 1H9VA 3RI5K 1BFOA 4V2CB 4ZUSA 1QUNA 4OZFB 2R0ZH 3BW9A 1T83A 5GS1B 4IRZL 1BWWA 2Z31C 1T89A 5ID1B 2IBGA 2BNQD 2C26A 1O7SA 5DZOA 5IR1B 3PWPA 1Q72L 2AXGA 5C70A 1F02I 1HZHL 1S7VA 2E27H 5KS9E 2AV7A 5T3ZH 4H5SA 2FD6H 2XWBB 4PJCE 4BQBA 2HAZA 1QHPA 2VXSL 3ARDA 2V2WA 3VGFA 3G04B 1RHHB 4EDXB 2YBRA 3HCVB 3RWDB 1FAIL 4Y5VB 4GAYB 4Z0BH 3QUKB 1FC2D 3CZFA 2EKSB 4M43L 4F7MA 1JZ5A 1I1CA 4FOMA 3WO4B 4RWYL 3BZDA 2JB5L 1EJ6A 3OAUL 5DVMA 4S1QH 1WQVT 2NY6B 4LSSL 3FZUC 2QKIA 4P2OC 1YY8B 5J13C 2MQ0A 1MPAL 4G8GA 2HWZL 5IFJB 3NCFB 2HG5B 3TFKD 2XQYK 3LRHA 2P44B 3PWJA 4MJ5B 3SDDC 2VLKB 5JUEH 2A73A 1ONQB 2IH1B 3ZMRA 3VXNA 5H94B 4OI7A 1LO5A 4JQIL 3RKPA 1TETL 4X6CA 3EHBD 3L6FB 4DKAA 3CPLB 3I2CL 1YMMB 3B9KB 3O3DB 4KKAC 1GGBH 3EJZC 1IBGL 5IFAH 2P8LA 4IDLA 5C6PB 4NJAH 1KN2L 2I26N 1FJ1B 1FYTB 4FMKA 4FHBD 2R2CA 5LVEA 3QUMA 4MA3B 3TO4B 1E4XH 1CDIA 5FXCH 5EU6D 5IROC 2WINB 4IJ3B 5J1AA 1RUQH 1JTOA 5C8JA 1WWWX 5MEPB 4L8CB 2NX5A 3ZKMD 2EXWD 1GC1H 1F3DJ 1DR9A 3MFFB 4EN3C 3G6JA 2QADB 4N90D 2BNRB 1AR1D 1H3WM 2YRLA 3NIDE 2EIEA 4PGZA 4U1GB 3B8YA 1CGYA 1A7PL 1PW3A 3QH3A 2B1HL 3MRMA 1LO3L 3E2HC 1BD2E 1CLCA 3L5XH 4BFGA 3OKMB 4X8JA 3L7EB 1H8NA 1A6UL 4I3RL 1N2RA 4JR9L 4OUOA 2EDFA 3C5JA 3DARA 2EC9T 3FOMA 3CVIH 3T0EC 3CXHJ 1HIMH 4Z7OF 4JAMB 5HGBA 1V7MH 5HHPB 3QWOA 1KELH 2HJFA 5CBEB 3VFGL 5D7IE 4P2RE 3QEHA 1EDQA 2J5LC 2Z4QA 3VW3H 1U8KB 1EO5A 4PRBB 4HKBA 1UB6B 3M1BB 5J6GA 1BJMA 5GXBB 3RGVB 3QIBB 1JHLL 3U9PL 5KAQF 4OZGE 4WDIB 3GMMA 3HAEB 1ETZB 4M62L 3MRBB 1D7FA 4GSDH 5DJCB 4HPOH 4QT5B 3SKJH 3TC9A 1UM4H 4JO2L 2NY2C 3MA9H 4L29A 1NGWA 3RPIB 5LAXA 3AUVA 3VFRA 2EYTA 4LGPB 3O6ML 5C09E 5CHNA 4G43B 5HYJE 1CE6A 1KIRB 2X9XA 3WFZA 2J7LA 3G9VA 5F8RC 1UXSB 3BEVB 2UUDH 3A67L 3I6GA 5E6YA 4JDVB 