2JELH

Jel42 fab/hpr complex
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
218
structure length
218
Chain Sequence
QVQLAQSGPELVRPGVSVKISCKGSGYTFTTYAMHWVKQSHAKSLEWIGLISTYSGYTNYNQKFKGKATMTVDKSSSTAYMELARLTSEDSAIYYCARVMGEQYFDVWGAGTTVIVSSAATTPPSVYPLAPGSGGQGNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLAADLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIAPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Complex (antibody/antigen)
molecule keywords JEL42 FAB FRAGMENT
publication title The 2.5 A resolution structure of the jel42 Fab fragment/HPr complex
pubmed doi rcsb
total genus 43
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 1998-02-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2jelH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2jelH02
3PV6B 1CDCA 4J6RH 1UXWA 4X4XB 4HQQH 5D5ME 5TQ2L 3QDGB 4ISVA 4HK3J 4MA3A 4MQ7A 4RAVB 4RAUA 5JW4M 1YEHL 5IVZB 5IHLB 5C0AD 4H0IA 3S6CA 2AKRA 2OI9C 5JMOC 4TPRH 2EIEA 1KB5L 1IFHL 2P7TB 1DVFD 4OB5H 4JQVC 4PYGA 5D1XD 4TTGA 4L5FH 1P7QA 1J1PL 1KYOJ 4DKFL 3MJGX 4XP4H 1A7BA 5C0GB 5INDA 4PTTA 2NXYD 4FQCL 3UJJH 4AT6B 1WGOA 1KG0A 5D1QB 2GCYB 2VDPH 3RY4A 2NY4D 4M5ZL 1CT8B 3JWOH 2VMFA 1SVZA 3MRDA 1SY6L 2EDFA 4NCC1 1BVLA 2A73B 4RGNE 5J13C 2UUDH 3U48A 4P2RE 1LNUB 1YC8A 5C0BE 5EO1A 2VR9A 5DK2A 4IOIB 4RNRB 5BJTB 2PCPA 4X99A 4PBWD 4LCWE 1UQSB 3S34L 3DTXA 5K9OA 5F1IA 5EUOF 4KKNA 5ALCH 3ZKXB 1PEWA 4L4TB 2J88H 4HWZA 1JUFB 2J4WH 3MNWA 4Z5RB 1DQQB 3T4AB 4MX7A 1IJ9A 4LEOB 1A1OA 1B9ZA 1T2XA 1KEGL 3ILQC 2FBJH 4HIHA 4Z7VB 3VXRE 1VEPA 3BPNC 4G5ZL 2R0KH 4YDKH 5E6IC 3FONA 2IPTH 4ELMA 5A2LH 2FB4L 1M71B 1IBGH 3NFPB 1RK1B 5BV7B 4MDJB 1WF5A 1GAFH 1LEGB 1ZT7B 1S78C 1PKQB 1I1YA 5F44A 3C9NA 1DLFH 3U4AA 4EJ1C 3K4AA 4XNZB 3OMZA 2CDEA 2A9MH 3RFZC 5HYSA 1IAIL 5I76A 4D8PB 1A6TA 5KW9L 4YBQC 3F5WB 4C83B 5ABDE 3BZFA 1J0JA 2IG2H 4ORGB 3LPGA 1UZ8A 3BP6B 4NKOA 2OL3L 4PJGB 1UC6A 2NXZC 4M7JH 1OM3L 1HHHA 2A6KA 2EIZA 4CDGC 3SOBH 1I3RB 2OP4H 3DVNA 4JN2A 1AI1H 3MCKA 5FYLE 2X4RA 4M3KB 1JZ5A 1MLBA 1TQCB 3F12A 1YMHB 1N4XH 2HA1A 5I73C 2AW2A 4OZFB 1IAKA 1WFOA 1G7HA 1A3LL 1N0LA 2MQ0A 4LCYA 1MCSA 3LKSB 5DUMH 1YEFL 2FJGA 2NYYC 2A77L 2OJZH 4X5WB 5F9AC 1FL6B 3B9DA 1G7IB 4ESKA 5L2JA 1S7RB 5CGYC 4K9EC 2X1XR 4ZD3H 5D96B 4NO2A 3TLRA 1QFOA 4JG0L 4KJQC 2YPKB 3VXUD 5T1LA 5AWNL 4DVBA 2ICES 2PYEB 5E9DD 1K8DB 1J8HA 4G8IA 3N0PB 5IKCB 5CJQL 3HTLX 4ZQKA 2X4QB 4WEMB 4OF5A 1Z3GL 2I60H 4JG1H 4KFZC 3ZO0A 1JCKA 5DFWH 1CGTA 2BC4A 4IRJA 5E5MB 1T80A 1WAAE 5GGVL 4FQIH 2BK8A 4TULH 4FG6C 2XN9B 4HUWA 3UC0H 4YPJA 5BMFH 1Y6KR 2W0KA 4PJ7F 3QAZB 4QRRE 2Q8AL 1LE5A 5BXFB 1KJ2H 1XIWD 1PZ5B 3K8MA 2LTQB 2H1PH 2V5YA 1CL7I 3PWUB 3JWDC 4X0KA 3TN0B 1EFXB 4N5EC 3KYOA 3MUZ1 2EDXA 4Y4HB 3BJ91 2NY5C 4W81A 2HKHH 1E27A 3CAFA 4NQTA 5E2WL 3IF1A 3FQTB 2EKSB 5GPRA 1WEJH 5EFIA 2P5WD 3QBTB 3TA3B 4PJCF 1Z5LB 1DL7H 3K80A 4XT1C 4KJPC 2F19L 5C0CA 5DZLA 3D2UB 1U3JA 1IL1A 4AENA 5IMKB 2EDHA 6FABH 4DN4H 2JJUA 1QR1A 2EXWC 2Y06L 4WI5A 1LE9B 1OL0A 3BD4A 1EXUA 4GMTL 3EYSL 2V5SA 2OR9H 3QQ4B 2BNQB 1R3JB 4YH6A 4YDIH 4X7SL 5F7UA 3NGBB 2HTKD 4O5LL 4M1GH 4O2FA 3PXHA 4CKVX 2HTLC 3O8XA 2VDOH 4PGEA 2VWEE 3C8KB 3CC5B 4R26H 2EE3A 5BZDB 1TPXB 5I74B 3T1FB 1EH9A 1MCWW 3HB3D 5DMKB 1QQDB 1TTGA 3I02A 2VKXA 3KDMA 5FK9A 2WZPD 5GGTH 2EEAA 2FLBT 1HH9B 3FO2B 5SWQA 4XHJC 4F7PA 3EYUH 4PJBF 3IDIB 3GBNH 3RVWD 1S7TA 4KI5F 1I8LC 4PJ9A 4LLUA 3TPKA 2MHAA 4AEIH 2RHEA 2ZP0T 4JPVL 5GISH 5TPWH 5TH2A 3B8YA 3LS5L 2V17L 4YO0B 1IM3B 1KPRB 1R5IA 4OGZA 3U7YL 4C56D 5CLWA 2QQNL 3LEYH 5DDHB 3EJYC 3TO4B 2D03H 4XI5C 1ERNA 4D9RD 2NY7L 1QBML 1FO0B 5ANMA 3TIEA 3DX7B 4JDZB 2HLAA 2VTFA 1UWEH 4GMSL 4HHAA 2ZPKH 3MLYL 3BKCH 5ITBH 5FKPB 5DS8A 1K4CB 3C5JB 4JFFD 3KXFB 5EH1A 1HHKA 2ARJA 5JHDE 5I1EL 2KPNA 2YN3A 4DZBB 2X4OB 4UU9B 1WIOA 3QDHA 4OAWA 3U2SA 4HG4K 4LBEA 1CXHA 4MA1B 4HKZB 1BGXH 3BEVB 3BQUC 5FYKH 3MUGB 1CF8H 2UVFA 5GGSA 2HVJA 3O9WA 4D0CA 4HIJA 1AR1C 5HDBE 5SWSD 5DA0B 1PDKA 1DSFL 3B9AA 4KQ4H 4XNUH 2X10A 5GGUA 3QHFH 4IOFC 2AS5M 5HVFB 4U1SB 5EO9A 1VGEH 1R24A 3HAEB 3RIFK 4GQ9H 2PTTB 4MAYA 5TJWK 3V5DA 1VACB 3D39A 2CKNA 4GRWE 1TVHA 3KPOA 3BI9X 1CQYA 3MRGA 2ZG3A 3QXAA 4MD4B 5AUMB 5FUOH 1BFVH 3D69A 1HQRA 3ZYJA 4NNYA 1XF1A 1T5WB 5IG7B 3K3QA 1T6WA 2NLJB 4GBXA 4XNQA 2YEZA 2ERJB 2JCCF 3PWVB 2P43B 3QA3B 3NFSH 5IT2H 2ZJSH 4X9IA 1FJ1B 5KSAD 5T1KB 1M05B 1AHWC 1XR9B 2ICWI 4NO0D 1K85A 1F4HA 4KI5C 5CWSA 3REWA 3MSPA 3A6OA 4LOUC 3IRZA 4NP4L 3OKMB 2DJ4A 3ARZA 4I2XB 3OF6D 2A6IB 3OL2A 1HZHL 5GZNC 1S7UB 1T0NA 2N56A 4XMPL 3K8LA 1H8NA 1EGJA 2VITB 1NUFA 1RIUH 3OTTA 5CEXA 4OV5B 4PREB 1WBXB 4U6HB 4Y2DA 5HVHB 3IFPA 5GGRY 4MDIB 4EVNB 3ARDB 3GDBA 5KANG 3WS3B 4R8WL 4FFYL 3WEXA 3MO1B 3NPSC 2P24B 3DYMA 5JW3H 3BRGC 2JIXA 5FV1L 4DEPB 2NY1C 3HZVB 2ZSVB 1A4JA 4R97B 2HT4D 1NEZB 3WFEL 4I3RH 5GQBA 1DUYA 4TQEL 4YNYA 1ONQB 2HG5B 4JO4H 5DUBB 3V7MA 2APXA 2AI0H 4NN6B 3T4YA 4HJ0D 2PW2B 4X6CF 1KELH 4JR9H 5TDOA 4M62L 5D2NE 4YFEA 2F54D 3GI8L 2XA8L 2AQ3A 4OLZH 5I75B 2F74A 2CLRA 4UDTB 2Z92B 3FHAA 1PG7H 2JB5H 1D5BB 1HOCB 2EDBA 2VLJE 3NIDF 3BHBB 3HG1A 3MLTA 3GSUA 4OM1H 1FYTB 4LQFL 4OZ4A 4WUUD 3OJDB 4HKXB 4PJ7E 