2JEMA

Native family 12 xyloglucanase from bacillus licheniformis
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
232
structure length
232
Chain Sequence
ASSSNPSDKLYFKNKKYYIFNNVWGADQVSGWWQTIYHNSDSDMGWVWNWPSNTSTVKAYPSIVSGWHWTEGYTAGSGFPTRLSDQKNINTKVSYSISANGTYNAAYDIWLHNTNKASWDSAPTDQIMIWLNNTNAGPAGSYVETVSIGGHSWKVYKGYIDAGGGKGWNVFSFIRTANTQSANLNIRDFTNYLADSKQWLSKTKYVSSVEFGTEVFGGTGQINISNWDVTVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Characterization and Three-Dimensional Structures of Two Distinct Bacterial Xyloglucanases from Families Gh5 and Gh12.
pubmed doi rcsb
source organism Bacillus licheniformis
molecule tags Hydrolase
molecule keywords ENDO-BETA-1,4-GLUCANASE
total genus 71
structure length 232
sequence length 232
chains with identical sequence B
ec nomenclature ec 3.2.1.151: Xyloglucan-specific endo-beta-1,4-glucanase.
pdb deposition date 2007-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01670 Glyco_hydro_12 Glycosyl hydrolase family 12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2jemA00
4HK8A 3VZOA 2F6BA 3B7MA 1T6GC 3WQ7A 2VULA 3WP6A 3MF9A 2JENA 1M4WA 4S2HA 4IXLA 3VLBB 2QZ3A 1H4GA 1OA2A 1C5HA 1UKRA 3VZNA 2DFCA 3AKSA 4HKLA 3VZKA 5HXVA 3AKRA 1OLRA 1REEA 2BWCA 2DFBA 3AMQA 3AKQA 2DCJA 5EJ3A 3VHNA 3VL8A 3WXPA 1UU4A 3AKTA 1XNDA 2BWAA 2QZ2A 3RI8A 1BVVA 1REDA 1BCXA 1BK1A 2VGDA 2JICA 3WP5A 3WX5A 3M4FA 2C1FA 1XYPA 4HKOA 3AMNA 1H8VA 1XNKA 3VZLA 2B46X 3EXUA 5K7PA 2Z79A 1REFA 5K9YA 1HV1A 1H0BA 1W2UA 1YNAA 1KS4A 4HKWA 1NLRA 3WR0A 3WP4A 3AMPA 2BW8A 2NQYA 1F5JA 3O7OA 4XQDA 1UU5A 3HD8B 1HIXA 4S2GA 3WQ1A 2DCYA 4S2DA 4HK9A 1KS5A 1IGOA 1OLQA 4XQ4A 3LGRA 2DCZA 1OA4A 3RI9A 4S2FA 3AKPA 3LB9A 3WT3A 1C5IA 3VGIA 1XXNA 1XYOA 2B45X 1HV0A 2BVVA 3VZMA 3VZJA 2VG9A 3MFAA 4NPRA 3MF6A 3AMHA 3VHOA 3ZSEA 1XNCA 1QH7A 4XQWA 4XPVA 3WY6A 3MFCA 1ENXA 3VL9A 3AMMA 2DCKA 2NLRA 1AXKA 3B5LB 4H7MA 3VHPA 1QH6A 1H1AA 1OA3A 1UU6A 2VUJA 3WQ0A 2JEMA 1PVXA 1TE1B 1XNBA 3WP3A 1H4HA 2D97A 1XYNA 2B42B 2D98A
chains in the Genus database with same CATH superfamily
5LASA 2PQQA 4CCOA 5BNOB 5A7WA 4JHZA 2RM23 1T6GC 4BOWA 4AFCA 2VVEA 1LHVA 1Q8SA 1XPWA 4AQ6A 5I91A 4QT6A 2XJSA 4N43B 3H3LA 2DUOA 1UAIA 3QCWA 2BBVA 2JB8A 4Q8KA 1MEC3 2QQIA 4C1WA 3Q8FA 1DQ0A 1PVC3 4UBGA 4B1MA 3BVCA 2RS32 1PM7A 4OI2A 1W0OA 5CFCB 2MPFA 1EV11 3NJZA 4I01A 4UFHA 1VBE2 1UWWA 1C1FA 3K77A 4XFGA 4XUQA 2YYOA 4NRPA 3ZYIB 2VMIA 4LHSA 3CHXA 1NUKA 5IVCA 3KQRA 2YB7A 3FHAA 3ZKYA 1STMA 3OJBA 4KL1A 2E32A 4CSWA 1RITA 4TTGA 4MHUA 3KGZA 4W6YA 3VDAA 4AVBA 2WZR3 2YUEA 1QQP3 2J1AA 4W50A 4CEWA 3U78A 5F1RA 1S1AA 1CPNA 4DB5A 4IW3A 4Y5TA 2HWB2 3LEKA 3Q8EA 4AI8A 5JAXA 1R082 1W6NA 1SFNA 2J42A 5FZFA 3ZXGA 5AFBA 2W5FA 3UL2A 2JG9B 1F9KA 1WWYA 1BQPA 1H2MA 1YQCA 1G86A 2WO7A 3A0KA 1J83A 5IK7A 3OPZA 1AR82 4LBNA 4L97A 1YFUA 1JYCA 1RUG1 2IZWA 3WQBA 2WNOA 3KT7A 5M0TA 1LOCA 3OBRA 1KRIA 4JKLA 1VBB1 1BBT3 1YLLA 2JG9C 5IK4A 3AJZA 4M4PA 4YVSA 5GM0A 3PNAA 4GB33 3OGVA 1AL22 1S2KA 1ULPA 4WV8A 2UWBA 5IW0A 3SHRA 4ISRA 1JYVA 3ZIWA 5F6KA 4XFHA 3MBWA 4RHV3 2ZGSA 1ASJ3 2ZABA 4MVTA 5A6ZA 4FBFA 5C70A 5JMCA 4OFGA 2VNVA 3LGRA 3JB8A 5D8AC 3TRSB 1AR81 1OOPB 4B3NA 5C33A 1MS3A 3J9SA 4Y24A 2OW4A 4GULA 4HN1A 4O65A 3FHQA 4PIXA 4JC1A 5K4LA 1W8UA 4E4HA 2IXCA 2HWB1 2OPWA 5F5CA 5FJHA 1N1TA 1HB2A 2CGNA 4Q26A 5FDBA 3ZYJB 5FO9B 2A3YA 3VZJA 1D0GA 1RUG3 2CU5A 2LRPA 3NJYA 3MV01 4FQZA 4DPNA 4XETA 1Y9QA 3WUDA 1VBE3 4AHYA 5C71A 3J7HA 1UYXA 4Q0SA 1PX4A 4QAWA 1PZ8A 3O0WA 4LK7A 4X8PA 4XTMA 4B7EA 2IXJA 3VN4A 3ZFEA 4Q27A 1DF0A 2VW0A 3J8F2 4UYBA 4LHKA 1R093 5FYBA 4QQPA 2DCKA 3VBOB 5IYYA 2P1BA 1RGSA 4XFIA 1VBE1 3OEAA 5D2AA 4YVSB 1KGYA 5FZLA 1TMF2 2GH2A 1OURA 2FCUA 1BMV2 2Q30A 5A3OA 3LOIA 1UL9A 2NN8A 1Q8QA 4HZFA 4XDPA 1VAVA 1EV13 5KC6A 1QMJA 3VKOA 2HWD1 1XU2A 1EAH1 1JBCA 1UXZA 1VMFA 1UYPA 5A7PA 4IE6A 3WNOA 2FZ1A 2YMZA 4AVCA 4Y1YA 2ZGNA 2DUQA 2E9QA 2D44A 1UKRA 3MLJA 1O3QA 2K46A 5DUWA 2XL9A 5LA9A 2HWC3 2K2SA 3WW1A 1W8ZA 2WA4A 2A6VA 2BWCA 2Y0OA 5EQUA 2R0HA 2DVGA 4FOYA 4Q2FA 3ZDVA 5EJ1B 4X6RB 5IAXA 2D6NA 3NNLA 3WW2A 3WHUA 1ASJ2 4G4FA 4LO5B 3BODA 3VBOA 5CG8A 4XHXA 2E53A 4JGYB 1BCXA 3RZKA 1VRH2 1J1LA 3KV9A 4E9KA 2WAOA 4BQYA 1TZOA 4BQ5A 4CDXB 4CU7A 4DUXA 1B35A 1O4YA 5IT6A 3ME2A 3TEYA 2N7GA 2MEV1 3P6BA 4QXHA 1TVGA 1MVQA 3AMNA 5FYSA 1YO8A 3HQRA 3TEWA 1RUD1 2AUYA 2QKDA 3POYA 4Y4YA 1KFUL 2JIGA 4QM9A 4HSJA 1FT9A 2W1QA 3NL1A 4AF9A 1OKQA 3RDIA 4UFMA 4K3UA 2ZZJA 1X8MA 5GKAC 1C8M2 1GMMA 3E5UA 3RPQA 2WQ4A 2QQLA 1UIJA 5BNNB 4C0HA 2DCTA 3GYDA 2UWCA 1COV2 1A78A 4COZA 3OCPA 4N90A 1ZBE1 4META 3GF6A 4JKKA 3HVDA 3ZN6B 4DRRA 2RV9A 2AYHA 1U5IA 1MZ5A 3IMNA 4H55A 1DHKB 4KMQA 3WG4A 4AI3A 2Z69A 5ACA1 2A75A 1W9YA 2BJSA 4CPBD 4FTBA 4AI0A 4QXBA 1GV9A 2ORZA 1PNGA 3LFIA 3DKWA 1J58A 4Q0QA 2BGPA 3H1YA 1HJGA 3I4IA 2B4KA 3VD5A 4FPEA 2ZA9A 4OYUA 1OF3A 3ZSMA 1W8HA 3K3OA 5FZAA 3GJBA 1DCSA 4NHYA 5BNPC 1JOBA 1G9FA 4V2WA 4BIOA 3KV5A 2VG9A 3KLSA 3WDXA 2WKKA 1CVNA 4XIOA 3IM0A 3O12A 1VP6A 4MGYE 1LU2A 2QQWA 3P5BA 1LB2A 3DGTA 4JQRA 1Y9GA 2J1VA 2VC9A 2BGOA 2X8KA 4HPKA 4LO8A 2WZR2 3N7LA 1IKQA 3FUOA 4AE2A 4UFIA 5A7SA 2BNMA 1ODNA 2DV9A 3S5QA 3ZYFA 4ASMB 4FFFA 5FIXA 2V5DA 3QACA 1GZWA 