2JEMA

Native family 12 xyloglucanase from bacillus licheniformis
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
232
structure length
232
Chain Sequence
b'ASSSNPSDKLYFKNKKYYIFNNVWGADQVSGWWQTIYHNSDSDMGWVWNWPSNTSTVKAYPSIVSGWHWTEGYTAGSGFPTRLSDQKNINTKVSYSISANGTYNAAYDIWLHNTNKASWDSAPTDQIMIWLNNTNAGPAGSYVETVSIGGHSWKVYKGYIDAGGGKGWNVFSFIRTANTQSANLNIRDFTNYLADSKQWLSKTKYVSSVEFGTEVFGGTGQINISNWDVTVR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDO-BETA-1,4-GLUCANASE
publication title Characterization and Three-Dimensional Structures of Two Distinct Bacterial Xyloglucanases from Families Gh5 and Gh12.
pubmed doi rcsb
source organism Bacillus licheniformis
molecule tags Hydrolase
total genus 71
structure length 232
sequence length 232
chains with identical sequence B
ec nomenclature ec 3.2.1.151: Xyloglucan-specific endo-beta-1,4-glucanase.
pdb deposition date 2007-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01670 Glyco_hydro_12 Glycosyl hydrolase family 12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2jemA00
2Z79A 1M4WA 3WP4A 3WP5A 2DCZA 3AMMA 1REEA 4XQWA 3VL8A 1OLQA 3AKRA 2C1FA 1XYPA 1W2UA 5EJ3A 4S2DA 3VL9A 1BK1A 1H1AA 1XXNA 3MF6A 4IXLA 1C5IA 1KS5A 4HKLA 3VZLA 3AMPA 4H7MA 1H4GA 3VGIA 2DCYA 1OA4A 1QH7A 4HKOA 2DCJA 3VZMA 3B7MA 1H0BA 3EXUA 2VG9A 3AMNA 3VLBB 3WP3A 2F6BA 3AKSA 2JENA 3VHPA 3LGRA 3RI9A 1REFA 1ENXA 1OLRA 1H4HA 3VZKA 2B42B 2VULA 4NPRA 1XYOA 3VZNA 3WQ1A 3B5LB 2JEMA 2JICA 3MF9A 2B45X 3VHNA 2BVVA 5K7PA 2B46X 1XNKA 4XQ4A 1XNDA 1TE1B 1H8VA 3RI8A 1F5JA 1HIXA 1T6GC 4XQDA 4XPVA 3WT3A 2DFCA 3HD8B 2BWCA 1AXKA 1XNCA 4S2FA 5HXVA 2QZ2A 1YNAA 2D97A 3VZJA 1XNBA 4HK9A 2BWAA 3WXPA 1HV0A 1HV1A 3AKPA 1UU5A 4S2GA 3WY6A 3WQ7A 3WX5A 1XYNA 1UKRA 1NLRA 2DCKA 1C5HA 1REDA 3LB9A 3AMQA 4HKWA 2VGDA 1OA3A 2DFBA 5K9YA 1BVVA 3MFCA 3O7OA 3AMHA 3M4FA 1QH6A 3VZOA 3WQ0A 1IGOA 2QZ3A 4S2HA 2NQYA 3ZSEA 3AKQA 1OA2A 1UU6A 2NLRA 3WP6A 1BCXA 3MFAA 3VHOA 1KS4A 2BW8A 2D98A 2VUJA 3AKTA 4HK8A 1PVXA 1UU4A 3WR0A
chains in the Genus database with same CATH superfamily
3BTZA 2VD7A 2JDNA 4FXKB 1LOEA 4O9GA 1JZ8A 2J22A 5KHJA 3ZFGC 1SQ4A 3JB4C 5DUUA 2ZAHA 1O5UA 1X8EA 1WLTA 5FP7A 1N3OA 2LW8A 5FXVA 2HWF3 1RUJ3 4JKKA 1G6NA 1MS8A 2A3YA 2IZWA 2WQ4A 5A6QA 4DMIA 2I45A 3IZOA 1Q3EA 1TMF3 2UWBA 2W0XA 4P08A 4A41A 1LHOA 1PMHX 2LRPA 4ASMB 1HRI3 4PF1A 2Y8KA 1HJGA 2YC4A 3B7MA 4DRRA 1CX4A 1CX1A 5F5CA 2VG9A 3PHMA 1VR3A 5DAPA 5LB6A 5JZGA 3WG1A 5C8CA 1CD3G 3DPRB 1BJQA 2HLEA 3UL2A 4XE9A 3ZPYA 5A1LA 1VBE3 1CZTA 3M3QA 3RI9A 3RYKA 1HB2A 5GLTA 1G9BA 4IE6A 1EV12 5FMOL 3WQ1A 2NMNA 1DZQA 5FYCA 2JEMA 5CB7A 1LGCA 4ARYA 1ZVFA 1JOJA 1GKBA 1SLTA 3MF9A 5H9QA 4EWAA 5KXBA 2IVIB 2D93A 2B46X 4NE9A 1XNKA 2XJRA 3SNMA 1PO23 2A3WA 3LZZA 3K3NA 2KM2A 3NJYA 2YGMA 4H55A 4KL1A 5CFCB 1LHWA 3RI8A 1OURA 1IG0A 4RS5C 3WNLA 2BBAA 1A6CA 3S0MA 2DVDA 4XQDA 1S0JA 3R4DB 2Y33A 1CN1A 1VBB3 2YY1A 4XPVA 4E4ZA 1IQDC 4IV3A 4OHYA 3D6EA 5FLJA 