2JELH

Jel42 fab/hpr complex
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
218
structure length
218
Chain Sequence
QVQLAQSGPELVRPGVSVKISCKGSGYTFTTYAMHWVKQSHAKSLEWIGLISTYSGYTNYNQKFKGKATMTVDKSSSTAYMELARLTSEDSAIYYCARVMGEQYFDVWGAGTTVIVSSAATTPPSVYPLAPGSGGQGNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLAADLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIAPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords JEL42 FAB FRAGMENT
publication title The 2.5 A resolution structure of the jel42 Fab fragment/HPr complex
pubmed doi rcsb
molecule tags Complex (antibody/antigen)
total genus 43
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 1998-02-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2jelH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2jelH02
5HYJD 3NFSL 2HFEB 3IF1B 1CGYA 5GHWH 4OM1L 3VFMB 5KVMC 4JJ5B 1G6RL 5IVXA 3ULVD 2GAZB 1EHLH 2A6IA 1QKZL 2PR4L 5IB1B 4DZ8A 3U0WL 2A6KA 5C6TH 1J8HE 3VRLE 5I1GH 4PREA 3WJJA 1NCBL 2FATH 4QNPE 3RWIA 5MEQB 4CADB 3FQTB 5D70L 3KPLB 3SKOA 1CDYA 5IEKA 5C0BD 3V5DB 3KLSA 1YNKL 3OKDA 5DJ6B 5T1LD 5T1MA 5EZIH 1MAMH 5BOZG 5JHLH 3CFCH 4L3EE 5LG1A 4CN1A 1J11A 1W2KT 1FBIH 2UZYB 3H6JA 2EE3A 5FFLA 4NSKB 4NPYB 5E70A 4U1GB 3T2PA 3E6FB 4QRUB 1S7WA 3NAAL 2E8ZA 4FN0A 4G8EB 3X17A 3MXWH 3VU2A 2HT3C 4TSBH 4GKZA 1BOGA 2ITCB 4ZO6A 3S4SB 5FYJL 4E41D 3O6FB 5E5RB 2I60L 2QTEA 3H9HA 4JPIB 4JRXB 5DFVD 3NTCH 5F3HA 4PJ7E 3ZSTA 2A0LC 5CGTA 5IB4B 1FORL 1MRCH 1DLFH 4U1MA 4FFZH 2F8XC 4BM7A 3OAZH 3WJJC 2R2HB 4U05A 5HYSG 3O2DH 5MP6H 1IC1A 1JGUH 3MYJA 4BUHA 4P2QD 2E3VA 4GW1A 2BC4B 3CVHL 3PWLA 2X41A 1OLZA 3F62A 5C7XH 1U8PA 2X40A 1BZ9A 1OAUL 3DECA 3EOAB 1CDJA 3H42L 4KY1H 1U8LB 5ICZA 4XCFH 3KPQA 2NZIA 3AREA 5C0EB 1I7ZB 1ERNA 4TSCL 2B4CL 2VWEC 4EN3A 2VLRD 2W60B 2ATPB 4NN7B 3DTXB 4JG0H 1C5BH 4QGYA 5ADPL 3ARSA 4LRIA 5GGVL 2LE9A 3ESUF 3L5WB 4RGOH 4GJTB 4WY7H 1T7WA 2ORBH 1OAYL 3EOTH 4PJCA 3VGAC 2OBGA 4UAOB 1EFXB 3RVUC 5FA4B 2R4RH 4OZIB 4MAYD 3WFDH 1GVIA 1JHKH 2IGFL 3BDBA 5D2NE 2WIIB 2AEPH 1OP3H 5H94A 3ZTNL 2BVEA 5DRNB 1UWXH 3S5LA 4HQQL 5FOBA 1JWMA 1ZT1B 3BUTA 3NACH 3WIFA 3GJEA 4PJ5B 3BT2L 4OIBA 5KN5B 4WJ5B 3RY4A 3MUGA 4GAYB 4JGUA 3UEZA 1RJYB 1FC1A 1BIIA 3ULUH 1JWUA 1ES0A 3ZMRA 3ZKSD 5JOPD 1QR1B 3WKNA 4LVNB 3ULSA 4R9HA 1G7IA 4UT7L 3INUH 4X4MA 5C0GA 5HHOE 2E9BA 4GXUN 4LP4A 1JGLH 2DS4A 4MJIE 4QWWC 4QRQA 2BDNH 1NFDE 1A9EA 3GSNH 3W39A 3G6DH 5K93A 4DFIA 3VMNA 1UXWB 4W6XB 5AWNL 1J8KA 5DK0A 5TE4H 3TZVB 2F5BH 2PYFB 2DIAA 3HMXL 2V7HB 3FB5B 4Y89A 2R2EB 5M7QA 3HUJF 3TBWA 2RFXA 4ODWA 3T3PE 1J9CT 1G7LB 5B3NA 1F02I 5KVDH 2UYLB 4QTHA 3BZFA 3PE9A 2GFBA 3CC5B 1WT5A 1J5OH 4MS8D 2A6JA 4X6CB 4NT6B 1EEUA 4MA1C 5JMRA 4QRPE 4AQ1B 1A0QL 4V1DA 1OQXA 3S96A 4N68A 1KCLA 2GJ6E 3LSOB 5JXEC 4J8RA 2NY5H 1LP9B 4HS8H 1QHOA 1WWBX 5DR5H 5F88B 1CK0H 3C8DA 3O3EA 2VZTA 3NABL 4Q0XH 2ZUYA 3MLSH 5C0RH 4F7CA 1MJ8H 2DJSA 3EHBD 2BJMH 2WIMA 3KYKL 1NFIB 4XPBL 4AMKH 3KNBA 4KKBD 1W72B 2DQGH 2W65A 3J7HA 4NRYB 1ZANL 4NZDA 5B3JE 4LCUB 3S97C 4F57L 2BVQA 1P5UA 2YZ8A 5CJBA 3RZCA 2R23A 4NNPH 3CDFA 3P9LB 1GL4B 1MWAA 3HAEA 5LGHL 2DQJH 5TF0A 3TIDA 2GEEA 2NMSA 4P4KC 5IR1A 4HJGA 3I75A 4FQIH 3CSPA 1RIUH 4KHTH 2ZG2A 2HRLA 4M8VA 2CDGB 4I2XA 5C1MB 1UXSB 5ANMB 5I1KL 1CLZL 3G6JF 2E8YA 4EEEA 1Q9WA 1BGXH 4U2ZA 5FB8A 2FJGB 4FFYL 4MAUH 3RVXD 2GYSA 2BHUA 3TH2T 3VFWB 3FOMB 2CXGA 4KUZL 3T2NL 2K7QA 4G7YL 2EDQA 1B3JA 2XWBA 5IBLC 3WE6A 4M7ZC 2NTFA 4Y5VA 2DOCA 4Q74A 4O4YH 1EEZB 4NUJB 3DRTA 1W0WB 2XY1A 1A3RH 4LQFL 4JFED 2R15A 1OTUC 2Z93A 1A3LH 3EFFA 1AQKH 4HH8A 4I0KA 4KVCL 1GCFA 2FZ3B 5EFIB 4PGCB 4DQOL 1O7VA 2A2QT 4P2OC 3GIVA 4WWKD 1RZGA 3RZCC 1HSAB 5IT2L 4RMVA 3UROR 5M95B 4MD5A 5EG6C 1RY7B 3BVNB 4NQCD 5J3HC 3WFCL 2DI9A 4JANA 4MCYB 3ARYA 5E4EC 5MERB 4L3EA 4HD9A 1RFDH 4IRJB 4XC1L 2RHEA 3QHZL 3CLFL 4JLRA 4MB3A 1S78D 4MWFB 4R3SB 2Y6SC 4LPWA 5GGTL 1IQWL 2BOCB 1JI1A 1BBJB 5DD0H 1HDMB 1YYLH 5CLTA 2V5MA 3ARDC 3GGWB 1M7DB 5DA0B 4YHZL 2VDPH 3OGCA 5KSVA 4Y4KA 5DC4B 4HG4K 5D7LB 4PJ7A 1P4LB 3D87B 4HUKB 5D5ME 1T1YA 4UTAH 2OX5A 1QBLH 4J12A 4ZD3H 3KDMB 3HE6B 1MVFA 4LPYA 1UH3A 5AD0A 5T3ZH 5J1AA 1PEZA 4GXUM 1HYSC 5HHNA 3L95A 2CKBH 2CLRB 3V7AE 1OAQL 3MRLB 1F8TH 2B1AH 1ZGLM 5HGDA 3TO4C 3TVMB 3MNWB 3PL6B 2AV7A 5FKPA 2AK1L 4GAJH 4EDWL 1NDGA 3LRSB 1RUPH 2VLLB 2VDNH 1I8LC 2R1YA 4JY6B 5FYKE 5LGJB 2JJSA 5JPNA 2UUDH 4JRYA 1GYAA 3O41B 1WFNA 3BKCH 4F7PB 5IMMA 4NYLB 3MNZA 1XF4B 2IAMA 2A38A 4UMGA 4WFEE 1SJVA 4K3JL 3RTQC 2WUBL 4PJGB 3BP5B 4PRNA 4JO3H 2PTUA 4FQHA 4NP4H 4M3JA 2CMRH 2IBZY 2W9DL 2YA1A 5JW4Q 4Y4KC 2MTPA 2JCCB 4X6BB 5D2NA 3O2VL 3BGFB 2J88H 4QHMA 1J88A 4JHBA 2YBRB 1T4KA 1BWWA 2NXYC 5J0BA 5FEBA 2LQRA 4OF7A 3L3DB 1GC1H 3W2DL 1NBQA 3G6JE 1GGIH 2ID5A 1UZ8B 3NFPB 5INCB 5F21B 1CE1L 2CPCA 3REVA 4OLXH 1N7MH 4XH2B 3TA3D 1IZKA 1BEYH 1D9KA 1Q9KA 2R56L 3KPOB 4D2NA 1CXFA 4X7FC 3G6AB 2QQLH 5HHOA 2NY4B 2W0KA 5JDSB 1EBAA 4WUUB 3BP4B 1I8MA 1VEMA 1BMGA 4MJIA 3ULUD 3DUSA 3EYOB 4ACPA 4LU5H 1SMOA 1NFDA 5IHZA 4OV5A 4PB0H 5DHYA 3UC0L 1V3KA 1D5BB 1DUZB 1FLRL 4MQSB 5T1KB 2GTWB 2EDTA 5EU6A 4G8IA 2FH6A 5GGUB 4IMKA 3UPAA 5FV1L 3FMGH 1NH6A 2FD6L 3QG7L 2VLJB 2VDOL 