1KLFA 3BYTA 5E6IC 4QHNB 4UZGA 1VENA 3HE6C 2E7HA 3B2VH 4BQCA 2GEEA 4PJBE 3PDDA 4H88L 4P9HL 5JW3H 4D0BA 2R4RH 1SEQL 4BSJA 3MRIA 3DX8A 4I77L 1UADC 2BC4B 2J1KA 2W0KA 4RX4D 2BY0A 4QOKA 3RZCD 1DVFB 3FT4B 1E6JH 1T0NA 4TSAH 5HYSA 1KOAA 2DWDA 1U58A 2QHRL 2CLVA 5D7KD 3O8XB 3EOTH 4CGTA 1S78D 1A3LH 1FG2A 3NVQA 4KRNA 4F33A 4HLZG 4LHQB 3IJHB 5DDHA 3U4BH 5F96H 2EDKA 4NM4H 3GMOB 4ZUWB 3ESUF 5D71L 4UAOB 1PDKA 1PYWA 3PL6A 5HY9A 3MOQA 4Q58C 1BFTA 2P8PA 5INCB 5IVNA 5KG9A 5DO2D 5I15H 1KLGB 4P2QD 5DR5H 3MRDB 1ZLSL 3D69B 3MLVL 1DQMH 5T1LD 1NMBL 4NFCA 3WD5H 4M7KL 3IJSA 1D5BA 5DVLA 4TRPL 2BRRH 3FQXB 3S36L 2HTLC 3O9WC 4R0LB 5FFLA 1JV5A 3VMPA 2I07B 2YUWA 4JKPL 4R7DA 5LQBH 5ILTH 3I02A 2WIMA 1Z0NA 5HI4D 2XPGA 3HFML 4G7YL 4U1IA 4X6BA 3WS6C 4LCWA 1R24A 4Z9KB 4ZUTB 5E00A 3QQNA 1D5XA 3P0GB 3QNZA 5F44A 1G0DA 3ZE0E 3H0TB 2W92A 4QHMB 3O3EA 1LMKA 1MCCA 1QQDA 4WFFD 4EIZC 3FN3A 1MELA 2X4OB 5J11B 1K85A 1BQLL 3F62A 1DBAL 1CF8H 2OL3A 2R0LH 2Z35B 3S6CA 3PDOB 5IMLB 5EWIH 2BVQA 1WLHA 2NNAA 5D70H 4EI5C 3DIFA 3RVVD 4GRWH 3HG1D 5IKCA 5CSZA 2W60B 2ATKA 3BKMH 3TT1L 3LKQA 1OCWH 2VLKE 4OFYD 3RBSA 3O6FD 5GSVB 3QUML 1EVUA 4UOW1 1A6ZA 4X4MA 1NBYB 4E42B 2VZ3A 2R1WA 3RZWA 3FQNB 1YMME 5CBAB 1WICA 1A2YA 5J6HB 3HNVH 4PJDA 5GGRB 1VFUA 2VAAB 4Z95L 4NQCB 5E8NB 5F9OH 1X7QB 4QXUL 3WIIH 4XXDB 2DI8A 3WLBB 4KI5E 1FYTE 1G1YA 2VDPL 1I1FB 4PG9B 1GJIA 4PS4H 3RWIA 4D0DB 3REVA 5F6HJ 2OR9H 4L3EB 4OZIA 2VLRA 5MP6H 1MUJB 3NCCB 4QHUA 2BOBB 5M95B 3QEUB 2C1PA 2VLJD 1E4WH 2A6DA 3NFPB 1J1OH 1IKNC 1C08B 4BFEA 2BNRE 1MQ8A 5J3HD 1MIEL 3RVWD 2IAMD 2IGFL 4JFYA 5F9JA 1IC4L 4GXVH 1N4XL 1DEDA 5AEAA 3C9NB 3F7YB 3MV7D 1P5VA 4HCRA 4J4PA 2YSSB 4OIIL 5CJXC 4YDLB 5DK3A 4Z7OE 3OZ9H 3RKDC 3OG4B 3MO1B 5ICZB 3FN0L 4G6JH 