5JXJA 1DCSA 4XHXA 2HWD1 3TNQA 1GOFA 1FOD1 4Q29A 1JUIA 3HT2A 3I7DA 3FLTA 4XF3A 4EQVA 4Q0VA 5K8SA 5F2SA 1GOGA 1QJU1 2RJKA 2OQ6A 3B9IA 3C7HA 1UAIA 1W8TA 4PQ9A 1UXZA 5BNOA 4DXRA 2D7FA 4XF1A 2UYBA 3AL5A 3K77A 3ILRA 3APBA 4XACA 1UY0A 4CDXC 2VZUA 4XCAA 1NUKA 2JG9A 2IXLA 3C7OA 4AFMA 5FLHA 3TRSB 3OBAA 4BH9A 2G1MA 1X8MA 2WQZC 2HWD2 2RV9A 3AXEA 3FBYA 3OBTA 1APNA 4JV4A 5DAWA 3EMRA 1DYPA 2X29A 1K5MB 4O9EA 4YZ3A 1FOD2 4ES8A 3SCFA 2Y6FA 3N7MA 4XUQA 2WZEA 1EY2A 4WVZA 5GZEA 2PAKA 1QJU2 2WINB 4FPOB 1NCRA 3AZYA 2FZ2A 5DN2A 3LIHA 2QZ3A 3CJIC 4B4QA 1VMFA 4IEWA 1S0GA 4I09A 3SMHA 2P37A 3IKWA 4URTA 2XQXA 5DAVA 3W5MA 2WNVA 3O1MA 1QWRA 1OH4A 2Y60A 5LZ6A 5L7OA 5A7WA 1COV2 2YDEA 1UMIA 2VNGA 1MR5A 1VAVA 2XLGA 3AKTA 4CEWC 2C26A 2O1QA 3VBFA 4Q1PA 4OHWA 3F2ZA 1OOPA 4Y1VA 4QKDA 3LEMA 4Y5TA 2CL2A 3CLPA 2ARXA 2AZ5A 3JD73 2VTXJ 3JBG1 4XQWA 4XZUG 3JUUA 5FUNA 1OF3A 3IM0A 1SACA 4N9HA 1CIWA 3RZZA 1QQP1 4TSVA 2ZGPA 1UYZA 3KF3A 4FPGA 2WQ8A 4QX0A 2ARBA 5A7SA 4PLOA 4IXLA 2XOMA 4DUVA 4FPJA 2Z2SB 4P9LA 5F3EA 3QLQA 3I3BA 1NX9A 4MX3A 4LBKA 1QH7A 1QJZA 4NVPA 2AH2A 3J7HA 2ES3A 3PJYA 1QY4A 4LIUA 4BQYA 4N53A 1QXJA 4IE7A 3O1TA 1GSLA 3LDBA 5ISLA 3BPZA 4IW3A 1WUVA 2G19A 3K46A 4FFGA 1PO12 3KD4A 2Y6KA 1MS9A 1H4HA 5L9BA 1UY4A 5J37A 2VULA 1OVSA 4NPRA 3WNPA 3IDEA 1N3QA 4A7YA 4JQRA 4A2UA 3ZDSA 4LBNA 4YZ5A 4DXTA 3VD4A 4CCLA 3B69A 4IEXA 4Y5Z0 2NZ9A 2YPDA 2ZJCA 1ZA4A 2RDSA 5HV0A 1W06A 1VBA3 3KQ4B 2ZACA 4URAA 1CAVB 4DY3A 4OUSA 2Q1FA 4NIDA 3RZGA 2VAUA 1IOAA 4QDRA 2YPJA 1W8ZA 2GC0A 1AR81 3I3DA 4KWKA 3VD9A 3AVSA 3USUA 2QFEA 4DIQA 4YGBA 3EBRA 4XC9A 3TBDA 4AVSA 5C3RA 1D2QA 4FQ4A 1FNYA 1L3JA 2VZVA 4KI5M 3RJ2X 5D8AB 1RUD3 3KVBA 3VBRB 4ASLA 5IW0A 4YARA 2NP0A 2DU0A 1ZREA 4IEPA 1W6PB 2RHPA 2RDRA 3M8LA 2FDFA 4WM7C 4RHV2 2W94A 2Y0OA 4CDWC 3ACFA 4Y5SA 3ZN5A 3WF2A 3ZFGB 1H1MA 2JDHA 5T5OA 3WX5A 4LKEA 1URXA 1AR82 1H1IA 1L7LA 3AXDA 3L9JT 1OH3A 2WLQA 5FRAA 3IIAA 4Q5OA 4GH4C 3AP9A 2K0GA 3M70A 2HWF1 2IXKA 3N9LA 4TLGA 3WEZA 3POJA 3E1F1 4IUGA 2R073 2VOVA 4ONUA 1TNRA 2EVXA 1VBC3 4LHKA 5FZIA 3TB0A 4AQ6A 4AE2A 2Q8DA 5LRSA 2VMGA 3MIBA 1XJAA 4D6QA 2RS11 1W6MB 4XFIA 2ZGQA 1X82A 4FP3A 4PDWC 4W6XA 1ZZ6A 1Y7BA 3U14A 5A6XA 4WM8C 2GU9A 5DMYA 2JG8C 2A73B 1UYPA 4JRLA 1MACA 1VBE1 5GALA 4RA0A 2HWF2 1RUJ2 1SLIA 1PVXA 5FZ6A 5GLVA 4AI1A 3RWNA 4CXXA 1HXS1 1TMF2 2DCZA 2O8OA 4P9GA 5EP9A 5ERLA 1L7QA 5FPXA 1SCRA 5EFUA 5T50A 1E5HA 4XETA 2RS12 4BOWA 1XE8A 3WF1A 5C9AC 4RS5B 5LBBA 3MF6A 1YYNA 4LIVA 4PI0A 2ZX3A 1C5IA 1WMDA 4OUEA 4P5HA 4AFBA 4FOYA 4Q4Y3 4BJ0A 5FZ9A 4CU9A 5FYIA 3B94A 4KNCA 4OI1A 3UNPA 3DYOA 4GWJA 4AEMA 1STMA 1VBE2 2OVUA 3SEEA 1HW5A 1KQRA 1YLLA 3ALQA 3N9OA 1UYYA 1E57A 3U78A 4NIGA 1W03A 3TEXA 4CXYA 1V70A 2JDUA 3MW3A 5F1RA 2ZBJA 3OY8B 5KC6A 1PM4A 2WNUA 4CU8A 5A7QA 1QJX1 4WVMA 5J98B 5FMBA 3TAYA 3KCXA 2OUJA 4LUKA 3RZLA 2FD8A 5ACA3 2ZX2A 2D43A 1PGL1 2DUQA 1PO22 2WN2A 3BODA 4GMP1 1UPSA 1ENXA 4MGZE 4YLZA 1NQJA 1UZ0A 2CHHA 3PDQA 1W0PA 1W6NA 2JE7A 4CDXB 5HPOA 