3KR3H 3PABA 3QUXB 4B5EA 4APQB 4JFQB 5FHAH 2R2BB 1IAII 3K2UL 4Z0XA 3Q1SL 2D7OA 5JDSB 4P2RD 3MR9B 5C0BD 3ARVA 2C4XA 4HS8H 3VFVA 3SKUD 1LO3H 2Q8BL 3FRUA 5DJXA 3L9RA 2F53B 1H3TA 2VXUH 1F4WH 2W9DL 2YPVL 5GSVA 4DJMA 4G9DB 4C58B 4MD0A 5D7IB 5E08L 1I7RB 4PJCE 4XPTH 2CGRH 3ZT7A 2M1KA 1I1AC 3CVHA 3UDWC 3P9MB 5DVKA 3D9AL 3G9AB 4NCC2 1OGAB 4NWUH 3QPQD 1DP0A 4UT7H 4YX2L 1XGYH 3AXLA 2AK4E 1JPSL 3VXRD 1Q9OB 1INDH 4DAGH 3RTQD 3LH2L 5ILTL 3OG6B 4JHAH 4ZSOA 3IJHA 3STZB 2Y1VA 1XFPA 2KKQA 2W9EH 4WW1A 5D1ZB 1JP5A 5C6TL 5HHNA 1XGTA 3H9YA 4NC2B 4I5BB 5FM8A 1GOGA 1T0MA 3Q6FA 5K93A 1UYWL 2IANE 4NHCL 3F7VB 5C92A 3V0WH 1JRHH 4YXHL 4LP4A 2BVEA 2IADB 3RWIA 4PGDA 3OXRB 3TNNB 3EOAB 2FIKA 2P8LB 3MJ7B 1CGUA 2EICA 3ZSSA 3PDGA 3MNVB 2CMRL 4LVOB 1WV7T 2DQHH 2X70B 3IFOB 3DHMA 2X4SA 1NC2A 4OCSL 5FYLD 3ZKNC 4EI5A 5H2BA 4PGBA 1RU9L 1J0KA 3HNSL 5BRZA 5E6ZA 3A6CH 3QUYD 3KPLA 3MREB 4HJJH 2ADGA 5KJRL 3QH3A 1B0GB 1EMTL 3GRWH 4OCXH 4LDOB 3ZSTA 2DQTH 4P5KB 4XPFH 2E9IA 3WNKA 5E9DA 3FMGL 2FIRT 4TOYL 2YR3A 4LSTL 1RZ7H 3VDAA 3H7BA 1GGIL 1H5BC 3T65B 3CLEH 1T21A 1MCPH 3MLPA 1LDPH 1IC4L 1LGVA 4W6YB 3HPLB 4LAQL 3HE6D 4NJ9H 5FUCC 4NYLB 1ZSDA 3DYOA 1ZHBB 4JY5H 3GMQB 1KCSH 2G5BA 3W9DB 1NGXB 1XR8B 3MLXL 3B43A 4I3SH 1ZT4B 4JKLA 3WFCL 1PSKL 3VWJD 5E2UL 4LHUB 4B41A 4WFHD 1CL7H 4HV8A 3SDAB 5I8CA 5JXAH 4QWWC 3MV9B 4J3SA 4QRRD 1LEIA 3T77A 3PGCB 2BXYA 4Z7VF 3TVMD 4U31A 3WL9A 3FB6B 2B39A 2WUBH 4JHWH 4R4ND 1A9EA 2N7BA 1AGFB 2BDNL 2DM3A 5EPMA 3TIDA 2WM0A 2D9QB 3WFDH 3CZFB 4OCWH 4ODWA 5IFJB 1U36A 3R8QA 2OZ4A 1ES0B 5SWZD 5HHQB 2ENSA 3FB5B 3WLWC 3FQWB 2MQCA 1OARH 3FT4A 1RUML 2EC9T 5A40E 2W9LA 5E1HB 4PP1C 2YXMA 5CD3B 3LPWA 3L1OH 4X7TA 4DK6A 1Q1JL 2GSGA 2E7MA 3QDJB 1WIUA 3IXAB 1EGJL 2H32H 3I75A 4NZRL 4F9PC 5E5UB 5F7HA 4P59L 3D85B 2CD0A 4HXBH 4N0CC 1G9NC 5IWLA 5HYQB 5B3NA 1J5OL 1V3LA 5CZVL 4IDJH 1X5GA 5ADOL 1HYSD 3MGAA 5FGBA 1WICA 5FO8B 3RWCA 1G0DA 1S78D 1MFNA 3WXVH 3LQAH 2H9GB 5GJSL 5I8EB 1E4WL 2A9NL 4M1DH 3RNKB 3AS1A 3GSNH 5D1QC 3EDKA 3VFPB 2PXYB 4Y89A 2Y5TB 1TZHB 1S5IL 3QUKB 3DRTB 2KDGA 5EU5A 1D6EA 1C7SA 3L3OB 4KPHH 3I6GB 4DW2H 3DUUB 1P4BL 4O9HL 4BH8B 2Y7QB 4X6CE 3VXTB 2C9AA 5EOCH 3CLFL 3Q5YA 3HA0A 3ZKXC 4X6BA 1BM3L 1I7ZB 4HXAL 3ARED 1X5LA 4CMHB 4F58L 2X5PA 1QD0A 2IMNA 3NIDE 3V0AC 1N6VA 5DJZB 2R8SH 1BJ8A 4S1RL 2A1WL 4IIQA 2VXTH 2E7BA 3DMMC 3GI9L 4WIQA 2BFVL 3EAKA 4BFBD 2A83B 4HX1B 2IH1B 1TQBB 5EU6E 1T2QH 3SKJH 1I8IA 5FXCH 1A3RL 3EDDA 5DJ8A 1C5DA 3ZDZF 1A1NB 3RJQB 3FFCE 2FX9L 5IROC 2DJSA 1KACB 4KJQD 1UJ3B 3ARQA 2HVKA 1Z9MA 3LV3A 3CVHL 1CVRA 1KIPB 4F33A 5JHDD 4MNGB 1EA9C 5CEZD 1CFTA 4PY8J 5I1LA 4KHXH 3QHTC 3I6KA 3C5SB 3EJZC 1OPGH 1Z9OA 2X9XA 4QHUA 5HJ3A 3OGCB 2C1OB 1ORQA 3FCTA 2E3VA 3G6JB 1I9JH 5C09D 4YHML 2VYRE 2QHLA 5EBLB 5ENWB 3VGDA 2BSTB 1HHGA 2AAVA 3KJ4B 4ZOEA 4V1DE 3STLB 5TDNB 4P48A 5E8OA 2D0FA 5INCA 1MRCH 5DSCB 3RQ3A 1GC1C 1S9VB 1KB5H 4O02L 1G9EA 4QOKA 3HRZB 1TCRA 1UB5A 2HFTA 4JFDD 2A2QT 5B38A 3F7PC 1J1PH 1S7QB 4OM0L 4DKFH 3B5TA 3UTTD 5CLTA 2VB5A 4G6AC 4YE4L 5KSAA 3MROA 3QR2A 1M6OB 2AJZB 1SMOA 2J8UA 3CXHJ 3IU3A 5BS0E 3MRLB 1EUTA 1VFBA 4M5ZH 1NFDA 1Y18B 1D7FA 1ZLUK 4D0DB 4KJPD 1CLOL 4FQHB 5D96C 3S36H 5IJKA 3JZ7A 3L3GA 1G6RA 4LVHB 3RWGB 4G9FD 5ACZB 4PTUA 4P4RB 5J1AA 2YPLD 1JPFA 5JA8B 1JHTB 5CKGA 4ZNEE 1YYMH 2E9BA 5FAAA 1I7TB 5F9JB 2AJSL 1KJMB 4YHIA 4Q6IB 3SBWC 4CVZA 4FS0A 3PIQA 3IJSA 5D5MA 5DURD 3H9HA 4EDXA 1BWWA 4HG4J 3QUZB 3BSZH 1OTUC 3LRSA 1A2YA 5DJDB 1KEGH 2IBGA 5FF6A 4MA8H 2EYSA 2LU7A 4HIEA 1M7DA 3MLZL 4KK5C 1ZVSA 2FB4H 3IRPX 3ZE2E 1RY7B 4OKVB 1UWGL 2VZ3A 1U8NB 2QR0A 4W4OA 4ZOAA 3ELAT 3OKEB 1T6VN 4F3FB 3VD4A 1YN6A 3GMRB 4LHUG 4Y4HC 4QHLA 5GHWL 2DWDB 1QYGL 1CWVA 1MSPA 2XTJB 5DFVC 4KUZL 4U3CA 5C2BL 5C1MB 4X8JB 1X7QA 3TA3C 3SKOA 2HH0L 1AP2A 1U3HB 2XKNA 4NWTL 4JFOA 5KW9H 1AKJB 1JGEA 2VLJD 1FVCB 3EYQD 4P2RA 2BCKB 5KZCB 2O5YL 1HI6B 1T1YB 5DK3A 4LCWA 4RAHA 5C0EB 2DD8L 3MTRA 1T4KA 5IBLC 4Z7VE 2GAZA 2ICWB 3EJYD 4RFEA 1H8OA 4HKJB 4ZXBD 4RDQG 2OZ4L 4I8DA 2P5EE 3IXTA 4CMMB 4U7MA 5KS9E 3PNWB 1L9NA 5DRXA 2W65B 1KLUB 3NGBC 2NNAA 2ZUQB 4TVPE 2GJ6B 3P30L 4JRYE 4KK6C 4R4BB 3UYRL 4PIRF 2X4TA 4E9LA 5D2LB 1D5XB 4KMLB 3QULB 1IGCL 1TPXC 1YEFH 1KENL 2A77H 1E0OB 5DI8A 5I18L 1U8PA 4Y19E 2AK4D 1P1ZA 3WE6A 5C07E 2EYTB 5DRWA 4JG0H 1OB1A 3NH7L 4LKXB 1QHPA 5AWNH 5D7JB 4R0LC 1KGCD 4MB3A 3L5HA 2SEBA 1YQVH 4JFPA 1NFKA 2NPLX 4U1JA 2ZOLB 3OWEA 4XVTH 5HI4D 4G42B 1VKXA 5F7FA 1EAPB 4XRCA 4I0KA 1GYAA 3BUYA 2ADFH 4JO2L 2IAND 2VDMH 4NBYB 3KLHC 4XXDA 3VGBA 2BVQA 2UY6A 5C08B 2B4CL 3VXNB 1BBDL 1N6QL 1S7WB 3OKYA 4N0YL 3DX8A 3B5HA 2FO4A 1MAML 1QSEA 2D0HA 4X5LA 1SYVA 4X7EC 5T3XL 2Q8AH 2H2SC 3OJMB 5GS0C 3MLRH 3PGDB 3O81A 1I75A 2X89D 2V7NA 1FFNB 5EULV 5BO1L 2FDBP 3DUSA 3UMTA 1JIBA 3BRFA 2C3VA 2OL3B 3U0TB 2R0ZL 2NY2B 4Y8AA 1AGBA 3HZYB 4NKMA 1LVEA 3SDYL 1XEDA 1MH5B 3CCHA 5DZNA 1IGYA 2ATKA 3I2CH 4XBGA 1WVZA 4D9QE 1DTUA 4JPIB 2GY5A 2F19H 1YN7A 4CNIA 1HQ4A 3C2AH 5HHPA 4UB0L 1K4DA 5GRVK 4F2MB 1NAMA 3W39B 4U2ZA 5J6HB 1HKLL 1F11A 5I1AB 5IJVA 5GGQL 2Y06H 3H0TB 3GJFH 4JQVA 4GMTH 4LLWA 3O6FB 1F3RB 1SYSA 4ODSL 4GKNA 4RRPG 3WIFB 2HFGH 4AH2A 5HGBA 2IBBA 2KZWA 5I17B 2CIIB 3QDME 4ZG1A 