4KJYA 2FSEA 4JFFA 4LPUA 3RJDA 1BGXH 1UWGH 3DX6B 3MODL 2X2YA 3LKNA 5H37G 3ARXA 3DRQB 1CZ8H 3F12A 4LL9A 3QULB 4G8EB 1YEFL 2R69L 3PHQB 4PRDB 5HYEA 3NABL 3MPCA 2X4QB 4IS6A 4U1SB 3GSNA 3D18A 4OF5A 1I3GH 4ZAKC 1OT1A 1VCAA 3LQAL 1X4ZA 3RNKB 3VD3A 3BKJL 4YHIB 1P7QB 3KR3L 3P0VH 4OAWA 5D2LF 2AJUH 4ZYKA 4DQOL 1AGFB 5C0RH 1T2XA 2BY3A 3UYRH 5CLTA 5ISZB 4BH7B 1TJHH 4K94C 3G5XA 3VRIB 2XACC 5E8EB 3V5HA 4TUOB 1Z0MA 4MD0A 3AAZB 5SWSB 4YHMH 5F6IC 1RJZA 5HGAB 1YPZB 4N5UA 1U8QA 2IQAB 1FZKA 1U8PB 4D9RE 1LVEA 5E2UL 4HWUA 2QR0A 4IOIA 3DVGB 5CUSH 3E6FB 2OTUA 5ICXB 4HH8A 5FM5O 3MJ6A 3IDNA 1IGIL 2R0WL 1YPZF 5F9DC 3DYMA 4OCWH 5D7JB 5IHLB 1R3KA 4JRWA 5CS7A 4HXBH 3ZYIA 4MNQB 2X42A 3P11H 1N59B 1BQHG 5T3XE 3V5DB 4EJ1C 3ULUC 4DVBB 1YA5A 2VXVH 4ONFH 1SM3L 4HIXL 5JHDD 1DUYB 3G6DL 4KMTH 4UQ2A 5SX4I 1FFNA 1QBLL 4I3SH 4WHDA 1DLFL 1MJ7L 1T04B 2OTWB 4KQ4H 3RWFA 4CJ1A 5FO7B 1HKLH 5TE7H 5I1HL 5ADPH 1QA9B 3DVIA 3AROA 4K71C 2I5YL 1IEBB 1G9NC 1SY6L 5JPMB 3VGBA 4WFGD 4DW2L 1DDHB 4OBSA 4HIHB 5IQ7H 5JQ6L 4LEXL 4NRZB 1FHGA 3O81A 4POUB 4M8VA 5D7SH 3SDYH 5EO9A 4D9LL 4AEEA 2EXYD 5FCUH 2H8PA 1FRGH 3DYPA 4Y8AA 1P4LA 5GJTH 1KC5H 5FGBC 3JV0A 1RZJH 3ARZA 4WI7A 5AG8A 4QNPF 3BXNA 1K8IB 1KCRH 4HJ0D 1JHKL 5C6TL 1U42A 3BAEH 3L3GA 1QBMH 4Z8FH 5B38A 2R1XB 3DJ9A 4YXLL 5F71A 4J6RL 4DCQA 2B39A 1K8DA 3TJEL 3WO3B 3DSFL 1UACH 4PJAA 1ZS8B 3BT2H 1WGOA 1GPOL 5SWQB 3D39B 4ZPVA 3RL1A 2DN7A 3ZO0A 4QHLB 1J9CT 3QWQB 3KPLA 1NAML 2OJZL 1J0JA 4WO4A 1SVCP 3CAFA 2IEPA 3HC3L 2MCPH 3CFKB 5SV3A 2AABH 3TN0B 1JGVH 2K1MA 5I1KH 3LV3B 1YEGL 4NM8H 1N0XH 2CJUH 4P46D 3P40A 3S4SA 3MYJA 4PB0H 5D6CB 4TSCH 1WSST 1A0QL 1Q9LB 1QPXA 4FFWD 5I1CH 4KGLA 5F88B 4OLWL 1K2DA 1HYSD 3V0VA 1CLOH 4ODUA 4RGNB 1P7HL 4UMGA 3SE3A 4K8RC 1U93B 