2W91A 4J1XA 3R6SA 3W5MA 2B9UA 4XFFA 2CDPA 2Z2SB 1MR5A 4XZUG 4U36A 3D3AA 3IKWA 4BK5A 1J1TA 2PHFA 1W8TA 3GBFA 3PJYA 3RWKX 1CAXB 2HWC2 2VUCA 2XPJA 1W04A 2VAUA 4YM3A 3WP6A 1F8VA 2XJUA 3LWCA 4A7KA 3U4XA 3V0AA 4OZXA 1DLLA 2JE9A 4Z2AA 2QZ3A 1PK6C 2VNRA 3OGRA 1JMUB 1LAJA 3UT0A 4CDWC 1W8WA 4LUKA 3VZNA 4RS5C 3PDQA 4OUEA 4BLIA 3AKSA 1IZ3A 3PLQA 2NYYA 2ZX2A 3IT8A 1JUHA 3KGLA 4QPIA 3D0SA 4XBQA 5FZEA 3W20A 2V72A 5FO7B 4TWTA 4EWAA 1RHI2 4IDZA 4YNIA 4ATFA 4BU2A 4OHXA 3AFKA 3Q9OA 1C28A 2VBDA 4QX5A 1LEMA 3CBNA 1AR73 4IEYA 2QZ2A 2I07B 4AG4A 3GCWA 2A6ZA 4QDSA 3VKNA 4CP2A 5L36A 1O3RA 3LE0A 3WF4A 1O59A 5LBFA 4M00A 2VU9A 1AJOA 1QKQA 3V56A 4C1XA 4XDOA 4EN0A 4R9BA 1HRV1 2PTMA 3VKFC 2BGCA 2W39A 3HWJA 3N9MA 2EIGA 1O4ZA 2WNEA 5T5LA 4JTOA 3UJQA 1IQAA 1UY0A 4QB2A 1CR7A 2PMWB 1QJFA 2J22A 1ZZCA 3SC7X 1VRBA 3MI8A 3FMGA 1XQNA 2CAVA 4CP1A 3EBRA 2VBBA 4XHBA 2XL7A 1IQDC 1NXD1 2C26A 4CCDA 2VMHA 1KS4A 1JZ3A 1NZCA 1ND2B 2QQVA 5C6CA 3R05A 3WP4A 3AMPA 2BW8A 4YYOA 3WCSA 3AP6A 1DP0A 4Y3OA 4XMAA 3SITA 4GAZA 4QQOA 1OI6A 4IE0A 1WMEA 2GN7A 2HJIA 3ZFGB 5A7QA 5J3UA 4I2OA 2PYTA 2HYKA 3OBTA 4FPOB 2DCYA 4IEOA 1DQ1A 5EYYA 3BN6A 1NG0A 2XJQA 2ARCA 2VNOA 3WNPA 1H8TC 4FVVA 2VCBA 3J7LA 3B94A 1HB4A 1KQRA 1OA4A 1QOOA 3LDBA 2AR6A 2VD7A 4S2FA 4EJRA 3ZN6A 2VOWA 1RXGA 3DF0A 1ONAA 1W2TA 4AVSA 4INDA 2L9LA 2H0BA 4IEWA 4LLOA 4K8FA 3RZMA 1YFXA 4LO7A 4Y26A 1LRHA 1VMJA 4MOAA 5A3NA 2FDHA 1COV1 5IUQA 4HG6B 2WQZC 2ET7A 1UMHA 4JHTA 5DAQA 1EPWA 5J96B 1JHJA 1V6LA 1L7RA 1W39A 2BUKA 4K1YA 3UGGA 3NJVA 4FP3A 5FZ1A 5JIAA 3THPA 3WY6A 1IG3A 1SACA 2X09A 4CUCA 3AMMA 5A3WA 4CP9A 5HBAA 5KHKA 1E5HA 5FMDA 2Q8OA 5JOXA 1PVXA 3CNAA 4NJ4A 2KD7A 2RR11 3RQ0A 3POEA 2GC0A 3ZFGC 2JXAA 1Z7S2 4IEVA 3H8UA 4LBQB 3S6PA 3U37A 3AVSA 4GJZA 4DQAA 2YU1A 1XYNA 4NAMA 1NZIA 3T0BA 5CKMA 4COUA 4IE5A 1X9TA 4BJ0A 2ILMA 3HMYA 5EHDA 2XHKA 1VRH1 3HT1A 2E63A 2RG4A 2NZ9A 3M1HA 4RS5A 5J36A 5LEKA 1LHWA 1RHI3 1QIQA 1MQTA 5AVAA 1SLBA 1VBD3 5JSOA 2KM2A 3UKVA 2OT7A 1GQGA 1RUNA 1GOHA 2ZX0A 3F95A 2DVFA 5DDJ3 1G7YA 1HLCA 3UETA 1L3JA 3VBUB 1JZ6A 2JX9A 2BU9A 4CVUA 4FPFA 4NWWA 2HYXA 3ZN5A 5KBFA 4QU1A 1ST8A 3AKRA 4N9IA 2A71A 4AI2A 1YQ2A 2FQPA 1S4CA 2P3JA 2VZTA 5I0UA 4EN9B 5FY0A 3HNBM 3NQHA 2VMEA 3POWA 1GBGA 2ZMNA 4RGAA 4V2VA 1PGSA 1MACA 1JYTA 1RUJ1 1UQXA 2WT0A 1EAH2 3H42B 2HWD2 3R4DB 3K4DA 1OSGA 4QPIB 2Z5WA 2JICA 4H3WA 5AVPA 5FTTC 1W9FA 5FOJB 5CB7A 4Z1VA 2P4EA 3MW3A 1NA1C 3E5QA 4PDWB 1ZRCA 4D0QA 3D6EA 1OF4A 4QB1A 3CDZB 4FT8A 4UF0B 3NAPC 1XE8A 1BMV1 2TNFA 4QB6A 4Y20A 2IXLA 1UNBA 4FPKA 3OBAA 3U75A 3O0VA 4RS5B 2TBVA 1DGRN 1XNTA 2VQ0A 1PK6B 4HFSA 1GWMA 3GALA 2EXIA 1H0BA 2OA2A 2PHUA 3HIFA 3N9OA 4CDQB 1US3A 3WG3A 1AL0G 1FYUA 2EA7A 3DV8A 1PO21 3WR0A 1TQ5A 3GCXA 4EZ4A 2XLGA 2GNTA 3KCXA 4K6BA 4H14A 2PA7A 5KXEA 5DDJ1 3I8TA 1RUI1 4AZZA 1UU5A 3I2OA 1SG3A 1H6YA 3K4ZA 3BTAA 4EZHA 5IVVA 5GZFA 3CU7A 3G6JB 1OKOA 2IXIA 5FMOS 2XQXA 1KFXL 1K5JA 1OLQA 1OQ1A 1RUI3 2Y26A 1BBT2 5DUUA 5FXZA 2FZ2A 5APAA 1SFYA 4IE4A 4LITA 2V73A 4CPBA 4OQ8A 2PELA 1AR92 3VD7A 4CU9A 1VBD2 2VNGA 2BNOA 4QDQA 5LBBA 3U11A 1ULDA 1VBC3 3O1UA 4CZSA 4PDWA 3U10A 1XB9A 2BQPA 3H3UA 5A33B 3NAPB 1PO12 2B45X 1OUSA 3CJIB 5T5OA 4Y20B 3NWKA 1DQ4A 4EN6B 5FPBA 3RMXA 4NMIA 4XW3A 1VBB2 1D4M1 4P9GA 1APNA 4OHVA 3WVJA 4YZ2A 4K21A 2XG3A 2DVAA 4Q4V2 3FL7A 4FPGA 4UT5A 1R1ZA 1RUG2 1DGRA 5H9RA 5FY1A 2D7FA 3ZOIA 3AXEA 1FX5A 1UD1A 4MGKE 2OX0A 2JD9A 1JW6A 2EXJA 5EJZB 2HBTA 3FE5A 2ZX4A 2BRTA 1TME1 2R073 4LBQD 1SBEA 2WDBA 3AYAA 4P9YA 1PGW1 2D6PA 3UGHA 4ZXKA 4BMBA 4MGTA 4KWLA 1DGLA 1IPSA 4O7XA 3WW4A 3WZ1A 1F2NA 1X50A 5KXDA 4S2HA 2P37A 3MIGA 3PL0A 4JGZB 4CA9A 5A6QA 3AL5A 4HMZA 1RMU2 1UF2C 3DUIA 1H4GA 2VE1A 3ACGA 2J7MA 4TN7A 1EV12 5KC5A 2LTNA 2VR4A 1DQ6A 1SBFA 1GOFA 2ERFA 2RS31 1U5ZA 3ACFA 1RTVA 1UW8A 1SPPA 1VJ2A 3AMQA 3M3EA 3DYMA 4IGOA 4P9XA 4XURA 4ZPIA 5F3IA 4CCCA 1MZ6A 2VXJA 3T08A 1CAVB 4N53A 4ES9A 3VBFB 3BALA 1Q8PA 3VBUA 4A3ZA 2AEZA 2XBO1 1XNDA 2J1UA 3AKTA 5EFUA 4D7YA 4DY3A 2BWAA 2VW2A 4LKFA 4A7YA 1BVVA 1ZREA 1ZZBA 4HSLA 1WBLA 5F32A 4IUGA 2OZJA 4GD4A 5FKBA 4Q4W3 2BFUL 4QKFA 3WF0A 5CEHA 3D4KA 4GJYA 4IV3B 2P3YA 5A1FA 5EYXA 3RJ2X 5AFEA 1RVF2 3OY8B 4AGRA 1XYPA 4ZKTB 4DO0A 2YPDA 3I2KA 3I3QA 1XNKA 3TN92 5JSPA 2EIEA 5FYMA 4BQ4A 1F31A 3ZR6A 3U07A 4KG0A 5J1XA 1EYBA 4JGZA 2F17A 1AZDA 1EUTA 2JG8B 5FCCA 2JDKA 1GANA 1LECA 4BCUA 1QDOA 1XC6A 3I3DA 3K48A 2K9ZA 4UF0A 1UOGA 1DLCA 3W58A 1C8M3 4MUVA 3A4UA 1EPZA 3TEZA 5IK5A 1NCQC 5L73A 2R072 1QJU3 2ZHLA 1L7QA 1CAVA 1QXPA 3OB8A 2RS13 4Z2WA 3HD8B 1VBC2 2HWE2 3GBWA 2CWSA 3PMSA 1W8FA 5LY1A 3HNMA 4Q8LA 3I7DA 1L7LA 1UX7A 3F2ZA 4CDQA 1COV3 3USSA 5DZFA 3AZYA 3ZMOA 3PURA 4Q4Y1 5FZOB 4BA6A 1WMXA 4GMP1 4LKEA 5GLWA 2W47A 2FMDA 2J1RA 3QBQA 3M3CA 1OT5A 2VOTA 2Y6JA 1UY4A 4L9BA 2XMLA 3AP4A 1WMDA 3PU3A 4AEMA 5A3MA 4Y5Z0 4XYXA 4AGVA 3KHCA 3M8LA 2JIJA 2JJ6A 3HBKA 2SLIA 5LBCA 1LOFA 1SMVA 3ZXJA 1C4RA 1JS9A 3NNGA 2GSYA 3LEIA 2WL1A 3C7GA 5DAXA 4ZU5A 3D5OA 4DXZA 4YVWA 4YFZA 2YGLA 2ZX3A 3LA2A 4MXVA 4WVZA 4PJYA 3URFA 2A5ZA 2XVGA 3MFCA 3BCWA 1RB8G 2WRAA 1HRV3 1UPIA 3BUCA 1ULCA 1UKGA 2NMNA 1A8DA 1WKYA 2XDVA 5A7OA 1CD3G 4OQ9A 3ZO0B 5JXGA 1H4HA 1POV0 5F3EA 4QDRA 2ARAA 1LGBA 1P8JA 1NXMA 2PHDA 4GH4A 1LOBA 