3TYFB 3B83A 4O5LH 5F88A 4Q6YA 5M94B 5GGRA 3F6IA 5DVLA 2QHRL 2GSIB 3C60C 3TVMA 3QUMB 2E5EA 5L7XL 5HGAA 4BSWA 2MOVA 5I2IA 4NQCD 1CFNB 4P2QB 5DUPL 3LY6A 4MCZA 3SE9H 3ECBB 1AGEB 3DECA 4PJEF 4R6UA 3PQYE 5MEPA 2O5ZL 4PRAA 1R6VA 3BEWA 5KTEL 1J05A 3UO1L 1ZLVH 4GAGL 4ZO7A 3MXVH 3CDGB 2R2EB 3L5XL 3RWEA 3TGXA 4PLKC 2BNQE 2AEWA 3X3GL 4PG9B 4JPVH 3RL1B 4BZYA 5HVHC 4XGZA 3MBXL 1M7XA 3ARDC 4TSCH 2XKSA 4WY7L 1G1CA 4Q2ZB 3LS5H 1TIUA 3KLDA 2VQ1B 1G6RL 1KBGH 3DLQR 3U7YH 1KC5L 3KPNA 4DEPC 4MD5A 2G75B 2BOBA 4Y16B 5FO9A 1YEIH 1RURH 4R97C 4UQ2A 4GW4A 3SQOH 2EC9U 3QP3A 2NY7H 1ZHLB 4XCYB 4NFCA 1AQDA 3NABH 4MJ4A 4NGHH 4UIKL 4IRZH 5JQ6L 3MLYH 4D2NA 4Z7UF 5FA3B 1QFUL 4GH7B 5I1EH 5EZIH 2KZ1B 1IGJB 5I75C 5C0JA 3S4SB 3LQMA 1TMCB 1D5MA 5BW7C 2IQ9H 3H42L 1KF9B 3OJVC 1NCCL 2XY1A 1TNNA 4JANA 4JE4B 1BJMA 2NY3B 3UTSE 2MJWA 3QUXC 4ISVB 2HT2C 4APQC 3B9KD 2AV1B 4MA3B 1IC5H 4MQ7B 4RAUB 3JWNC 3MV7D 2Y25A 4N0FB 1DSFH 4H26B 5CP7B 4BFEA 5BCAA 3DVFA 5KN5B 2AQ2A 1IEBA 5GRYA 4X4MA 3CFKB 4LSUL 5IB5A 3Q0HA 4KRMB 1UENA 4CN6A 4XP6L 5E8PA 3QNYB 5F7DA 4TNWK 2X4PA 4PTTB 4PD4K 5FKAA 1BQHG 4L9LC 1JV5A 4G8GE 3RKPA 1MRFL 3G5ZB 4A2LA 1KG0B 4XXCC 1REIA 3MRIA 4GT7A 2GEEA 1VFMA 4QT5A 2VERN 3P73B 4BUHA 4A6YL 4S0SD 5CHNA 5EU6D 1RHFA 1X3DA 1BVLB 2GJZB 5EUOA 5CCKL 2IEPA 3WJJC 5JHDA 3IT8D 3T8XA 4ZTPH 5LGKA 1UACL 5ICZA 2H8PB 2B7DT 3L95B 3DTXB 4L1HA 3FFCD 4XP9L 1CXFA 2HKFH 2X4NA 5LGJB 4YGVA 1MWAB 2I27N 5L2KD 1PKOA 2E7CA 2WWMC 2OSLA 4MX7B 1KJ3H 2IMMA 3D0LA 4FFYH 4V2BA 4LQ1A 4PRNA 1RZKC 4PLJC 4ODXA 4XNXL 4OFYD 4RDQF 3V6ZA 4LLMA 3CFEA 4UV4L 4HIHB 1JF1A 4AK1A 1I1CA 1CD8A 4HZLB 1MCWM 2ZCLL 2IJ0C 3FONB 4HSQA 3WFEH 4ELMB 4TQEH 5DC4B 1QP1A 4HFUH 4K3HA 2DLHA 4V1DD 4RQQA 4LVOC 4QHMA 1JE6A 2NX5B 5M95B 2JELL 1KTLA 3TF7C 2RIKA 4M62H 1NGPL 4HUUA 5EWIH 2DIBA 3GI8H 4QY8A 3NZ8A 3LPFA 2K3TA 3TJEL 3FTGA 5HI3C 2WBKA 2WNGA 3ZDYF 4KKAC 5I76B 4MJID 1A6TB 4U3XA 1SM3L 3DETC 4QXTA 3P77B 4QHKJ 1HNGA 3ARFB 3H9SA 4GG6F 3PV7A 4RA3A 5IF0B 5BS0D 5JTWA 2RCSH 3QZWB 3HPJA 4KRLB 4JFEB 4PRDB 3K2UH 4OZIB 3C5ZB 2LE9A 4YZFE 1HHHB 2A6KB 3MA9L 4XBPB 3ARSA 5IB2A 4CRPA 2Q6WA 2JJTC 5A3IC 4RBPH 3PHQB 4P2OD 3DVNB 4JN2B 5DK0B 3MCKB 1FRGH 3WFBL 1QUNA 4K3EL 2X4RB 1MLBB 2Z8SA 4DFHA 3F12B 4S2SB 2YPVH 3OAYK 3W81A 4XWGL 1A1MA 4N0CD 4HBCL 3QXVA 1IAKB 3BJLA 1G7HB 3MOAL 4KZEH 1UA6H 4LCYB 1NAML 3THML 2JB6A 2VC2L 3LOWA 4NQDB 2P45B 4PJ8B 5L2JB 1FYTE 1JPSH 4AEHH 1V7ML 5HXMA 4JO3H 3LH2H 2R9HD 4G8FA 5D2NA 3C6LD 3LQZA 2AV7A 1H8SA 4WHDA 4OLUH 4EXPX 3UJIL 5T1LB 5C0ND 3AM8C 5I8OL 1F58L 2P1YA 1YC7A 4RSVA 1A6AB 3NBNA 2VLJA 3O3BB 4ZQKB 5JNYA 1RMFH 1NCBL 4ZYKA 2DQEH 5CP3A 4H1LA 4PJ7A 1J12A 4P5TC 1W8OA 3O41A 1UYWH 1QEWA 4NHCH 1A6VL 4IRJB 4I18B 3EW3B 4HUWB 3OXSA 4YXHH 3RX5A 1VERA 3P0YH 3UBXB 1B6DA 3C8DA 4PJEE 1LE5B 3KAAA 1LDSA 3G6JF 4QRTA 4HAFA 1RFDL 4X0KB 5J57B 2CMRH 1JNLL 3R1GH 1INQB 4U49A 1UM6L 4FNLL 4PJCA 3G6DL 4JVPA 4J7RA 2P5ED 2EDJA 5B39G 2CO6B 2R2HA 3L3HB 4DQOL 3OZ9H 3HNSH 3KYKL 3MGTB 5EFIB 3I84A 5KJRH 4TVPD 4K3GA 2Q87A 3BQUA 3VXOA 1EVUA 4JRYD 4OUOA 1FZJA 3QI9B 1KJVA 1QNZL 3ULVD 1Q72L 2MWCA 4Y4KD 3GSXA 3EHBC 3IGAA 3MRRA 2PXYC 3FMGH 3HUJB 5C0CB 1UCBH 5LQBL 1HINH 3CMGA 4Y19D 4AENB 1GGIH 1KXQE 3QEQD 3CH1B 5C07D 4YJZL 1IGFL 1UFUA 2NQCA 4C59B 2AJ3A 1MIMH 3DGGA 1P6FA 3FQRB 4Z7UE 1EXUB 1T1ZB 2VDQH 4LAQH 2IANA 3HR5B 1CGVA 4K71B 4PJXB 4IHOA 3MLXH 1X5XA 3MODH 4O2FB 3O8XB 4PGEB 3MA7A 3OJ2C 5T1DH 4ZUTB 3AUVA 4ZO6A 4J4PC 3L3KA 5E2UH 2X89A 3MUJA 4PJBA 1WC7B 3QFJE 4JB9L 1AHWA 1TQBC 3B2UD 3QEUB 3I02B 1N7MH 4WCYH 1QRKA 2QV2A 3BE1H 5MENA 5SWQB 3QXTA 4KHTL 3VXQA 4XVSL 2BDNH 1UJ3C 2YZ1A 4NT6A 1IM9D 3KGRA 4LLUB 3GMPA 4HH8A 4K9EL 4KAQH 2MHAB 3CU1A 4M8QB 4CU8A 1WBYA 3H2WA 3PL6D 3EJJX 3RUGB 5JPMA 4JM2B 1TXKA 4LCCC 1RUMH 4FQJL 4UILL 3FOLA 3OAZH 2Z8VC 4D9QD 3BO8B 3LMJH 3K46A 4BSVA 3KJ4C 5ANMB 3TIEB 4YR6B 5F1NA 4NZRH 3GIVA 4P9ML 2C7UA 1OAXH 1D5ZB 3BZEA 4JPWL 4P59H 2ARJB 1TNMA 1F6AA 4Q97A 1QR4A 2VIRA 3G6AB 4M1CC 3SN6N 5ADOH 2JTDA 4TNVF 3S5LG 5J12B 4PB9L 4O58H 1H3PL 2XG4A 1P69B 2BVYA 3JWDL 4DWHA 1ODAA 5DQ9B 3MV8B 1E4WH 2A9NH 3U2SB 5DFVD 1PJ9A 3PDOB 4L4VE 1RIVH 2NY5L 5D9SA 1N2RB 1VGKB 4WHYH 5GGSB 5D2LF 4HIJB 1S5IH 3ET9F 3NA4A 2V7HA 1ZGLA 1QFPA 1RIHL 1BJ1H 1NKOA 3PQYD 2Q76A 4LVHC 5LGHL 4YDJA 5EOQL 4XPBL 3CLFH 4OGAC 4MAYB 3SGJC 4Y5XB 1BD2E 1D3CA 3D39B 1NBVH 1BM3H 1OSZA 1MCBA 2JCCA 3KPOB 1UM4L 3UAJC 1I1AA 3UDWA 3ZDYE 2ZCHH 3SGDI 3D69B 2A74B 4E41B 3ARPA 1HQRB 4NNYB 4S1RH 4GG6E 2V2XB 3GI9H 2BFVH 3OPZL 2XWBA 2KL6A 3VWKD 3IJYA 4U1LB 4JY4B 3ZE0F 5IFHL 4GQPH 4N0UB 5I16A 5F7LB 3RDTD 1NC4D 1A3RH 1NLBL 3CFCH 3HZMB 4EDWL 5CWSB 3REWB 5J6GB 4LIQH 5BVJA 1A8JH 4P99A 1PYWB 1FFRA 1U8IB 1PVHA 3KYNB 1T0NB 3CVHH 5HI5C 1W72A 2XTJC 1MCOL 5C9KA 3IFPB 1NGWB 1QBBA 3H8NA 2D31A 1P6AB 2MTPA 5IEHA 5C0AB 1IAMA 4OF6A 4YHMH 5IR1B 1T66D 4ENEC 1FZOA 1SBSH 4RGOL 1A4JB 1C5BH 1DVFB 4IRSD 4N8CL 2Y36L 4TVSa 2HP4A 4NUJA 3VU2A 1YEJL 2FWOA 5D1XB 2P47B 4YNYB 4Z7WB 1UM5L 2NW3A 4CGTA 1ZA3B 2NXYB 1V5JA 5TDOB 3IDMB 1WFTA 5CJ8A 4WHCA 1A64A 2NY4B 2OQJA 1IARB 3AU1A 5IM7B 1V7NL 3UBXG 1EBPA 4GW5A 4U1KA 2ZUQC 4PRHA 2B8OT 4ZFGH 5EU6A 1U42A 4YE4H 4TNWF 5TE4H 1SHMA 3MLTB 1KXVC 4G8GD 