1XYOA 3U4SA 2Z69A 4RD7A 5FK8A 1H6XA 4CDQA 2AUYA 1VPHA 5FPLA 1VBB2 2X5IC 2BVVA 2W47A 4HSLA 4HPKA 2Q8EA 2W91A 3H7JA 5DDJ1 4E4DX 4AI9A 2XQRA 4JDOA 4ASKA 5FY5A 4HETA 2WT1A 4Y3OA 4XFBA 1AYM1 1B35C 2EIEA 4M3CE 4EN8B 1E5RA 5E6HA 2ZS6B 3IPVA 2W2IA 3AZZA 5D21A 1UOGA 5BNNC 1JYCA 3FLPA 3CJIB 1VBD3 3ROUA 4WBBA 2AEZA 3VBUA 4BIOA 1PGL2 5FQ0B 4OI0A 4E8CA 1R091 2JX9A 4Q4X1 2VQAA 1W2AX 1X9TA 3VD7A 2HYXA 1VB2A 4AFCA 3VZJA 4CEWB 1DHKB 1XC6A 2XDVA 2IXIA 3E6CC 5FYZA 3WW2A 5I8TA 3CNAA 5DDJ2 3WXPA 1JBCA 1L7RA 1OT5A 3AKPA 2R16A 3PUQA 1AYM2 4LBQB 1RMU3 4BU2A 2WBKA 1AXYA 1UF2C 5D2AA 1SDDB 2GAUA 1UO9A 2ZGNA 1YRZA 4IGOA 3HBKA 2BNOA 3JD71 4F7ZA 2WJSA 4YWAA 5I0TA 5FZMA 4BISA 1UIKA 4AF9A 3N9MA 2ERFA 4YW1A 1VP6A 2Y6JA 3PUHA 1CAUA 2Y6LA 1SLCA 1NY71 4XMIA 5KHKA 4Q4X2 3CMGA 1AR73 1BVVA 3IT8A 3MFCA 1W8WA 2VXRA 5LA1A 4CUGA 4IV1A 1J83A 1ZX5A 2XR4A 4AEDA 2ZGOA 3CQOA 5KHIA 2XH6A 4NHKA 5LBFA 3U07A 3V65A 1AXZA 3JD72 4MXWB 2YMZA 5F37A 1Y9MA 2ZMNA 1BYHA 2WZR3 4LLFA 3D82A 4X8NA 1C8NA 1GWLA 1NY72 1ENSA 1GWKA 3RFRA 2YROA 1RUF3 2GSYA 1RUG1 2A71A 3KHBA 3PUIA 4PIZA 4P9XA 2GP3A 3IAQA 2RDNA 1IPSA 3CIHA 4S2DA 2R6QA 2D40A 1DQ0A 2E9QA 1FI2A 4AHWA 1DQ6A 3KHCA 5GLZA 1PMIA 3GZUC 4GXLA 4AG4A 4QM9A 3MPBA 1UZZA 2VZSA 3IMNA 3T0BA 4M3CB 3MIHA 4AGGA 1J3PA 2CWMA 2DCJA 3IAPA 2GNBA 4BQWA 2LROA 1V0AA 3PUAA 1D0HA 4G9SB 3UKNA 2R32A 2WN3A 5FY4A 2A70A 4QKFA 4YFWA 4MUVA 1RUG2 5FBJA 4BWOA 3OPWA 1NKGA 2QBXA 3RJRA 2XB6C 2HWB3 3ES1A 3VKMA 4UT5A 1ZRFA 2FDKA 5JAXA 4OULA 2JJ6A 4Y1YA 3QCWA 1VBA2 3O1SA 1SPPB 3NO8A 5FXZA 2W39A 2JKXA 3B5LB 1CAXB 1US2A 2V72A 1N1VA 1KGYA 2BGPA 4GH4B 4QXCA 2OPKA 4YW2A 3NNGA 4Q4V3 3ZYPA 3K75B 1G9DA 3BCWA 3H8XA 1K42A 3I2GA 4YVSA 3S7EA 4L2NA 4KQ7A 4AGVA 2FDJA 1H8TA 2C6SA 3T2TA 1OQ1A 4D7YA 2AC1A 2H0VA 4IGQA 5FIXA 4XF9A 1YIPA 3O12A 4CE8A 4E2QA 4PDWB 4QT6A 5A3LA 4BMEA 1GFF2 4CPBD 3WHTA 5HV4A 1EAH1 2R1BA 1VMJA 2BNMA 3FUOA 4WM8B 5FXWA 4NIHA 4QX8A 3RZMA 2VCCA 1UOFA 2A75A 3ENRA 5CFDB 3ILFA 1DQ5A 2DVFA 1AL0G 2BWAA 2IFRA 2CDPA 1PNFA 2GC2A 5L9RA 1AL23 1DLLA 4Q8KA 4C91A 4YM0A 3OTFA 3T08A 1DF0A 5L73A 1VBC2 5JOWA 1RUC3 2FZ1A 3NV2A 3K2OA 5JMCA 1OQEA 3U0ZA 5C9AB 2DV9A 1JMUB 3IB3A 4FCAA 4HVOA 1QJEA 4LPLA 4XUOA 2J1UA 4XW3A 4C8DA 5GZCA 1W9YA 4HKWA 1WCUA 3AYEA 1NCQA 2R041 5IUQA 4JKMA 3AMHA 3LIGA 4JTNA 5FYUA 1QH6A 3WQ0A 2XL7A 3ACLA 4LA2A 1ND3B 5A3WA 4BHPA 4KWJA 5K0UA 3ZX7A 3BIWE 4BXFA 3J8F1 4L97A 2K46A 1H2KA 1Z78A 3A0NA 4HG6B 2ZKNA 4HZFA 4RYDA 3AKQA 3DCQA 3S7IA 5LK7B 1GZCA 4JGZA 5C5TA 1OFNA 2ZEZA 5FP9A 1D0GA 3H3LA 4KWUA 1KS4A 1LR5A 3BN6A 4Q4W3 2GC3A 1W0NA 3ZYJB 2QJVA 3MO4A 1GQHA 2VQUA 1N3PA 1AF9A 1YUDA 1W6QB 2R063 1UU4A 2XL9A 4MADA 4PLMA 1J3RA 1GICA 2X5IB 1Q5OA 3OD0A 1MEC3 4Q4Y2 1W6OA 1F31A 1POV3 2JIJA 2VW1A 3KGLA 4AI2A 1S55A 4PJYA 1EUUA 1DZRA 1HRV3 4Y26A 2I74A 4QPIA 5DG2A 5FO7B 4CDUC 4NRQA 4IEOA 1B35B 2VUCA 5JZGC 5C8CC 3SCGA 4M0NA 4Y4RA 2W87A 2QQVA 2HWC3 1FXZA 2J42A 4P9WA 2YB7A 4XBLA 5BNNB 3S5AA 5DUWA 3ZFFA 4N7UA 5JXHA 