4CUBA 3ZFFA 2O0OA 5FPAA 5KHGA 3C7HA 3N7JA 5FZOA 4QWNA 2QJVA 2IVJA 2VH9A 1PVC1 4A6OA 2DBNA 3RJRA 4XBNA 2GZWA 2VQAA 4QPGA 1NY71 5C4WB 4GQ7A 1NLQA 4XXPA 1ZYBA 3SEEA 1VBA3 3UV9A 3IPVA 3AYCA 1URXA 5HXVA 3RGBA 1N3PA 2ZEXA 3C7EA 3WUCA 4WVVA 4P9LA 2X5IA 1KDKA 2TUNA 3GGLA 3PTRB 2WA3A 1H1MA 3DYOA 1AR63 1VAKA 1CONA 4COVA 1S0IA 5LWBA 4LKSA 2JG8C 1DGWA 4IERA 4DS0A 2QDRA 4XCBA 4XAEA 5ABJC 5FWEA 2VZSA 3E6CC 1AR61 4Y1VA 3BPSA 3TAYA 2VOKA 4QHOA 1GKBA 2PHWA 1H6XA 3VKMA 1G9AA 5F3CA 2WLQA 4DRVA 1VBA1 5FYHA 1IPJA 4XIKA 2VTXJ 2EIDA 5C3QA 4AFBA 4MGIE 1N1YA 3MUY1 1QU0A 3CO2A 2WSVA 2B46X 2GNBA 3A23A 4PQQA 4YZ3A 1GQPA 5L9RA 2G9FA 2GP3A 2PXJA 3D8CA 3U1XA 1G9CA 1WGPA 4LORA 4CU6A 1W6QB 2JDYA 1W2AX 3MIHA 1Q3EA 3K75B 1MS1A 4NIIA 3JD72 5FQ0B 1MPXA 3UYJA 2BEOA 2WABA 1QXRA 3V0BB 2HEYF 2QQOA 2HLEA 2QVSB 2DWRA 2X5IB 1ZZ8A 3T1MA 1JYXA 4PLNA 1OPMA 1NKGA 4CCJA 3OPWA 2DBIA 3O7OA 1PIV1 4KWKA 4ONUA 4XQDA 4BDVB 2WAAA 2QQPA 1BHGA 3QOPA 3OTFA 1N3OA 3NVCA 1GP6A 4S2DA 4BHPA 4MG2A 1EP0A 4X8NA 4MZUA 5C8CA 5FLHA 1U12A 5A7NA 2OUJA 1AXZA 1TG7A 2PFWA 3RI9A 3H7JA 5I8YA 3BTXA 1OUXA 1QNWA 2D3SA 1OD5A 4FFHA 5FYYA 4LPLA 4QX1A 2VZ1A 1WCKA 1XYOA 3N9PA 1SLTA 1V6MA 1DQ5A 4KNCA 2FCTA 4YGEA 1VBA2 4GALA 1LULA 2R071 2Y34A 4YWAA 2OZ6A 4BE3A 4CDXC 4ZONA 3DL3A 1AR62 4Z82A 3WF1A 2ORXA 4R8HA 1DYPA 2KR2A 1YHFA 1JYNA 3TEXA 1OH3A 4KI5M 5BPXA 2Y64A 5FP8A 5T55A 5E8AA 1ZRDA 2C24A 1JHNA 5FQ0A 5ANNA 1FPN1 4AEDB 4RFT0 3WQ0A 1BXHA 1W90A 5J09A 1G8WA 3V64A 2VJXA 2HWB3 3GJAA 4BQWA 3NNFA 1ENQA 5L9VA 1WLCA 5A6YA 4QHZA 1JZ2A 1RVF1 3WDUA 2VZQA 3CEWA 1NY72 4YGDA 1O3SA 1YI7A 3DXTA 3I49A 5F2WA 3RWNA 5FYCA 3ELNA 1UY3A 3ES4A 2BV4A 2ZJCA 3SXWA 5FY5A 2D6MA 4P9IA 3RYRA 3VBHC 5FY8A 5A6XA 5G04L 1CZVA 3LFMA 5FZKA 3OSDA 4GH4B 3K4AA 4I0WB 3LQCA 2RDSA 4GA9A 4HKLA 2PHLA 2VTXA 2WJSA 4PIZA 3SH5A 4YARA 1MS4A 3AL6A 4WBBA 1REEA 1POV3 1CIYA 2X5IC 2VY0A 2ET1A 2ZGOA 2Y6KA 4M01A 4WM8A 4WVMB 1CAUB 3I2IA 4QPGB 2DCJA 3WXPA 4OHZA 1FOD1 3WNKA 4A42A 3A7QA 5KR7A 1PGL1 3CIHA 3MHZA 4XUOA 4W8JA 1VR3A 2VGDA 3N9QA 4MGQA 2CGOA 4GXLA 2SBAA 4XJ9A 4YM0A 3H8RA 2ZS6B 1ZBA1 5K0UC 4PDWC 4FCAA 2VMCA 3IDBB 4JDOA 5DPNA 1QJEA 4DZGA 1K12A 1PGW2 1YFYA 5IFPA 1SEFA 2WT2A 5DUVA 3JD73 1E5RA 1OBNA 4QPIC 3QD6A 1OLME 5C3OA 4N7IA 1ALYA 5JXIA 2B8MA 5IJRA 1LGCA 2IWGB 2IC1A 5J98B 1JH5A 2WNUA 1SLLA 1CAWA 2I45A 1QJY1 5I8SA 5BNPA 1HV1A 2ZGQA 1VALA 5H9QA 2ZHKA 4NR1A 4ZU4A 5IVYA 1W2UA 3PVEA 4UXAA 1NX9A 1VBC1 3HOBA 2B39A 3KSCA 4L11A 2LALA 4ZZ5A 3SCHA 5E88A 2ZGKA 4ZXEA 1D4M2 1W2OA 2XB6C 3WNLA 3NNMA 5CFDB 3PUQA 1LOFC 2RDRA 3OBZA 2P3KA 1IG0A 4GWMA 4WM8B 4ITCA 4XF1A 3RS6A 2R062 1RUF3 2YXSA 4XFAA 1Z78A 3T4VA 1UZZA 2JDAA 2JWPA 4BMEA 3ZSLA 3O1SA 2QQUA 4LO4B 1QOTA 1VBD1 2ZKLA 4E27A 1GNZA 1G9BA 1GUIA 1GQHA 2A6WA 2HKXA 2VCMA 2ZGTA 4B4QA 5C5UA 1W28A 2YBSA 2WZEA 2FD8A 1PO23 3DN7A 2Y6HA 5GLVA 4CCEA 4QHBA 3WW3A 1U5YA 5EZWA 1YQ5A 4NROA 4B4PA 1VMHA 1FXZA 2ZMKA 1RUI2 2ZKNA 1RUH1 5L9BA 2IXHA 1OPOA 4FFIA 4RR3A 5C8CB 1BJQA 3MIDA 2MEV3 3RYPA 2OUHA 3H1MA 2YGMA 1ULGA 5C7GA 5EIYB 2XBO2 3APBA 1VRH3 2ADDA 1ENXA 2GP5A 1ULFA 1WA4A 2ZACA 3PUAA 1AR72 5F5IA 4XXAA 1AX2A 3IWZA 1SLAA 5AC91 4ZY9A 4JAAA 3VD9A 3LOBA 3B93A 2JEMA 4YW2A 3EB7A 3GZTB 5A32B 4P5YA 4MXWA 1NE4A 2E31A 1RUC3 3JQXA 2BNNA 4RGGA 2XOMA 5C5TA 2OVUA 4NHXA 1UN1A 1NQDA 1RMU1 2CL2A 1HQLA 3HEIA 3POIA 3PTYA 5EXOA 2VOVA 1H8TB 3DPRA 2E51A 3B7MA 1AXYA 3VV1A 3VZOA 3KHBA 1N47A 5F8PA 3UESA 3SH3A 3VLBB 1GWKA 4NAOA 5FP9A 1JOPA 3VBHA 1NCRA 2BZDA 5F37A 4O9EA 1NOVA 1LCLA 4I30A 5FLJA 2A73B 3H0OA 3O1RA 3KMHA 3CZUA 2D40A 4EE2A 1TME2 2GALA 2W1SA 1OLRA 2WUHA 1VLNA 3CQOA 4AWDA 1LOAA 2R063 4CEWB 1RMU3 1RUH3 1B35C 4FI9A 4FAGA 2BFUS 2RS33 1DYOA 3I3EA 4IEXA 5JI9A 1XSRA 3RG0A 1W6NB 2F4PA 4N8MA 1H1IA 2Q1MA 5DXDA 4Q4X1 5F6LB 1REDA 4MYEA 4ZS3A 3MPBA 3E5XA 3ZDSA 3X29B 4O61A 4BISA 4KU7A 5D21A 3T1LA 1CAUA 2YFUA 5FPXA 1WLWA 1PO11 1LOEA 4CCLA 1ENSA 1XJAA 5E6HA 1W2NA 2CGPA 2XJPA 3EJKA 2G1MA 1O8PA 3ZFEC 2OQ7A 3U4SA 3HN1A 4BK4A 1AR91 5FYTA 5F2SA 5E16A 3H50A 4NHLA 5K7PA 2H6BA 1X82A 4MO3M 1WLDA 2E7AA 4COWA 1US2A 1R1A1 3C7FA 5K9YA 1NCRB 4CDUC 3FFQA 3J4UH 5FBJA 5GLZA 5EWSA 4TLGA 4I02A 2EXHA 3VBFC 4IEUA 5C8CC 5HV4A 2TEPA 3T09A 2ZHNA 2IFWA 4LA2A 4MV2A 4RHV1 4TYSA 1GP5A 3WF3A 3CLPA 1FATA 2WNUB 1PO22 5F5AA 1O5UA 4HVOA 1JYIA 4RQPC 2QQMA 4QQ2A 4DEQA 2R7EB 3N9LA 1W3XA 3DEMA 1KD7A 1E5SA 2I2SA 3E97A 4W65A 1UX6A 2W46A 3HQUA 5DAVA 3BIEA 2XGXA 1QJU2 4CCKA 1O91A 1BYHA 3O5SA 1R64A 1DZRA 2HEWF 4L0PA 2JD4A 5FZ8A 1W0NA 4LIVA 4TXWA 4XJZA 1GP4A 2RDQA 4YSFA 1W8NA 3ZYRA 1TME3 3T2TA 3EMRA 4CE8A 3EQEA 3POBA 1HXS3 2KA3A 2CYFA 2DF7A 3FN9A 4QGLA 5HV0A 3FLTA 5JIUA 2XUEA 5GLTA 5ISLA 2W3JA 3N7MA 5FPUA 1RUJ2 1F4HA 3BIWE 3WDWA 1ULOA 2P17A 1RC6A 3IDCB 3B5LB 2RS11 3A21A 1HXS1 1TNRA 4YRDA 1O7FA 1OFNA 3R4SA 3AX4A 4Q0PA 2MHFA 4OHYA 1FNZA 2GNDA 2JKBA 4LA3A 1AJKA 1TE1B 2VUDA 4LBMA 1UZYA 3MIBA 4HONA 1RUE3 1HRV2 3LDRA 2OKXA 4BQXA 3KM5A 2G9ZA 5FWJA 1MS9A 3CMGA 1UOJA 4CXXA 1WD3A 2A7AA 1BEV3 4I3GA 5T3NA 2Z42A 3FFZA 4TLFA 3WSOA 1WMFA 1MEC1 3M3OA 3MF9A 3S30A 4CRQA 4QPGC 2EAKA 2RE9A 2QQKA 3ASIA 4K1ZA 1YXWA 1M06G 2WYFA 3BTZA 1GFF2 1FV3A 2RM21 1DU3D 4NO4A 3WLUA 4GMP0 3VHRA 1Z7S1 1JZ7A 4L92A 4Q4W1 2RR12 