3IFNH 1FN4B 1JRHI 5DMYA 1MJJB 4MA7H 1ZHKB 2C7UA 5DJAA 2F8VA 4KDVA 5D1QB 6CGTA 3RWEB 5CWSB 5KVFL 2AK4E 3ARFB 3I50L 4HUNB 4OZFB 3HRPA 1DBAH 4RA3A 4YDIH 2Z8VC 4HHAA 3VI3F 4JHWH 3G5VA 5T5FH 1SEBB 1IGJA 2F53B 5K9OA 4GG6F 3REWA 1KPRA 2W0FA 1KUMA 4QRPA 1MVUB 4HZLA 2B8OT 2AKRB 3QZWG 5JA8B 5JQHC 4RZCB 1QYGL 2GJ6A 3ROOA 3QI9D 2X1XR 4WO4B 4NQVB 2QQKL 1E4WL 1XGRB 4OSUH 1S8DB 3RIAF 4KXZI 2GUOB 1X5XA 5CP3A 1XGPB 4HCRL 3BESR 1JTTA 2FLRT 1TZGH 3W0WB 3SGEH 2GKIA 5I1IH 3FN0H 3QO0A 1T0MB 1J10A 4CVWA 5CLWA 1UJ3A 2X89A 1B88A 4PBVC 3HZKB 4IMKC 2P7TB 1H3VA 4CW1A 2E27L 3H9SB 5FDWB 1VPOH 1A7QH 3HCVB 4KK8C 1CFTB 4KU1A 5EZOL 4YE4H 3CMOH 4QY8A 2FBOJ 4IBLT 1NSNL 2OZ4L 4BZ2L 2HTKC 3Q48A 5E6IC 5K59F 3RWHB 3BKJH 4QHUA 4Y4HB 3OKOA 4POZD 4LDOB 1DQLH 3RZWA 2R1XB 3BKMH 4ZAKB 5D96B 5FYJE 3RI5F 4ALAH 4PJDB 4JR9L 5E8OA 5BJTB 2JK5B 1L0YA 4NQSA 1WSST 4UDTA 1SYVB 3U1SH 1F4YL 4F15C 4XWOC 3A67H 3UTQB 3CCHB 5DMIH 4QHKI 5EDXA 2D0FA 3RWDA 3RL1B 2GK0B 3TCXA 4PR5B 5J56B 4O58L 3UTZA 5J4MA 3TESA 1A7OL 3IXAB 1OSZB 4OZGB 1G9EA 1KLFA 3D39E 5C07B 1X5IA 5E9DD 4MDIB 3BD3A 2DTMH 3K3QA 4KZDH 5GGRY 5KG9B 2DQTL 4LLYB 4ELMB 5J6GA 4RMTA 4L29A 4JN2A 2DQIL 4PJBB 4M1GL 2ZUQB 3O6MH 1YNLH 3GMOB 1CFQA 1SM3H 3DNKA 4H5SA 5CGYD 5EN2A 2DM3A 4MCZA 5BV7H 1IAIL 4Q9CA 1E28B 3SE9H 2BOBA 2DKMA 4YGAB 5C3TA 1OM3H 4TTGA 4G6JH 3DYOA 2QQQA 3KJ4C 4Y0GA 3WJLA 1HWHB 4S10A 4J1UB 4K3HA 5EIIB 3T0BA 3KPRB 3L5IA 4IRSD 3HPJA 5K9KA 1U6AH 5FO7B 3ECBA 3VFGL 3WV0A 1BX2A 2PXYD 1DVFA 5KVEH 4M6ML 2DQFA 4R4FL 3VG9C 4RAHA 2IC2A 4LKXA 3MLWL 5AEAA 4NZRL 5D5MA 4XNZC 5J9PA 3RGHA 1FFOB 1BFOA 5E7FA 4HXBL 3SDXF 1MI5B 1HYRC 4WHTB 4MQXD 4XVSL 4QLRA 1HI6A 5EUOE 2AERT 2XWTA 3JWDH 4P9HH 4TUKH 3VMOA 3M1BB 4PRDA 2ATKB 1CN4A 12E8L 4GFTB 2DM2A 3GUTA 1FZMA 1T66C 4NRZB 5DD3L 2LABA 1AC6A 4Y2OA 5T3ZD 2B0SL 2EC8A 4XI5C 4FFWD 4R26L 1CU4L 1A4KA 5I71C 3WJLC 3LHPH 3S34L 1QEWB 1AD0B 3BDXA 1J1OH 1XMWA 3EIFA 3WYRA 3QUKA 5L2KD 2V2WB 1BLNA 2DIBA 4GOSA 5I1JH 4A6YA 2J6EL 5DVOA 1G9NL 2ESVB 4N0FB 3L9RA 4ZUSA 1T7VA 2X4QB 1B9ZA 4D9RD 1IM3B 2AW2A 2GW5A 4DAGL 1QRNB 5EBWB 1G7MA 5K59E 4KWUA 1UEYA 4P3CL 3G6JA 1NAMH 3IDJA 3CXDH 1XIWA 3V4VH 2HFTA 1W0YT 1KF9B 1WTLA 3QQ3B 1AO7A 3ZSSA 3RWGB 3QXDB 2V9RA 1X4XA 3MRFB 1KBGL 2HWZL 3U7WH 3KR3H 4BZYA 1R0AL 2IALB 3MOAL 3GJFK 5F8QC 1UACH 4KRPB 4YIQB 1E27A 1H15B 1V3LA 3U46B 1EGJA 1S7RB 3LV3A 3FZUC 1XR9B 5DS8A 4IHOB 1TPXC 4GRLC 4PV8A 2J8UE 1EZVX 3V8OA 1TQCC 5DUPL 3RVWC 1SY6A 3O9WC 4XGZA 4CMMA 1NUDA 1VGKB 3MLTB 2XN9B 3QUMB 4GUPA 4NCC1 2EYSB 3OR7B 5D1XA 5A2KH 2ED7A 5IFJB 1UH4A 3P0YL 3BD4A 3QPQC 3DVGB 4GMTH 2F5AH 1MHPL 2AK4A 2H2SC 2XZAH 3VFPA 2NX5E 3NN8A 4KJQC 5F72S 1RZKC 3OAYK 2WWMC 5GXBB 1N0XH 4D9QD 2ZSWA 3R06B 4Z7VA 1I1RA 4U1JA 3BAEL 5JXAH 3KVQA 1G6RA 5KSAD 3KPMA 1U8OB 4XP6L 5IROC 4ZOCA 1XGTB 3HB3D 4ZG1A 4OLVH 1V5JA 5K9QI 1DR9A 3KPPB 3B9VA 4PTUB 2HRPL 3O6KH 2X05A 3SDXE 4CU7A 5DJYB 4NUGL 1FIGH 1H3PL 4JM2D 4G3YL 4U1LB 2B1HH 1H0DB 3IU4H 5ESVB 4KHXL 4YUEH 3VRIA 2DD8L 3P0VH 3D2UD 1KJ2L 5KTEL 5D1XC 4JFOB 3H9ZA 3MV9D 5MEOB 5HVFB 4TOYL 1DLHA 5I30L 5SX5K 4PRAB 3RP1A 3HNVH 1BQUA 3LQAH 4P99A 4M93B 1Q0XL 1MCEA 3ELAT 3S3JA 1EVUA 1LE9A 2BMKA 3SDCC 3OJDB 5T1DH 1QQDA 3TPKA 1NGQH 5E2WH 4B50A 4P46D 1ADQH 1KJVA 15C8H 1QR4A 3WSQL 2Y07L 3EOBB 1MLBB 2RBLA 4PJXA 3IRZA 5HGHB 4MB5A 3X13B 4I0PA 1PVHA 1V7NH 4U1IB 5C2UB 1P9MA 4U2YA 1YN7B 2V7NA 1FV1B 3CH8A 5ESAA 4C56B 1RIVH 4CNIB 1ZLSL 4X4XA 5ITBL 3P4MB 3IJYA 3QO1A 5IFAL 1MIMH 2EO9A 3CVHA 3DX8B 5GRZA 3BWAB 1NGZA 3D39A 4QRRB 3S35X 3R1GH 2DQEL 5IHUH 5IEHB 1FJ1A 4PJHA 4OQ1A 1N6QL 1Y18A 5IBUB 2PUQT 4XP4H 2MWCA 4FQCH 5HI4D 3V6BR 2Z31A 3GI8H 1W72H 2VNCA 1MUJA 1U8NB 1R24B 2WBWB 1S9VB 2XTJE 4O5LL 4PRHB 4R4BB 5HYSA 1T2QL 3SGDH 4PJFF 3EYUH 5FK9A 2O5ZL 2ZCLH 3HS0B 1E4XH 4GRWH 4LAJH 1F58H 4JFDE 4RMUA 5DDHA 1NC2A 1WLHA 4XVTH 1EJ6A 4YHNA 1B0GA 4L3CA 5C0FA 4DKFL 3MOBL 2I5YL 2EYRB 2LTQC 4G43A 4NC1E 1NCNA 3CUPB 4BSVA 4EZMA 5ACZB 5E08H 4QHLA 4UTBH 5F9JB 5F3BA 4I0PC 3O3DA 3SE3C 5F7DA 1P9MC 1FG2B 1QLEL 3AUVA 2XIDA 1K85A 1TTUA 3MRPA 4MZ2A 2D7TL 1OLLA 4TTDD 2JTDA 2DQDH 1NCAH 25C8H 4U7SA 5FECB 3CVIL 5FM8A 4XP9L 3MR9A 3DETC 1FH5H 1IGYA 4KMQA 1M05A 3TN0A 2B4CC 2J8OA 2RJMA 3B8YA 3JV0A 4WFHE 5EUOA 2H45A 2A6IB 1RZIA 3GSRA 3VGEA 1N5AA 2BHYA 4DZ8B 3D0VA 2A6KB 5L88H 4PREB 2AXJA 1T04A 2EDHA 4PIRF 1U3HA 4AENA 3CU7A 2ZUXA 3RWIB 1M4KA 1X5AA 3ES6A 1S5HA 3CX5J 4ODBD 4MYWB 3SKOB 5IEKB 5I8EA 1KLUB 1TQBC 5D2LE 1DEEA 3GB7A 4HUVA 5I6XC 3OKDB 5MHSD 5T1MB 5E5MB 1MH5A 1CL7I 4OB5L 2FB4H 1TENA 3TCLA 1R3JA 5FYLH 4NJAH 2HT2D 1UEMA 4LLVA 3VXME 4EDXA 2GK2A 4PJ8A 1ZEAH 5F7EH 5AYUL 5K9JH 4FABH 1P4IL 1WZ1H 4MJ4A 3VGAB 3ZTJH 4M6OH 1YA5A 2B2XL 4GKZB 5DQDL 1DQDH 3RU8H 3CH1B 1BOGB 3IU3A 1K8DA 3H9HB 4OGYH 5F3HB 2PNDA 1CR9H 3O6FD 4U1MB 5HHXL 4Y1AE 4MD0A 1WUNT 2VSDA 1U3HC 2ZUUA 3ILPA 3MYJB 1JNJA 2H9GB 4M02A 4GW1B 1VFOA 3MA7A 4O02L 4FQJL 1DJSA 3KXFD 4NBZB 3PWLB 3F7YA 3ZO0A 3B8SA 1U8PB 4RBPH 5KS9F 1BZ9B 2IFFH 4OD1H 4XTRC 1A6UH 4C59B 2EXWC 4BFBD 1O5DT 1E6JH 1MELA 2FNBA 1GOHA 3KPQB 3MBEA 3QUYC 5IJVB 2HP4A 5J6HA 4PJFE 2AI0H 2J8UA 3P0GB 4FQ1H 4EN3B 1I1AA 1YECH 4FG6C 1N6VA 3GEWB 4PB9H 4U49A 1MCOL 2VQ1A 5KAQF 