1FH5L 1Q0XH 4CW1B 4NQCE 4N0RA 3W0WD 3GMPB 5GRJL 3PQYB 5C0BA 2CLRB 3QO0B 1TZHB 5CEZD 5GZOC 3T2OA 1UXWA 5A43C 5F7MC 2X7LA 5GZNC 4ELKB 3V6OE 3H7LA 1F58H 1GOFA 4L3EE 3VA6A 1Y18A 2R39A 5GSRB 4HCRL 1U91B 4O58L 3BP7A 4PV9B 4KRLB 4OZHB 3BVNB 2BVOB 3SPVA 1QSVA 5HHOD 4F58H 3X3GL 3QNYA 1EPFA 4L9LA 5DQ9B 5F3HB 1KENH 1CLYL 3U2SA 1N64L 4HWZA 3HC4H 1Z5LB 2RB8A 2E9WA 1LEGA 4OZHF 2V9RA 1MFNA 1I4FA 3MV01 1N5AA 4X7FC 1AGEA 3VFWA 4PRIA 1INQA 2EDWA 3R06B 1XFPA 2EECA 3UCRA 1TENA 5E2TL 2GY7B 1TQBC 3RWCA 2VDKH 5D7LD 2IPKA 2D7TH 4RFEB 3S5LA 5E9DA 2FX9H 2IC2A 3JV5A 4PGEA 1R0AL 1PQZB 1OGTA 1YQ2A 5FM8A 4GKZA 2X09A 4NGHL 1KB9K 3AREB 5EA0H 5FUZL 1RMFL 2XTJB 1ZTXL 3DMMD 4Z7NF 3KYOB 4XC3L 5I17B 4XWOD 4TPRH 1G6RH 5D1QA 1AO7A 4R8WL 4I9WE 3VH8G 1CDHA 1CVRA 4M6NL 4WJ5B 4KK9D 2P5WD 5ISZE 4GT7A 3HI6L 5C2BL 2EYSA 3LQMA 4MQXC 4TTDC 3O3BB 5DJ0A 4YR6A 4JO1H 1O0VA 5SWSE 3Q3GA 2HKFH 4AM0B 2FBJH 2R15A 2V6HA 1J8HA 2YZ1A 1NCNA 1KCSL 3QHZH 4WEBL 1YPZE 2AXFA 2FECI 4CVXA 1OSZA 1SJHA 1ZKAA 4N0CC 2AEPH 2YKLL 4JPIA 5I1IL 2X89D 4ZSOB 4LHUB 2FJHB 4UV4H 5FDWB 4HS3B 3O4LA 3MLTB 2DLFH 3H6JA 5EPMB 3EFDH 5EORL 4G9DA 2GHWB 2EXWC 5I8EB 4CADA 4LF3A 5E94A 4A6YB 4MNQE 5IVOA 3BZ4A 4TQEL 2D0HA 3OSKA 5C0IB 4FQLL 4I0PD 5AZ2H 4FQ1L 2Y1VA 3KWWA 4R6UA 3KPOA 3VDAA 1FAKT 2DQEH 4OKVA 3D3VD 4GMTL 4J1UA 4NDMA 4FQPA 4YBLC 3VDCA 2O5XH 1C16A 4BZYA 1ZHLA 3GSVB 1RK0B 1IM9D 1H0DB 2DWEA 1KCUL 2RGSA 3HE7D 3FQWA 2C4FU 2QQLL 2WUCH 3BGFB 4CNIA 2X5PA 3SN6N 5CWSA 1LEIB 3HI1B 3VXMB 5DURD 3IF1B 3WJJC 5E08H 5AG9A 4X6DB 3O41B 3AVEA 2D4DA 4EI6B 5B3JE 4PREA 2FHCA 1MFDL 3GSWB 4RIRB 5IBTL 4HKXB 2PW2B 3L5IA 4N9GB 2EEBA 4X6DF 5C07B 1P4BL 1PZ5A 1ACYL 1MCDA 4UOJA 3BPOB 3OKNA 1Q38A 3K46A 3A6CL 3O2VL 1UYWH 4YFEA 3SHSA 3D39E 