4YZ5A 4XOGA 1UY2A 4W6XA 1JTZX 1LENA 2H0VA 3AC0A 4OMCA 3PIJA 4PBOA 4A44A 3VBHB 5KWRA 3WINE 2RMU1 2Y6GA 4JRLA 1I6XA 3VL8A 2B9VA 4CDQC 5FZ9A 1GNYA 3TWIA 3UJOA 5JOYA 2R1DA 5FV3A 1U5XA 4CEYB 5JVVA 4YGCA 5TSWA 1QJY3 5FK8A 3JBG3 2RHPA 2WNUC 4ASKA 4EYUA 1RUD3 1YRZA 3IAQA 5FR3A 5K0UA 4P14A 4A41A 1Y43B 3HJRA 1OVSA 4D6RA 2WQ8A 1OD3A 5FZIA 2XKPA 4E2GA 1H8VA 2R49A 2XR4A 1Y4WA 1I9RA 1Y9MA 2V4VA 3B02A 3GM8A 3I54A 4WZFA 1DZTA 4JGYC 2XBO3 5FYVA 1YIFA 4ASLA 5K8SA 4MHRA 1W3VA 5CG9A 4Q4V3 1UZWA 1BLZA 4N43A 1JXNA 2DU1A 1HX6A 1BEV1 1QHDA 1RUJ3 3WV6A 4RD7A 4URTA 4AR2A 3NKGA 1V0AA 2UWAA 3ZFEB 2VVFA 2WS91 1NLRA 1RUE1 5LRSA 2V4AA 2VQUA 2Y0IA 5IATA 4ARYA 1UXXX 4XDQA 1AUYA 4KBZA 4BYYA 1WCQA 2OYZA 3M3IA 2ZZQA 1H9WA 1RUE2 1IS3A 1PM4A 2BDRA 2A1XA 4Q4Y3 5C9AA 3PU8A 1QGLA 1JZ4A 5LEJA 3VBUC 2GAUA 5FK7A 3RVHA 1BEV2 2W52A 2G19A 5BV6A 2VMFA 3MW4A 3WF2A 2D5FA 4FQ4A 4KBBA 3WDVA 2PHRA 3HR9A 3LB9A 3T0DA 4NIGA 1K5MA 1U0AA 3POSA 5FY9A 5J48A 4K7JA 3I2HA 4UI9L 1W9WA 1ZBE2 2BVVA 2HBUA 2UURA 5LA2A 4CDUA 4IV1B 4BM8A 2FDFA 1WCDJ 4XABA 5JLVA 5JXHA 3ZN4A 4A3XA 2W95A 3ZYHA 4AAXA 1GZWB 5F7UA 1IS6A 1BK0A 4GWIA 4LTAA 1S0JA 1UIKA 1IOAA 4PHZA 1W8OA 4F7ZA 1EAH3 3JUUA 2UY9A 3LSEA 4LR4A 3IMMA 2NLRA 4YW7A 1OQDA 1CAXA 1H1AA 2QTWB 2VZOA 4JVAA 3MW2A 4AQTA 2J1EA 1HB1A 1LHNA 3ZXKA 1RUD2 2XQRA 4I0BA 4Q4W2 2IVIB 4E2QA 1YWKA 4C8DA 4BQ2A 1YCIA 1O5LA 4C90A 1B09A 1SFPA 2RM22 5DABA 5C9AB 2RS53 4AL9A 3SNMA 1UY1A 2X05A 3VDDA 4LJHA 1S0FA 1NE6A 1GU3A 3TN93 3LF7A 1OOPC 4DFSA 3MIFA 4QQHA 4RL7A 1MS8A 5ABJB 1OOPA 3BGAA 4LBLA 5IAVA 1LU1A 1MEC2 1TEIA 1T2XA 3AP5A 4I09A 2HWC1 1M4WA 4P9WA 3LAGA 3WQ7A 4DXSA 1ASJ1 2O8QA 2D43A 2W0XA 3IIAA 2A3WA 1MVEA 4P00B 1RINA 4QX3A 3VBRA 4XUNA 4O9GA 2VBPA 4CCNA 5BNNA 3PVBB 4QKBA 1QWRA 3INAA 4I0AA 5DUXA 4A7ZA 5JSRA 4AFAA 1DYKA 3P1IA 5A7WB 3JU9A 3W21A 4DINB 1V00A 1W0PA 1CWPA 2VXRA 4OCTA 3Q8CA 1W9TA 3NSTA 2RS12 3I2JA 3MGUA 4ET7A 5BNQA 1KEXA 1AX0A 1LEDA 3FBMA 3HN3A 3HPNA 4YLZA 5FZCA 1ND2C 4SBVA 4CDWA 2WSUA 1N3QA 1WBFA 4UW5A 4Y1UA 4FTEA 2QE3A 3QLQA 4PLOA 4WM7A 1S55A 1IS4A 3ILFA 4FOWA 1AYN1 3W9AA 2R043 3FZ3A 2GMMA 4ZHNA 1Q56A 1QDCA 5LRRA 1NQJA 1POV1 5JR7B 1VBB3 3U0ZA 3KT4A 1TMF1 1IHMA 1CJPA 4D3WA 5FZ3A 4AOCA 3WNNA 1HQWA 1S0CA 1FMD3 2Q5TA 3WDTA 2A3XA 5IVFA 1C8NA 2LS6A 4JX0A 3LIHA 1BKZA 2VOXA 4L99A 5BUVA 1A8MA 3B9IA 2A70A 1LESA 3I97A 2VUAA 5ACA2 3RNSA 4KGGA 3V65A 2LM3A 4BH9A 3J26N 5GJ6A 5CFCC 5FMBA 2JG9A 3OEBA 1ENRA 4WVWA 4RHV2 4MH0E 3ENRA 4UFJA 1I3HA 3WG1A 2BPA2 4B29A 1OVPA 4XCAA 5FY4A 5JOWA 3S0MA 5A3LA 1KJRA 3B9CA 4M3CE 3KV6A 5G05L 1CPMA 3KS7A 3UKNA 4CDWB 1MZEA 1NT0A 1R1A2 4L8QA 1ZBE3 4JGYA 2K0GA 1RUF2 2WR9A 3ATGA 4M3CF 2BBAA 3TYJA 3AB0A 3LD8A 4PLMA 3WT3A 3FLPA 2JDMA 1B35B 4NHKA 5FYIA 3L2HA 3THTA 4PIYA 3AVRA 4CXYA 3VZMA 3LEGA 4RR3C 4D69A 5FZ6A 3MF6A 4UFLA 4AHZA 1ACCA 3FX3A 1LGNA 1FPN3 3MDPA 4QGMA 4Q4X2 1XNCA 1W05A 5EV7A 1KXGA 2E6VA 1QH7A 2W9XA 3FWEA 1K5MB 2W2IA 4YVWC 2YZ4A 5DQ0A 1GOGA 4XQWA 2JB4A 2NM1A 3ACIA 4IEZA 3RZHA 5DAWA 1ZBA3 3AXDA 4Y22A 1XOYA 1PHMA 2AH2A 3THDA 1ND3C 4DEVA 1QH6A 1OA3A 2XJRA 3PVNA 4IV1A 3IAPA 4E8DA 3ZMNA 2R042 1N1SA 4NRMA 1CZTA 1X36A 2O14A 2D97A 2ZGUA 1SDDB 3KD4A 4AFDA 3AP9A 1K45A 2FDKA 1N1VA 4IGPA 1XU1A 5IVBA 1SDWA 1C3HA 2IUWA 4XMIA 4Q1PA 5FJKA 2ZOEB 5JI7A 3BU7A 1VPHA 2CV6A 3OGGA 2A6YA 4HETA 2CNAA 3KV4A 4W4ZA 4YG6A 1RL3A 3KVBA 1ZX5A 3IZOA 4HBNA 4AEKA 2XONA 1MQTC 5IVJA 3K46A 2F4LA 1C5HA 1GNHA 5FY7A 4I3PA 5T5PA 3ZXAC 1AYN3 2D3RA 2XXZA 5ERLA 3VZKA 4KQ7A 2VMGA 1WA6X 1DFQA 5IFTA 3CL1A 4PBPA 3KCYA 4NIAA 5B4NA 2LROA 3PUSA 1V70A 1DQ2A 3K2OA 4JGZC 5CYYA 3J8F1 4HT1T 5EJ3A 4HPKB 4JZRA 4YW4A 3VBRB 3VHNA 4CXWA 1YFWA 1R1A3 4Y22B 1QOSA 3WD5A 4Y1XA 3H1WA 3NV2A 1W6OB 1SHWB 4LMFA 2V5YA 4YG0A 4AVAA 5FZ4A 1RIRA 4CP0A 4IETA 3WP5A 3U14A 3LEMA 1RUH2 2OXBA 3H3ZA 1IPKA 1HRI3 2P34A 4WM8C 4C0BA 4MLOA 1IS5A 1J3QA 5FYZA 2R041 3EO6A 3I59A 5F5QA 1YJKA 3VZLA 2WYSA 4WM7B 1WW5A 2GMPA 3EXUA 5JR2A 3KCCA 5DN2A 3GXUA 4UAPA 1ZRIA 1I5ZA 1H2LA 4UBHA 4CDXA 1D4VB 4Z07A 1WLTA 3QH7A 2DUPA 3MO4A 4HKWA 4YG3A 2DYCA 3ES1A 2R061 3FHIB 4QM8A 1GICA 4Y4RA 3ZYGA 1YJLA 4D94A 1AL21 4N53C 3NV3A 4LUMA 5JUVA 4Z92B 1UOBA 3CF6E 5JMOA 4LBQA 2RJ2A 2W08A 4AI9A 4S2GA 4EV0A 3N9NA 3ZXLA 3VD3A 5A33A 4AQ2A 1UZVA 1T6BX 1PGL2 3KT1A 2EVXA 2HEVF 2R30A 4Y33A 4HVQA 3ETQA 1Q5OA 1W6OA 1RUF1 3J7MA 4NIDA 2XUMA 4UW6A 3GBGA 1UZ0A 4BIFA 5T54A 1HDKA 1SCRA 5LBEA 1R081 2P6HA 3ZPOA 3QH6A 2WLPA 2PAEA 2C9KA 2R32A 4XFCA 4L2NA 1HV0A 1ZBA2 5CADA 3I59B 5A1AA 5JPMB 1AYM3 1X8EA 3ZX7A 3VD4A 4FOVA 3AMHA 1OMIA 3HAGA 4QX2A 2HH9A 5L19A 4XJ8A 2DURA 3EYPA 4BQ3A 4FP2A 4E4ZA 1LJ7A 5A80A 2JDNA 3PVOA 5GLUA 1PZ7A 1YEWA 3RFRA 1OQEA 4Q29A 5KXBA 5LCWL 2W68A 1JOJA 2VUJA 5KHHA 5FO8B 4OHWA 2VMDA 3IDEA 3ZYPA 2Q8DA 1BVP1 2QUOA 2ZGLA 3FLRA 4GKXA 4M0HA 3ST7A 4J25A 4YPJA 1FOD3 2RDNA 4XF4A 2FBEA 4YVSC 3PUIA 2GU9A 3JCIA 3NV4A 4E4SA 2B42B 2ZGMA 4EWDA 1I1EA 1AYN2 2VPVA 2XLFA 3N35A 1OXCA 3IIIA 5FZGA 4LBJA 5DG2A 3T2QA 1ZRRA 2AZ5A 4G3YC 1POQA 5F9TA 3MLLA 1PK6A 3OUHA 5T50A 1CN1A 1QNYA 3KQ4B 2WWUA 4OI1A 5J37A 3N3HA 2ATFA 1RXFA 2W92A 4X6QB 4XAAA 5FXWA 3HBZA 2G9GA 1PMHX 1HRI1 5I93A 1X33A 3V0AB 4P08A 1XE7A 1EY2A 2BYVE 4XZPA 2PQSA 4FXGB 2DTYA 4YM1A 3MUZ1 