1KELL 2PO6C 4YFEA 1S9XA 1LEKA 2NX5A 2GQHA 1IFHH 1DFBH 3SE8H 4WCYH 1B4JL 4YZFF 1XF3A 4JPVL 3I84A 2D03L 2EDDA 3EDFA 5JOEA 4EQ2A 4HMCA 5H94B 3WHE0 1NLDL 4AZ8A 2VLKB 3S5LB 3L3HA 2HKFH 3UO1L 1JWMB 5FOBB 1BQHA 3EJJX 3WIFB 3FQNA 1JPST 4J3OC 2DYPD 5E8NA 4OZHF 1BIIB 1JWUB 4OFYD 4LHJB 1ES0B 3SDXA 4AG4H 2R0ZH 4MA1B 3MBEC 3RA7L 3ULSB 5C0GB 2BFVH 4TRPH 4U6VL 3F8UB 2FX7H 1MQKH 5E2UL 1GIGL 4QRQB 5DGRA 5C0JA 1N5YH 1I8KB 2FO4A 4D3CH 1OAXL 4BSWA 1EUUA 1A9EB 3MTRA 2DLIA 4OCXL 4OLYH 5J1TC 4XAWH 4AH2A 3UTPE 2R4SL 5DMGD 5GGTA 3W39B 1VFAA 1MFAL 4QXGL 3B9KD 4EOWH 4Z6AT 4I3GA 4PJIF 3HG1E 4FHBD 4OZFH 3O0RH 1HXMA 4P23A 3NA9H 4KJPD 4OF5A 3OV6A 1JF5A 3TZVD 4XWGL 2JJVA 2O5XL 3TBWB 4YXKH 2JIXA 2DLFH 1IKFH 3HLAA 4ODWB 3ZE1E 5TDNA 4YHYC 3LKQA 4QTHB 2ICWJ 3BZFB 3JUYA 2GFBB 2KL6A 5CCKH 3ISWA 4DN4H 1DQTA 1A6TA 2A6JB 3STLB 3QCVL 3OG6B 3PWJA 1FZOA 2Y06L 4Y8DC 1AI1H 1LK3H 2DWEA 3K8MA 1JRHL 2YD1A 4V1DB 3FFDA 3PABB 1QFUL 4ODSL 1ACYL 5E8DH 1QSFA 1IQDA 4M7ZB 3C08H 5I18L 1TVDA 1UVQA 3O3EB 2CDFB 5BRZD 3IXTA 2CR6A 4F7CB 4F8TA 2HMID 2E7HA 4JFDA 2B7DT 2YN5A 3KNBB 2W65B 3TO2A 1F3JA 4ZXBC 5KS9E 1D6EA 4HJ0D 3SKUD 3S88H 1AQDA 2BVQB 3DUUA 4K94L 4P23C 4P2OB 1HNGA 3E2HC 3RZCB 2R23B 1FFPA 4UOW0 3AM8A 3BDYL 3HAEB 7FABH 5JDJA 2LFGA 4N5ED 3ZT7A 1Q72L 5ILTH 3TIDB 5IR1B 3FCTA 4HJGB 3I75B 2IADA 2ICES 3DX6A 5L8JB 5E4EB 2YPLE 3DVNA 1KTDB 3PV7A 2UZIL 2F74B 4MQTB 4WI3A 1BQLL 1CBVL 5FB8B 3O45A 1XZ0A 1YEDA 5GISL 1I9EA 2WW8A 3MRDA 1OPGH 3GI9H 4I4WA 1A02N 3MLZH 4ZPTA 2OJEA 4NWTL 4PPTA 1G0XA 2XWBB 2XTJC 4G6KL 3WE6B 2NTFB 4Y5VB 3ZKXB 4RIRA 3DRTB 1IGCH 3IS1X 1IVLA 2XKUA 4HGWA 5F7FA 1J8HB 4ETQA 2Z93B 3EFFB 4NM8H 4NO5A 4OZHE 1OTSD 1P84K 2NPLX 2DM4A 1CIUA 3BRDA 3GIVB 4NC1C 2GT9A 3P11H 5D2LA 1RZGB 4AY0A 5I66A 4MD5B 3AM8C 3FB8A 1A1OA 2EZ0C 3HNTL 4JANB 1ZA3B 3OAZK 4L3EB 2FL5A 2WUCH 2FSEA 1HILA 2FRGP 4JLRB 5E00B 2NZ9D 3VXMA 4IRJD 5CJ5A 1VEPA 4OCSL 3V0WH 4LLWA 1M7IA 4CVXA 4GMSH 1RSFA 1KTRL 3RTQB 3OGCB 2EECA 4KTYA 5KSVB 5ABDE 5FYLD 4Y4KB 2VSCA 5E56A 4PJ7B 4HCRA 3NBNA 1SQ2N 4XZUA 4MB4A 1T1YB 4Y1AA 2NXYB 5D7LD 3VA2C 4LHUG 4HWZA 4HIXL 5AD0B 5FGRA 5GS3A 4K9EH 3EOYG 5J1AB 3SEPA 2G9HA 3HE6D 3BW9A 3PP4H 1FL3A 3QZWA 4S0SD 4WI6A 5HHNB 3L95B 3T3MF 3TJEL 3VH8G 2IQAA 4PLKD 3B9DA 3HPLA 4NO0D 4JKWA 2J2ZA 1WEJH 5HGDB 4QXUL 1JTPA 5I1CL 2E7CA 1OP3K 5ELIA 2AV7B 1UWXK 4PJFA 4X99A 1NDGB 5AZ2L 3TVMD 3STZA 2YK1H 3TEUA 2OZ4A 3PL6D 5JPNB 1PLGL 4LLMA 5ENWA 3RUGF 5L9DH 3MRJA 4NZTH 3U83A 5K33A 4HXAL 4HC1L 5IW6A 5IMMB 2FWOB 3MNZB 2F15A 2IAMB 3VE0A 3BUYA 4I77L 1YEHL 1NL0H 1RZJH 2IQ9L 1AR2A 4PRNB 4U1NA 4FQHB 1NBVH 3V4UL 3MROA 5SWZE 3RHWF 4AEEA 3V6OE 5D2NB 1TJHL 2EICA 4J6RL 4QHMB 4WHYH 5GRVK 5D6DA 3IB4A 3C6LA 5F7MC 2ADIA 3KYMA 1I3UA 3B6SA 1G6VK 2A73A 2BRRH 5GS0H 2VH5H 3ARPA 2CK2A 3WIIL 3OSKA 1U2HA 2K1MA 4E0RA 3REVB 1JVKA 4OLEA 3QPXH 1D9KB 4XXDB 3VGBA 1Q9KB 4XX1G 2P43B 2CJUH 4M1DH 5HHOB 1AXTH 4PLJD 4G5ZL 1QO3B 1R3LA 4L5FL 4GXVL 1I8MB 1FAKT 1XGYH 4NKQB 2AGJL 4KI5F 4PGEA 4MJIB 3VFOA 3DUSB 3JV4A 4WUUD 1F3DJ 2PTVA 1NFDB 5FDYA 1UENA 2AABL 5IHZB 4OV5B 2R2BA 5DHYB 2N4IA 2ZJSH 4HT1L 3UZVB 5CILH 3GSXA 1KXVC 5EU6B 2UZXB 4G8IB 4ZS6D 1QSEE 2ZCHL 3RIFF 3HG1A 2OXHA 1H9VA 1S7QB 2MOVA 5T1KD 4JFFA 3CFEA 5HDBE 3LEVL 3TF7C 1HHIA 1EUTA 5ADOH 4P5MA 2JJTA 1JCKA 3C6LC 2C7UB 5DJAB 4UT9H 1U95B 4M9PA 2M2DA 4GS7B 4HHAB 1NEUA 3G5VB 1FO0L 5D1QD 1AJ7L 1E4KC 1IGJB 3ARFD 4ZQKA 1X4YA 4RNRA 3QBTB 3REWB 4GSDH 2JB5L 1KPRB 2EDEA 3CFBA 1WCQA 2W0FB 2F53D 4QRPB 1T22A 4HZLB 2A1WH 4PBXA 4WHCA 4OGAC 2UWEA 2GJ6B 1WZLA 3LB6D 3QCUH 4MA8H 4XCEA 5K9QG 5F1OB 3OQ3B 1T1ZA 4F8QA 4YO0A 4WO4D 4M7KH 5DT1H 1RJZA 1ZLWH 1CF8L 3QAZC 4JFPB 5C3LD 1RI8A 3QO0B 1NBZA 4M48L 5KS9A 4M6NL 3BZ4A 3C2AL 5DK3A 2E6JA 4JDZA 4OT1L 3BEVA 32C2A 2XRAL 4K8RL 5ITFA 2Q6WA 2ZPKH 4UIMA 3H9SD 4QY8B 2D7MA 3RUGE 5F9OL 3VXRE 2YPLA 2IH3A 1WC7A 3V9FA 5D7SL 5DURB 5F7WC 5JORA 2XNAA 4QHUB 3OKOB 1RZ7L 1LDPH 3KJ4B 2Q3AA 2Q76A 5I1DA 2ZUTA 2HJKB 3PQYE 3VGHA 4Y4HD 2YD8A 5E8OB 4ZAKD 4D9LL 2P24A 4NQSB 4UDTB 5I8OH 4OKVA 2DQCH 2N56A 3FQRA 2C3WA 5EC2A 3ULVL 1EPFA 1TIUA 3RWDB 4KTEH 1FL6A 3WN5A 5KZCB 4NKIH 1DBJH 1L7IH 3UTZB 6FABH 4XNZB 1Z9OA 1WIPA 4KPHL 2AJSL 4ODTH 3MA9L 3MRKA 4W6YB 4NQEE 5C07D 2YSSA 5J6GB 1OD7A 4L29B 4ONGH 4JN2B 1A14H 5E6YA 2A83A 3RVVD 3DPBA 2HT4C 1Y6NR 1CFQB 4H5SB 5EN2B 4MCZB 4OUUA 1MCPL 1BFTA 2OTPA 3H9YA 1TTGA 3ZKND 4KROC 2BOBB 3WIHA 3GSOA 2QHLA 3IDXL 3PV6A 3DVFA 4TPRH 5I71B 3BX7C 2YZ1A 4MLIA 2F58H 3UJIL 3K46A 3TV3H 5GS1A 2AEQL 5D71H 5CINL 3HPJB 5MENE 4DKEH 5K9KB 4LSVH 3TFKD 3IGAA 3ECBB 3TYGL 1Y6MR 1X44A 3KPRD 4WEBH 1BX2B 3QXVA 2AJUL 3NIDF 2DQFB 2UUDK 1MFEH 5FXCH 3OB0K 3ARQA 5D5MB 5J9PB 4ODHH 1BFOB 4D0CA 1F4HA 2L7UA 4XNMA 2Z9TA 2ICEA 1A7PL 4QRTA 3JBG7 4MMXC 3F7RA 1HI6B 1MI5D 2XWTB 4PRDB 3GNMH 4KMTL 3RJQB 3GUTB 5HHME 1FZMB 2VYRE 3QQNA 4E5XB 1XR8B 1CT8A 5F7KC 4XNUL 3NPSC 1ZK9A 3HC4H 1T0NA 4KKLD 4LCIH 4MX7B 1A4KB 2VL5A 5I15H 5IMLA 9CGTA 3B3IA 1FVDA 3ARWA 4B7IA 4WUKL 5EIQA 3QUKB 4JEGB 5GS1C 1BLNB 4JZOA 4A6YB 1BF8A 1TPXB 3L9RB 4ZUSB 5ECJE 2O26U 4YBQD 5SWZA 1HHKB 5IHBA 3RWFA 1BFSA 2ZCKL 2ESVD 5EBMA 4WV1A 4LDEB 3WS3A 4YQXL 3TBYA 4MHHI 1G7MB 5GGQH 1QRND 1VDGA 