3THTA 3E5UA 4I0AA 3LQCA 5T3NA 2BUKA 3WLUA 2AYHA 3AB0A 3AM2A 1QGLA 3N9QA 5I0SA 4CP9B 3H3ZA 1PIV3 3D8CA 1QJY1 1RUH3 2ZEXA 3HIFA 2ZZJA 3LF7A 3NW4A 4OMCA 5HCHA 1LB2A 3RNSA 3EXUA 5A70A 4WVVA 3I2OA 3WW1A 3VLBB 3DXTA 1C1LA 1RC6A 4XUTA 4FPEA 4IEZA 3WHUA 2YYOA 5BNQA 2PHFA 1MQTA 1ST8A 3R4SA 2VC9A 4AI8A 4DS0A 3ZXJA 3BIEA 1UD1A 3IN9A 4NN0A 4YVWA 1RMU1 3THCA 1VMHA 3I2IA 1LHVA 1XBFA 2CAUA 4XAEA 5JR7B 4EN9B 5DZGA 1VAKA 3VHRA 4FFFA 2WFF3 3W5NA 2D3PA 2JICA 2VOKA 1POQA 5J48A 1VBD2 4OQ8A 4QPWA 4FPCA 2GALA 2R0HA 4LBQD 4NO4A 3WNNA 4EROA 2XJSA 4P9YA 1IQAA 3FMGA 2XBO1 4JKLA 1V9U3 4Z07A 2FDGA 1OD3A 1LOGA 3EO6A 4IETA 5FZDA 5F5AA 4JAAA 2X05A 5BNOC 3M3EA 3WDVA 3WW4A 5JDBA 5DG1A 4IESA 3JZVA 2CSGA 3T1LA 1F2NA 5A3TA 5DZEA 3BUCA 5FMDA 5KXCA 1AR93 1ULFA 1RUOA 4LJHA 4GD4A 4TXWA 1RMU2 4XFGA 4XILA 5FWEA 3WNKA 2AACA 3MLKA 2WRAA 3SCHA 1VE0A 3I54A 1G7YA 4KGQA 1ZBA1 2D97A 4QPGC 4D6SA 4R4ZA 5JPMB 1H2MA 1W8NA 3DN7A 1YJLA 4AGRA 2A7AA 1H30A 4RN5A 4A6OA 2LS6A 3AFKA 1DGRN 3RQ0A 1AR72 2CY6A 3WY6A 3T0DA 1VAMA 3WNOA 1XYNA 2WNVC 1UXXX 3ETQA 4XUNA 1NLRA 3S30A 2TNFA 2XVGA 4AVTA 2K9ZA 4D69A 2VU9A 4GWMA 1C1FA 1D4VB 3GDBA 3JU9A 5A33B 4LBMA 5L7OC 4QGNA 1YFUA 3KCYA 3UGHA 2VGDA 1WMFA 2DFBA 2KD7A 4J1WA 2WO3A 1N47A 4YW5A 1D4M3 3BTYA 1OLMA 1ZBA2 3LA7A 2EIBA 4JGYA 2JDAA 4Y1UA 3SH4A 3ZSLA 1RVF3 1K12A 2VM9A 2KXLA 2VZQA 1W39A 2J7MA 3ZIWA 3Q9OA 1GUIA 4Y1ZA 2QE3A 2P3IA 1PVC3 3EQEA 5CKNA 3MI8A 3G6JB 4UI9L 2WT0A 5FWJA 5JWPA 4DY5A 2DVAA 4ZONA 1JUHA 2XJVA 3P3NA 1ZA7A 5JSRA 1SLBA 2CAVA 1AR63 1H9WA 1Q8PA 3ACIA 3I3QA 4N43A 5F32A 1RINA 2JD4A 5FLIA 3E5XA 5A7PA 2VCMA 5FPVA 3I2HA 3AYCA 1UOJA 4K1ZA 1BZWA 4QXBA 4E4SA 1KXGA 2JDMA 3M7AA 1PK6C 2P6CA 2Z79A 3OG2A 1M4WA 4BLIA 5JOYA 5BNPA 1WZXA 3TN91 5FBZA 2VTFA 4N53C 4M0HA 5LCWL 5APAA 5A3OA 4JDMA 4Q4V1 4BQ1A 5JIUA 1MS5A 3DKWA 4E2GA 2PHXA 2EXHA 4L11A 1BK1A 5CG8A 3DEMA 3BTAA 2Q8OA 3UKTA 4FPHA 1W99A 1YFXA 1GR3A 4QX2A 1NE6A 1I6XA 4M4RA 3SH3A 3Q8AA 1Z7S3 3IWZA 4QXHA 1BKZA 3B9CA 2QQJA 3JB8A 3NAPA 4UAPA 5JPNB 3KQRA 5CG9A 3WOGA 3VUOA 3ZN4A 3V0BA 2XHKA 4QAWA 4R9AA 1TME1 3LDRA 3OYWB 4Q4V2 4FPFA 2AENA 2W52A 3LGRA 1REFA 5LEJA 2NMOA 5FZ7A 3DV8A 1R083 1O3TA 2OZ6A 2CWSA 4FQZA 3UESA 3C7EA 4CCJA 4GB31 1RUC1 1GP5A 1UYXA 1TVGA 2YBKA 1YCIA 1WD4A 4LKFA 4E4HA 3O1PA 1ZBE3 4PBOA 4HL0A 1EV11 4AEKA 1ULGA 2E51A 4Z82A 4QDSA 1FT9A 1JTZX 2GDFA 4MGQA 3LOBA 1K45A 1H8VA 4L99A 2BFUS 2DVGA 3OPZA 4H14A 5F7UA 2BTVC 2PHTA 1TME2 4MGIE 2XUMA 1PZ7A 1LODA 3PVBB 3H8UA 2QCSB 4FAHA 1V6LA 3W59A 1AL22 3MGUA 5I0DA 2HH9A 5T54A 2ID4A 2JDZA 1LEDA 3MV11 1RUC2 3AL6A 3PLQA 3OGRA 4GB32 2DDUA 3B00A 4XTPA 5F3GA 5IK5A 3R6SA 3ITQA 3LSEA 1HQWA 1J84A 5FZCA 2WYFA 3ELNA 4BQ3A 2D6PA 3FHAA 2WNOA 1HV0A 3KV4A 4OYUA 3H1WA 1UU5A 4MO3M 3B02A 2C5DA 3ZYIB 5B2GB 1IG3A 1POV1 4CDUB 5FY8A 2R49A 5CFCA 2J1VA 1IS3A 1LHNA 3HQXA 5HCBA 2P2KA 3THDA 5FOJB 3U1XA 1LOCA 2EXKA 3BOWA 1CZVA 3OBRA 2P1BA 3O1RA 4YFZA 5GLUA 1H9PA 5A1AA 3U11A 2AR6A 3I97A 4QQOA 2ZOEB 4Q4W2 4EN7B 