4OZ4B 2HLFD 1R3IL 4M4PA 2EDQA 3PABB 3G6JE 2A6DA 4JY6B 1CLOH 4KROB 1YEKL 3MV11 1HEZA 2QTEA 1YNKH 4MQTB 4YIQA 2EXYC 4JKWA 3FRUB 1E6OH 3L9RB 1FH5L 2AJSH 5GSVB 4I48A 4RMQA 4L3CB 3IETA 5EIIB 1JF6A 2B1HH 1DN2A 3MLWL 1J88A 3ARRA 5IP4A 4QGTA 3SCMC 5DD3L 3CVHB 4HKBA 4V1DA 5E56A 2XXMB 5K9QI 3A67H 4JFZL 1GGCH 4JRXA 4CU7A 5E5RB 3VGEA 3VMOA 3C60D 1HSBB 1HHIA 2HJLB 3S9DB 3MLZH 3FO1A 1I7UA 4YDLB 4HZAA 1WWWX 3MRMA 5F89B 1A02N 1KT2B 1OT2A 3ME0A 5I1HL 1UWGH 3TP4A 3HR6A 5HHNB 4PJDE 4AIZA 3P11L 5GHWH 4TRPH 2NY2C 2F5BL 2FZ3B 3N1QC 2WP3O 1T0MB 4QNPF 3B9EA 3VFSA 5C2BH 2BHYA 2CKBB 4TSBL 2VZSA 4HPYH 4GAJH 2HH0H 1AFVH 3PV6A 2DAVA 3G5YB 1DANT 4X4XA 1KPVA 4XTRD 4XNYL 4P4KC 2O5YH 3EFDH 1FIGH 1G0YR 1ZKAA 4PGDB 4F9PA 4ZNEA 1ZEAH 2GKIA 5D70H 4U7SA 5JOFA 2WANA 3HMXA 2P7TA 2DM7A 2IC2A 2OZ4H 3S7GA 2X4SB 2HRPL 1NC2B 4PGBB 3F58L 3NFNB 5MP6L 3S3PA 2APTA 3KPLB 2X9YA 3T2NL 5E2JA 3KLAA 5D1QA 3UYRH 2GCYA 3GHBL 2XTJE 3JVGC 4DGIL 1IGIH 1JYNA 4KTEL 3WCYA 4YHOL 3VXUB 1IGCH 5E9DB 2CDFB 1KENH 2A73A 3EO1A 1YNTB 1LNUA 4IOSD 5I18H 2Z31D 3UROR 4IOIA 1U8QB 1I8KA 3DYPA 3H7BB 3DXAD 1T21B 1UEMA 1R5WB 3NH7H 5KSBF 3HRPA 1OLLA 4L4TA 4CVUA 3GO1L 1QG3A 3ZTNL 3T4AA 3VE0A 1ZSDB 5EBWA 4BK4A 5EDXA 2J12B 1P9MC 1QLEH 4L3EE 3SQBA 5FGCB 1XIWB 3BIKB 1A7NH 3DMMA 3DNKA 2B1AL 1V3JA 5CD5D 2HT3D 2B4CH 4Z7VA 2EH8L 4HV8B 5I8CB 1N6QH 4OD2A 4Y16C 1DUZA 1QBLL 3JTTA 4MVBC 5T3XH 3T08A 3WJLC 1LEIB 1A7RH 3O0RH 2VLRD 1RK1A 3GBLA 3C8HA 4MDJA 5IROA 3WO4B 3WL9B 3NACH 1LEGA 4HGWB 3DURB 2FCBA 5BO1H 2EDEA 1V3MA 3NCJH 4JRYA 5EPMB 4ZOCA 4HUVB 4PJAB 2R0ZH 2DQUL 5EOTB 3RZCD 3SDYH 1MQKL 3HFML 4IDLA 3VGHA 4NKQB 4NUGH 1YECL 2DI8A 4OLEA 4ORGA 1D9KC 5D7KE 1MFCL 5C07A 3BP6A 1EO5A 1JNJA 4LSSL 3MRPB 3ALXA 3WKMH 1R0AL 1I3RA 4X7TB 2AXFA 3IFNH 2WQ8A 1U8JA 5DF0A 1HKLH 1FSKC 1W72L 4HIIA 2MCPL 1W0VA 3I75B 1EJ6A 4X6DB 5GGQH 1AQKL 4OZIF 2DQGH 4JM4L 5DMIL 2CJUL 3VGFA 1JZ8A 1S9WA 4ODSH 5MHSE 4PRID 1A47A 3ZYZA 4K7FB 4XP1H 3W9EB 1TJGH 2EYRA 4PLOB 3LKSA 1DFBH 1QVOA 1UWXH 2QHRH 2VXQL 1S7RA 1JMXA 1ND0B 2DS4A 5DUPH 5DVOA 4XZUB 4NQUA 1IM9A 1CDBA 3QIWD 1BAFH 1D6EB 2PYEA 4WV1B 5EO0B 1K8DA 1KIRB 2XWTB 5IKCA 1ZV5A 2EECA 3MRNA 4NQXA 4XC1L 3ESVF 5B22A 4HC1A 3SBWA 3QISA 3L5XH 3VW3L 5E5MA 3X3GH 5HYJE 3OKDA 2CUMA 2XN9A 3MBXH 4FA8A 3RU8L 5J89A 4LNRB 5BXFA 1KC5H 1F02I 1PZ5A 4F9LC 5E7FA 3GJEA 3PWUA 3TC9A 4JFFB 3SDXB 4UTBH 3LS4L 3WIHA 3LRHA 12E8L 4EUPH 4UIKH 4Y4HA 3H3PL 5DJ8B 4DFIA 5JQ6H 3QDMA 1FL5B 2XZCL 5DQDH 3OKOB 4H20L 4M48L 5DRNB 2EKSA 4JO1L 2BP3A 3BAEL 5DEFB 3TA3A 1Z5LA 1A6PA 1CFTB 2CR3A 4POZD 2IALB 5IHUL 3PWJA 4K3DL 3MQIA 3H42H 1QFWH 1YEDB 3D6GA 1JHLH 4ODTH 1NCCH 3PQYA 4P5TD 4AY0A 3FCTB 4L4VD 3ULSA 3D2UA 3ARFC 4Q58C 2BVTA 2I25N 1FAIL 4X9FA 4ONGH 4JVWA 2VLKD 1C08B 1HHGB 2YOCA 3T3PE 1LE9A 3C5ZC 4EQ3A 2X44D 2XY2A 5F93C 3HUJF 1OTTC 4IJ3B 2BNQA 5KSVB 4FFWC 3V8CA 3FZUD 4LKCA 2RJMA 3T0ED 2LU4A 3SGDH 2FR4A 4LSUH 1TCRB 4XP6H 3FO9A 3MOQA 1IQDA 1BD2D 4QNPE 3MZTA 3PGFL 4O4YL 3C8KA 4KKLC 1FG9C 4PJXF 3MROB 5KSAB 3SDCD 2DYPD 1GJIA 4NO0B 4NO3B 1MRFH 3IU3B 4MAUH 1F6FB 4WI7A 1JZ3A 5DMKA 3HMXL 1OP3K 3SGEI 2NY0D 5KVDL 4PJ8C 1HH9A 3EHBD 3FO2A 5IVXF 4H0HB 3VH8G 4U7KA 1G6RB 4R0LA 4YUEL 5F9OH 1T1XB 1UACH 1SJEA 4PTUB 1F8TL 5J1AB 1OAKH 1JPFB 4XP9H 5DD6A 2L4OA 3WN5B 1RULL 4MNQD 4KJYA 4A2MA 3T04D 3RZWA 3HMWL 4CVZB 3PIQB 3IJSB 5D5MB 5HGDB 1WCBB 3UTSA 1IM3A 3RPIB 1KPRA 4IRJC 3GM0A 3LCYA 1MHPL 2OX5A 4I18C 5ID0A 2IPUG 5EORL 1H3GA 3M8OH 3STBA 4QO1A 1BF2A 2EYSB 1TJIL 3EDFA 3RUGF 5IMMB 1FO0A 4HIEB 2ZCLH 4JM2F 4JDZA 1PG7W 2AJYL 1X5FA 3TH3T 1FFPB 5F6HI 5FKPA 1XCTA 2DQDL 5KSBE 1O7VA 4X4ZA 1MF2L 3VGGA 1V05A 1BOYA 4GXVL 1YN6B 3AGVA 4ZAKC 4QHLB 4YC2B 1NGPH 3PHOB 4KH2A 4DZBA 3IAQA 1MJ7H 2X4OA 3BZDA 4UU9A 4U6TA 3TJEH 3C09B 3HC4H 4HKZA 4ODVH 1X7QB 1P7HL 3SKOB 3MRQB 4GUPB 1GSMA 1AP2B 4RGNB 1B90A 2NCMA 1SM3H 3QI9C 4P2RB 3V52H 5C0BB 3UJTL 2EE2A 5DMGD 3FB8A 4IS6B 2VL4A 2ZNWA 4TVPL 4WFFD 1XGQB 2ZNXA 3FO0L 1T4KB 4U1SA 3RGVD 2GAZB 2RQ8A 3HAEA 3MA9H 4RFEB 1D6VL 5KVGL 5GS3A 4UOJA 4IMKA 1SJVA 4XH2A 2PTTA 4A6YB 2XZAH 5B3JF 1VACA 3X13A 3CPLB 3WFBH 4K3EH 5L9DL 3U9UB 1NCWL 5F7KC 4ZUWA 4M8VA 4MD4A 5AUMA 4DUWA 5CINL 4XWGH 1GIGL 1CD0A 3C60A 4HBCH 4YXKL 3VXRB 5IG7A 3MOAH 3RTQB 1AGDA 2GHWB 3MXWL 4AIXA 2X4TB 4B0MM 2HJKA 3PWVA 1H3WM 1GC1L 4UAOC 1NAMH 5DA4A 1RPQA 5LBSL 3THMH 4ZUSA 2VC2H 5DJ6A 3P9LB 1FJ1A 3GM8A 3QIBC 5DI8B 1EFQA 4J8RA 4K2UL 1P1ZB 2AGJL 3WE6B 3OKLB 5DRWB 2A6IA 1OB1B 3UJIH 4OZIE 4BQBA 4HEPG 1F58H 5I8OH 3IDYC 3BP5B 2SEBB 2VITA 3IDJB 4U1JB 4U6HA 4OV5A 4MDIA 4EVNA 3DROB 1N6UA 1NCBH 2X4UA 3WS3A 1VKXB 4Y4FD 4NHUA 3MO1A 1JGDB 2P24A 2Y9RT 3HC0A 3ISWA 1M1SA 2XRAL 3U4EB 43C9A 3HZVA 3FN3A 4P3CL 4ZFFB 4JM2C 4M7LT 3K4DA 3LZFL 2Y5EA 1NEZA 2QQQA 4JLRA 4LEXL 1ONQA 2HG5A 1DANU 4HC1L 2XQYK 4NQDE 3UTPE 1RFDH 2EDKA 2PW2A 2MQ3A 1JNLH 3QUYB 3QPXH 1I1RA 1UM6H 4Z7WF 3LEXB 2RAMA 3G6DH 4RX4A 1MIEH 1H15B 2Z92A 4OQTA 5BW7A 5DYOA 4NKMB 1D5BA 2IAMD 1HOCA 3KYKH 4JN1L 5J12C 2YBRB 3CCHB 1FYTA 3B3IB 2Z31A 1IGYB 2BJML 2ATKB 3OJDA 1P7KA 3WIHL 4XBGB 4AZ8A 3QUXA 4QRPE 4APQA 4JDVB 2EDOA 2WBJD 32C2B 1IT9L 1GGTA 3HE6B 2AJUL 5HHXL 4MJ5B 5GRUL 5JDSA 2N4IA 2EIDA 5LQBH 5HHPB 