2EXYC 3QEUA 4PUBH 1A22B 3IDYC 4LQ1A 3G6JB 1CLOH 3IDJB 2P8PA 4WFFE 5F96H 3VGFA 5DEGA 4JB9H 3SJVD 3BRGC 1XIWB 2R0WH 4RMSA 3SGEI 1CL7L 4PJ9A 1HINH 1RZFH 4EBQH 2AJYL 3IAGC 4R2GB 5JW3L 4HS3A 1BJ1H 3I6KA 1T1XA 1CLCA 1TXKA 3HKFA 3QDHA 1IL1A 1F4WH 5GS0D 4XPHL 5IV2A 4YHML 3SPVA 3T4YA 4P2CG 2CQVA 2EDYA 2QV2A 5F9WC 5KANI 1HH9A 1JPTL 4ZPVA 1E27B 1A2YA 5BOPA 1PKQA 3MFFA 1BZQK 3MJ6A 3G5XA 2Q87A 3LV3B 5D7JD 5CSBA 4PGDA 3RBSA 5DS8B 4YX2H 3OAUL 4PV8B 3QRFM 1QSEA 4UIKL 1AE6H 4XGZB 1VGEH 3V6OC 3MUY1 4GUPB 4GLRH 3RGVD 2FIKA 2OP4L 4WV1C 5D1XB 2NQCA 1NCDL 3WEXA 2XN9D 3HZVA 1KB5L 1J0ZA 3FN9A 2AK4B 4F7EA 4F9PC 3VFPB 4YAQA 3O4LE 2Z8SA 1JPSL 3LIZH 3SDCB 3QEHA 4CMHC 1DL7H 4NHCL 2ZSWB 5DTFB 3QEGH 4U1JB 3IJHB 4HAFA 3KLHD 1G6RB 3KPMB 1CDBA 3NIDE 3LS5L 2XZQL 2DIJA 5I73C 1MFDH 3L3IA 2CD0A 2CKNA 4HMEA 3KS0H 1U0QA 5CIPA 4JFXA 1CD9B 4TN9A 4OCYL 2KQMA 3MLRL 3VXNA 4UUJA 1ZVSB 2YA0A 4CJ0A 1UCBH 4YR6A 3S35L 3UJTL 4LRNH 3OR6B 1BIHA 1KCUH 3VRIB 4NWUL 2C3VA 3MO1A 1GHFL 2IG2H 1D3CA 3U6RA 1KXQE 1GPOH 2NY6C 2V2XA 4PY8J 4BQ8A 4GQPH 1DLHB 2P44B 1EH9A 2BVTA 3RUGA 1K6QL 3MJ9H 3PGFL 3VXRA 4Q9RH 3FRUA 5HHVH 1LE9B 2BMKB 3IFLH 1QQDB 4NN6B 3BPCA 4X9HA 1KJVB 3JWOC 4XNQA 3PQYA 2XACC 3VXUE 4LLAA 2W0PA 4LSTL 1WJ3A 3HI1A 3LPGA 1J87A 3ROLA 3RQ3A 4HKJA 4PRID 4YHOL 4I0PB 3QIUA 5C8JA 5CHNB 2XKNA 2V7NB 5ESAB 1ZKAA 5HHPA 3CLEH 4X4XB 3VG0H 2EH8L 3QO1B 3OKLA 3CVHB 4I9WE 4C56D 1KJ3L 5IWLC 1NGZB 3D39B 3SO5A 4G80A 4HPOL 3DX7A 2NY1C 5C08A 1OGAE 2VZ1A 3F6LA 4QRRD 3SCMC 2Z31B 1MUJB 3MRCA 5HYSB 4M3KB 3ALXA 2MFNA 4HIIA 1WIUA 5FK9B 2Q8AH 5C6TL 4BKLA 4JG1H 4X6CF 3MRNA 4PRHD 5DDHB 1NC2B 4WW1A 1A6ZA 1B0GB 4L3CB 4MXWL 5C0FB 3RNKA 3QH3A 4K3EH 3VD7A 1NGYA 5CSGA 4G43B 1TQBB 3LKOA 4BSVB 3RWJA 4WNQB 5EZIL 1CIDA 1URLA 3TBTA 3MBXH 5I6XB 5JHLL 3NCYS 3U9UA 4QHLB 3CFCL 3WFHA 4M5YL 5ID0A 5MENA 5F3BB 3O3DB 2BY0A 4GKNA 3U0PB 5F7DB 4JFHD 4YWGH 3DRQA 4IOFC 1CS6A 3MRPB 1WQVT 1JV5A 3QISA 5E24E 2MNUA 5BXFA 1VENA 5IVZA 2EKJA 4R90H 5H2BA 1UA6H 5FF6B 2C4FU 3DIFA 3MR9B 1WITA 1RVFL 1YMME 3MCKB 1IGYB 1EFQA 1M05B 3VXQA 3TN0B 1MRDH 3QCTL 3Q3GA 2I9LA 2A74A 3LQZA 2HT3D 2FCBA 5EUOB 1LE5A 2V17H 4X80L 1C5DA 1I9IH 1DLFL 1MRCL 1FIEA 1JYVA 1RZIB 3GSRB 4QXTA 1FDLH 4KI5C 2Y1VA 5MP6L 1JGUL 1T04B 1U3HB 2A0LD 3GMMA 4Q6IC 4AENB 4EUPG 2VISA 1UQSA 1AFVH 4XX1E 1BP3B 2VQTA 5C0CE 3ES6B 3W11C 1S5HB 1GAFH 5I8EB 2FGZA 1DEEB 4ISVA 4XCFL 3VA6A 3GB7B 5AUMA 2ZOLB 1GZPA 3CGTA 1FE8H 5TH2A 3MYZA 2HJLA 3SGJC 1A4JA 1Z3GL 3TCLB 3Q5OA 4ODVH 1R3JB 3DSFH 5CEZL 3U36A 5BCAA 4P5TC 3UAJC 5B4MC 3TBVA 4LLVB 4L4TE 4HV8B 4EDXB 4PJ8B 1IC7H 1FGNL 4WY7L 2ORBL 1TETL 3S3SA 3RVTC 1X7QA 5DJDA 4ZFGH 1P69B 4YXLH 2X5PA 3WFDL 4H0IA 4FMFA 3MNVA 3IU3B 5DD5H 1FVCA 1K8DB 4N0YH 3RVUD 5J13C 3MV11 3EJYC 1P6AB 3V6ZA 5E2VL 2VDMH 1PSKL 2Y9RT 4MD0B 2V2TA 4YDVA 3C8KA 4K3DL 3ILPB 5IMOA 4Z7NF 1CGSH 1U3JA 2EE6A 2HVKB 3ULUL 4OQTA 1MHEB 4GBXC 2C1PA 3F7YB 5JO5A 2D7OA 2GITA 4P2RE 2H1PL 5HY9A 3MBEB 4RQQA 4DVRH 4K71C 3OL2A 1CLYH 4P48A 5CJQL 5J6HB 4DUVA 2J8UB 4WIQA 2APFA 1I1AB 3WMSA 3L5XH 1R3HA 3GK8H 2BDNL 1WAAE 2F19H 4EN3D 1NKOA 4JVWA 4BQBA 4XB8A 3G6DL 2VQ1B 2D9CA 4XMPL 4QWWD 4HULB 1S9XB 3O4LA 4ORGB 1LEKB 2NX5B 2WLYA 3L5HA 4M03A 1ZOXA 1XF3B 1OD9A 3VDCA 3GO1L 1U58A 4K2UH 2Y36L 4KRNA 2D7NA 2YMXH 4TNVK 2WINB 2EDFA 3ULVE 4GW4A 4X7SH 4GAFB 2CUHA 2NY3C 3L3HB 5KVDL 1ZHLA 1ZMYA 5GRUH 3MREA 2DL2A 3FQNB 3SGDI 3LMJH 2VLKD 3SE4A 5GJTH 3F58L 4OFIA 2QJDA 1E4XI 5DYOA 3SDAA 3OJ2C 4ZOBA 5E8NB 1AKJA 4L1DA 4H0HB 2VXTH 4K94C 3D3VD 3SDXB 1I8IA 4ETYA 3ZHDA 1L6ZA 5C0BE 3BO8A 3QUML 1MCFA 1KGCE 3CFDA 2VKXA 4HS8L 5DRWA 4DZBA 5DR5L 1SHMA 3LEYH 5GJSH 1CK0L 3ARGA 4Q0XL 3MLSL 5DVKA 5C0RL 1QP1A 5JXED 4URTB 1OCWH 2FO4B 2DQGL 3GHBH 1FAIH 5D72L 1QNZH 4ZO7A 4AH2B 1YN6A 5AAMA 2XQYG 5IW1A 4HUMB 4D94A 2SEBA 2PW2A 4PD4K 3HE7A 4WTZG 4JFYA 4NNPL 1HXMB 4P23B 4E41E 2DQJL 4NDMA 1UKSA 3VXUA 5EZJA 4E42A 2JIXB 3HLAB 3PXHA 5TDNB 4FQIL 4KJYA 5IBTH 3LKQB 1IT9H 4XPAL 1G7QA 4P2QE 1CDUA 4P4KD 1A6TB 1SVCP 4X7EC 2FH8A 4MAUL 5D6CA 1XF5B 2NY0C 1FZOB 3PWJB 1EO8L 1VADA 4MJ5A 3T08A 1KN2H 5CP3H 2DWEB 2E9IA 3FFDB 5EOQL 5C9JA 1OGAA 5I75C 2DLEA 1TNNA 4OF6A 1IQDB 4AEHH 3GBNH 2XTJB 5B38G 1L0QA 3ARGC 3IDMA 1A3RL 4LHUA 4Z7NE 4OCRL 1YEJH 5IBLD 1AQKL 3IXTB 5GRYA 5DLML 3H0TA 4JFDB 3VH8A 4FTVD 1SJEA 1YEKL 5CD3A 4AIOA 1F3JB 4I48A 1D6EB 3ZDXE 1OTUD 3QWRA 5DF0A 5CSZB 3B9EA 5IBUG 4FFVC 3DUUB 3FFCA 2B5IC 1FFPB 2JELH 4P2OD 1MIEH 5I9QB 1IEAA 1I4FB 1F13A 3RZCD 3FCTB 2IADB 3DX6B 2VOTA 4HKXB 4JM4H 2BNRE 5JUEL 1F3RB 5MEPA 3DVNB 2V5RA 1C16A 4DK6A 3GJFA 5J3HD 1L9NA 1PW3A 1YJDL 1GSMA 1YC7A 4RX4A 5KW9H 2DI7A 4ZUVA 5DD0L 2BCKA 4Z5RA 1YYLL 5T33L 1XZ0B 4HWBH 4JHAL 1YEDB 4YHPA 4X7TA 3MRDB 3V2AR 4APQA 4I4WB 1UGNA 1YMMA 2CR3A 2Y6SD 4JREB 4ZPTB 5ICYA 2OJEB 2VDRH 5J57B 4MVBC 3SBWA 4NGHH 1LK2A 3PJSA 3ARDD 1NMBH 4RIRB 1C12A 1F97A 1QBLL 4HGWB 4ETQB 1IJ9A 4NO5B 2X9WA 2KBGA 2A9ML 1H8SA 1U2CA 1J8HD 5C0CA 4XCCH 2CKBL 2IANE 3BE1H 4RAUA 1F8TL 2D31A 2GT9B 2B1AL 5D2LB 4NFCA 1MEXH 4UOW1 4HW6A 3OF6A 3FB8B 1A1OB 1XGUA 5HI5C 3UMTA 2O93L 1KJMA 5GRJH 4OZGF 2FL5B 5E1HB 1CXHA 2FSEB 1VFBA 5D8JH 1HILB 4L3ED 1FO0A 4L4TA 2D2OA 5TE7H 3VXMB 1M7IB 5KBNC 