1UU4A 2DU0A 1JU3A 2BOIA 3BYWA 2Y38A 1MZFA 1V6OA 1F4AA 3ZVXA 2X29A 5FPVA 4E2SA 3DECA 1WUVA 3J8F3 1EUUA 4PF5A 5JZGC 3I2DA 2ZGRA 5SV5A 1S2BA 4ARXA 2CAUA 3R4UA 3RZGA 3NNJA 4OI0A 5FOBB 4GB31 3I3MA 4DMIA 2GNMA 1HQNA 3NAPA 3O14A 1HKDA 3ABZA 1BZWA 3O1VA 5GZCA 2ZEYA 2XWBB 3CJIA 4OLLA 1KDMA 5FZBA 4E8CA 5C8WA 3C3VA 5L7OC 3RYKA 3G7DA 4H7LA 1ZM1A 1RVF3 4DUVA 3ETPA 2CSGA 3BU0A 2UYAA 3CZJA 4HVRA 1Y3TA 4GWNA 1MQTB 2CDOA 3UK9A 3B3QE 1XRUA 4P02B 5FP4A 3USUB 4Y1ZA 3AZWA 3LIGA 2ARBA 2X53S 4N9HA 2ZXQA 2ZTNA 3DKQA 2WFPA 3TNPB 3A0NA 2NQYA 3POJA 4D6QA 3ZSKA 3ZFFC 2O1QA 3H8OA 2P5BA 2YROA 4HL0A 1D0HA 5FPZA 5LY2A 2E7QA 1RUC2 2PLV1 5LA0A 3JD71 2VZ3A 4M3CB 5JOZA 1HIXA 2GDFA 3RZJA 4RYDA 4AHXA 1D2QA 1ND2A 4HK9A 3RSJA 5F3GA 3T4HB 1PZ9A 5FZ0A 3ZIXA 5LA1A 4LT5A 4PCRA 4PF1A 3LZZA 2HWE3 2IFRA 1W06A 5FPLA 2DCZA 1O3TA 5DZGA 1FI2A 1A3KA 3AKPA 1UO9A 4YVWB 5IWFA 2WN2A 3FC0A 1LOGA 2YBPA 4FPJA 4JRAA 1C5IA 3ZFGA 4A6SA 4BQ1A 5HXMA 5BY5A 3ITQA 4RQPA 2B7YA 5FKCA 2RS51 4IEPA 2IXKA 5JPNB 4AI1A 4NPRA 5AC93 1J3PA 1QJZA 5DG1A 3VHOA 4LOTA 3ZSEA 5JZGB 2WS92 5C4WC 2D3PA 4CTEA 1RJ7A 5I0SA 3USUA 5FUIA 4XPVA 2R0FA 3VDDC 3VL9A 1XSQA 1LHOA 4LO6B 5LATA 4AEJA 3MLKA 1PMJX 2AEYA 1RYYA 4XF0A 2OQ6A 3RZLA 2R16A 1WZXA 3L9JT 4JDNA 4J1WA 4KU8A 1H9PA 5FP7A 5B2GB 4ISQA 4YW3A 4QMAA 1H2NA 3WP3A 3NKTA 4IV3A 1Q43A 1SZBA 3P3PA 3OY8A 1I5PA 3T0AA 2ZX1A 1NCQA 2D98A 1CIWA 1E5IA 4CP9B 1ZZ7A 5C3RA 2ZGPA 5I0RA 2F6BA 3OPTA 1D2SA 2ETEA 3FJSA 1OFSA 4AQSA 5EP9A 4K9SA 2JE8A 4ORFA 4YM2A 2C5DA 2XJVA 3MYXA 3AM2A 3VB9A 1D4M3 2RMU2 3LPGA 1DIWA 1O8SA 4WZCA 2YHJA 3SQOA 4PI2A 1OLMA 2J1TA 2WNVC 5F39A 4R9DA 5CKQA 1W6MB 2DFBA 4BWOA 2QQJA 3JQWA 4AHWA 2WINB 2HWD3 2YC4A 4OZOA 4JDMA 4MGSA 4B7KA 3UGFA 5BXXA 1JZ8A 4XE9A 3KB5A 2WWSA 3OGJA 5KXCA 1F35A 2VECA 4LQRA 4QXKA 1ULEA 2OS2A 4NN0A 2J1SA 1HJFA 3M4FA 1JUIA 3AFGA 3AZXA 2BP6A 3DPRC 2C1FA 1AYM2 1OH4A 3AZVA 1VE0A 1NCQB 4IESA 2D6LX 5A3UA 1JYWA 5JXJA 2OIIA 2WNVA 2H6CA 4KH9A 2XH6A 4A45A 4V1PA 3V0BA 2Y6LA 4A4AA 1SBDA 3SKVA 1HXS2 4UWDA 2WS93 5CA6A 1ZRFA 3LKJA 1YIPA 5FYUA 2JECA 1H30A 3JBG1 1ZZ9A 4QPYA 4D7SA 5LB6A 1JU4A 1FMD2 2P6CA 2WO1A 3BB6A 3ECQA 4YGBA 4LE4A 2HWE1 1GR3A 4K40A 3VKLA 3ZXDA 2LUWA 1S0EA 3IB3A 4LK6A 3K51A 4PT6A 1RUOA 1SCSA 2DDUA 3NO8A 4NRQA 4RFRB 2I74A 5FXXA 5H9SA 1IKPA 4GMP3 4N53B 4LOSA 5FAXA 3H7YA 3NV1A 1A6CA 4IV3C 3JB4C 1AR93 4W6WA 1CZSA 2Y8KA 1GWLA 1KS5A 4FFGA 4H2AA 1QJU1 3K3NA 2QNKA 3ORJA 2Y6FA 3PHMA 1V6JA 3L2YA 4QX7A 1NLSA 4U2AA 3NW4A 4M3CA 5FMOL 5C4WA 3O1PA 3VGIA 5LW9A 5D1IA 2VZRA 3E6BA 2ARXA 4KWJA 4IV1C 1W9SA 3TBDA 3CJXA 3O0XA 4P9JA 3LDKA 4QKNA 4AYUA 4JKMA 3MZHA 2JG8A 3HQXA 3VUOA 4IQPA 2BOJA 3B00A 3E1F1 2PAMA 2NMOA 4KGQA 3S5AA 4LHNA 4NPLA 4RQPB 2C6SA 4H7MA 3VHPA 4XILA 3AP7A 1W03A 2JKXA 3MV11 3ZPYA 2HWF2 3OD0A 4DOUA 2FDIA 5T5JA 5BYNA 4NE9A 1JZ5A 5JZGA 5J7MA 3GDBA 2ZBJA 2Q1FA 2WBKA 1K3IA 1QJX2 2JDZA 3FBYA 1V9U1 4R9AA 3N36A 1XNAA 3Q8BA 2WN3A 2DVBA 1MS0A 2JE7A 3SCFA 2C9AA 2ID4A 2D6KA 2O8OA 2P2KA 2WO2A 3WNXA 4AK3A 1ZA7A 2QFEA 3KZ4C 3KVAA 2JDHA 2JENA 2AACA 1X9PA 3ZKUA 3C7OA 3SCGA 4IGQA 3AK0A 1Q8VA 4HOOA 4OUSA 1AF9A 4EROA 2YFZA 1QQP1 3KWVA 3MPPG 2ZAHA 4CYDA 5HI0A 5FZDA 2EIBA 3CJIC 1LHUA 3PIGA 1W6PB 4BLJA 1QQP2 4B4RA 4LIUA 4RA0A 3ZLIA 3LA7A 4LE3A 1NA1A 4MADA 3SMHA 1FAYA 3S7IA 1YQ8A 3LCPA 1XE0A 1R083 3AJYA 4Q4V1 3RI8A 4DY5A 4CEYC 4D7TA 3NJXA 3R0RA 4ZS2A 1OHFA 1DZQA 1SPPB 3WCRA 1W6MA 3I2FA 3WX5A 2VW1A 3EHKA 4DNYA 2ZMLA 2WFF2 3IDAA 4OI4A 1R091 1WCUA 1DGWX 5CNAA 3VBFA 1AR83 1NAEA 2VQTA 1AVBA 4K8RB 3OUIA 4IEQA 4TZDA 2E7TA 3VBSC 2VTFA 2HWF1 4LBKA 4AVVA 3PUHA 1AR71 1BBT1 5CIRA 2Z79A 5A1LA 1UYZA 5A70A 3BOPA 2R6QA 1V9U3 5C3SA 2ENRA 4XUPA 3ZSJA 2GMEA 1VAMA 2EXKA 2WNVB 5DDJ2 2YC0A 3TOJA 1W6PA 4YFWA 4CUAA 2FMYA 1PX3A 3B69A 4EN7B 2FCVA 2YG0A 3J7NA 3UKTA 2V09A 1NA1B 2Q4SA 4SLIA 2XVLA 1LNSA 3GZEA 5GZDA 1QF3A 2W94A 3T2OA 4N7UA 4JV4A 1TNFA 5FRAA 2RMU3 1OC1A 4JCKA 1GSLA 5C3PA 5DMYA 4FO9A 3BPZA 3GNEA 2RR13 2ES3A 1G9DA 3IBMA 1CESA 4C91A 2Q8CA 1R092 2WFF1 4HLTA 2ZEZA 4F83A 1ZZ6A 3M2MA 3OGSA 2BERA 1UCXA 1S0DA 4LEJA 3O1TA 4HXCA 1GLHA 1SLCA 1Z0HA 1VB2A 2E26A 2VM9A 4QQLA 4WVMA 1TMF3 1QJX3 3TNQA 2RVAA 1W6QA 1QJY2 1J59A 3JBG2 2G4IA 2YBKA 1DBNA 4LULA 5HCBA 1H8TA 3ZYBA 1WW4A 3SISA 2UU8A 2VO5A 1QXJA 3OD4A 3TB0A 3OF1A 2E33A 5CVRA 3GHNA 3O1MA 1QY4A 5CFDC 1XNBA 2W1UA 3IN9A 2WT1A 3OUJA 4UOJA 1AYM1 3HNYM 3JZVA 2AREA 2AGSA 1WCSA 2DVDA 2ADEA 4XACA 3WG2A 4GZ9A 1X7NA 5CZKA 5IHRA 2AC1A 3KF3A 1VIWB 3N7KA 1UYYA 1CX4A 4R9CA 2D93A 4XJAA 1UPSA 4ATEA 3BKZA 1CX1A 1GZTA 1V6KA 2R1BA 3I3BA 2VULA 2YDEA 3M3QA 5EPAA 4AGGA 1FOD2 1UMZA 4IXLA 5HCFA 4CU8A 1CAWB 4B8EA 3ZM8A 5BNPB 1V6IA 4LXLA 4UW4A 2EALA 4RN5A 4Y5SA 1PIV3 5DAPA 1V9U2 1SQ4A 1QJX1 3ZFFB 3LPFA 1C1LA 5FFOC 5C9AC 2XHNA 2XJTA 3RRDA 4AXOA 4F3JA 4DXRA 2W87A 3WHTA 2A6XA 1G6NA 1ZVFA 3D0JA 4K20A 3AKQA 3GHMA 1WW6A 2WFF3 4GIQA 4N43C 4D6SA 3A22A 1Y7BA 3ROUA 5HCAA 4A2UA 2ZPXA 5BNOC 2JDPA 3IPVB 4NUBA 5L7OB 2GN3A 2YV8A 1BK1A 3AYEA 3OOXA 4D8MA 3W5NA 3H9AA 3ACLA 5E1RA 1ZA4A 2PN5A 4MSVA 4P5HA 2FHRA 4CEWC 2Y33A 3VBSB 5I8TA 5LZ6A 1YI9A 4GH4C 4HKOA 4AAPA 5I0TA 1UMIA 1CGPA 5E89A 4XVHA 3SKJE 5CAZA 3POGA 1FPN2 3E6DA 4Q4X3 2CHHA 5FLIA 4PQ9A 4KWUA 3SEPA 3DYPA 