3VZOA 5IVEA 5JSPA 3VN4A 1WWYA 3WNXA 4PLNA 2Y38A 2XVLA 2XUEA 2CNAA 2R062 4D7TA 1UU6A 4XFHA 4CP1A 4P5YA 1ZZCA 5HBAA 2VH9A 1QXPA 1HRV2 2D98A 3ZVXA 1RJ7A 2XVKA 4HK8A 1COV1 4O65A 2DWRA 2HWC2 2W95A 1WBLA 2RMU1 5H9SA 2PFWA 4QQLA 2OX0A 3L2YA 1NLSA 1YQ2A 2SBAA 4XCBA 3CHXA 5C70A 4YM1A 3PVOA 5IVFA 3NJVA 4KWLA 2Y26A 1K5MA 3VL9A 5C3SA 5FR3A 4AL9A 3SQOA 1WMXA 5ABJC 4CA9A 2R30A 4R9CA 3T2PA 4OI2A 3P1IA 4L92A 3A23A 3GF6A 3I3MA 4K6BA 1RITA 1YQ6A 4N9IA 2A6XA 4RSUA 1Y4WA 1O8SA 3NQHA 3PVNA 4ES9A 1RUE1 5EV7A 3VKFC 2D44A 4QPGB 4OQ9A 2RMU2 1UN1A 1X33A 1CWPA 4Q8LA 2D5FA 1JS9A 2HBUA 2RM23 1AZDA 1RUNA 2VCBA 3UJOA 2F6BA 2Y0IA 1JZ5A 3AKSA 4YW4A 3LEGA 2BERA 1FX5A 2YUEA 3C8XA 3POIA 2ZGRA 3PU8A 4MV2A 4YW7A 4CXWA 1V9U2 4DUXA 4H2AA 1UL9A 1OLRA 1G9FA 4UW6A 4HN0A 3RMYA 3OBZA 1PO11 4BQ2A 2MEV3 3OEAA 2ZABA 1AYN3 2B45X 2HEYF 2E7TA 2VUDA 5CIRA 3MBWA 4K9SA 3O0XA 4MGKE 4FOWA 3CF6E 4RR3B 4P9IA 4YRDA 1RUE2 5BUVA 1YC61 2ZKLA 2W46A 5FZEA 5JI9A 1S0CA 1HIXA 3I2FA 2VE1A 4XF4A 3UYJA 2ILMA 4D3WA 4FPYA 3K51A 3MUY1 2WO2A 1ODMA 3ZKUA 4OLLA 1U12A 2BWCA 4CCEA 3RRDA 5FDBA 3N35A 2J1EA 2BQPA 1S0IA 1QNWA 4LK6A 4XBNA 1AR61 1XNBA 5I8YA 4ORFA 5T5LA 4K20A 3ZXAC 3HEIA 1J58A 1PK6B 1TEIA 2OYZA 1GQGA 3ES4A 4C0HA 5FPAA 1ASJ3 3MYXA 5CKMA 4RHV1 1D4M2 4DEQA 1FMD3 4R8HA 1RVF2 4XIOA 4YM2A 1XQNA 2GP5A 1CAVA 1MS3A 1LGBA 2E26A 2QQIA 3NNFA 4UFHA 3Q8EA 4XOGA 5FYBA 1ULDA 3AMQA 1PVC2 3IBMA 3X29B 3LEIA 4EZ4A 4I3PA 1Y9GA 3E97A 2WDBA 2D6MA 3ZXGA 1Q8QA 5FZOB 2VZOA 4Z8BA 1JW6A 3WDWA 4EV0A 4UF0B 1AR62 2BBVA 2ADEA 1ZZ8A 2VL4A 3U37A 3ZMNA 5JXGA 3SH5A 4B7KA 2VQ0A 1AJKA 1YQCA 2BP6A 5D8AA 4LO7A 4JC1A 2BOJA 1XNAA 4GA9A 3VBRA 2RDQA 2PLV3 4OFGA 1JYWA 3N4MA 2XWBB 4CCCA 1QDCA 3T0AA 1S2KA 4D94A 1W6PA 2WS91 2C4XA 4Y22B 5G04L 5IYYA 1IHMA 1QF3A 4CUAA 3WDUA 3RZKA 1MS1A 1DQ4A 2H6CA 2XKPA 3ZFGA 4INDA 3WCSA 3K3OA 2RS53 4KU8A 3N3HA 1PGW1 2WC2A 5GLWA 4QGMA 3ZSJA 2ZHMA 1CR7A 1NZIA 1PZ9A 1W8HA 2JXAA 1RUJ1 1REEA 3QACA 4EWEA 3GHMA 1V6OA 5I0RA 2A6WA 3ECQA 1GBGA 2AREA 1TMF1 4LO6B 1W2UA 5EJ3A 4ZY9A 4CPBA 2Q1ZB 2VZ1A 1LHUA 4D7SA 3C2UA 3IMMA 1HRI1 4I2OA 4UW5A 2WS92 1HLCA 1W6MA 3NRUA 2ZX4A 2WLPA 3QOPA 3NJXA 3L2HA 2P3JA 4HKOA 2QKDA 5FKCA 1OD5A 1PGW2 1XE7A 5A32B 1R082 1KFXL 1JZ6A 3FHQA 4NAOA 5IVCA 1KFUL 3VBOC 2VOXA 3OGGA 3WP3A 5LEKA 1H8TC 1O4YA 1ZBE2 2RVAA 2B9VA 3ZXDA 3ZR5A 2GC1A 3VHPA 2XJTA 4MG2A 1YEWA 4OCTA 4EZHA 1W28A 3TEWA 1SHWB 3ZXLA 2IC1A 1UKGA 2B42B 1HRI2 1UQXA 3VZNA 2WR9A 2HKXA 1PO21 2LM3A 5FMCA 4CEYC 1WKYA 1WCDJ 3KV5A 1RTVA 2AEYA 4RS5A 2QQLA 3VHNA 1UMHA 1XOYA 4X6QB 2YBSA 2DTWA 5F5QA 1VBB1 1SEFA 2OA2A 2VO5A 1O3QA 3FUQA 1GANA 4RGAA 3MHZA 4DB5A 2DUPA 2YXSA 3MW4A 3WDXA 1SFYA 1SCSA 1CONA 4HOOA 1A8MA 5C4WA 3T2QA 3WQBA 2FHRA 5KWRA 1O91A 3LOIA 2YFUA 3P5BA 1UW8A 3NNJA 1MZFA 5L9VA 2BRTA 3OY8A 1NQDA 1WMEA 2EA7A 2F4PA 1P8JA 4QB2A 4D8MA 1ZRRA 3WW3A 4Q1RA 1ZYBA 1YNAA 1MZ5A 4PIYA 1LEMA 3FLRA 1IS4A 3OD4A 1A3KA 4A3XA 1GQPA 2VZTA 1VRH3 4XMAA 3W21A 1O8PA 3URFA 5K0UC 1LOAA 