2ZKHH 4APQC 4JO3L 2WAHA 4NP4L 2OL3A 2CMRL 2GTZA 4OLZL 5DJ0A 2QBWA 2J88L 3RTQD 1JF1B 3FHQA 4UAOC 4Y4KD 2P49B 4XZUB 1JGVH 4Y1AB 4QHKJ 3B2VH 1OGTA 3FAXA 4HWZB 1CG9A 4JGMA 2NXYD 2D9QB 4DGYH 4PGJA 1J86A 4OLXL 4Y2DA 3BW9B 1I3RA 1FL3B 2K7PA 3QZWB 4PGZA 1BEYL 4KKCC 2IQAB 2NY7H 3U9PH 4ZMAT 3HPLB 4P2RA 2AVGA 3LOWA 3UTSE 5CBAA 1IKNA 4X99B 3M45A 4PJFB 1JNNH 1FHGA 4N0CC 2WBJA 2FGWL 3STZB 1WBYA 4LU5L 4LLMB 5ENWB 2OMBA 4NN5C 3MRJB 3V52L 5F7UA 3PWNA 4MXVF 1WAAA 4LLDA 3DXAE 5IW6B 1DANT 1YMHA 2OTUA 2JF1A 2IFGA 4H1LA 4KQ3H 3VE0B 3BUYB 4XPFH 5KSUA 4H26A 4N1EA 3BWUC 3FMGL 4IIQA 3MROB 3IFNL 5GZOC 1GGCL 1JK8A 2XI9A 1QRKA 2V6HA 3IDGA 2WWKT 4MHHG 3C6LB 2ENYA 2ADIB 3KYMB 1RZKH 1DBAL 2A73B 4P57B 4YDIL 5CZKA 2DDQH 4JHWL 2B20A 2XWJA 4KKAC 1NGXA 3K80A 4E0RB 2P5EE 1JHLL 4RFOL 1Q9LA 3F7PC 3MCLH 1D6VL 1VESA 5C0BA 4K8RC 3QDME 5E8PB 1A7BA 1T83A 3IFOA 4OSUL 4LFHD 4KK5C 3IFPA 1NUFA 1R3LB 3MZTA 4U6YA 2Z91B 5HHOD 1T2JA 4PGEB 5E99H 3VFOB 5JNYA 3JV4B 5KANG 4WI2A 1INQA 5I1IL 3FN0L 1SY6H 3LH2H 2R2BB 3HRZA 1RJCA 4FQ2H 4G8FA 2PYED 2FDBP 3T0EE 4HUUA 5ALCH 3BXNB 3HG1B 1PYWB 1VPOL 2HH0H 4JFFB 3CFEB 2Z4QA 4E41A 4U4BA 4YE4L 3IAPA 1HHIB 3QT2A 3CMOL 4P5MB 4CVUA 3NFSH 4K55A 4PY7A 4OM1H 4JO4H 1DP0A 4KK8D 4P2QA 2MJWA 3RWCA 3PWVA 2PR4H 1DQLL 3O3BA 3BKML 5GGSY 4RNRB 2ARWA 1F00I 1O0VA 1NCBH 3CFBB 1CDCA 5E6ID 1T22B 5EBGA 3K4ZA 4LASH 2H8PA 2IH1A 5D70H 1I1YB 3U1SL 4NOBA 3A67L 4QRPD 4XCEB 1IC4L 1T1ZB 5DMIL 4KAQH 1U3ZA 2GJ6D 4YO0B 1YNKH 1RAMA 2WZPD 3BHBA 3V4PL 1JNLL 1KENH 2C3GA 1RJZB 4WDIB 2QR0A 1B0WA 1KIPB 1JTOA 4XWOD 4LSQH 3BGAA 5IM7B 1OT1A 4L8CA 1A6WL 4A2LA 1NBZB 5D1ZA 5KS9B 3BZ4B 3PF2A 3NAAH 1RURH 3BEVB 2HA1A 2EE2A 5CEZE 32C2B 5F1KC 5ITFB 2Q6WB 1RHFA 1YNLL 3QNYA 1C5CH 3EKCA 3SE9L 2BNRA 4X6FA 2YPLB 2IH3B 1RK1A 1HHGA 3ET9F 4G6JL 4P3DA 5JORB 2XNAB 1FORH 2Q76B 4EXPX 5I1DB 4TVPH 2VZ3A 1JL8A 1XH3A 3ZKMC 5F6HI 2HFFB 3CVHH 1U6AL 2P24B 1TJGH 1IGTA 5KVEL 1OAUH 1W8NA 2VIRA 1RQ5A 3H42H 3OMZA 3ULUE 1FL6B 4HIHA 3WN5B 4XVJL 1FQ9C 2WQ8A 4TSCH 2B4CH 3RDTA 3OKYA 4OZHB 1MY5A 5KZCD 5D1ZC 3QP3A 4OCMC 4P3WA 4GH7B 4TUJA 2IANA 1KCKA 1MWAL 4QOKD 4YGVA 2C1OA 1A9BA 4P9HL 3LVEA 5DMJB 1UWEL 4H25A 2C5DC 1J1XH 4OUUB 2IGFH 3QIBA 4PD4J 1KB5A 3NPSB 1JBJA 2LU4A 2VLMD 4N5UA 1T66D 3GSOB 3LHPL 3PV6B 3ZTNH 4HQQH 3ZHKA 4XI5D 3ZE2F 1R3IH 3BT2H 2AP2A 1BJMA 1YY9C 3T2QA 5GS1B 5BVJA 3IGAB 1OP5H 5DJXB 3BEWA 3ZE0F 3RDTC 1NAML 3GMNA 1KCRL 3MFGB 1P53A 1KEMH 4G9FE 5AYQA 4D0CB 1CTNA 4IMLA 4ELKB 4XNMB 2ICEB 4HF5H 4QRTB 4J3VA 3PUCA 2E6PA 4R6UA 4OD2A 1KJ2B 1MRFH 2CO7B 3UTSA 5AWNH 3AMKA 3EDKA 4M7LH 1UB6A 1CT8B 3ABZA 3AY4A 3QIBC 3ARRA 1U91A 2AV1A 3HMXH 1T0NB 3P3YA 4EI6A 3MC0A 1UACL 2VL5B 5IMLB 2EO1A 3B3IB 1FVDB 4EIGB 5C0NC 3DXAA 5FYKD 5IJKC 2YEZA 4P59H 2NY4C 5DSCA 5IVXF 3HC3H 2CRYA 4CAGA 1OSPL 1PFCA 1CGXA 5SWZB 4F37F 3RWFB 3FZUD 5EBMB 4OFPA 1A0QH 4GRLD 4WV1B 4GMTL 3WS3B 3RVWD 3TBYB 5IQ9A 3O9WD 2FX9L 3ARUA 2XZAL 1S7VA 3QEUB 4PP1C 2VUYA 2P8PB 1KC5L 3QPQD 5DEGB 5EU7E 2P5EA 1N0XL 4CMHB 4PJ9B 4BH7A 2H2SD 5JXAL 4XPBH 3CZJA 4WWKA 5IVOA 1ZANH 4KJQD 3WKML 4HS3B 5BS0E 2WWMD 3I6KB 1T1XB 1T20A 3AY4C 4NQCA 1IL1B 1A1MA 4MA3A 1NKRA 1CZ8L 5D4QA 3UBXI 5IV2B 4FXGA 2MSPA 4NHUA 3SPVB 3O6KL 3T4YB 3F7QA 5LGHH 4AYFA 4LCWE 3IETA 1HH9B 1K2DA 4ZPVB 1T21A 1A2YB 1NC4A 3MRMA 1FIGL 3MFFB 2B1HL 3G5XB 1H3WM 4YUEL 4PGDB 3T0EA 3P0VL 1LILA 4X7CC 5I1KH 3JSSA 4CN4A 1JFQH 1QSEB 3K2UL 1FVEA 2Z8RA 5SX5H 5HGBA 1HIML 2FIKB 3T2NH 3ETBF 2NY6B 3WEXB 3HNVL 5IGXL 3LQAL 4Y7MA 4Q2ZA 1ZLWK 5D1XD 4HLZG 4F7EB 3V6FA 1XF2A 4DGIH 5E94A 4YAQB 1NGQL 5E2WL 1ADQL 3EDJA 3QEHB 4U33A 4LQFH 3AS1A 4D8PA 1Z2KA 2JLLA 3SDCD 4KVCH 5I8CA 4DQOH 5I17A 3MRQA 5DWUH 4Z77A 1DBKL 1K4DA 3ZE0E 4PJCF 2VXSH 2PF6A 5IT2H 5D96C 2A9NH 3QEQE 1MIML 4A2MA 3LRGA 3WS6C 2E5EA 3VMPA 3C09C 3OKMA 3WFCH 5CIPB 4JFXB 1PX3A 2Y5EA 3R1GL 3VXNB 4UUJB 4XC1H 1YPZE 3QHZH 3CLFH 4FQCL 4XP4L 4XP1L 2NR6C 4YR6B 3T0EC 4RGMC 3GI8L 1KACB 2C3VB 4OTXH 3SCMB 4HK0B 1IQWH 3MO1B 3EYUL 3DARA 2BNQE 3U6RB 1E4XL 4EUPA 4HK3N 1TLKA 1F58L 4YHZH 4XVTL 3RUGB 3MOQA 3VXRB 1EV2E 3NCFB 3UDWA 3FRUB 2FHBA 1RUQH 4G42A 4DFHA 3DLQR 4KTDL 5IVXE 4OAWA 1CXKA 4YJZL 4XNQB 5IB3A 2XV6B 4BQCA 3PQYB 3TA3A 4KZEL 5E08L 1JMXA 2X10A 3PWUA 1NEZG 1MREH 3ROLB 4HKJB 4OLUH 1OAQH 3QIUB 2VZVA 3QUZA 5DK2A 5HHPB 3NCYP 4I0PD 3K1KC 5I74C 1NCAL 3OKLB 3OHXB 4TVPD 4EDWH 2RIKA 3DJ9A 5F1SA 1FYTD 3H3BC 5HPMA 4G80B 3VWJA 2DBLH 3D39D 2J4WL 4N8VG 4NQEB 3MRCB 3DETD 5TQ2L 4HIIB 2O5YL 4BKLB 5L88L 2WUBH 2Y7QA 3MRNB 4WTWA 2W9DH 5DJCA 4WW1B 5SWQA 1Z9LA 1A6ZB 3O2VH 3DGGA 4G6MH 1EAJA 3QH3B 3RNKB 2EC9T 1NGYB 3LKOB 5I8KL 3ZTJG 3RWJB 4F37K 3UCRA 1LWRA 3TBTB 2VXUH 2ZZUT 1EAPB 3VCLA 3MGTA 2FB4L 3WFHB 3RPIA 3DV6A 4OFDA 5ID0B 5MENB 4GKNB 4LKCA 2EYTA 3QUZC 4JKPH 1ORSA 3MJ7A 4UOJA 1ETZA 3DRQB 2R56H 3JXAA 4HPYL 4RFNB 4P5TB 4G8GE 3B43A 3PDOA 1ZEAL 5SX4H 5K9JL 1WTGT 1BVZA 5BXFB 5DO2C 5IVZB 5H2BB 4EIZC 35C8H 1MSPA 1C1EL 1I7RA 3DIFB 3DOSA 1F2XK 3QXAA 3VWJC 3RU8L 2WMPA 3JV5A 5EA0H 3VXQB 5CS7A 1LDSA 3Q3GB 4Z7UE 3OKEA 2I9LB 2A74B 2EEAA 3LQZB 1LE5B 1CR9L 2NCMA 1C5DB 1P6FA 5J13B 4PJCE 5DZLA 5HHMB 3CNKA 2C3HA 1AIFB 4J3TA 4NQXA 3KHOA 4GLRI 5LCVL 2FD6H 2LU7A 3FKUS 2VISB 