1S2EA 3POFA 1E57A 4UW3A 2Q8EA 4FXKB 2HWF3 2CWMA 1YC61 1YNAA 2VZPA 4QX8A 3THCA 2AENA 2EF6A 4LBOA 3T30A 4IL7A 2OPKA 2YU2A 2QCSB 3FUQA 2EAAA 2RS52 2FDJA 5FMCA 4BPZA 4MGZE 5FZHA 4CCMA 5A32A 5CISA 4LLFA 4LKDA 4MXWB 1MS5A 1ZNPA 3WNMA 3AYDA 1HN0A 2ZEWA 5FZMA 4COYA 1FMD1 3WQ1A 3O1OA 2NPIA 4MX3A 1IGOA 2C0ZA 4XQ4A 1DG6A 2PHTA 2QQNA 3ZR5A 5L7OA 4BB3A 1O4TA 4QGNA 1ND3A 4Q0UA 4QU2A 4J6GA 1ODMA 1HW5A 1SLIA 2XVKA 1JODA 1YUDA 4Q5OA 4BZ4A 1V6NA 2WO3A 2Q1ZB 1PNFA 4NIHA 1AX1A 2GC3A 2P3IA 1PIV2 2XLAA 4URAA 4IE7A 1C57A 4NVPA 4YW5A 1DDLA 1RJ8A 3D82A 5CKNA 1FNYA 3MFAA 3WDYA 2Y60A 4M0NA 2YY1A 5GZEA 2WZ8A 3UNPA 1UOFA 2QBXA 4XF9A 4KG8A 5AC92 4FPHA 5JDBA 3W59A 1F15A 4XFBA 5B4XA 1AXKA 4ZZ8A 2PLV3 5IVEA 5IK8A 1GYKA 1RHI1 3ALQA 4HANA 5BNOA 2ZAAA 1CJDA 3S7EA 3N4MA 3Q8AA 5CFDA 4LNVA 1GZ9A 3OYWA 4FPLA 4AVTA 3KF5A 2WC2A 4GB32 4UFKA 1D7PM 1AL23 3S57A 2Q0AA 1FV2A 3VBOC 5ANQA 1HN1A 4FOQA 4AEDA 2WWJA 3I2GA 4LHLA 4HK8A 3M7AA 3BOWA 5FBZA 4QXCA 4FTSA 2Z4FA 4QX0A 2MNGA 1KJLA 4JTNA 5DZEA 5ACA3 5CFCA 4YZ4A 2D6OX 3M70A 4RSUA 2EICA 2VZVA 1OA2A 1CQ9A 3LSDA 4RGKA 5FUPA 2CTVA 3SH4A 2DFCA 1PO13 3RZZA 2YPJA 3GZUC 4ZU7A 3OG2A 1S0BA 4OVEA 4B1LA 2VL4A 2DTWA 2PAKA 3C2UA 4YW1A 5SV8A 3BI3A 5K0UB 5D8AB 1A34A 4OUMA 1QEXA 2WZR1 3MIEA 4XEZA 1W99A 3NMBA 5FUNA 5FZ7A 4HN0A 1PVC2 4FSJA 4FPYA 4WM7C 3MEPA 4NHMA 3AZZA 2GC2A 3DCQA 4ES8A 3HT2A 4JQTA 4XF3A 1S0GA 4TSVA 3OYWB 5FP3A 5FREA 1J3RA 1J84A 2B5HA 4YW6A 1Q8OA 4EQVA 3ZXEA 1KITA 3JXSA 2BVBA 3PMEA 3PJQA 2W1WA 3VDCA 1YQ6A 3DPRB 1LODA 1XBFA 5JWPA 2WIIB 4EWEA 4PI0A 1JI6A 5BNNC 1WD4A 2UYBA 3C8XA 3VBRC 5LK7B 1REFA 4NWVA 5FXVA 3VBSA 2WZPP 3SLIA 3ILNA 1WW7A 3T3YA 1VB4A 4XTPA 4Q1RA 4YZ1A 2PLV2 1RUC1 2VCCA 4CUGA 4DUWA 1PMIA 2BTVC 2CY6A 2VCAA 3ACHA 5HCHA 1NYWA 1LTEA 5HPOA 1F5JA 4M4RA 3NRUA 1YYNA 5D8AA 2YC2A 3RMYA 4E4DX 1O6UA 3H8XA 2FDGA 1F5FA 5KHIA 4NOTA 1AHSA 1C8M1 2ZCWA 2JDUA 4FPCA 1K42A 4GWJA 3GZAA 5KHJA 1NCRC 3WEZA 4CDUB 4F8AA 4AEDC 4Q4Y2 4XJUA 5I0DA 4FAHA 3ILRA 2XKOA 3WOGA 2D5HA 4XJWA 4NPMA 4DXTA 2VZUA 4XBLA 2PHXA 2GH8A 4Q0VA 1XXNA 2MEV2 4QKDA 2XWJB 1JN2P 4R52A 4G9SB 4AW7A 2LW8A 1H2KA 2X10A 2VVDA 5CBLA 3T2PA 1ND3B 4OMDA 2RJKA 2ZHMA 1LR5A 2GC1A 4Z8BA 4OULA 4BXSV 1Z7S3 4QD2A 4QPWA 1K5MC 5T52A 4EN8B 2NP0A 2KXLA 5GZGA 3BTYA 2QDNA 4XC9A 1LKNA 4GKYA 3P3NA 3VDDB 4BXFA 5CU1A 4XUTA 4CEYA 1UU6A 3ZXFA 3LA3A 5A3PA 1GZCA 1HB3A 4RR3B 1HRI2 2C4XA 5LK5A 5ABJA 3DXUA 5H9PA 4DIQA 3TN91 3VDBA 2UY8A 3ON7A 5A3TA 2RJLA 4AFMA 5GALA 3CKHA 3B01A 3MICA 5JCTA 4R4ZA 4R4XA
chains in the Genus database with same CATH topology
2PQQA 5BNOB 2RM23 1T6GC 4BOWA 4AFCA 2VVEA 1LHVA 1Q8SA 4AQ6A 5I91A 4QT6A 2XJSA 4N43B 2DUOA 1UAIA 3QCWA 2BBVA 4Q8KA 1MEC3 4C1WA 1DQ0A 1PVC3 4UBGA 2RS32 1PM7A 4OI2A 1W0OA 5CFCB 2MPFA 1EV11 3NJZA 4I01A 1VBE2 1C1FA 4XFGA 2YYOA 3ZYIB 2VMIA 3KQRA 3OJBA 4KL1A 1RITA 3KGZA 4W6YA 4AVBA 2WZR3 2YUEA 1QQP3 4CEWA 5F1RA 1S1AA 1CPNA 4DB5A 2HWB2 5JAXA 4AI8A 1R082 1W6NA 1SFNA 3ZXGA 5AFBA 3UL2A 2JG9B 1F9KA 3A0KA 1BQPA 1H2MA 1G86A 5IK7A 3OPZA 1AR82 4LBNA 4L97A 1YFUA 1JYCA 1RUG1 2IZWA 3KT7A 1LOCA 3OBRA 1KRIA 1VBB1 1BBT3 1YLLA 2JG9C 5IK4A 3AJZA 4YVSA 5GM0A 3PNAA 4GB33 1AL22 1S2KA 4WV8A 2UWBA 3SHRA 4ISRA 3ZIWA 5F6KA 4XFHA 4RHV3 2ZGSA 1ASJ3 2ZABA 4MVTA 5JMCA 4FBFA 4OFGA 3LGRA 3JB8A 5D8AC 3TRSB 1AR81 1OOPB 4B3NA 5C33A 1MS3A 3J9SA 4Y24A 2OW4A 4GULA 4HN1A 4PIXA 4JC1A 2IXCA 2HWB1 1N1TA 2CGNA 4Q26A 5FDBA 3ZYJB 5FO9B 2A3YA 3VZJA 1D0GA 1RUG3 4DPNA 4FQZA 4XETA 1Y9QA 3WUDA 1VBE3 4AHYA 4Q0SA 4X8PA 1PZ8A 3O0WA 4XTMA 4B7EA 2IXJA 3VN4A 3ZFEA 4Q27A 1DF0A 2VW0A 3J8F2 3VBOB 4LHKA 1R093 4QQPA 2DCKA 4XFIA 1RGSA 1VBE1 4YVSB 1TMF2 2GH2A 1BMV2 2Q30A 3LOIA 1UL9A 2NN8A 1Q8QA 4HZFA 1VAVA 1EV13 5KC6A 1QMJA 3VKOA 2HWD1 1XU2A 1EAH1 1JBCA 2FZ1A 2YMZA 4AVCA 4Y1YA 2ZGNA 2DUQA 2E9QA 2D44A 1UKRA 3MLJA 1O3QA 5DUWA 2XL9A 2HWC3 2K2SA 3WW1A 2WA4A 2A6VA 2BWCA 2Y0OA 2R0HA 2DVGA 4FOYA 4Q2FA 4X6RB 2D6NA 3WW2A 3WHUA 1ASJ2 4G4FA 4LO5B 3BODA 3VBOA 5CG8A 4XHXA 2E53A 4JGYB 1BCXA 1VRH2 1J1LA 4E9KA 4CDXB 1B35A 1O4YA 5IT6A 3ME2A 2MEV1 2N7GA 1MVQA 3AMNA 1YO8A 1RUD1 2AUYA 2QKDA 3POYA 4Y4YA 1KFUL 4QM9A 4HSJA 1FT9A 4AF9A 3NL1A 1OKQA 3RDIA 4K3UA 2ZZJA 1X8MA 5GKAC 1C8M2 3E5UA 3RPQA 2WQ4A 1UIJA 5BNNB 4C0HA 2DCTA 3GYDA 2UWCA 1COV2 1A78A 4COZA 3OCPA 4N90A 1ZBE1 4META 3GF6A 3ZN6B 4DRRA 2AYHA 1U5IA 1MZ5A 3IMNA 4H55A 1DHKB 3WG4A 5ACA1 4AI3A 2Z69A 2A75A 4FTBA 4AI0A 1GV9A 1PNGA 3DKWA 1J58A 4Q0QA 3H1YA 3I4IA 4FPEA 2ZA9A 3ZSMA 5BNPC 4BIOA 1G9FA 3KLSA 2VG9A 3WDXA 2WKKA 1CVNA 4XIOA 3IM0A 3O12A 1VP6A 4MGYE 1LU2A 1LB2A 3DGTA 4JQRA 2X8KA 4HPKA 4LO8A 2WZR2 3N7LA 1IKQA 3FUOA 4AE2A 2BNMA 2DV9A 4ASMB 3QACA 1GZWA 4J1XA 3R6SA 2B9UA 4XFFA 2Z2SB 1MR5A 4U36A 3IKWA 1J1TA 2PHFA 3PJYA 3GBFA 1CAXB 2HWC2 2XPJA 4YM3A 3WP6A 1F8VA 2XJUA 3LWCA 4A7KA 3U4XA 3V0AA 4OZXA 1DLLA 2JE9A 2QZ3A 1PK6C 2VNRA 4CDWC 4LUKA 3VZNA 4RS5C 4BLIA 3AKSA 1IZ3A 3PLQA 2NYYA 2ZX2A 3IT8A 1JUHA 3KGLA 4QPIA 3D0SA 4XBQA 4EWAA 5FO7B 4TWTA 1RHI2 4YNIA 4ATFA 4OHXA 3AFKA 3Q9OA 1C28A 4QX5A 1LEMA 1AR73 4IEYA 2QZ2A 2I07B 4AG4A 3VKNA 2A6ZA 4CP2A 5L36A 1O3RA 4M00A 2VU9A 1AJOA 1QKQA 3V56A 4C1XA 4EN0A 4R9BA 1HRV1 2PTMA 3VKFC 2BGCA 2W39A 3HWJA 2EIGA 1O4ZA 2WNEA 5T5LA 4JTOA 