1S4CA 1HDKA 3VDDC 1KEXA 2FQPA 4IE4A 5E89A 3KVAA 3LPGA 4COZA 4BLJA 1G9CA 2W3JA 3BU7A 3MIEA 4FFIA 3HNBM 4JGZC 1I9RA 3LA3A 5ABJB 1AJOA 1UY3A 1YO8A 1WCQA 3V0AB 4A7KA 3IDAA 3H7YA 3LAGA 2B7YA 1JYIA 3CJIA 1W6NB 3JCIA 3PUSA 4A7ZA 2SLIA 3PL0A 5FQ0A 4LO5B 5DUXA 1R64A 1U5IA 5AFEA 3OGJA 4IEYA 1OI6A 3ZN6B 4XIKA 4LO4B 1C8M3 1LU2A 1N1TA 2QQWA 2Y6GA 3ZFEA 3FZ3A 4CEWA 4XXPA 5J7MA 1ENRA 1IZ3A 4RGGA 2RS33 4BMBA 3HT1A 5CEHA 3VDAA 3TEYA 3QD6A 4OVEA 1OQDA 1PMJX 1XPWA 3KLSA 4LBQA 4AQTA 1NG0A 5F5IA 1JYTA 1PM7A 1C3HA 2J1AA 4J6GA 4RQPC 2R7EB 2YGLA 3WR0A 2HEWF 3AZXA 1IKQA 3VL8A 4XEZA 2HWE3 3BYWA 4XDPA 1CJPA 1N1YA 5FREA 1AYN1 1O4ZA 1GYKA 2BFUL 4YGDA 5F6LB 4XDOA 2JDPA 2XONA 3Q8CA 5AC93 1DU3D 1U5ZA 4W6WA 2E7QA 1I1EA 2G4IA 1HQNA 3E6BA 2ZA9A 4LBOA 3I59B 4YNIA 5BPXA 1H4GA 1FV3A 3P3PA 3KM5A 1W8UA 3BI3A 4CP2A 4WZCA 3OJBA 2E6VA 4ZKTB 2C9AA 4MXWA 2RJLA 3DUIA 2OXBA 3MPPG 1LOFC 4N7IA 3ZYHA 1UY2A 5AFBA 1H0BA 5E1RA 3I3EA 1AYN2 2TEPA 1H2LA 1M06G 1MS4A 1DYOA 3SISA 2W9XA 1V6MA 2WAOA 1GOHA 2DURA 4J25A 2WO7A 4GULA 4NUBA 3MDPA 4MSVA 1X36A 2VVDA 3VBHC 3JQWA 3J7LA 1SLAA 1FYUA 1VBA1 4UOJA 3LD8A 3Q8BA 4ET7A 1RHI3 4CRQA 2ZMLA 1RUI3 3HJRA 1DGLA 4AI3A 1QHDA 3QBQA 1OUSA 1CAWB 1C28A 4GALA 1GZTA 1OFSA 1Y3TA 3G7DA 4GWNA 4W50A 4Z92B 5FMOS 4OHXA 3M3OA 1RUD1 4BCUA 1NE4A 5GKAC 4WM7B 2J1TA 2B39A 1CZSA 1NXMA 2PLV1 1BMV1 3WINE 4GAZA 1W9FA 4DZGA 4CDWB 3ZR6A 1BXHA 2G9ZA 2LUWA 1FMD2 1I5PA 2QZ2A 3HMYA 4AYUA 5EWSA 4FSJA 1LU1A 5SV8A 3O1UA 1R1A3 3RZJA 1FATA 1O59A 1SPPA 1JHJA 1E5IA 3T1MA 4V2VA 4BZ4A 3N9NA 1PHMA 1CAXA 1U0AA 5DXDA 1BVP1 4GH4A 1VJ2A 3WF0A 3IDCB 2W1SA 3WQ7A 3ZYGA 1FPN3 4HXCA 2PQQA 3ABZA 3VBSC 1NA1C 2R071 5J96B 1RUD2 1VBC1 3OF1A 2Q0AA 3HWJA 3ME2A 2PLV2 3LKJA 1ND2C 2YHJA 4OZXA 4QX7A 2WZPP 1BMV2 3GZEA 2DU1A 3SITA 3ZSKA 4PDWA 4XHBA 5A7OA 3RSJA 3H9AA 2QQMA 5BNPC 3TNPB 2E63A 3NV1A 3RPQA 2A6YA 4D0QA 4NIIA 1W2NA 1WW4A 1WD3A 2CTVA 2GNTA 2JG8B 4WM8A 1GZWB 3RS6A 2Y64A 4XABA 3OEBA 5KC5A 3VBOB 5A6ZA 1GU3A 4COWA 4YG3A 1OA2A 2WSVA 3WP6A 5IVJA 5CFDA 4BK5A 1B09A 4LNVA 4G3YC 5IT6A 2R072 4Z2AA 5FP8A 1HB3A 3HN1A 2RR13 3AP4A 4AHXA 3H42B 4Y4YA 2VVEA 3D4KA 4CEYB 2ATFA 3JQXA 5GZDA 2OKXA 3RG0A 5C9AA 5FKBA 3WP5A 3NAPC 2FCVA 4YZ2A 4HVRA 4Q2FA 2VBBA 1VRBA 3WG3A 3UJQA 1RB8G 2VVFA 2C1FA 2XMLA 1GZ9A 4Q4Y1 4IEQA 3UETA 1IS6A 4CYDA 1QDOA 2PA7A 2GN7A 2W5FA 3J7MA 3RZHA 2XGXA 5J09A 2WUHA 1DFQA 1ND3A 1UNBA 3VZLA 3AMPA 4MOAA 2Y34A 5CKQA 5J3UA 1QOSA 2ORZA 1OUXA 3MEPA 5J36A 5IVVA 2DCYA 4RGKA 2NYYA 1SLLA 3U4XA 3TEZA 3ZKYA 1X50A 1DGWA 2DBIA 5ACA1 2IXJA 4LXLA 4PQQA 4I0WB 2VCAA 2GNMA 5JOXA 4AVBA 2E31A 1BEV3 1YQ8A 3CKHA 4P02B 1W6QA 2B5HA 4P14A 4ATFA 3DECA 1SBDA 2ZGSA 4Q0QA 1QJFA 2X5IA 4YG0A 3KS7A 3VDDB 4U36A 2MHFA 1LJ7A 3FL7A 2DTYA 1UX7A 1F15A 4XJ9A 3WNMA 2GN3A 3A7QA 1B35A 1EYBA 2A6VA 1YQ5A 5FCCA 4XFCA 4COVA 3KCCA 1ZM1A 4A42A 4DRVA 5FO9B 2VZ3A 1DP0A 4DOUA 2VNVA 3POSA 3ZYRA 4AVAA 1VBD1 3ST7A 5EYYA 1RIRA 5ACA2 2ZHNA 2V4VA 3I2JA 4AW7A 2IXCA 1W6OB 4NROA 4UWDA 