2IFGA 4IRSA 4EUPA 1KJ2B 1T1WB 2EDLA 1H15A 2F54A 4I2XA 3BKYL 5IT2L 3NFNB 5C08B 3ARFC 4XI5D 5EUOE 4JO4H 3VXUA 4K3DH 1T2QL 4UUJB 8CGTA 43C9B 5EH1A 4YDKH 3AS2A 3CFBA 4LSRL 3BD5A 4EOWL 2RCSL 1VESA 1MRFL 1HHIA 4OCMC 4F9PC 4OLVH 5BVPL 3KPSE 1GHFH 3P73A 4RGNE 2N1KA 1QLEL 4R2GB 4F9LC 3S37H 2QQNL 1RU9H 5E1AA 1WFOA 3W9EB 2HN7A 3V4UH 1S5HB 2HP4A 3VGAB 4TULH 1VERA 3PQYE 4M5ZH 5FGCB 1DQLH 4AL8H 4RBPK 2BSSB 2Z93A 1C12B 1W8NA 3BD3A 2EDNA 4MX7A 3PGDB 1QEWB 3JBG7 1KJVA 4J7RA 4U6XA 2VR5A 4DN4H 2GK0B 1A21A 2BMKB 4OZHE 3SKNB 2P7TA 2BNUB 5DK0B 1QFOA 5HD8C 2GFBB 5B8CB 4XVUD 1FLRL 4ORGA 5ICYB 5DEGA 4JPWH 4HMEA 4NO0B 1CGWA 1GGCL 4Q6IC 5JZ7C 4XNMB 1LE5B 1XGRA 3IFLH 2DDQH 3L95B 5FK9B 1S9VA 2VDLL 4LKCA 1X44A 3PWPD 4JDZA 1CE1L 3FO0H 3JV6B 1BZ9B 1NCAH 5SWZA 1A47A 1N6UA 4QXWA 3M17A 4LPVA 3SO5A 2RFXB 1KBGL 3NFSL 1X6NA 1YNLH 1FL3A 3P77A 2HJKA 4I4WB 3GMNB 3JVGC 3X3FH 4O02L 2COQA 4WHCA 4L8BA 3ALXA 4NUGH 4Z6AT 5BJTA 3UJTL 3ARDD 1A14H 4ZFGL 1OPGH 4R26L 1FGNH 2WUBH 2VTFA 4P2RD 3EJJX 2CK0L 4CU6A 3D0VA 5DRWB 2XTJE 4YC2C 4OD2A 1RIUL 2PXYC 3HHRB 3RVVC 3TVMA 1IZKA 5IB2A 4JN1L 3OR6B 5EOCH 3V4PL 3OKLB 2MPAH 3ULUH 4MA1B 4OLZH 3EYFA 1SBBA 1HCVA 2XWTA 2NR6C 5T1DH 1MCNA 1MAKA 2JTDA 5HI3D 2O5ZH 4IIQA 4LCCB 1CLZL 4MDJB 3QIWC 1RJYA 3KYMB 4G8GD 3ILPA 4PJEA 2MCG1 1CG9A 3BH9A 1F11A 1MFAL 1VFBA 4R4BB 3NZ8B 2EE9A 2J88L 2C4FT 4ZSOE 4PJ9B 1T21B 4PGCA 5KVDH 5D6DA 3IDIA 4ELMA 1MJ8L 2FIKA 4BUHA 4H0HB 5HYFA 4LVEA 2HLAB 3L1OH 2YA0A 1KJ3H 3GI9L 4U49A 3EYOA 5K93A 1B4JH 3ARBB 3BHBB 1DQDH 5CD3A 2WLZA 3C5ZB 1AC0A 5MERB 2ICEB 1P4IH 2IAMC 3BP6B 3MLZH 3MLPA 3L3DB 1YUHA 3DVNA 4XWGL 3NGBC 4OCSL 5DFVD 1WZ1H 3GMLB 3TZVC 1AGCA 4GO6B 1XGPB 5AZEL 2NX5D 5KZCD 2P47B 4YK4B 3G08A 1NGQL 4NNYA 1ZGLA 5FV2A 