3UJQA 1IQAA 1CR7A 1ZZCA 3MI8A 3FMGA 1XQNA 2CAVA 4CP1A 3EBRA 4XHBA 2XL7A 1NXD1 2VMHA 1KS4A 1NZCA 1ND2B 5C6CA 3R05A 3WP4A 3AMPA 2BW8A 4YYOA 3WCSA 3AP6A 4XMAA 3SITA 4QQOA 1OI6A 1WMEA 2GN7A 2HJIA 3ZFGB 5J3UA 4I2OA 2PYTA 2HYKA 3OBTA 4FPOB 2DCYA 4IEOA 1DQ1A 5EYYA 1NG0A 2XJQA 2VNOA 1H8TC 4FVVA 3B94A 1KQRA 1OA4A 1QOOA 2AR6A 4S2FA 4EJRA 3ZN6A 2VOWA 3DF0A 1ONAA 4AVSA 4INDA 2H0BA 4IEWA 4LLOA 4K8FA 1YFXA 4LO7A 4Y26A 1LRHA 1COV1 5IUQA 2WQZC 2ET7A 1EPWA 5J96B 1W39A 1V6LA 4K1YA 2BUKA 4FP3A 5JIAA 3THPA 3WY6A 1SACA 3AMMA 5HBAA 5KHKA 2Q8OA 5JOXA 1PVXA 3CNAA 2RR11 3RQ0A 2GC0A 3ZFGC 2JXAA 1Z7S2 4IEVA 3H8UA 4LBQB 3S6PA 4DQAA 1XYNA 4COUA 2ILMA 3HMYA 2XHKA 1VRH1 3HT1A 2E63A 2NZ9A 3M1HA 4RS5A 5LEKA 5J36A 1LHWA 1RHI3 5AVAA 1MQTA 5JSOA 1SLBA 1VBD3 2KM2A 3UKVA 1GQGA 1RUNA 5DDJ3 2ZX0A 2DVFA 3VBUB 1G7YA 1HLCA 1L3JA 2JX9A 4FPFA 4NWWA 3ZN5A 5KBFA 3AKRA 4N9IA 2A71A 4AI2A 2FQPA 2P3JA 5I0UA 4EN9B 3POWA 1GBGA 2ZMNA 4RGAA 1PGSA 1MACA 1RUJ1 2WT0A 1EAH2 2HWD2 3R4DB 1OSGA 4QPIB 2Z5WA 2JICA 4H3WA 5AVPA 5FTTC 5FOJB 5CB7A 4Z1VA 3MW3A 1NA1C 3E5QA 4PDWB 1ZRCA 3D6EA 4FT8A 1BMV1 3NAPC 1XE8A 2TNFA 4Y20A 2IXLA 4FPKA 3O0VA 4RS5B 2TBVA 1DGRN 2VQ0A 1PK6B 4HFSA 3GALA 2EXIA 1H0BA 2OA2A 2PHUA 3HIFA 4CDQB 3WG3A 1AL0G 1FYUA 2EA7A 3DV8A 1PO21 3WR0A 1TQ5A 2XLGA 2GNTA 3KCXA 4K6BA 4H14A 2PA7A 5KXEA 5DDJ1 3I8TA 1RUI1 1UU5A 3BTAA 5GZFA 3CU7A 3G6JB 2IXIA 5FMOS 3U11A 1KFXL 1OLQA 1OQ1A 2Y26A 1RUI3 5DUUA 1BBT2 2FZ2A 1SFYA 2V73A 2PELA 1AR92 1VBD2 2VNGA 2BNOA 1ULDA 1VBC3 4CZSA 4PDWA 3U10A 3H3UA 2BQPA 5A33B 3NAPB 1PO12 2B45X 3CJIB 5T5OA 4Y20B 3NWKA 1DQ4A 4EN6B 3RMXA 4XW3A 3WVJA 1VBB2 1D4M1 4P9GA 1APNA 4OHVA 4YZ2A 4K21A 2XG3A 2DVAA 4Q4V2 4FPGA 1R1ZA 1RUG2 1DGRA 5H9RA 2D7FA 3AXEA 1FX5A 1UD1A 4MGKE 1JW6A 2EXJA 3FE5A 2ZX4A 1TME1 2R073 4LBQD 1SBEA 3AYAA 4P9YA 1PGW1 2D6PA 4ZXKA 4BMBA 4KWLA 1DGLA 3WW4A 3WZ1A 1F2NA 1X50A 5KXDA 4S2HA 2P37A 3MIGA 4JGZB 4HMZA 1RMU2 1UF2C 3DUIA 1H4GA 1EV12 5KC5A 2LTNA 1DQ6A 1SBFA 2ERFA 2RS31 1U5ZA 4Q29A 1RTVA 1UW8A 1VJ2A 5JR7B 3AMQA 3M3EA 4P9XA 1MZ6A 1CAVB 4N53A 4ES9A 3VBFB 3BALA 1Q8PA 3VBUA 2XBO1 1XNDA 3AKTA 4DY3A 5EFUA 4D7YA 2BWAA 2VW2A 4A7YA 1ZREA 1BVVA 1ZZBA 4HSLA 1WBLA 2OZJA 4Q4W3 2BFUL 3D4KA 4IV3B 5EYXA 3RJ2X 5AFEA 1RVF2 3OY8B 4AGRA 1XYPA 4ZKTB 3TN92 1XNKA 5JSPA 1F31A 3U07A 4KG0A 1EYBA 4JGZA 1AZDA 2JG8B 5FCCA 1GANA 1LECA 4BCUA 1QDOA 3K48A 2K9ZA 3W58A 1C8M3 4MUVA 3A4UA 1EPZA 5IK5A 1NCQC 5L73A 2R072 1QJU3 2ZHLA 1CAVA 1QXPA 2RS13 4Z2WA 3HD8B 1VBC2 2HWE2 3GBWA 2CWSA 3PMSA 4Q8LA 3I7DA 4CDQA 1COV3 3USSA 5DZFA 3AZYA 3ZMOA 4Q4Y1 4BA6A 4GMP1 5GLWA 2FMDA 3QBQA 3M3CA 4L9BA 3AP4A 1WMDA 4AEMA 5A3MA 4Y5Z0 4XYXA 4AGVA 3M8LA 2JJ6A 2SLIA 3ZXJA 1LOFA 1SMVA 1C4RA 2GSYA 2WL1A 4ZU5A 3D5OA 4DXZA 4YVWA 4YFZA 2YGLA 2ZX3A 3LA2A 4MXVA 4WVZA 4PJYA 3URFA 2A5ZA 2XVGA 3MFCA 3BCWA 1RB8G 1HRV3 1UPIA 1ULCA 1UKGA 2NMNA 1A8DA 1CD3G 3ZO0B 1H4HA 1POV0 1LGBA 1NXMA 2PHDA 4GH4A 1LOBA 3ZFFA 2O0OA 5KHGA 3N7JA 2QJVA 2VH9A 1PVC1 3RJRA 4XBNA 2GZWA 2VQAA 4QPGA 1NY71 5C4WB 4GQ7A 4XXPA 1ZYBA 1VBA3 3UV9A 3IPVA 3AYCA 1URXA 5HXVA 1N3PA 3WUCA 4WVVA 4P9LA 2X5IA 1KDKA 2TUNA 2WA3A 1H1MA 1AR63 1VAKA 1CONA 4COVA 1S0IA 2JG8C 1DGWA 4IERA 4DS0A 2QDRA 5ABJC 3E6CC 1AR61 4Y1VA 3TAYA 2VOKA 1G9AA 1GKBA 2PHWA 3VKMA 2WLQA 4DRVA 1VBA1 1IPJA 4XIKA 4AFBA 4MGIE 1N1YA 1QU0A 3CO2A 2WSVA 2B46X 2GNBA 4YZ3A 2G9FA 3D8CA 1G9CA 1WGPA 1W6QB 3MIHA 1Q3EA 1MS1A 3JD72 5FQ0B 2BEOA 1QXRA 3V0BB 2HEYF 2QVSB 2DWRA 2X5IB 1ZZ8A 3T1MA 4PLNA 1OPMA 4KWKA 3O7OA 1PIV1 4ONUA 4XQDA 2QQPA 3QOPA 3OTFA 1N3OA 3NVCA 4S2DA 4BHPA 1EP0A 4X8NA 4MZUA 5C8CA 5FLHA 1U12A 2OUJA 1AXZA 5I8YA 2PFWA 3RI9A 3H7JA 1QNWA 2D3SA 1OD5A 1WCKA 1XYOA 1SLTA 1V6MA 1DQ5A 4KNCA 4YGEA 1VBA2 4GALA 1LULA 2R071 2OZ6A 4BE3A 4CDXC 3DL3A 1AR62 4Z82A 4R8HA 1DYPA 1YHFA 5BPXA 5T55A 1ZRDA 5E8AA 1JHNA 5FQ0A 1FPN1 4AEDB 4RFT0 3WQ0A 1BXHA 5J09A 1G8WA 3V64A 2HWB3 1ENQA 1WLCA 1RVF1 3WDUA 3CEWA 1NY72 4YGDA 1O3SA 1YI7A 3RWNA 3ELNA 3ES4A 3SXWA 2ZJCA 2D6MA 4P9IA 3RYRA 3VBHC 4GH4B 4I0WB 3SH5A 4GA9A 4HKLA 4PIZA 2PHLA 2WJSA 4YARA 1MS4A 4WBBA 1REEA 1POV3 2X5IC 2VY0A 2ET1A 2ZGOA 4M01A 4WM8A 4WVMB 1CAUB 4QPGB 2DCJA 3WXPA 4OHZA 1FOD1 1PGL1 1VR3A 2VGDA 2CGOA 4GXLA 2SBAA 4XJ9A 4YM0A 2ZS6B 1ZBA1 5K0UC 4PDWC 4FCAA 3IDBB 4JDOA 4DZGA 1PGW2 1YFYA 1SEFA 2WT2A 5DUVA 3JD73 4QPIC 3QD6A 4N7IA 1ALYA 2B8MA 1LGCA 2IWGB 2IC1A 5J98B 1JH5A 2WNUA 1SLLA 1CAWA 2I45A 1QJY1 5I8SA 5BNPA 1HV1A 2ZGQA 1VALA 5H9QA 2ZHKA 4NR1A 4ZU4A 1W2UA 3PVEA 4UXAA 1VBC1 3KSCA 2B39A 4L11A 2LALA 3SCHA 5E88A 2ZGKA 1D4M2 2XB6C 5CFDB 1LOFC 4GWMA 4XF1A 2P3KA 4WM8B 3RS6A 4ITCA 2R062 1RUF3 2YXSA 4XFAA 1Z78A 1UZZA 4BMEA 3ZSLA 4LO4B 1QOTA 1VBD1 2ZKLA 4E27A 1GNZA 1G9BA 2A6WA 1GQHA 2HKXA 2ZGTA 4B4QA 1PO23 3DN7A 5GLVA 4QHBA 3WW3A 1U5YA 5EZWA 4B4PA 1FXZA 2ZMKA 1RUI2 2ZKNA 1RUH1 2IXHA 1OPOA 5C8CB 4RR3A 1BJQA 3MIDA 2MEV3 3RYPA 2OUHA 3H1MA 2YGMA 1ULGA 2XBO2 3APBA 1VRH3 1ENXA 2ZACA 1ULFA 1WA4A 5AC91 1AR72 4XXAA 1AX2A 3IWZA 1SLAA 4JAAA 3LOBA 3B93A 2JEMA 4YW2A 5A32B 3GZTB 4MXWA 1NE4A 1RUC3 3JQXA 2BNNA 4RGGA 2OVUA 1UN1A 1NQDA 1RMU1 2CL2A 1HQLA 3PTYA 5EXOA 2VOVA 1H8TB 3DPRA 2E51A 3B7MA 1AXYA 3VV1A 3VZOA 1N47A 3SH3A 3VLBB 3VBHA 1NCRA 4O9EA 1NOVA 1LCLA 