1UQSB 2VDOH 1FNGA 4JVPA 2AEWA 4X5WA 1U3HD 1IGIL 2IFFL 4OD1L 4RMQA 3ARVA 1E6JL 5KVFH 4ISVB 3V7AG 2X2YA 5EU4A 3CFJA 5AUMB 2AI0L 3MRGA 2YRZA 4XBGA 3VRLF 5TH2B 2HJLB 1A4JB 4XTRD 2EXWD 4MLSA 4KRPC 3QUYD 3U36B 3BKYL 3TBVB 4X9GA 1QYGH 3S37H 4PG2A 4FG6D 4WTZA 3MRBA 2QQKH 1E4WH 2I9TA 2BXZA 4HSQA 1X7QB 3KLAA 4CBPA 43C9A 1KN4L 5DJDB 1G1YA 3SE8L 5E03A 1AD9A 3P9MA 5GSVB 2PO6D 3MNVB 4NIKB 3W9EA 5EO9A 1KT2A 3V6ZB 2HKFL 4P49A 4U31A 5BS0A 1TMCB 2V2TB 5CKAA 4YDVB 3C8KB 2E27H 3L3OA 4U1KA 2APWA 5F7HA 5EZOH 3AC0A 4LCWA 3DX9A 2C1PB 5ICXA 3JWNC 2R0ZL 1F6AA 5JO5B 1NSNH 2GITB 2OZ4H 1ZT7A 5B38A 3UJJH 5DQ9A 4PJ7F 4WWID 4NNXA 5I76A 4RQQB 2AJ3A 4TRPL 3QWOA 4G7VH 2FX7L 1P2CA 1UH2A 4L3AA 5ISZE 4BFEA 3MBED 3C5JA 5BMFH 4KGLA 2BZDA 2PXYA 4XCNA 4D3CL 4JFQB 2C3XA 4LSSL 4LVHB 1A64A 3EYVA 4LL9A 2FEDC 4LSRL 3QUXA 3O4LB 3LN4A 4X98A 5EU7C 3QDGD 2FYYA 3O0RL 4O58H 3VDAA 1A7OH 1U58B 4X8JA 3C87A 3FO9A 3ZYOA 4YDJA 2P1YA 2DLFL 1G7PB 4WW2A 4XVUC 4GW4B 1MAKA 5DA4A 1ZHLB 3V0VA 3MREB 5BW7C 2DQTH 5CCKL 2DQHL 4DN4L 4LBEA 3QEQA 2DQIH 5DYOB 3SDAB 3VFTA 4M1GH 1N0LA 1AKJB 2CKBA 4EVNA 1AI1L 1LK3L 3ZL4L 1IAIH 1I8IB 2NY2C 1QZ1A 3U79A 1YPZA 2V5TA 5EC1A 5E8DL 3CFDB 5MHSE 1XGQA 5DRWB 4I2XE 4LPUA 5I75B 2IPUK 5HI3C 3ARGB 2CRIA 2BNQA 2WBKA 3IDNA 3AXLA 4BZ1L 1YJDC 3DSNA 2FJFA 4ENEC 3NIFE 2W1NA 1YN6B 1FGVL 5IW1B 1QOKA 3S88L 2SEBB 3QYCA 2PW2B 3HE7B 1Z5LA 3MLWH 1G84A 4NZRH 4JFYB 2BK8A 1ZHBA 5EOCJ 4ZXBD 4HUXA 7FABL 2B5IB 4XMKL 3VXUB 5EZJB 4E42B 3OJVC 4P23D 3K81A 1NFDF 3ARTA 3ALPA 2APBA 2EDBA 4XVSH 1G7QB 2IWGA 2JIXD 3H7BA 3L7FA 3A6CH 3QQ4A 3HZMA 4UB0H 5F70A 3CK0L 3DV4A 3KXFE 5DD3H 5D6CB 1VADB 4MJ5B 1OPGL 3KJ6H 1A6AB 2YXMA 3GI9L 3X14A 3MLZL 3VFNB 3T3PF 1Q0YL 1OGAB 2X6MA 5I2IA 4DW2L 1NGWA 2R9HC 4LHUB 4N1HB 4CU8A 5I1EL 2XTJD 3BPLB 2J6EH 3ORJA 4NM8L 1WK0A 4F33A 2XXCB 2JB6A 4I5BA 3H0TB 3VH8B 1SJEB 5CD3B 4CGTA 4Q9BA 4I48B 3WL9A 4JFDD 4HKZA 3P11L 1XCQB 3ZKQD 4ONOA 3K74B 2VAAA 5KSBF 4LLUA 2LVCA 5KSAA 1IEAB 2WUCL 4NNYB 3FQWA 4XBEL 3C6SB 4PFEA 2EZ0D 2X4OA 1C16B 4HUWA 1U8QA 3GJFB 5B3JF 2FX8L 1CVRA 4G8GA 3JVGA 3C60A 1PQZA 2R1WA 1BHGA 4IDJH 5EO1B 2BCKB 4Z5RB 4ZFFA 4YHPB 4X7TB 1QSZA 4APQB 1UZ6F 1R0AH 1YMMB 3O3AA 3SN6N 3TNMA 4JRYE 1IZJA 1FNSH 4Q58C 2QKIA 1LK2B 4Z7UA 3PJSB 2X44D 4ORZC 1JYWA 1G9ML 5LQBL 3D2UA 1U92B 3L3JA 1C12B 4U7KA 4L4JA 2ZG1A 5DUPH 4C83B 4K9EL 3H3KA 2Z35A 3PP4L 2IPKA 3BIKB 3BYTA 5C0CB 3P0YH 5CP7A 5IVNA 1X5LA 4OZ4A 3IAQA 4P46A 1MHPH 1N64L 1XGUB 1PG7H 1KJMB 2EIBA 1AGCB 1IGML 1VFBB 2X9XA 2Q86A 3BAEH 4NZTL 1QLFA 4UU9A 5HHQA 2VITA 3C60C 4NN5B 4OGZA 4XP6H 4PS4H 1FO0B 3AREC 4L4TB 5I16A 4LLQA 3CFKA 2G5RA 3QNXA 1LO4L 2IBGA 5F8RC 4EN3C 3VXMD 5IESL 2OL3B 1NBVL 4MSWA 2GTZB 4F7MB 4HBQA 5JOFA 4LRIC 1BZ7B 1J12A 3HZYB 4NUGH 4WFGD 3H7LA 3QQ9C 1H3PH 1L4IA 3F12A 3U2SB 2OK0L 3LRHA 2BRRL 4KHXH 2XXMB 5BRZE 5GS0L 1WV7T 5EU6E 1JN6A 2VC2L 5CJXA 1KJ2H 1VFUA 5TE6L 1KPVA 1PZ5B 4UNUA 4Y1AD 3QXWA 3QPXL 1JMZA 1MCNA 4Y2DB 1I3RB 2CUIA 4GAGL 3T0XA 5I30H 4Z7WF 1A8JH 1F5WA 4N0UE 1D7FA 4M1DL 4P2RB 1Q0XH 1HQRB 2OI9C 3LDBC 1AXTL 3K2MC 4GRWE 5D5MF 5HVWA 2M8XA 1WFUA 2HKHH 2JE8A 5ISZA 3ZT5A 5AG9A 3FO1A 1WBYB 3FQUA 4X4YB 1T3FA 3PWNB 3QDJE 4M8QA 4LLDB 1ED3A 4P2YA 2ZJSL 3D9AH 2VJXA 2OTUB 3CSBA 4NKDA 4H1LB 1DUYA 5I1HH 1FSKC 4JO1H 1RIHH 4H26B 5DRXB 5ITBH 5IFAH 2BXYA 3E8UL 5KSBE 1I75A 3FN3A 3GMQA 4IIQB 1FLTX 3EO0A 4IRZH 1T5WA 5ADOL 1EVTC 2OM5A 1JK8B 1Q1JL 2BERA 2DQEH 3CZFA 2DRUA 1DQJA 1MJUL 1N6QH 3IDGB 3S7GA 5B21A 2IPTH 1SMAA 4HJJL 1GZQA 1AP2A 4O5LH 2PTTA 3MV7D 5JMOC 3WBDA 5IOPB 2LU3A 3C6LD 3DHMA 3QRGL 2XWJB 1NGXB 3PHSA 4ESKA 1WBXA 1A47A 5KVGH 1UZ6E 3NH7H 3V8CA 4JO2H 2A1WL 4JDVA 1F90L 5C0BB 4DKFH 3WFZA 3QCUL 4MA8L 2I5YH 1WT5C 3FTGA 4MXQC 3IFOB 4JPWH 3BSZH 4UDUA 4Z95L 1BQHG 4Z0BL 3UBXG 3IFPB 4U6YB 5DT1L 1F42A 1I7TA 4OGAD 2YKLL 5JNYB 4TSAL 1INQB 1X5KA 2CUMA 1I9RL 3HRZB 1QLEH 4G8FB 1KCSH 5FUOL 4Y19E 1BJ1J 5CZVH 4NPYA 2C26A 5HBBA 3AB0C 4HUUB 4QRUA 3UTPD 1DQML 3V95A 2D7TH 1TCRA 1JZ5A 4XP9H 4JFZH 1NMAL 4E41B 4N8CL 5L7XL 3HG1D 2ITCA 5IQ7H 2YWZA 3O6FA 4PY7B 3NZ8A 4DTGL 3JWOH 1IAKB 4JPIA 1NAMA 1BD2D 3TPUA 3WO4C 1GOGA 2BSTA 4P2QB 1CQYA 3RWCB 3PWVB 3O3BB 3KXFA 1ZLVK 4EJ1C 4P9HC 1PEWA 3Q6FA 2BC4A 5GGVY 1PX4A 2IH1B 5EWIH 2XZZA 1A5FL 1GJIA 1ORQA 3NCJL 1QHPA 1CE6A 3QHFH 2P45B 4KTEL 3BHBB 1L7IL 4K7PL 1ONQA 1LEIA 1NMCC 5C70A 2QR0B 4OB5H 4IS6B 4Z7VF 4YK4B 4Y5VC 3T65A 4Z7WE 5D1ZB 1CXLA 4YFDB 2LAAA 1RV6X 4GQ9L 3ZKXC 1GGUA 2J7LA 4BFGA 1S3KH 1A14L 4XAKE 1P4IH 1QD0A 4KV5F 4LK4A 4NQDE 4ZSOE 3QNYB 3KS0J 2M1KA 2GY7B 2DBJA 2B2XH 1MFBH 4YC2B 4PJAE 2BNRB 4X6FB 1RK1B 1HHGB 4P3DB 2HT4D 1QFHA 2DQUL 2DYPA 2YPLD 5HHXH 3TV3L 2H32H 1DZBA 4KROD 1EHXA 3ARZA 1YYMH 5D71L 3UXFA 1XH3B 2CO6B 3EYQC 1U8MA 3PIQA 4FQJH 1QBAA 4DKEL 3FT2A 4WU7A 3MRHA 4WEBL 4MDJA 3OB0H 1IGTB 3LZFL 2YRLA 2H6PA 2VIRB 1MFEL 4XC3L 3VXOB 4ODHL 4PLNC 3RDTB 3W9DA 4JGJA 4XPTH 5JIHA 3H2WA 5BO1H 4PJXF 4TUJB 2IANB 3EDDA 3B9KA 5CUSL 4YGVB 4NJ9L 5TGBA 2FBJL 1IM9D 2C1OB 5KJRH 1A9BB 2XA3A 1KELH 1UXWA 2VZOA 4H25B 5D7KD 4OBSA 4UT6H 1P7HL 2I26N 3HC4L 4JHZA 1B4JH 1YEIL 2KZ1B 4JPVH 3QIBB 1KB5B 4FQXA 4PJHF 1J7VR 1NLDH 5ALBH 1ADQA 3UO1H 1AO7E 1MY7A 2WWKO 1DN0A 