2OI9B 4ENED 4DGVL 5F96L 4LL9A 2F53A 4LLWB 4L8CA 2V2WB 3VWJB 3WSQL 5D7IA 4Y5XC 5C0FA 1DQLH 1I7RA 3VG0H 5IFAL 3KJ6L 1YDPB 4E0RB 4L9LA 3GK8H 4L3ED 4Z7NF 5T1MA 4JPKL 5F88B 4QRRB 1T0PB 3P9MA 4XXCA 4PJEA 2PR4H 4NC0B 1MY5A 4EKXA 5CUSL 3TVMB 4HUXB 4BSWB 5EUKA 1Q9OA 1BZQK 1SJXA 4MCZB 1Q94A 3WJJA 2HMIC 4G7VH 5ESQA 1YEEL 5MEPB 4YDVA 3HUJE 35C8L 1RV6X 3RZCA 4I5BA 2YKLL 1J05B 4KHTH 4I3GA 4MXQD 1FZMB 2ATPA 3DO3A 1X5YA 1QSFE 4WFEE 4K9EH 5TQ0L 3KNBA 3NN8B 5DJ2B 1OT1A 3EOYG 4WI6A 4XGZB 4YFDB 1T04B 15C8L 3FN0H 4LK4A 5A16B 5D7KD 1LO4L 3BPNB 2IADA 4FQJH 3MLSL 3OXRA 4MD5B 2BOBB 1R3HB 2P8LA 2YUXA 5FO9B 3SCMD 4Z7UA 1DVFC 4UBDC 5IVXE 1KB9K 1KCVH 1AQDB 2X70A 5D1XC 3IFOA 5CJXC 1FE8L 4PS4H 3K2MC 4P9MH 4RFOL 2NXYC 1UCTA 4JPWH 4M6OL 3JSSA 3OB0K 2WWKT 2YK1H 3SO5A 5MHSD 3CVIH 3MREA 2NY4C 5C6WH 3B2VH 2AABL 3QFJA 1FO0L 1H3PH 1D5MB 3PE9A 3JWDH 2ENYA 4P5KA 2AEPL 5DQJB 3RJDA 3WUWG 1WWCA 1B0WA 1NUNB 2QKIB 4I0PD 2Z91B 2NY5H 1D5IL 4YAQB 1CGXA 4YBLB 4U33A 4R3SA 4F37F 3T65A 1NDMA 4ZNCD 1XMWA 2JJTA 3BUTA 3OHXA 4P4KD 1RIHH 2W07A 3EYOB 3HPLA 3AREB 3WXWL 5LVEA 25C8L 1NL0H 5LGHH 3VXSE 4YHKL 1II4E 1ZHBA 1ZMYA 5IB5B 3DO7B 3W9DA 2GFBA 1WZLA 1NGXA 1XR8A 2I9LA 1S3KH 4QYOB 5E8PB 5F7DB 2BOCB 2X4PB 2NZ9D 4LLYB 5FYJE 4LHUA 2JE8A 5HYJD 1JV5B 3U7AA 1E6JL 5FECA 4PP2B 3OPZH 5DC9B 5CHNB 2BY0A 3SJVD 3AM8A 3FB6A 2BNRE 1NLBH 3CDFA 1HE7A 3INUL 5T5FH 5JHDB 4EDWH 3EFFB 3VD5A 4YDLC 1WSST 2CR6A 5ICZB 3U0PA 2Y4SA 4QTIH 1MCEA 3V2AR 3S8WA 3CZFA 1FGVH 2DQCL 5I9QC 4WEBL 4DKEL 4P5TA 4YGVB 1ES0A 5C09B 3IKKA 3L7EB 1OLZA 2FEDD 3FB5A 5HHQA 2OM5A 3FQWA 4PJAF 2JK5B 3ZT6A 3HS0B 4PRNB 3RI5K 2R0LH 1MFDL 5CD3A 3V6ZB 2UVEA 1XGUB 3X11A 3SPVA 1CDJA 5CBAB 3QDJA 4RGOH 4N8CH 3IXAA 2Y36H 5J11C 1YEJH 1MVFA 2CRIA 4JFDB 4JZJB 4BFIA 1UM5H 4GRWB 4U1IB 2IH3A 4QHMB 5CP3H 4H1LH 3UTTB 1CXIA 3WDIA 5HYQA 1U0QA 5FYJU 4D94A 3SDCA 3NTCL 4WTWA 1WBZB 3ARBD 3ZL4H 5FO8A 4X6DF 4ACPA 4GG6A 2GT9A 3FTGB 1HHJB 3TT1H 3RNKA 1BVZA 5FYKE 4X5XA 4FQ2L 4BM7A 4PFEA 1CGSL 3VFPA 4QXTB 2XFXA 4JHBA 5JXED 4G9FB 4LPCA 1R3IH 4HS6A 5HPOA 3QUKA 2OLDA 5DTFA 3HPJB 3L3OA 2LVEA 3I6GA 4K8RD 4MZ3A 3DUUA 3EYFB 1MJUL 4BH8A 2Y7QA 4OQTL 4YPGB 3VXTA 3CXDL 4JEGB 1YJDH 2Q6WB 5DFTA 3Q5OA 4Z7WE 4Z9KB 3KPMB 4TUJB 4WWKC 2IGFL 1WZ1H 2DDQL 4I4WA 1JNNH 1ZLWH 1A6UL 1FQ9C 1K6QL 5FDWA 2E8ZA 1A1MB 4OI9A 4J4PA 5DJZA 3Q5TA 3MLWH 1Q0XL 1XIWC 4HX1A 3UTZB 5DD3H 2R56L 3O2DA 4JFZH 5ITFB 2EZ0D 4QLRA 3MFFB 4G8FB 5D2NB 1XT5A 5CJOH 1UJ3A 1HKFA 3SDXF 4FFZL 1KIPA 5F1KC 1CZ8H 4PB0L 5D6DC 4PY8I 3P11H 3QHZH 2VLJB 5HYFA 1R3LA 3QO0B 4OTXL 4KRNA 3C5SA 4Z7NE 4PJ7B 5F7EL 5JIHA 4LCCA 4KVNL 2C1OA 4M7ZB 4RRPA 5HHOE 3G6JA 4MZ2A 5EBLA 2X2YA 5ENWA 4NKIL 1P4IL 2BSTA 4LAJH 4Z95H 4XNYH 1UADC 5KANI 1CDUA 4QRTB 5I1GH 5DSCA 3S35H 2J5LB 1AD0A 5FCUL 3OAUH 2HTKC 1UH3A 1DBML 3HRZA 3MBED 4J3WA 1CBVL 4KY1L 1AY1L 1KSRA 5D7SH 3DX9A 4RWHA 5MP6H 3HB3C 1F4XH 3LDBC 5ESVB 3LKQB 1CK0L 2OTWB 2AK4B 3MUHL 3T2NH 3PP3K 3MRLA 3VXOB 4BELD 3GHBH 4EIZC 4KTEH 5C0IB 2VXSL 1C5CL 1X9QA 4YHOH 3ZT5A 3GSXB 3IGAB 3MCLH 3MRRB 2KH2B 4FQHA 2GIYA 2Z9TA 4LU5H 3KS0J 5LJYH 3LKRB 5E94B 5ACZA 5C2UB 1GPOL 1SJHB 4P4RA 4WV1C 1BFTA 4Y4FA 4NQEE 1JHTA 3SGJA 4N8PA 4GS7C 2IANB 4QXGL 1I7TA 5F9JA 3GO1H 2BNUA 4FFVC 1KJMA 1QRNE 2ZUVA 1CR9H 2O26U 1HCFX 1Z0NA 4CVWA 3MZGB 3P4MA 4PJHF 1C16A 2EH8H 2MSPA 1TTFA 4ZODA 4H88H 4FP8L 3PWNB 1QBLH 2R4RL 1DE4A 3VXUE 1HNFA 2VH5H 5EOCJ 1MCKA 4OKVA 1JTPA 3UTPD 4WI4A 3OKEA 4F3FA 2UWEB 3G04A 1KCRL 3GMRA 2J6EA 3VI4F 5AZEL 3LQAC 1YEGL 4OD3L 5DHVB 5H94A 3VXQB 3SKMA 3WNMA 3VFMB 5F21B 3NCMA 3GMPB 4HJGB 4G8EB 2DQUH 2C3HA 4RZCB 1KCUL 4OT1L 1MQKH 4MSWB 2G2RA 1FVCA 1WBYB 2BCKA 3MMEA 3TN0D 5A2KH 4GG8B 1MFCH 1NANH 5JPMB 5EBMB 1YMME 1T1YA 5C0EA 4RMTA 4QRPD 4NO5B 4LSSH 4PUBL 3OG4B 5E2VH 3IB4A 1BQHA 3V7AG 2O61A 4HKJA 1Q38A 4BSVB 1R0AH 1LO0H 2Q7YB 5F1NB 4AMKH 1W72H 2MCPH 1CD1B 3GIVB 4CMMA 2C7UB 3V4PH 1NFIB 2FATH 4U0QB 4JM4H 5GXBB 2CJUH 1KLUA 2P5WE 1KN4H 1F6AB 1RZFL 4R4BA 4NQCB 5HYSG 4ZAKD 2OXHA 2RBLA 4TSAL 5D2LA 4EBQL 1CTOA 3QULA 5C0DA 1N64H 2VXQH 2CXGA 3QWQB 5DJ0A 2YS4A 1A14H 2FD6L 1MI5E 1NMBL 2V7HB 4LKXA 4NZTH 2FJHA 3BN3B 4MCYA 3L6FB 3QCUH 4YDJB 2A0LD 4OJFL 1VPOH 3WN5C 4X6DE 4G42A 5JMRA 1EAPA 1W0YT 3QNXB 2LABA 1K3ZA 1QSFD 1OSZB 4WFED 4G6MH 3VW3H 1FC2D 3SCMA 3VXNA 5HDQH 1BEYL 2DLIA 3RU8H 1HH6B 1OVZA 1RD6A 2VISA 5ICXB 3TT3H 1EO8H 2XWBB 3O3DB 4YHZL 3IJYB 4HJ0C 3TYGL 3U4BL 5I16B 3BPCA 1MJ8L 1OHQA 1I9RL 1Q9LA 1AC0A 2H26A 3KPQA 5IQ7L 2FGWL 5GJTH 2J7LA 1IQWL 4KWUA 1EK3A 4YC2C 4JO1H 4I0PA 3OSKA 4HS3B 3HI5H 5I66B 1MH5A 3O2DL 3P40A 3C09C 5EU4A 4MYWB 4C56E 3B9KB 1DN0A 2D31B 1EERB 3MV7B 4K3DH 1NAKH 4D3CL 4P4KA 5IW1B 4N68A 5CZXC 5MI0B 1FZOB 4X6CB 4F2MA 3W39A 5J6HA 1J1OL 1QA9B 4PJIE 1DQDH 2V9TA 1JI2A 3ARTA 2FWOB 3QYCA 4NJAH 3H0TA 3PWPE 3GHEH 2NTSP 5IVOA 4Q9RL 4XCEB 4MXVF 3WIFA 4CN4A 5HYJA 4I9WE 5I17A 2CIIA 3VXSD 4K94C 3TYFA 4JHZA 1LD9B 5JO5B 2OS7A 1IE5A 3NCBB 3JVGA 3QPQC 3PGFH 5FFLA 4JGJA 1WAAF 2GSIA 5EU6B 4QXWA 3QUMA 4HWUA 3RTQC 4YHNA 4M6NL 2CUHA 1CFNA 2GTZB 5FB8B 2YZ8A 3ECBA 1AGEA 4HLZH 4PJ5E 5SWSE 3HMXH 2PYFB 1UZ6F 4LARL 1G9NH 2V2TB 5E8EA 5KVDH 1T89A 5EN2A 2ZUTA 3FFCB 4LASH 3SKNA 4DOHE 