5GM0A 2BYVE 4QWNA 3UGGA 2GZWA 1T2XA 3NJZA 3OUHA 5A3PA 4Q0PA 3OGSA 5DABA 1CVNA 5FTTC 1VRH2 2P3YA 4AVVA 4IGPA 5A1FA 3ZPOA 4BM8A 4AHYA 4IV3C 1W0OA 4C1WA 2WWUA 1OC1A 1GP6A 5JCTA 1YI9A 1A34A 5LY2A 4DINB 4JVAA 4RQPB 2IUWA 1NOVA 3VD3A 2WL1A 1FOD3 1HV1A 1WBFA 3OUIA 4NJ4A 1O4TA 4QB1A 1KJLA 2PYTA 3W20A 2OW4A 1QJU3 1T6BX 3EB7A 3H3UA 4X8PA 4QMAA 4UBHA 1UX6A 1AR71 3B93A 2JKBA 3NV3A 3AYDA 4K1YA 1UZVA 1NAEA 5IFPA 4ZU7A 1REDA 4XJUA 5BV6A 5HI0A 3BVCA 1C8M2 2WABA 4E27A 3AX4A 1SMVA 2X10A 2PTMA 2JG9C 4XZPA 5KHGA 1LCLA 3O7OA 3M4FA 4UFKA 1KDKA 2D5HA 3T09A 1W2OA 4CCDA 1UPIA 4TWTA 3ATGA 4J1XA 2CV6A 4LITA 2C24A 2VUAA 1K5JA 5EZWA 4BXSV 1S0BA 1OMIA 4MYEA 5FZ0A 5H9RA 3LEKA 2WAAA 1KJRA 1TZOA 2WZR1 3CEWA 3KT4A 2RJ2A 3M3IA 1NCRC 2HWE2 2QDNA 4EJRA 3GM8A 4QX3A 1W2TA 3CU7A 3KZ4C 4TYSA 5FZ8A 1RUF1 2MPFA 2HJIA 3VBHB 3MV01 4CZSA 5AC92 3H8RA 3ILNA 4K7JA 2BV4A 4QX1A 2O0OA 3TYJA 4E8DA 4U2AA 3DXUA 3NL1A 5A33A 3J26N 4BDVB 1ZRCA 2PELA 3VBFC 3GXUA 1IS5A 5J1XA 3ZXEA 1OOPC 1RUI1 3A21A 4M3CF 5FZBA 4AEJA 4XYXA 4EN6B 4Y20B 3JBG3 5FP4A 1SDWA 4UFIA 2WZR2 3A0KA 3HOBA 4LE4A 4QHOA 4TN7A 4BK4A 3CBNA 2DCTA 4MGTA 4KG8A 5HXMA 1QQP3 4NIAA 4LHLA 1TNFA 1U5XA 2E33A 3V64A 1RUF2 2DVBA 3AFGA 2PHWA 1HJFA 3KF5A 2FDIA 2QVSB 1A8DA 2WFPA 1QKQA 3RVHA 3ZIXA 2HWB1 3FHIB 5FYHA 3GJBA 5HCAA 1QOOA 2ZEWA 3PU3A 4B4PA 1R1A1 1F4HA 1DBNA 4H7LA 1Z0HA 4QPYA 1RUI2 3PTRB 1US3A 4COUA 2GH2A 2WYSA 3HR9A 5JIAA 5KHHA 1OXCA 3WF4A 4BIFA 3VBSB 5C7GA 1NA1B 2OS2A 2ZGKA 1VIWB 5FAXA 5FY0A 5IJRA 4NWWA 2EICA 1FPN1 1WW7A 2OT7A 4LBJA 3O0VA 1OPMA 4YG6A 4CCMA 1ND2B 4NPMA 2HWB2 1XNDA 5A7NA 3USSA 5IHRA 1O5LA 1ZZ7A 3HNMA 5SV5A 2QQKA 3U10A 5BNPB 1HN1A 2OQ7A 4R9BA 1R1A2 1S0FA 2BZDA 5F8PA 4B8EA 1WA6X 2VZPA 3PMSA 4MZUA 3NSTA 4QGLA 1AXKA 2XWJB 3AP5A 5DAXA 3ZYBA 3WG4A 3OYWA 4ZS2A 1W3XA 4AWDA 1YFWA 5LA9A 1AL21 1FPN2 4AOCA 4PHZA 3KV6A 2FCUA 3UGFA 3M2MA 4S2GA 1DIWA 2Z42A 3LSDA 3BALA 3KMHA 3MW2A 5KBFA 5EJ1B 3OPTA 5TSWA 2X8KA 4A3ZA 4XJ8A 4QQPA 2ZEYA 2XJPA 3ACGA 5CU1A 3LB9A 4YGEA 1X9PA 3VB9A 2HEVF 5K9YA 2CYFA 1H2NA 4QQHA 2CGOA 4QU1A 4B1LA 4QD2A 2CGNA 3DPRA 4META 1C57A 2WNEA 5LWBA 2EF6A 1SZBA 1S2EA 2J1SA 2RR12 4D6RA 2BGCA 3I49A 4Q4W1 4GQ7A 5FZ3A 5LBEA 1O7FA 1XU1A 2RS13 1GNZA 1DGWX 2R061 3M3CA 1BEV1 2PN5A 1MEC1 5FUIA 2VUJA 4NHYA 2W08A 2ENRA 3NNMA 1OBNA 4MXVA 4YSFA 5JZGB 5KR7A 1HRV1 1ULPA 2QQUA 5EPAA 4Q0SA 3SHRA 4CDUA 3ASIA 5C8CB 1JZ3A 2WT2A 4JQTA 2ZHLA 1GLHA 4RL7A 2P6HA 5FYMA 2WA4A 1J1TA 4PT6A 2HWC1 4NOTA 1OLQA 4FFHA 1X7NA 1XYPA 4JHTA 3KB5A 5F3CA 4OUMA 2P17A 3DGTA 1HXS3 1GNHA 3T3YA 5E16A 5FXXA 1LECA 1JYVA 5D1IA 1PIV1 1LGNA 1RUH1 2Z5WA 2UWCA 3MIGA 1BEV2 3FFQA 3VGIA 1ULOA 1MEC2 2VTXA 2CDOA 5I93A 2CU5A 3ETPA 4IV3B 3TOJA 4YW3A 5CISA 2R0FA 3GNEA 2JE9A 1BQPA 4DNYA 1XU2A 4UFMA 1IPJA 1SG3A 1KD7A 4A44A 4NHMA 3WUDA 5C4WC 1NT0A 4UXAA 2WFF1 3R4UA 2ZGUA 3KV9A 4QU2A 1O3RA 4FPKA 2UY8A 2VR4A 4COYA 1OPOA 2XXZA 4UBGA 2WNUC 1QJX3 3W9AA 1RYYA 1V9U1 1PIV2 4Y33A 1RUH2 4KMQA 5CADA 3D3AA 