1H3XA 3HI6H 5BVJB 2JJSC 2APXA 2WNGA 5HYQA 3JTTA 2CRMA 3BEWB 3IJSB 2IAMC 3RA7H 1WWWX 3VXSE 5HPOA 2V9QA 1IC5L 4PUBL 4U6VH 5BRZA 5F88A 3GMNB 5LWYL 1CLOL 1QLRA 4LAQL 1I85A 2R2CA 2R0WL 4UV4L 4U7MA 3PGCA 5D2NC 3KGRA 4IMLB 1GIGH 3TH3T 4O9HL 2EXYD 4BQ6A 1HINL 1OAXH 1RZFL 4BQ9A 4Z8FH 4OCXH 3P2TA 2R4SH 4N0UA 4OD2B 4QXGH 4G6FB 2OCFD 3UTSB 4IOIA 1RULL 1UB6B 3QR2A 3O81A 2IBZX 2AV1B 4N8PA 5C09E 4LPXA 4FQXC 4OIIL 1D9KC 5A2IH 3RL2A 1MHCA 4Z7VE 4XWGH 4ZODA 3VFUA 2O5XH 3QDJA 3V7MA 3L6FA 3PDDA 3DXAB 2YEZB 3NZHH 2DMBA 5EUOF 1ZLUH 5DSCB 1H3GA 2CDGA 1TTFA 1CDHA 4YX2L 2N7AA 3I02A 1AE6L 3QCVH 5KSBA 3K1DA 4KV5E 1MF2L 1FNLA 1JRHH 3I85A 5IQ9B 1QFUH 4ODSH 4FS0A 2AJZB 3ARBA 1EEZA 4KRLB 3CX5K 2HTLC 3QNZA 3W5MA 1DL7L 1QBMH 5ETUA 2P5EB 4L1HA 4KQ4H 1NEZA 3M8OL 4ODXA 4ONFL 4WWKB 4PJEF 4GS7C 3QDMB 4QO1A 1HHHA 1T20B 4YHKL 1A1MB 4K7PY 4MA3B 4HIEA 2OR7A 4K94H 1MFDL 1AHWA 3BVNA 4FXGB 4KXZH 4NHUB 1HXYA 4X83A 2IF7A 3T0WA 3IETB 4P9MH 5MERA 4NC0B 4RMRA 2VN7A 3C09B 4PJXE 4IRJA 1T21B 2YUXA 5I0DA 1NC4B 3MRMB 4N8VA 1UCBL 1VACA 3T2OA 4Y19A 4QHNA 1T0PB 4DEPB 3T0EB 4RGMB 2IG2L 1X6NA 1BBDH 1BQLH 4H8WC 5D7IE 1S9WA 3E6HB 1FVEB 3P40A 4HFWA 3THML 2XG5A 3MXVH 4JPKL 1GPOL 5GISH 2CK0L 3NCEB 1UJ3C 2CGRH 4NWTH 4M62L 4PJHE 4PP2A 3ARBC 3NGBC 5B39G 1LQSR 4Q2ZB 5HHVL 5D7LA 4LSUH 3E3QE 3V6FB 3NPZB 3IFLL 1XF2B 4Z7QF 2NY6D 1B2WH 4HWNA 1NBYA 4H20H 5DZOA 1QSVA 2J8UF 3TWCH 3KDMA 4D8PB 3PHOA 5HJ3B 2P5WD 5BVPH 4W70A 1JNHA 4NO0A 2A6DA 3MRQB 2MCG1 3DO3A 4LPTA 4NFDA 1K4DB 2CIIA 1AHWC 1X5FA 4GW5A 4KDTA 1BPVA 1NANH 1R5VA 1QFOA 1CI5A 5IK3A 3RKPA 3HNTH 4MD4A 3BPOC 3CX2A 5I74B 5A2FA 3OKMB 4JY6A 3RRQA 2EE9A 1HZHH 3KLDA 3S36X 4Z7WA 1JZ8A 4XB7A 4M4RA 1BM3L 3UTTE 4NYLA 3F5WA 3OPZL 2Q8AL 1V05A 2NY1D 1J0HA 4PJGA 4EUPB 1OWWA 4NQDA 4NBYB 4ZSOA 3SCMD 4QEGA 3OGOE 2ENSA 1I9JH 4M43L 2JCCA 3VD5A 4PJAA 4W4OA 1T6VN 4UQ2A 4K3EL 3RKDC 4G42B 2PCPA 2YBRA 2ICWI 2QSQA 4X5XA 3VXRD 3SJVE 4OAWB 1TFHA 5IB3B 3MBXL 1MLCA 3PWUB 4RGNE 2BSSA 4CKVX 3GMRA 3PQYD 3TJEH 2PN5A 3QUZB 5DK2B 4CRPA 4XNYL 3SKJH 4KKNA 4QXUH 3QIUD 2VDQH 4YPJA 4CL7A 4FZ8H 1UA6L 3HR6A 4IOFD 2ERJC 5AZ2H 1S7UA 1ND0A 1U3YA 5HPMB 4KJWD 4LSPH 3MGAA 1DVFC 3VWJB 3V0AC 1MRDL 3BOVA 2KKQA 4PJEE 4HC1H 1U8KA 4H0GA 4S1RL 1DUZA 1OP5K 4I77H 3QWQB 1T80A 2IQ9H 1ZS8A 2DJ4A 3LD8C 4NQED 2Y7QB 5E2TL 3RX5A 4EKXA 5DJCB 1MCIA 5CJOL 3V4UH 5SWQB 3QIWA 4KI5D 5EO0A 4J6RH 1DEDA 3RIAK 3ARFA 4JN1H 3N0PB 4OCLC 1I1CA 2VDKL 4OIAA 3A6BL 4M7LT 3W11D 3JTSB 3WIIH 1SEBA 5KOVC 3WFBH 4R0LA 3VCLB 3MGTB 5IUSA 1MCLA 3QJFA 4W6WB 3RPIB 3DSFL 1ZVHA 4LKCB 2EYTB 3PP3K 4OJFL 2KPNA 1ORSB 3MJ7B 1ZGLA 1WF5A 3LKNA 1ETZB 4L8SA 3PG2A 1J0IA 3VXSA 3PDOB 1IC7L 1UM5H 1J0YA 3HMWL 4Z7QE 5DXWA 1XAUA 1Z0MA 4G5ZH 2GUOA 4C58B 4P5TD 4ZUUA 3EDEA 5DEZA 5B4MD 3UAJD 3QXAB 1SBBA 2AQ3A 3NCCB 4G9FB 4BJLA 1UADC 5DD5L 1B4RA 2ADGA 3GBLA 3SHSA 4N0YL 3RVTD 2AABH 3OKEB 3GBMH 1U93A 1AGBA 3L1OL 4HT1H 3OX8A 4ZYKA 3WIHL 1FFQA 4FQQA 3RI5K 1PJ9A 5C0DA 2H2PD 1XIWC 2ZCHH 4NQXB 5FDWA 3QIWC 3EJYD 1N59A 5C09A 3SKNA 2H3NA 1RUKL 3LEVH 2BY1A 3QFJD 1FNGB 3HFMH 3QJHA 4R2GC 5HGAA 2CLVA 4X5WB 1F45A 4R0LC 2ZOKA 4DVRL 4GBXD 5EU4B 3CFJB 4Y4HA 3MRGB 1FO0H 3MLUL 4XBGB 4CVZA 4AIXA 3GHEH 3L5XL 4PRIE 3GKZA 3WNPA 3S37X 1EMTL 3GKWH 4HZAA 3FOLA 2F19L 1RMFL 2Q20A 3QA3A 5D2LF 5D93B 2APTA 3MRBB 3N85L 1CFSB 2I9TB 2APVA 3CCHA 3CIQA 1LO0L 3KLAB 2GK0A 43C9B 3AS3A 5L2JA 5IIEA 3O4OB 4B5EA 3OTTA 1AD9B 4ZUWA 4K2UL 3WXVH 5FUZH 4O2CA 4WFFD 4F3FA 4X7SL 1CDIA 3W9EB 5EO9B 1KT2B 4R8WH 5B8CA 5JIPA 5GRUL 5KG9A 4M6NH 4Y88A 5BS0B 2MKWA 3C2AH 1MCBA 2XTLA 5GJTL 3CDYA 2NY3D 2XRAH 4K8RH 4U1KB 2X4RB 4UV7L 1UC6A 3DX9B 4LCWB 5ICXB 2DKSA 1NCWH 1F6AB 1Z6JT 4YFLF 1ZT7B 5B38B 2NY2B 5DQ9B 3V5HA 3J8F7 4NNXB 2X9YA 3NA4A 5GJSL 5E1AA 1RZ7H 5D7IA 1P2CB 3C5JB 2DLGA 2PXYB 4XCNB 1OCWL 3GHBL 1S5IL 1KEGL 4D9LH 1FAIL 3EYVB 3KWWB 2XQBL 2VB5A 5I1AB 5FGBA 1QFWI 1QSFE 1JUFA 3QUXB 3LN4B 4X98B 2MQ3A 1N8ZB 2P47B 5GGSB 1FFOA 1B0RA 2ADFH 2KH2B 5C0IB 3UPRA 4X8JB 3FO9B 4YDJB 2WANA 3O2WH 4WW2B 1LO2L 2ED9A 4NN6C 2J12B 3V0VB 3KPSE 3QEQB 4H88H 4HBCH 4IOSD 4M61B 3VFTB 1I3VA 1ZE3C 2R0LL 2CKBB 3RY5A 1KN2L 1QACA 4EVNB 1MCPH 3LKRA 1H5BA 1JGDA 5BQ7A 1FYHB 2I25N 3VD9A 2UV3A 1YPZB 1QEWA 1AD0A 5EC1B 5FIEA 4GRMA 1X3DA 2NY0D 3UTTA 3GBNL 3GZKA 4JQVA 1WBZA 3UJIH 2A77L 1F2QA 5C2BL 4QRSA 2BNQB 1KG0A 1YEJL 3IDNB 3AXLB 1UCTA 4X6DF 1V3MA 4S1SL 5CINH 2FJFB 3ARGD 5JW4R 4X0KA 2E7LA 3E3QC 2Z31C 3TYGH 1QRNA 2Y23A 4HMDA 4PRPE 2AJUH 5GRWA 5SX4I 4K7FA 5IVXB 3RFZC 1Z5LB 3SJVA 4J4PA 1IBGH 1ZHBB 1FFNA 3EO9H 1HKLH 4HUXB 2JELL 1G9MC 3MV01 2DMKA 4F9LA 1MIEL 4FFVD 4BK4A 1X5JA 4JM4L 5FHBH 4HDIA 3R0MA 3P4LA 1A7PH 2VKWA 2EDRA 4L8DA 1HQ4A 3H7BB 3L7FB 4FZEL 3QQ4B 4I3RL 1OARL 3HZMB 4KMTH 1K3IA 3DV4B 4HWBL 2ICCA 4XNUH 5F1IA 1OP9A 3F6IA 5DFWH 3WNMA 4Q97A 1TNMA 3KPNA 3ZE1F 4NGHL 3EZJB 5D7JA 4PJEA 4JQVC 4W4NA 4K07A 4WUKH 1NMBL 5I2IB 1X5ZA 1NGWB 1XR9A 1OGAD 1S7WB 4HWEH 3N9GH 1SJHA 4MVBD 3RGVA 3U7AA 1M71A 4F33B 2E7LC 2JB6B 4I5BB 4LCCA 4LHUD 2XN9A 3G08A 3TN0C 1LO3L 5DUMH 5IFJA 2ZCKH 4AK1A 3WL9B 4HKZB 2UWEF 4J4PC 4YQXH 5F89A 4EI5A 1ZVYA 3WLWD 1CVSC 2ZUVA 4JRXD 2VAAB 5GRJL 1ZT4A 4LLUB 2GJZA 4OD3H 4RGNC 1WZKA 