2P8PA 3TV3L 1U92B 5L2KB 5I8KL 4YUEH 5DHYB 1XF2B 1HEZB 3O6LL 2GQHA 3CDGA 1P9MA 4YIQB 3IDXL 3BKYH 5F9DC 4PPTA 5ISZE 1RULH 1RZIB 1LK2B 1VCAA 4PG9A 3W0WE 4RGMB 4KZDH 1BQLH 2I07B 2DQIL 4XAKD 4TUKH 1FBIL 3MJ9A 3OB8A 4DVRH 2C3XA 2NY6D 2G75A 4X83A 5DO2D 4Y16A 4V1DB 3WJLA 4LCIH 3BT2L 2G9HB 2XI9A 1TJIH 1ZHLA 4OLXL 4XCYA 5D7LE 1CG9A 3ARBA 4LRNL 3RI5F 3FO1B 4OCMC 5DVNA 2ICEA 4X7FC 2DQDH 3QUYC 1NMAH 2YD2A 1MF2H 3BESR 3T3MF 1QO3B 4JGUA 4GXVH 4MJIB 2YD1A 1BIHA 4LFHG 5HVGB 1FDLL 2JKXA 2Q7NA 2VLME 3JTSB 3S4SA 4P23C 1NSNL 5BS0B 4P9HC 1D9KA 5IBTL 1O0VA 4R90H 1FNGA 1I9IL 2V9QA 4PJHE 5FYKD 4F7EB 3MLUL 2PO6D 3QB7C 5BV7H 3BP7A 3O6MH 3UJTH 1KPVB 2AV1A 2J6EL 1HILA 3HE6C 3PJSB 4MGXA 4N0FA 4NBZB 3MNZB 4H26A 5CP7A 4M9PA 2F9BT 2FHCA 5JOFB 5KN5A 4Z8FL 1VA9A 4LSVL 1TENA 3VI4E 1D6VH 2BSRB 5KVGH 4UBDD 3CFKA 2F54E 1CU4L 5A2IH 4KDVA 5K33A 3ARUA 3L3DA 1XF5B 3QNYA 5L9DH 3VWJC 3I9GL 1NCWH 5HHVL 5LCVL 4U6VL 1N0XH 4N8VG 1CS6A 5GRVL 4YXKH 3G5ZA 4WUUE 2ADIB 4XCCH 3KLAB 3QJFA 3C6LB 5I30L 2E8YA 3P73A 1GC1H 2EKJA 3ROLB 2LV4A 1L0XA 2YA0A 5LBSH 3TVMC 1JYXA 3B5GA 5DXWA 2GJZA 5KSBA 3EO1B 4R4NC 3HN3A 4K2UH 4DCQB 4UIMB 2AGJH 1R3KB 1I8KB 2H8PA 4N0RA 3L95A 5IV2A 4OZFH 3OR6A 3U0WH 5LWYL 5FDYA 5IMLB 4FZ8L 5TE7H 1CLYL 1JGUL 5LGJA 1MWAA 3KPRE 4WW2B 5KOVC 1L7TH 4G80B 1OGAD 3VE0B 5EBWB 3VFGL 1FL3A 4NRXB 4XBEL 3V5KB 5ERWB 1EVTC 4MS8D 2QSQA 3D3VE 2PW1B 3DMMB 2XRAH 1GZQB 5HHOD 2RB8A 4F9LA 5D1ZD 5T3ZL 4HZLA 3LHPL 3S5LA 4OD2B 3LZFH 5IBUG 3L3JB 1I3UA 1KUMA 3MBEA 5F70A 5HDBF 4LEXH 1IC7L 2DMCA 1DUZB 3JTTB 1MCCA 2MMXA 1MFAL 4NM4L 2P5EB 4HC1H 2DTML 5KS9B 1WTGT 5I1JH 2NX5A 1HYSC 4AG4L 3RVXC 2FH8A 1N5AB 4JRYB 1X4XA 5HD8D 5CKAA 1MELA 3TCLA 2VWEC 4GRWF 3N9GH 4Y4KB 4KJWD 3VRIB 4LVEA 5JR1L 4Y1AE 5TDPB 2MPAL 1GZPB 1U95A 3P77A 4Y19B 3ARFA 2BJMH 1F3JB 5IF0A 3QEQB 5C07B 4RMRA 4UV7L 3QZWA 1FLTX 1YPZE 4JFEA 4PRDA 4YBLC 5HDOA 4OZIA 3C5ZA 1ZHKA 2CSPA 5L8KB 2AJUH 5GRUH 3CSYB 4XBPA 1BQUA 5KVEL 2AXFB 3O3AA 1U8JB 2QQKL 5CAYB 3PHQA 2P4AB 5DK0A 4HIIB 1W0VB 5F96H 3AREC 3DV6B 1I1FB 1RUPL 1T7YA 4FQXD 4NQED 3I3EA 1VADA 4S2SA 1S9WB 1AO7D 2BSED 4GXUN 5IFAH 1VFAB 1QRND 2OMBA 5CIPB 2VE6A 2EYRB 4GRMA 4JPKH 4LSPL 1QVOB 4NQDA 5CUSH 4PJ8A 2DWEB 1VESA 2WUCL 4JQIL 1JGLL 2Y6SC 5BQ7B 5IW6B 1IM9B 1YEEH 5GRZA 4U1MB 1A6ZA 3ES6B 1CE1L 3BH8A 4MXVE 1A6AA 2VUYA 3QFDA 4FQLL 4F7CA 3MRNB 4NQXB 2YKLH 3O3BA 3PL6B 4ODUB 4OCYL 3QUML 3SDAD 1X5HA 3MRCA 5JQHC 5JW5B 2LVCA 4Z18A 5TQ0H 1C1EL 4UMGA 4WWKD 2ADJB 4WFHE 4I18A 3OKDB 4FQPA 15C8H 3RVTD 2NZIA 1UZ6E 1MAJA 1YMMD 3UBXA 1BF8A 3MLSH 2CQVA 2BRRH 4OF0A 1HXMB 2DJUA 3IU4L 3X12A 4I77H 3GJEB 4M7KL 5HHME 3U46B 2B0SL 4R7DA 2W0FA 3U6RB 4Q9QL 1INQA 4JZJC 4U6XA 2CIKB 1FVEA 4ZAKA 1FE8H 3H3BC 3BIBX 3QDMB 3O6KL 4RFOH 1F3DH 3N85L 3MJ9L 2XQBL 1UKTA 2K7QA 3L3HA 3VFRA 5DMJB 2C5DC 1L6ZA 3ARGD 1OF2A 3MGTA 3ARWA 5SWZE 1ZWIB 2M26A 2Z8WC 4OLYL 5GS0H 1MFEL 2AABH 3EIFA 5JZ7D 3QI9A 1FO0H 3V6FA 3PWJB 4J1UB 3SO3C 4WTZA 2HWZL 2AEPH 1F4YL 3PQYB 4O2EA 5E4EB 3HUJA 3ULSB 3ZTJH 3VRLE 3D85D 5BVPH 5I15L 3MRFB 5GRJL 5C3TA 3CNKA 3CH1A 4TTDD 3GSWA 1CYGA 1MI5D 4O00A 3RWJB 3OR7B 2XV6B 3FQRA 1QSFA 1T1ZA 3HR5A 3WXWH 1OAZH 3V6BR 1TJHL 3LKPA 2WLZA 3T3ME 5F71A 4PJXA 4LKCB 4K8RL 4YHKH 2FR4B 3HE7D 3FO9B 1IQDB 4YWGL 3GMLB 3VWKB 4ZUTA 1WIPA 5CGTA 4PJFF 4X6EB 3RDTB 3QG7L 3HZKB 4NRYB 1NC4B 5IVXA 4MXWH 1JI1A 1WC7A 1ZA6A 3QIBA 1WZMA 3HAEH 2BY1A 3QEUA 1TFHA 1U3ZA 4QF1A 2NR6D 2DI7A 5DD5L 5D2NC 1I4FB 3K74B 3CFIC 4R0LB 5ADPL 1SEQL 4G7YH 4ERSL 1SJEB 4U0RB 5E24E 2AEIT 5DD6B 3AS2A 5MEQB 1NH6A 3AS0A 5JUEL 2UWEF 5ALBL 4WEBH 3EYQC 4DKEH 4KJYB 1FV1A 1J10A 4M8QA 2R4SH 3BX7C 3QQ9D 3RUGA 4FFVD 1ZLSH 3CXHK 4IRSB 3UTSB 5J9PA 5JW4N 5I71C 4JM2A 4G3YL 2ITDB 1WFUA 4M7ZC 3L3IB 3BO8A 5EG6C 5ID0B 2G60L 4ZXBC 3IAGC 5TF1L 2K9UA 3QIUD 4XMLL 1MWAL 4YR6A 1S9YA 4JREB 4R2GD 4J6RL 4HQQL 1D5ZA 2ILLA 2J5LC 1XCTB 3PWPD 3QWOB 1N59A 1Z9SA 3G6AA 5CEZE 2DIJA 4ZPVA 4I9WD 4G8GB 1A7PH 4UUJB 3MRJB 5DQ9A 3MV8A 1PX3A 1FFQA 5T33H 3V7AE 3PDOA 5C09E 4ETYA 3RY5A 4JQXC 2ZG2A 4FQ2H 1N2RA 1VGKA 3IDNB 1CGSH 4HD9A 2BNRA 4KV5F 1CXKA 4PJ5D 3FB8B 2YN5A 2VDPL 4P3DA 4MLSA 4LMQI 5HI4C 4PGZA 3K8KA 4JFDE 4XH2B 3LEVH 1MCQA 4Y5XA 3X13B 5A2JH 2IGFH 2DDQH 2W59A 1E4JA 2D7PA 3WDJA 3UTTE 4ZUWB 1ED3A 5ISZD 1A6UH 1K6QH 3KWWB 2A74A 4WO4D 3W0WD 4E41A 5ALCL 3C60B 4LSRL 4CDHA 2EO1A 3SY0A 1NLDL 1AGDB 1Q0XH 1FN4B 2V2XA 1FNLA 1X5JA 1H0DB 2HJKB 4U1LA 3O3UN 2Z35B 5DJAB 4JY4A 4YEEA 4ZUSB 2R56H 4N0UA 5DJ6B 3DARA 2M2DA 3VMPA 4J12A 3HZMA 4J8RB 4G9FE 2HFEB 5D7LD 5J6GA 2FBJL 2YUWA 4WENB 3CD4A 2YPLE 1IKFH 2R0KL 1PYWA 1U8IA 3H3KA 3KYNA 1IBGL 4PB0H 2PO6A 3IDUA 5C86A 4LGSB 3V5HB 1NGWA 1GAFL 3O11A 4OTXH 2VLMD 4NC1C 5FUZL 2X4UB 1DLFL 1BECA 1DLHB 4DTGH 4Q9BA 5F7EH 4NHUB 5C0AA 3HC0B 4Q9CA 2CDGB 4KVNH 1MEXL 4EN3C 43C9B 5IR1A 1MHCB 2A9ML 1J8HE 1DVFA 1P4IH 1FYHB 2D7QA 4JLRB 5D1XA 4Z7WA 1IEAB 2LAGB 5CJXA 4K7PY 1T03H 4XPGH 1ZA3A 5F7MC 5FCUH 3E6HB 3IDMA 1DBMH 4M7JL 1CBVH 4KY1H 3SOBL 1RZKH 2OP4L 2NTFB 5IM7A 5J1SC 1Q9WB 1AI1L 4JCLA 5DYOB 3QRGL 4FABL 1CK0H 2Z31B 5CMAA 4PGCA 1P7KB 1EEYA 3IFLL 3DXAB 2VXSH 1C5CH 1ZANL 2YHGA 4QXUL 3HI1A 4JY6A 2ZCKH 3PXJA 5CEYB 5DUML 2LU3A 4EIGB 3W11D 