3MV9B 1R3HA 5CILH 5C92A 1J86A 5HJ3B 3UJJL 1A6AA 2YK1L 3UXFA 3WFCH 2WK2A 4JGMA 4PP2B 4GRLB 1QBAA 1G7MB 3M8OL 3MOAL 4K07A 3SKOA 3REWA 1FNFA 2G5BA 1DJSA 4LPYA 3I9GH 4U6VL 1T7WA 4NKDA 3KNBA 1NFDB 2WSKA 5FYLL 4YXHH 4LLUB 3GIZL 1LP9E 1L4IA 3VFPA 4EXPX 3STBA 2CRYA 1ZANL 4J2XA 3LOWA 2HRPL 2AGJL 5HYQA 1EHLL 4JG1L 3SKUD 3GJEB 1HXYB 2OZ4A 1RUAL 3PNWB 2I25N 1B90A 5LGHL 1EFQA 1H5BC 1NFDF 2ZCHL 5EU4B 3RU8H 3P4NA 1BFOB 4XVSL 1CT8B 5C07E 4K7FB 15C8L 2EE3A 4APQA 3F5WA 1H8SA 1UCBL 2VL5A 4J8RA 2AP2A 3D2UA 3E8UL 3CCHA 2E7MA 3OKOB 3NA9L 4GQ9H 1GZQA 4K8RH 4U7MA 3QUYB 1BOGA 4R9HA 5GGRY 4NQVA 3WJLC 3ZHLA 2AXGB 2ICWA 1S7VB 1YZZA 3VG0L 4JJHA 5C08E 3Q1SL 1QR4A 4H5SB 4LP4A 3UX9B 4P23D 5D4QA 3ZHKA 1RZKC 2KDGA 4L4TA 3UTOA 1J88A 1T0PB 3MRPB 3OG6B 1A3RL 4MJIB 1I9RH 4Y4HC 5FKAB 3VFMB 1V7NH 2VABB 2A6JA 2BY2A 4W68A 2P8MA 1ZXQA 1WIPA 5GIRA 4KTEL 3CZFB 4OQTH 2XRAH 2ED8A 1PGRB 1VEPA 3ECBA 3QEQA 3Q0HA 5F72S 5T33L 4UV7H 4LAQH 2VMFA 1AXTL 4P4KB 5FHAL 3LHPL 4QOKD 4MMZC 2WZPD 3I6KA 3SOBL 1P69B 3ALWA 2YN3A 2D31A 4KI5D 4Y1AA 1RD6A 5TPWL 1JTPA 5IMMB 2A73B 3VXNB 2NMSA 1AI1L 4F2MB 3THML 2E7LA 3RQ3A 1A7NL 5C0CE 3F7RA 1OAKH 3NIGF 1ND0A 5CGYC 1XF2A 3FHAA 3W2DH 2VZUA 2ARJA 2P8LB 2J4WH 4NJ9H 4M48L 1QD0A 3PL6D 1XF1A 4QKXB 1V8HA 2JCCB 1W72H 1VDGA 2PYEB 3QUMB 3VRJB 4I18C 4YHLL 1HI6B 3T4AA 1FV1A 1ORSB 4KK5D 4RAHA 5C8JB 4NZRL 4KRPC 1JNHB 2JCCF 3W9DB 1S7UA 4XGZA 4AQOA 5IJVA 4LSPL 4KXZH 2LE9A 1U3YA 4MCZA 4MS8C 3SQOH 3MR9B 5BRZB 3P0YH 3C6SA 1A1NB 4XPHH 3QQ3A 4AEHL 4U2YA 4XMKL 3QH3B 5IB1A 1OAQL 3IU4H 1UZ6F 4LCWD 1FIEA 4N0YL 4TVPL 4PBXA 3UBXA 2DQHL 3S96A 2E7BA 5GISH 1CTOA 1CFSB 3MLRH 4ZO6A 4HS6B 4XNZC 1MF2L 3MXWH 2CLZA 4EQ2A 4FFWC 4MXQD 1CFVH 4KQ3H 5AAMA 2DOCA 1KPRB 1UA6L 1HYSC 4W4NA 1KCVL 