1PDKA 5KSAB 1NLBH 1CL7H 4ZO9A 5ACLA 5HI5D 2X4OB 3PXJA 3T77A 1U8OA 2AJYH 3WDHA 1I3GH 4G8GB 5JW3H 1UM4H 3C60B 1BFVL 1PQZB 5ICZB 2R1WB 2G60L 3AREB 1AXSA 3KPPA 4I3SH 2EIEA 4XPHH 3D3VE 4LOUC 4PTUA 4ZFFB 1EIBA 4RX4D 4YXHL 1RHHA 1JZ4A 5DVLA 3O3AB 4LF3A 2QKIB 1JPTH 4Z7UB 4XPGL 4APQD 4PJ8C 1DDHA 3BYYA 1YMMD 5J8OA 3D2UB 1YEFL 2E6QA 3L3JB 4PJCB 4HX1A 3B2VL 3TJHC 3OXRA 1CD0A 4FNLL 4D0DA 2RQ8A 3TNNA 5MEOA 1IGFH 4PGBA 2Z35B 1EFXD 4MGXA 2OP4H 2IPKB 4EI5C 2NY7L 4PRAA 4HFUH 1NCDH 4OCWL 3BN9C 3U9PL 1J1PL 4N90E 5CP7B 1PG7X 4OZ4B 1VB9A 4P46B 1KB5H 3UBXA 4WI4A 2YN3A 2BVUA 3GJEB 1JPSH 3LDBB 2OI9B 1JNNL 4KKCD 5J89A 3MUGB 2AJXH 4TQEL 1MJ7H 4PJ5D 2YD3A 2BVOA 3OF6D 3WLBA 1TJIH 4X6DE 4PRIA 4Y5XA 2Q86B 3I3BA 4FXLA 4RRPG 1QLFB 4UU9B 5HHQB 2VITB 5E5UB 3N50A 4N0CD 1G7IB 4LLQB 3CFKB 3P30L 1KB9J 4C56A 1ZTXL 3QNXB 4ZS7H 1MNUL 1YQVH 2ZSVA 1I1AC 1FSKB 4MSWB 1IRAY 2EIZA 3DVIA 4QRRA 5IEHA 4OCYH 1U8IA 1KFAH 4JVUA 2MQ0A 2WP3O 5INDA 3DMMA 4WHDA 3F12B 3S35H 3VFRA 3X3GH 5T3XL 5GZOD 4NWUH 1RUMH 2B39A 1WZMA 2W91A 1JN6B 1GHFH 5DK0B 3SQBA 5LJYH 2MCPH 4FTVE 3BRFA 1L7TH 1S9KC 5TQ0L 1KPVB 2RCSL 4JFFE 1W8OA 1WCBA 3HNSL 3K4DA 3JV6A 3OXSA 5H35A 4JCMA 2RFXB 3MMEA 1K6QH 3PGFH 4LEXL 4KKAD 2YUVA 5FYKU 5F44A 4P2RD 4Q6YA 5BV7B 4R4NC 1T03H 3MJ8A 5ISZB 1L6XA 4GKOA 4K8RD 4Y5XC 5C6PB 3FO1B 3FQUB 2BRQA 2LVEA 1T3FB 4GT7A 4LSTH 1JIBA 1ED3B 3LKSA 4KK5D 3S96B 3FRPG 4FQ2L 2UWEE 4YHOH 4NKDB 4JZJA 4LGPB 1DUYB 3LS4L 1DANU 4J8RB 7CGTA 3P9WB 4AL8H 2QQNH 4LMQI 4FRWA 1EDQA 2BVPA 3AB0B 3OB8A 2HH0L 3GMQB 3EO0B 1KJ3H 1T5WB 5EU3A 3CZFB 3DMMC 1DQJB 5CBEA 4YDLB 1CGWA 4HPOH 1F11A 4OQTL 4JO4L 4AEFA 1GZQB 1AP2B 1D5MA 2PTTB 3KPSA 2VMFA 3EGSA 3WO4B 1UG9A 2HLFC 4PBWD 4YHIA 1WBXB 1MWAB 4KK6C 3WUWG 5CGMA 1AR1C 3GSWA 4LASL 1A1NA 4JDVB 1M6OA 4IJ3C 2EDXA 4MXWH 1KLUA 3FTGB 1CFVH 1KPUA 3GIZL 4I2XB 2I27N 3HC0A 3FO2A 4KAQL 4UDUB 3I6LD 1KGCD 1Q9WB 5C9KA 1I7TB 5E5MA 5FO9A 1KENL 2Q8BH 4LSQL 4M5YH 2AJVH 2GSIA 1LNUA 4JY5L 1NMCB 3LCYA 4JZJC 4FA8A 3DO7A 2HYMA 4PRPA 3UYOD 3AVEA 1RURL 2OTWA 4ERSH 2YD4A 1TCRB 5TPWL 2ZNXA 1ZGLP 4E9LA 1NGPL 1G0DA 4O2FA 5DJZA 1C5CL 3CH1A 1RVFH 2F54E 1N3NA 1SEQL 1A7NH 3NZ8B 3QCTH 4TULL 1NAMB 3TPUB 5DHXB 2BSTB 5F6IC 1BVLA 5AZEL 4X80H 4HGKC 3OWEA 3HI5L 3N1PC 4JKLA 3KXFB 4Q9QH 4TVPL 3CD4A 5I9QC 2H9GA 1KCVH 3Q6FB 5HDBF 4Z0XA 5F7NC 1TJGL 4NRXA 5GSRA 2O61A 2Z92A 2RGSA 1ORQB 3ZKMD 1CE6B 2YUZA 3OBAA 5IJVA 2PW1A 1K9TA 3U4BH 3UP1A 2VN4A 5GQBA 1ONQB 1LEIB 4JREC 3VDBA 8FABA 3D69A 1Z3GH 4PY8I 1YY8A 3MUHL 5CEZH 4EUPH 3T65B 3Q5TA 3U7YH 3BFOA 2OR9H 1OW0A 4CUCA 3Q1SH 1FGNH 5D1ZD 5I1LA 3WXWL 1NCCH 2OJZL 1TETH 4U1HA 4G9DA 3U30C 1RUAL 1QFPA 1SYSA 1J1XL 5ESQA 2VLKA 5FYJU 2N1KA 1MCKA 1VHPA 1MPAH 2KUTA 2BNRD 5E2VH 2PKDA 2DYPB 1R3IL 1PSKH 4O2EA 1PY4A 3I9GL 5L6YL 4U3CA 4K3DH 3SO3C 5FKPB 3D3VA 5JW4M 1U8MB 3PIQB 2X4SA 2R1YB 3SDDA 3FT2B 4WU7B 5IKCA 4JRYB 3MRHB 1YY9D 4MDJB 5HTSA 5TF1H 5SV4A 2H6PB 2H1PH 1AGDA 5L8LB 4XP5L 4P5KA 4UINL 5JXEA 5CJQH 1A6VH 1KEML 3MCG1 3W9DB 2HJFA 3L5JA 5F7LB 3U4AA 1I8KA 2PYEE 4HF5L 1OW0C 1VEOA 4PV9A 3RDTD 3B9KB 1FG9C 5TGBB 1T4KB 1MRFL 5JQ6L 4POYA 4XMPH 2IAND 4M7LL 1DBBL 5FCUH 2YR3A 4NCDA 3MJ9A 1JPGA 4NCC2 3GO1H 4X6DA 3RAJL 2Y36H 1IEBA 1UM6L 4W68A 4FQXB 2R29H 4NC2B 5EBLA 1FCCA 1KV3A 4P4KA 4P59L 3QIBD 3HC3L 1DN0B 2WV3A 1XF1A 3F58H 4X5LA 3SDDC 1WGOA 5C0ND 3STLA 5HYQB 4QYOA 5EOCH 3MACH 2NY4D 3SOBL 3JTTB 5FM4A 2X09A 1EJOH 5B39A 4UNVA 1FPTL 3PABA 5C71A 2N7BA 3QUMH 2R69L 1A7RL 1PKQE 1Z0NA 2VDLL 5BRZB 1QLRB 4FTVA 2CDFA 3PGCB 2H41A 1OAZL 3SY0A 5D6DC 2XZCH 5C0AE 4PP1D 3C2SA 4C4KO 5D72H 4N0UB 3RNQA 2VLJD 3N1QC 4C54A 2QHRH 4OF8A 1NAKL 4GRWB 4IOIB 2MKLC 4P2OA 4LVOB 4X4ZA 4G6FD 3UTSD 5K9OB 2FR4A 4BA8A 3RL2B 1MHCB 3VFUB 2ARJQ 1OAKH 3QDJB 5LBSH 2OL3L 3L6FB 3WHXA 4UNTA 1P5VA 1KTDA 4XPAH 3NMEA 3ROOB 4HAGA 3W81A 5DD6A 3DXAD 3EUUA 2F74A 5IB5A 1JFQL 3I02B 5KSBB 1X6LA 3EYFA 1EO8H 3HTLX 1ULVA 1AY1L 3GRWL 3ARDA 2Q7NA 4JDTH 5EOQH 1WFOA 3W0WD 1UJ3B 3DWTA 3ARBB 4DGIL 3NGBB 5J7CC 1CFBA 3KG5A 4CW1B 4H1LG 3QNZB 1J8HA 3UTOA 4OCRH 5ETUB 3PWPE 2JJTC 1NEZB 4QOKE 1DBMH 5DLMH 4ODXB 2P46B 1YEKH 3FO0L 2P5ED 5DWUL 3VW3H 1HHHB 2VXSL 4HIEB 2A9NL 3QDMD 1AHWB 2DWDA 3TO4A 1HXYB 2VLME 1ZA3A 1PG7W 3BPOB 4ZTPL 2DI8A 1I8LA 4N8VB 5JUEH 1VACB 3WFEH 3MLVL 5E00A 4Y19B 4QHNB 3S36L 3S8WA 1YJDH 3I3DA 4OTXL 1NC4D 1KIRA 1E6OL 1R3KA 2DICA 1S9WB 1ROWA 4HFWB 5T33H 4JHAH 3T0ED 2NR6D 4RFEA 3RTQA 1TCMA 3HUJE 1HK6A 2F54A 2KQNA 4PP2B 5JW5A 5C08E 3G04A 1RUQL 1G9NC 4S1QH 2QEJA 3LN5A 4RWHA 2W38A 4P4RA 2ARJA 1NBYB 4ZTOH 3PHOB 2A9MH 2I24N 3D85A 1MREL 1JNHB 2VL4A 4NO0B 4NQTA 4OFKA 4XNXH 2A6DB 5DEFA 5CEXA 4OLUL 3WCYA 2CIIB 4GW5B 1QFWL 1F4XL 1R5VB 5IB2A 3TIEA 4ODUA 3UYRL 1GGBL 5IK3B 1JGEA 4MD4B 3RHWK 2X4PA 5SWSE 3C5ZA 5H37G 4JQIL 1II4E 2ERJB 5LKNA 3B83A 4UBDC 4XHJC 4Z7WB 3B2UC 2DBLL 1DVFB 2FWOA 3WN5C 3F5WB 4LKXB 3EYSH 4NQDB 4EXKA 4ZSOB 3TT3L 3LD8B 1KXTB 5CEZD 4OLZH 4YHLL 2IMMA 4PJAB 1TZIA 4YDKH 4UQ2B 4G6ML 1DQQA 2VXVL 2KZWA 2PCPB 4X5XB 5EU5A 2Y4SA 5J12B 5GRXG 2G5BA 3PGDA 2VXUL 3DHJA 1MLCB 3RX7A 2EIDA 2BSSB 4JKPL 4BK5A 3GMRB 5T3XE 1S7TA 4XXDA 4KGJA 4FQLH 2HFGH 1INDL 4CN6A 1R5WA 3RIFK 3VGDA 5J11B 5EORL 3QUZD