5EZLB 5CZXD 3QJHB 2GJ6D 4ZD3L 5F8RC 4RFNB 3P3YA 4L8CB 4QXGH 5B38G 5E8NA 3KPRD 4L3CA 3RX8A 1LMKA 5EIIA 5C0FB 4C55A 4L9LB 1MHEA 3GKWL 2R1WB 5T1MB 4S1DC 1LO5B 2I60L 4JG1L 4PJEB 4GJTB 4X4YB 5B4MD 3D3VD 1BJ1J 2QL1A 5EUKB 1HSBA 3QQ3A 2HJLA 4GW1B 1Q94B 1BHGA 3UC0L 4FP8H 4XPAL 4ONFL 4UQ3A 2H2PD 5ESQB 5F89A 1KT2A 3GSRA 1QKZH 4YDVB 1KGCE 1RZ8A 3RZCB 1KCRH 2BHZA 1LEKB 4HGKC 3CX2A 4QTHB 5C08D 1YEGH 4OD3H 2YWYA 4EUPG 2RFXB 3CFJB 2FZ3A 5HGHA 2ATPB 6CGTA 1WWBX 2CKBA 3KNBB 3OQ3B 3UYOD 2D4FA 1KCUH 4JFHE 4Y1AD 4JFXA 4PJFE 4WJ5B 3G5YA 3B9KC 4EZMA 1T7VA 2MFNA 3MRHA 3GSVB 5IEKA 2VZUA 5F1SA 1DL7L 4NQEA 1AGCB 4PUBH 5MI0C 4Z7UB 5FGRA 1NBZA 3WBDA 5DHXB 4WTXA 4DN3L 4UDUB 1S5HA 1RZJH 4BA8A 2UWEE 3NFNA 2BVPB 3EO0B 2K7PA 3VH8A 3UX9B 1CE6B 1DDHB 5DR5L 1RZFH 4UT6H 2OR9L 2XG5A 4KU1A 2VZVA 1BBJA 3QFJB 4YDIL 1AR2A 4NC1E 3VXUA 1N3NA 3QIWB 4P23D 3R4DA 1G0XA 4M1GL 1NCDH 2FSEA 2CDFA 2VDOL 1YNTA 3EZ8A 3O6FD 1QHOA 1AJ7L 1M7IA 1I85C 4WI2A 1U8QA 4R3SB 2WLYA 4HF5L 5FYJL 1NDMB 2MCG1 3UZVB 2D2OA 2W0LA 1R5WA 3OHXB 3ZE2F 1OP9A 3HNVL 4WWKA 5MEOB 3BVNA 1QTYT 2YSSB 1OP5K 1FPTH 1KNOA 1P4LB 1JPTL 3FQXB 4YHYB 4XVUD 5IHZB 4OJFH 3CUPA 3EYUL 2GFBB 2I9LB 4LRIC 4UZGA 3QEHB 1JJUA 5LAXA 1XIWA 4RGMC 3BIKA 1ZLUH 3TBWB 4WW2F 1WWAX 4LPYA 4POUB 4NZUL 4NQCE 1I3VA 4KV5E 4MB5A 3DRQA 5FECB 3MJ8A 4WU7A 2IBZX 3CH8A 5TPWL 3LN4A 4YHZH 3L5IA 4B50A 3LEYL 3ARGA 5HHMD 4HGWA 1PLGH 3DURA 2P5WA 4GLRI 4HWBH 1XH3A 4PRBA 5IQ7H 5D6DA 3U0PB 4HUVA 4PJAA 5KS9F 1UWEL 1JL8A 3GIZH 1IQWH 2ZPKL 5EOTA 5TGBA 4P5TB 5ITBL 3J7HA 4L4VB 2WSKA 2EE6A 3O2DH 3QWRD 4CN1A 1CDHA 1TVBB 3KYMB 3ULVF 3T2OA 2VLKB 1MI5A 4O51A 2B20A 4ZS6D 3MRPA 2COQA 5HY9B 1KN2L 3X11B 3SPVB 5ACLA 4P2OC 1BGXL 5FYKL 4RMSA 4X6DA 1BD2B 4BFIB 2J8OA 4M6AA 2IH3B 3JV5A 4GO6B 3WHE1 4KQ4L 4OKDA 3T2PA 2GK2A 4K7FA 1Y6NR 2DYPB 3SDCB 4C54A 1TDQA 3RVXD 4S0TD 1QFHA 3W9EA 4GG6B 1JZ6A 2GT9B 1DBBL 3KLSA 4FXKA 4X5XB 5A1AA 2R9HC 3C6LC 1ND0A 4M6NH 3IVKA 2XFXB 1JTOA 5FUOL 4XZUA 3ALPA 2APFA 2FHBA 3MV7E 4HS6B 5C0NC 1EHLL 4LARH 4WHTA 5DTFB 1W8NA 2QEJA 4WV1A 5EO0A 1CTNA 1P7QD 5AZ2L 3WYRA 2VKWA 1KIRA 1KOAA 3DSFH 3NFSL 3TV3H 2XWTA 2CRMA 3T2QA 1FAKT 3HG1E 1FNSL 3E6FA 2EDRA 4Y5VB 4C56A 4NIKB 4I4WB 1WLHA 4WW2C 4WFGE 3ULUH 2GYSA 5FDWB 5GS2H 3PWLA 5SX5K 3QIUA 4KDTC 2DQIH 2F8XC 1T7WA 1U93A 2H32A 1RIUL 1EHAA 3D1MC 4LNRA 3GSOB 4YK4C 4OIIH 3ZKSD 5IW3A 4JFFA 3BWAA 3SDXA 4OCRH 5JW3L 2AXHA 1B0RA 4LIQE 2H6PB 4LRNH 1FL5A 1JWMB 2Y6SD 3U30C 3OKOA 4I3RL 5DRNA 5L2KE 4JO4L 4XCFL 1X6LA 3GSNA 3BD3A 3RX7A 5DEFA 5IHBA 2HN7A 2OXGA 5D6CA 5C8JB 3ULVC 1FDLH 1R3LB 5BOZG 5I1DB 4Y4KC 2IALA 1MRDL 1NSNH 4PJ5A 3TO2A 5SWSA 5J1TC 1YEDA 1I9IH 4LCCB 1U8KB 4M7LL 3GB7B 3RGVB 1Z9LA 1PG7L 2JB5L 3VFUB 2VR4A 3QXDA 2H45A 5TQ2H 3F65A 1T20B 1C08A 1YEHH 3DVGB 4ZTOL 1YY9D 3IDGB 2Z4QB 3KR3L 1N26A 5ISZA 1XZ0A 5FHAL 5KSVA 1AD0B 1G7PA 1MCIA 2CKBL 4ZFOB 3W0WA 4LSVH 1IFHH 1RJLA 2BERA 1CU4H 1B6UA 4LGPB 3I9GH 4HS8L 5LCVH 3AAZA 4Z76A 3EYVA 3DX9B 4MJIE 4FQCH 4FRWA 4NO0A 1YA5A 4NO3A 1F4WL 3B2UC 3SE8L 3VCLA 5D7LA 4NSKB 5D93B 3E0GA 3SEPA 5I30H 3OF6A 4XPTL 3UBXI 1SY6H 5GSRB 1FVDB 1IAOB 4NWUL 43CAB 4LPUA 4PJDB 4PG2C 5HPMB 1T1XA 3TBSB 1XGYL 4K07A 5F7WC 1INDL 4L8BB 3S34H 4DAGL 3NCCB 4Y4FB 3WN5A 3HKFA 4M6ML 2DM2A 3Q2CA 1JGUH 3PL6C 3QCVL 2BNUB 4U1HA 4LLAA 3VDBA 3VFGH 4C4KO 5HGDA 1WCBA 3D48R 4M4RA 5FOJA 3RPIA 1FCGA 1JNHA 3WD5L 4XBEH 2P48B 3MX0A 1U2CA 3EGSB 3TPUA 5JIIA 5HSFA 3P4MB 5T1LD 3RVVC 1C16B 5T3ZH 5IMMA 5GS1B 3LHPH 3P9WB 1J8HD 4G5ZH 2F54A 1IC7H 1P84K 1DE4B 1FFPA 1JRHL 1MFAH 2DTMH 2IAMB 3G04B 2G5RA 5AYUL 3PHOA 5H94B 4WUUA 3SKMB 3X17A 2DQHL 4B7IA 3FT2B 2R15A 1PG7X 2WBJB 3MRQA 1IAIH 4GUPA 2MPAH 2ARWA 2WQRA 4XMKL 2G2RB 1FNHA 3DBXA 3MMEB 5C0BA 3A6CL 2XNAB 1I3GL 2GUOA 4IS6A 4ZO9A 5E4EC 1XGQA 2AXJA 2OL3H 4P5MA 1QACA 1UJTA 2HJFA 1OM3H 1BQHB 3NCYP 2O61B 4LLVB 5KVEH 3RY6C 3WHE0 4PR5A 4DGYL 1OTSD 2QQKH 4A6YA 3G5VA 1NUGA 4ZPTB 4L3EB 1J18A 3CPLA 1RUPH 3U9UA 1U91B 3CLEL 1QLFA 1MCPL 3D3VA 3BP4B 3UPRB 4KK8D 4LPXA 3VXRA 4Z0BL 3FFDB 3RTQA 1A3LH 2HFFA 2W60B 2Y72A 3TBYA 3VWKC 3ZDXF 3ULVE 3JV4B 3RDTC 4AQOA 4LSPH 3P9LA 5C0DB 4LNVA 2FRGP 3E1F1 4WUKL 4I3SL 2I9TB 4G6FD 1BMGA 3BOVA 5CJ5A 4OUUA 5DJ0B 1G9MC 4JQIH 1JGLH 3QEQE 3OKLA 5JXAL 4GXUM 3RA7L 2FJHB 2QADD 1CFQB 3BP5A 2HRLA 3RPKA 4MCYB 3FQUA 1CLZL 4Y1AA 2ITCA 3IDJA 4FQLH 5CJQH 4U0RC 3QUMH 3DROA 1Z3GH 1N5YL 4JHWL 3CJJA 1NQBA 1JGDA 3LKNA 3GGWB 1T66C 5GGVH 3U4EA 3SCMB 2CRZA 3WFDL 4OCWL 4IRSC 4ZFFA 4JFHD 1N8ZB 2VAAA 4JZNB 3V0VA 3NAAL 2VISB 4ZMAT 4H0GA 4O2CA 4S1QL 2YD7A 5GIRB 4PJ9D 2D0GA 3VFTA 4M7KH 4YZFF 1I9EA 3BPCB 3QUYA 4LFHD 4JREC 5E1AA 4Q9QH 2E6QA 1NGZA 1Q9LB 4G43B 2H26B 3KPQB 3LEXA 4OQ1A 1H15A 2CO7B 3N85H 3MJ9H 2XQBH 4P23A 1ZS8A 2HYMA 5GZOD 5E2WH 3DUHA 3BDBA 1P5VA 4I0PB 4K23L 4W70A 2HLFC 2YBRA 3B3IA 4KRPD 4OLYH 1JN6B 4IDJL 1MFEH 3BGMA 4X98B 5EU4B 1CICC 1DN0B 1MVUB 4BJLA 4JDVA 3OBAA 3ALWA 4P4KB 32C2A 3AS3A 3WXVL 3LQAL 1F4YH 3LIZL 3HE6A 2PTUA 1I8MB 4MJ5A 4PRPE 3QEGL 3VXME 4EN3D 1A6WL 3BZ4A 4M1DL 1NBQA 5I15H 3GSNL 4HBQA 5DJCA 4HIXL 2BMKB 4X7CC 1FC1A 1JYWA 4OBRA 3JV6B 2EE9A 2EDYA 2ED8A 4TNVK 1AH1A 3EYSH 2V2WA 3VWJA 4IMKC 1WAAA 1RJYA 2UZIL 5HYJB 4KPHL 