2HJFB 3EYVA 4BUGA 4YBQD 4I5BA 4KROD 3QEHB 3NN8A 3KJ6H 1ZLVH 5DXWA 4X6EB 2NY3D 5L2JA 3MLYL 4Y88A 1E4KC 5GJSH 2H1PH 3GMMB 4FQCH 5L8KB 1J0KA 4JLRA 2NLJB 5EC1B 5HVGB 3C87A 5C71A 2A9NL 1J8KA 5C86A 5BO1H 2VE6A 2PR4H 3D87B 1U8JB 5F9WC 4L29B 1DP0A 3VFTB 1T7VA 1VGKA 4OUUA 1NBVL 4MB3A 4U0RC 4V1DA 3VFRB 3SQBA 2EYTB 4H26A 2GJ6A 2VSDA 4NN6B 4N68A 5KSVB 3MLSL 1RVFL 1ORQB 2XKNB 1KN4H 1OGAA 1CE6B 2VLRD 2VOTA 3I6GB 1ED3A 3FFCE 1DSFL 4NHCH 4X4XA 5GS0L 5JR1L 3PP4H 2HVKB 4U1LA 3BQUA 3QCVH 4QRQB 2GT9A 4GBXB 4Z76A 1A9BB 1HQ4A 1S7SA 4K7PY 4KJWD 4D0BB 3MV9E 3DX8B 4J3WA 2QHLA 1NGPH 1VGEL 4PJXA 4YPGA 1D5IH 2Z91A 5I1AB 3VXRA 3E6HA 2JE8A 1NFDE 2HT3D 5KOVC 4FQXA 4JFFD 1FG2B 3QFJA 4PLKD 3MCG1 2HT4D 1HH9A 4IRJA 5L0QC 1OLZA 3QPQD 3UTZA 2NY0B 3V5KA 3BRDA 1NBZB 2E27L 3RI5F 3TM6A 5T3ZL 2ORBL 4S1RH 1PYWB 1KB5H 5E0QA 3EW3B 1T7YA 4KK9C 2P8PB 5B4MD 4KKLC 1JZ8A 3AM8C 3ZLQC 5MENB 5KG9B 1IGYA 3MREB 4MGXA 4U31A 3D9AH 4LSVH 5JPNA 4HWNA 3FFDB 3QBTB 1B0RB 4GAJH 2BOCB 3PWLB 3IJSB 3V8CA 1WC7B 3MV8D 4LLYB 5I9QC 1BBDL 2HT2C 4O2CB 5E4EC 3NACH 4UTAH 1JWSB 4N0FB 1I1AB 5IHUH 1CK0L 4R7DB 4I13B 3WLWC 5ECJE 4MJIE 2JJSC 1KG0A 5JLZB 4X6BB 1NCWL 1R24B 2OX5A 5E00B 1A7QH 3T2PA 4YGAB 5ELIA 5K9JL 5JUEL 5D2NA 3U6RB 4PJFB 2CD0A 3LEVH 1H3PL 2ZJSL 3QWRD 4UOW0 4ZXBB 3T0AA 3TCLB 1WBYB 2ADGA 4M7ZC 3OKYA 1QLRA 2BVQB 1WT5C 3U4EA 2NNAB 1GGBL 3QXVA 5ID0A 4PJFF 3NIGE 2IBZY 4ZO7A 3QPXH 3T0VA 5HSFA 2ATKB 4N8VB 2YD3A 1JUFA 2QQKH 3C6LB 4POZD 4JJ5A 1AHWC 1EA9C 3CUPA 4NKMB 2D03H 1JFQH 2NXYB 3P9MA 1T2JA 1X5FA 5T1KA 2BVUA 1RUQL 4ZO8A 4EBQL 4QWWD 1A7BA 1AD0B 1ZOXA 1NAKH 3ULVL 3CSYB 2WBJA 4Z7UA 2C1OB 1XF5B 2AJYH 3HZKA 3T65A 3DBXA 1ZT7B 1JF1A 2JCCE 3WFEL 4WEMB 4XMLL 1AQDA 2PYEE 4M61B 1ZT1A 4OZIB 1IGJA 3DTXA