4I30A 5FLJA 2A73B 3H0OA 3KMHA 2D40A 1TME2 2GALA 1OLRA 1VLNA 4AWDA 1LOAA 2R063 4CEWB 1RMU3 1RUH3 1B35C 4FAGA 2BFUS 2RS33 4IEXA 5JI9A 3RG0A 1W6NB 2F4PA 5DXDA 1H1IA 2Q1MA 5F6LB 4Q4X1 1REDA 4MYEA 3MPBA 3E5XA 3ZDSA 3X29B 4KU7A 3T1LA 1CAUA 5FPXA 1WLWA 1PO11 1LOEA 1ENSA 2CGPA 2XJPA 3EJKA 3ZFEC 3HN1A 1AR91 5E16A 3H50A 4NHLA 5K7PA 2H6BA 1X82A 1WLDA 2E7AA 4COWA 1R1A1 5K9YA 1NCRB 4CDUC 3FFQA 3J4UH 5GLZA 5EWSA 4I02A 2EXHA 3VBFC 4IEUA 5C8CC 2TEPA 2ZHNA 2IFWA 4LA2A 4MV2A 4RHV1 4TYSA 3CLPA 1FATA 2WNUB 1PO22 1O5UA 4HVOA 1JYIA 4RQPC 4QQ2A 1KD7A 2I2SA 3E97A 4W65A 1UX6A 2XGXA 1QJU2 1O91A 1BYHA 3O5SA 1DZRA 2HEWF 2JD4A 4XJZA 4YSFA 3ZYRA 1TME3 3T2TA 3EQEA 1HXS3 2KA3A 2CYFA 2DF7A 4QGLA 5JIUA 3FLTA 5GLTA 3N7MA 1RUJ2 3BIWE 3WDWA 2P17A 1RC6A 3IDCB 3B5LB 2RS11 4YRDA 1HXS1 1TNRA 1O7FA 1OFNA 3R4SA 3AX4A 4Q0PA 2MHFA 4OHYA 1FNZA 2GNDA 2JKBA 4LA3A 1AJKA 1TE1B 4LBMA 1UZYA 3MIBA 1RUE3 1HRV2 3KM5A 1MS9A 2A7AA 1WD3A 1BEV3 4I3GA 5T3NA 2Z42A 3FFZA 4TLFA 1WMFA 1MEC1 3M3OA 3MF9A 3S30A 4CRQA 4QPGC 2EAKA 2RE9A 3ASIA 4K1ZA 1YXWA 1M06G 1GFF2 1FV3A 2RM21 1DU3D 4NO4A 3WLUA 4GMP0 3VHRA 1Z7S1 4L92A 4Q4W1 2RR12 4YZ5A 4XOGA 4W6XA 1JTZX 1LENA 2H0VA 4PBOA 3VBHB 5KWRA 3WINE 2RMU1 4JRLA 1I6XA 3VL8A 4CDQC 3TWIA 3UJOA 2R1DA 4CEYB 1U5XA 5JVVA 4YGCA 5TSWA 1QJY3 3JBG3 2RHPA 2WNUC 1RUD3 1YRZA 5K0UA 4P14A 1Y43B 2XKPA 4E2GA 1H8VA 2R49A 3I54A 3B02A 1I9RA 4WZFA 1DZTA 4JGYC 2XBO3 4ASLA 1YIFA 5K8SA 5CG9A 4Q4V3 4N43A 1JXNA 2DU1A 1HX6A 1BEV1 1QHDA 1RUJ3 3WV6A 4RD7A 4URTA 3NKGA 3ZFEB 2UWAA 2VVFA 2WS91 1NLRA 1RUE1 5LRSA 2Y0IA 4XDQA 1AUYA 4BYYA 2OYZA 3M3IA 2ZZQA 1H9WA 1RUE2 1IS3A 4Q4Y3 5C9AA 1QGLA 5LEJA 3VBUC 2GAUA 1BEV2 2W52A 5BV6A 3MW4A 2D5FA 4FQ4A 4KBBA 3WDVA 2PHRA 3HR9A 3LB9A 1K5MA 1U0AA 3POSA 5J48A 4K7JA 1ZBE2 2BVVA 2UURA 4CDUA 4IV1B 4BM8A 1WCDJ 5JLVA 3ZN4A 4A3XA 1GZWB 1IS6A 4LTAA 1S0JA 1UIKA 1IOAA 1EAH3 3JUUA 2UY9A 3LSEA 4LR4A 2NLRA 1OQDA 1CAXA 1H1AA 4JVAA 3MW2A 4AQTA 1LHNA 3ZXKA 1RUD2 4I0BA 4E2QA 4Q4W2 1YWKA 1YCIA 1O5LA 4C90A 1B09A 2RM22 5C9AB 2RS53 3SNMA 3VDDA 1S0FA 1NE6A 3TN93 4DFSA 1OOPC 3MIFA 4QQHA 4RL7A 1MS8A 5ABJB 1OOPA 4LBLA 1LU1A 1MEC2 1TEIA 3AP5A 4I09A 4P9WA 2HWC1 1M4WA 3WQ7A 3LAGA 1ASJ1 2O8QA 2D43A 2W0XA 3IIAA 2A3WA 1MVEA 3VBRA 1RINA 5JOYA 4O9GA 5BNNA 3PVBB 1QWRA 3INAA 4I0AA 5DUXA 4A7ZA 5JSRA 4AFAA 1DYKA 3JU9A 4DINB 1V00A 1W0PA 2VXRA 3NSTA 2RS12 5BNQA 3MGUA 1AX0A 1LEDA 3FBMA 4YLZA 1ND2C 4SBVA 4CDWA 2WSUA 1N3QA 1WBFA 4UW5A 4Y1UA 4FTEA 2QE3A 3QLQA 4PLOA 4WM7A 1S55A 1IS4A 3ILFA 4FOWA 1AYN1 3W9AA 2R043 3FZ3A 2GMMA 1Q56A 1QDCA 5LRRA 1NQJA 1POV1 3U0ZA 1VBB3 3KT4A 1TMF1 1IHMA 1CJPA 4D3WA 1HQWA 1S0CA 1FMD3 2Q5TA 3WDTA 2A3XA 1C8NA 4L99A 1BKZA 2VOXA 5BUVA 1A8MA 3B9IA 2A70A 1LESA 2VUAA 5ACA2 3RNSA 4KGGA 3V65A 2LM3A 4BH9A 3J26N 5GJ6A 5CFCC 2JG9A 1ENRA 4WVWA 4RHV2 4MH0E 3ENRA 1I3HA 3WG1A 2BPA2 4B29A 5JOWA 3S0MA 5A3LA 1KJRA 3B9CA 4M3CE 3UKNA 1CPMA 3KS7A 4CDWB 1MZEA 1R1A2 4L8QA 1ZBE3 4JGYA 2K0GA 1RUF2 3ATGA 4M3CF 3TYJA 3AB0A 4PLMA 3WT3A 3FLPA 1B35B 4NHKA 3L2HA 3THTA 4PIYA 3VZMA 4RR3C 4D69A 3MF6A 4AHZA 3FX3A 1LGNA 1FPN3 3MDPA 4QGMA 4Q4X2 1XNCA 5EV7A 5JDBA 1KXGA 2E6VA 1QH7A 3FWEA 1K5MB 4YVWC 2YZ4A 4XQWA 2NM1A 4IEZA 1ZBA3 3AXDA 4Y22A 1PHMA 2AH2A 1ND3C 1QH6A 1OA3A 2XJRA 3PVNA 4IV1A 3ZMNA 2R042 1N1SA 1X36A 2ZGUA 2D97A 3KD4A 4AFDA 3AP9A 1N1VA 1XU1A 1SDWA 1C3HA 4XMIA 4F7ZA 4Q1PA 2ZOEB 5JI7A 3BU7A 3OGGA 2CV6A 4HETA 2A6YA 2CNAA 4YG6A 1RL3A 1ZX5A 4HBNA 4AEKA 1MQTC 1C5HA 1GNHA 4I3PA 5T5PA 3ZXAC 1AYN3 2D3RA 3VZKA 4KQ7A 2VMGA 1DFQA 3CL1A 4PBPA 3KCYA 1V70A 1DQ2A 4JGZC 5AC92 3J8F1 4HT1T 5EJ3A 4HPKB 4YW4A 3VBRB 3VHNA 1YFWA 1R1A3 4Y22B 1QOSA 3WD5A 4Y1XA 3H1WA 3NV2A 1W6OB 4YG0A 2V5YA 4AVAA 1RIRA 4CP0A 4IETA 3WP5A 1RUH2 3H3ZA 1IPKA 1HRI3 2P34A 4WM8C 4C0BA 4MLOA 1IS5A 1J3QA 2R041 3EO6A 3I59A 5F5QA 1YJKA 3VZLA 4WM7B 1WW5A 2GMPA 3EXUA 3KCCA 1I5ZA 1H2LA 4UBHA 4CDXA 1D4VB 4Z07A 1WLTA 3QH7A 2DUPA 4HKWA 4YG3A 2DYCA 3ES1A 2R061 3FHIB 4QM8A 1GICA 3ZYGA 1YJLA 4D94A 1AL21 4N53C 3NV3A 4LUMA 4Z92B 3CF6E 4LBQA 2W08A 4S2GA 4EV0A 3ZXLA 5A33A 4AQ2A 3KT1A 2EVXA 2HEVF 2R30A 4HVQA 3ETQA 1Q5OA 1W6OA 1RUF1 2XUMA 4UW6A 3GBGA 4BIFA 5T54A 1HDKA 1SCRA 1R081 3QH6A 2WLPA 2PAEA 2R32A 4XFCA 4L2NA 1HV0A 1ZBA2 5CADA 3I59B 5JPMB 1AYM3 1X8EA 3ZX7A 4FOVA 3AMHA 1OMIA 3HAGA 5L19A 4XJ8A 2DURA 4FP2A 4E4ZA 1LJ7A 3PVOA 5GLUA 1PZ7A 1OQEA 5KXBA 2W68A 1JOJA 2VUJA 5KHHA 5FO8B 4OHWA 3IDEA 3ZYPA 1BVP1 2QUOA 2ZGLA 3FLRA 4GKXA 4M0HA 3ST7A 1FOD3 4XF4A 2FBEA 4YVSC 2GU9A 3JCIA 3NV4A 4E4SA 2B42B 2ZGMA 4EWDA 1I1EA 1AYN2 2VPVA 2XLFA 3N35A 4LBJA 5DG2A 1ZRRA 2AZ5A 4G3YC 5F9TA 3MLLA 1PK6A 5T50A 1CN1A 1QNYA 4OI1A 5J37A 3N3HA 2ATFA 4X6QB 3HBZA 2G9GA 1HRI1 5I93A 1X33A 3V0AB 1XE7A 1EY2A 2BYVE 4XZPA 4FXGB 2DTYA 4YM1A 1UU4A 2DU0A 2Y38A 1MZFA 1V6OA 3ZVXA 2X29A 4E2SA 1WUVA 3J8F3 4PF5A 5JZGC 3I2DA 2ZGRA 5SV5A 1S2BA 4OI0A 2CAUA 3R4UA 5FOBB 4GB31 4DMIA 2GNMA 1HQNA 3NAPA 3O14A 1HKDA 1BZWA 5GZCA 3CJIA 2XWBB 4OLLA 5C8WA 1KDMA 3C3VA 5L7OC 3RYKA 3G7DA 4H7LA 1ZM1A 1RVF3 2UYAA 4HVRA 1Y3TA 4GWNA 1MQTB 3UK9A 3B3QE 1XRUA 3USUB 4Y1ZA 3AZWA 2ARBA 2X53S 4N9HA 3TNPB 2ZTNA 2WFPA 3A0NA 2NQYA 3ZSKA 3ZFFC 2O1QA 2YROA 4HL0A 1D0HA 5FPZA 2E7QA 1RUC2 2PLV1 3JD71 4M3CB