1AXIB 4X7SH 4DW2L 1YDPA 4E0RA 3I3DA 2E6JA 2ZUWA 3O9WD 5EOCL 1NBYA 4QRRA 2VJXA 4YWGH 1X5AA 2UV3A 2CH8A 2CRYA 3QG7H 4HUXA 4YHNB 3TJHD 3MV01 2ZWLT 3EOTL 4GLRH 2Y07L 5E8DL 4QOKE 2R8SL 5E8EB 4MAYD 4OZGF 5EN2B 2VXTL 5DD5H 2FNBA 3SKNB 2P8PB 2VQUA 4MNHA 3P4OA 4NPYA 5SWZA 3SKJL 4KK9D 3QWRA 5ADPH 1FZMA 2J8UE 4ERSH 4LSDA 3MPCA 1IGTB 4QRUB 4GBXD 3J8F7 2VLLA 3NN8A 5DJ2A 5JUEH 3GMMA 5GRWA 1T04A 4XTRC 5A16A 4YFLF 8FABB 2V17H 4G3YH 1UH4A 1YUHB 2QQNH 1WQVT 3MYZA 5B39B 3GJFA 1R3HA 1OPGL 4S1DD 2G60H 1UG9A 2BXZA 2XPGB 3U83A 4XMLH 1QBMH 1CG9B 5IESL 1MWAH 1Z6JT 3ARBB 2DBJA 5H37H 4EXKA 4GMSH 3M17B 4Y2DD 4XCNB 1PQZB 5EA0L 2ICEB 3HNTL 5JHLL 5F3BB 1S7SA 4NBXB 3EUUA 1FFOA 4NDMA 2XICA 2ID5A 4X80L 2AVGA 2JIXD 4M93B 1MRCL 5MERA 3I6LE 3TBVB 1D9KB 1YY8B 3KHQA 4L8DA 1FNGB 5DEGB 5DQJA 2QKIA 4MQXD 3UTOA 2Z91A 4Y5YB 2Z31C 1G7QB 1NUDA 4YAQA 5C9JA 3BP7B 5B8CA 2DLTA 4NZJA 1KPUA 1HILB 3MACL 1FSKB 3EYOA 4ZFZB 3AREA 1AIFB 3S36L 1OGTA 2YRZA 1EEZB 3DO7A 1OW0C 4RFNC 1ITBB 3HG1D 4FXLA 3L3DB 4QYOA 5JOPE 4IM8A 2BOCA 1CXEA 2DQFB 2VN4A 5CD5C 2HT3C 3T0BA 3W5NA 4LLYA 4WFGD 5F72S 1YYML 4LSRH 4KROD 1NLDH 3QJFB 4PP2A 5DRZB 4OZHF 4L9DA 3EDEA 1U9KA 3ILPB 4M00A 4UNVA 3NA9L 5IQ9B 5KSBB 3BSZL 4K94L 2OK0L 2Y23A 3EFFA 1NCAL 1MFBL 4MA8L 4NP4H 5CZKA 4HH9B 5IV2B 1A0QL 3OR6B 3GMNB 3RZCC 1HZHH 2MKLC 2P44B 5DEZA 4XMPH 5C09A 1TTUA 2FECL 3L7EA 5I0DA 5TF0A 3LN9A 1U8LB 1YQ2A 1T2JA 5FUZH 4JFYB 3ZDXE 2JK5A 1FL3B 2VNCA 2BX5A 4R8WH 3EKCA 3BYTA 3HS0A 3K4ZA 3GMOA 4G6JL 3DV4A 1MEXH 2XTLA 1XGUA 2VZ1A 5CBAA 5FGSA 4GOSA 3S5LB 4L29A 5FA4B 2FGZA 4MMXC 3MBEB 4JFDA 3TFKC 4JZJA 1FCCA 3CX5J 5F7NC 4U1IA 3D25A 4KKBD 4QRSB 3EO9L 2IFFL 3UTTA 4PV9A 1KXTB 1WBZA 4ZUVA 4JCMA 1JRHI 2XA8H 3TCLB 1QSEE 1HHJA 1A9BB 4P2YA 1KCKA 5E95B 3DSNA 3QRGH 5FYLL 1MHHA 4H25B 4FABH 1U95B 4LQFH 4G9FA 4BQCA 1EHXA 3QIWC 2N7AA 3O3EA 3IFLH 3RVUD 2YPLA 1ZANH 2ESVE 1L0QA 3LN5A 3GEWB 3JXAA 4QXUH 3SDDC 4OSUL 1NC2D 3Q1SH 4EI5D 1ZHKB 3EYFA 3S36X 2OJEB 4YPGA 4UT9L 4P9HL 5BRZD 4AYFA 3O3AB 1LILA 4Y8DC 3T0AA 4J3OC 3KPMA 4TUJA 2VDNL 2Q8BH 4YHYC 1VADB 2DBLL 4ZDHA 2W9DH 1U58B 3BN9C 5E08H 1YQVL 3KPSE 3GKWH 1CFSB 2VE6B 4GRMB 4XVTL 3UTZA 1OCWL 3VD3A 5DZOA 3D9AH 4PBXA 2AERT 5ITFA 2ADFL 4YX2H 2VDML 5E00B 3MFFA 4G6KL 5ILTH 3DXAE 1GCFA 5IK3B 4XPAH 3QCTL 4ONFH 2FJFA 1A6ZB 1W0WA 3QDAA 3BH8B 5C6TH 3QFDB 4NNXA 4F7CB 3MLRL 5F97E 4POZC 5D71L 3QO0A 4KDWA 3MRCB 4XX1G 3HC3L 4BK5A 3QG6A 2PTVA 4QRPB 3QT2A 4H5SA 4XWOD 3RNQB 4K7PL 1B2WL 4ZXBA 4Y88A 1A4KA 3MRBB 4X9BA 2ZOKA 1EEQA 2VLRE 3I2CL 4OZGE 4D0BB 3X12B 3FZUC 3T0EC 1QPXA 3G9VA 4Q74A 4R7DB 2W0FB 4DN3H 3T0WA 2KUTA 3D0VA 4U6XB 3AMKA 3C2AL 1FVEB 4ZAKB 1JFQL 3BRDA 4OCSH 1RK0A 3SDCC 3VFRB 4ZUUB 1RU9H 1OF2B 4P0DA 3WO3B 3WMSA 5DR5H 5ESVA 4JQXA 3LKQA 2OTWA 2AK4A 2UUDK 1EMTH 2NY0C 2HFGL 5C0IA 3V6FB 2Q86A 1RSFA 4O2EB 3RAJL 4TOYH 1AJ7H 3LKRA 1U8MB 1MPAL 4LSTH 5E94A 3MGOA 5FYJH 4HF5H 4HLZG 1P84J 1SJHA 3GSWB 1HN1A 1GOFA 3DIFB 7CGTA 3SE9L 1IC4H 1QSFB 3HNVH 3ROOB 2R69L 4PRIE 5HGGS 4GRLD 4YHPB 3LKPB 4PJDF 1H3VA 3TM6A 4PJFA 1JPTH 4Y5VC 1V3KA 2VDRL 1JWUA 2LAAA 3RRQA 1KJ2B 2R2CA 3MXVL 3WFCH 1PSKH 4UAOB 2VABA 4NZUH 5IVXB 3VRJB 1TCMA 3M1BB 1ZA6B 3QIBB 3GUTA 4X4ME 5T3XD 3PWNA 4TSCL 4AM0B 4QF1B 4BQ6A 1UVQB 3U9PL 3WIIL 1KBGL 5E99L 1S7VA 1LK3L 2UWEA 1CQKA 1YEIL 3S3JA 3FHQA 3T09A 3IDYB 1RURL 4HDIA 5DHVA 3VD7A 3SQOL 3VFMA 3NABL 4BKLB 4NGHL 4HJGA 2CLVB 4IRZL 4G8EA 4OV6F 4RZCA 4UNUA 3AC0A 3DWTA 4K7PX 5JDJA 4MSWA 1FV1B 4GSDL 2R23B 5DMGC 5EUOE 3HCVA 2DLEA 5F6HJ 4EN3A 4GG8A 2C26A 1JPGB 2BVOB 5J9PB 1EIBA 5EZIL 5AAWA 5EBMA 5IUSA 5CEZL 4OZHE 4NO5A 3RGVC 2E9WA 4N8VA 3MYJA 2IQ9L 1KN2H 1YJDC 5TE6L 5C3LD 4PRPD 3VXMD 1Q1JH 1GHFL 2Q7YA 3RVVD 4MA7L 1S9YB 4DUVA 3DX6A 3VXSB 1EGJH 1UXSB 3RKDD 1CD1A 5JPNA 1NFIA 4YHLL 1IC5L 3CFDA 2J1KA 1MAKA 2KQMA 5DC0A 1AXTL 1J5OH 1N59B 5HDLA 5CZVH 4FHBD 4NQCA 4ZPVB 2CK0L 5GJSH 4R7NB 1DBBH 3O2WL 5M7QA 5D93C 2BNRB 2VLKE 1F5WA 1EHLH 4QOKD 4CW1B 3F7YB 4NQSB 2WAHA 4GAYA 4P3DB 2FL5A 5AZ2H 1P4BH 4O9HH 4NRZB 3L6FA 3T0EE 4Y4FC 2BRQA 4M3JA 4OGXL 2V5MA 1FNSH 2YRLA 4XNMA 2GTWB 2Z93A 3H9SE 3MOBL 3QNXA 1ZVYA 4OZFG 4ZTPL 1FGNL 1J11A 2NY6B 4HXAH 5I1IL 3V79C 4LPWA 1ED3B 4F58H 2HKFL 3C87A 2XOTA 1HH6A 3IKCA 1T3FA 4CL7A 2QQLL 3SY0B 2A1WH 1CDIA 4JKMA 5ICXA 3O3DA 3GSQA 4JKPL 5GS1C 1KJ3L 4LLQA 1ZHNB 2VDLL 3AY4C 2W1NA 2JF1A 4XPHL 3ZYIA 2FX9H 2IAMC 4MNQE 1C8PA 4HFUL 4XCFH 4HS3A 5I66A 2PO6B 3I6LD 5I1CL 3O11B 3B9KA 1FNEA 1MRDH 4AIOA 2WBJC 3MV7A 3CFBB 5EWIL 4K3JL 2JJWA 1RJCA 5H35B 1XGRB 2FECI 4Z77A 3A6BL 3D87B 4M7LH 5IW1A 2BY2A 1T7XA 4X6CA 1K2DA 1QA9A 1SMAA 2YRPA 4WNQA 1O5DT 4ZTOH 4HT1L 5FO7A 1B4JL 4XCEA 2RCSL 4S1SL 5K59F 2CKBH 1NPUA 1QFWM 4O02H 1ITCA 4RGND 3NVQA 2VL5B 1IRAY 1LD9A 5JO5A 2BSSB 2YD8A 5AG8A 3VFOA 5JOPD 4OM0H 1FRGL 2OR7A 3LSOB 4LCWD 3CMOL 4GKZA 4LF3B 1UB6A 1XCQB 2GTZA 2XWJA 3SE8H 5FB8A 3TZVC 1A7OL 1RJZB 5CMAB 2PYFA 4PGCB 1IC1A 1EEYB 1I85A 2V2TA 4WFFE 4KZEL 3FFCA 1UA6L 1CICD 3HI1B 1U92A 5L2KA 4MXQC 4OF3A 2IQAB 3F7RA 5DHYA 1XF2A 4Z78A 4P46C 3VG9C 2X40A 1LO2L 1EAJA 5DGQA 4AEHL 4JO3L 2L0DA 2ZSWA 5CSGA 2EH7L 4NM8L 4M6MH 4OLUL 4LRIA 1U8OB 3PUCA 5IMOB 1RZIA 1LK2A 5E8NB 3QCVH 4OFYA 3K81A <