3KSCA 2E53A 5BNOB 1JYNA 1U5YA 3POEA 4GMP3 1OKQA 1Q8SA 4MH0E 4DPNA 3AZWA 2VJXA 5CVRA 1JOBA 2VPVA 3OB8A 4LEJA 4CDQC 4HMZA 2JG9B 4LHSA 1AR91 4KH9A 3LCPA 5DDJ3 4CP0A 3LE0A 4NPLA 1W8FA 2DFCA 1AYM3 4ZXEA 4QPGA 1G8WA 2WFF2 4W8JA 3K48A 5FZ4A 1D2SA 1NYWA 4CSWA 1QOTA 1NCRB 4V2WA 5JLVA 3GZTB 1UIJA 3MIFA 1RXGA 3CZUA 4M00A 4Q26A 3HN3A 5BXXA 3VBUC 4JZRA 1OF4A 1VB4A 2JIGA 2WNVB 4I3GA 1R093 1UCXA 4LO8A 5E8AA 1KRIA 4Q4X3 3AVRA 1BK0A 3NV4A 5A7WB 3BB6A 5L7OB 2F4LA 2K2SA 5M0TA 1SFNA 5LY1A 4UFLA 1ALYA 1AR92 2B4KA 3VBFB 3BGAA 1XRUA 1YJKA 1LAJA 1WCSA 3KT7A 4RR3A 1OOPB 3ZFEC 3I2DA 4FP2A 1D4M1 4F3JA 3AK0A 2VW2A 1RVF1 2N7GA 1UOBA 1AX1A 1QXRA 3POGA 3U75A 4B4RA 2A5ZA 1PVC1 2FMYA 4KG0A 2WZ8A 5C33A 5KXDA 1JN2P 2WO1A 2ADDA 2ZGTA 3SKJE 1G9AA 3BTXA 1DGRA 4PCRA 4OHVA 4TLFA 5BY5A 2YZ4A 2PAMA 5G05L 4YYOA 3LDKA 3T4HB 3KGZA 4HT1T 4IV1C 1AX2A 2I07B 3K4DA 2VOTA 3THPA 4EYUA 1PK6A 5DQ0A 3W58A 4AEDC 4N53B 5FFOC 3VHOA 1CGPA 4M4PA 3H0OA 1HN0A 1ULEA 2OUHA 1YI7A 2PAEA 2W68A 3JBG2 5JSOA 3PJQA 4ZU4A 1NLQA 5LASA 3MLLA 4LE3A 3B01A 4FAGA 2FCTA 1QQP2 5FY1A 4ATEA 2D3RA 3O5SA 2YG0A 4K21A 5CAZA 1WCKA 3N7KA 4LULA 5DPNA 4ZZ8A 5F9TA 5FZOA 2VBPA 4K8FA 3T4VA 2VMCA 2XHNA 5FZ1A 5GZFA 1RUG3 5FZHA 4B7EA 1S2BA 4LKDA 3DKQA 4UF0A 1KS5A 1Z7S1 2A3XA 1UMZA 4W65A 3SEPA 4LLOA 5FPUA 4BPZA 4LA3A 5HCFA 1BLZA 2Q1MA 4A6SA 3AZVA 3INAA 2JDKA 4DXZA 3ORJA 4MGYE 4E9KA 1LTEA 3S57A 5LA0A 3USUB 4W4ZA 4Y22A 3FWEA 4FI9A 4Q0UA 1TG7A 3TWIA 4N90A 2R1DA 2JB8A 3AMNA 1D7PM 3POFA 5FZKA 1HB1A 1R081 5H9PA 5LBCA 1J59A 4NHXA 4LK7A 1CIYA 1PX4A 2V09A 3F95A 3ZDVA 1ZBE1 2W1WA 4IE0A 2E7AA 2UYAA 1Z7S2 4AZZA 4BB3A 5GZGA 4GKXA 4Y1XA 4ZXKA 2EXJA 4QX5A 4PIXA 1PX3A 3AJZA 3OOXA 1PGSA 4JX0A 3VD5A 3EHKA 4LTAA 1WLDA 2GH8A 4OI4A 3WSOA 4HVQA 2RE9A 3T2OA 2VNRA 2PHDA 1QIQA 3HNYM 2ET7A 5LATA 3LA2A 5JOZA 5CYYA 3HPNA 5A6YA 4XURA 3BKZA 3HQRA 1YHFA 4YVSC 4YZ4A 4CTEA 5A32A 1YFYA 4OHZA 5IAXA 4I30A 1JU3A 4GMP0 1V6KA 4NRPA 4Y24A 4AVCA 4JHZA 4TTGA 4AFDA 2OPWA 3ZSMA 2ZX0A 4TZDA 2FMDA 2ZAAA 2ZTNA 1XE0A 1F4AA 3I4IA 1EAH3 1SBFA 2RG4A 1LOBA 2ZGMA 4HN1A 5KXEA 2X53S 1Q56A 1SFPA 3J4UH 4GKYA 3OGVA 2ZX1A 4MGSA 4A45A 2BPA2 5CNAA 3WUCA 1JXNA 4X6RB 5CBLA 4NMIA 3WCRA 1ULCA 1LENA 2JB4A 4L0PA 1YIFA 4NRMA 1E5SA 2H6BA 3PIGA 3VKLA 4B29A 2DCKA 5BYNA 5CFDC 2G9GA 4AQ2A 3WDTA 5FOBB 2YFZA 5JVVA 1DZTA 3GGLA 4NAMA 5FY7A 3N7JA 4BA6A 1HQLA 1RJ8A 2GMMA 3POBA 3FFZA 2XG3A 3CO2A 4I01A 4M01A 2WWJA 3ZO0B 3CDZB 3CL1A 4QKBA 2EAAA 2FBEA 3GBWA 1IGOA 2R043 1NCQC 3R05A 1AHSA 3LWCA 4JRAA 4DFSA 4FT8A 2BVBA 2NQYA 4XBQA 1JH5A 1W3VA 3VDCA 4HBNA 1W04A 4CDXA 4DO0A 2NLRA 2O14A 3FC0A 4IEVA 4L9BA 1BCXA 4GJYA 2YU1A 5C4WB 5C5UA 3J8F3 4QQ2A 4F83A 1ND3C 3BOPA 5F3IA 3EJKA 5FV3A 5JR2A 1BBT3 1F9KA 1Q43A 5C3PA 1HXS2 2WNUB 4UFJA 1TQ5A 2QQNA 4WVMB 1PZ8A 1DQ1A 5DAQA 5EYXA 3A22A 4CUBA 1G86A 3WP4A 5FZAA 3AMMA 2DBNA 5I8SA 4XJZA 5ABJA 3S5QA 2DYCA 3V0AA 5DUVA 1V00A 3DYMA 4BQ5A 5JI7A 1S1AA 2UURA 2E32A 4CDQB 3POWA 4LORA 5IVBA 1NZCA 2NN8A 1XXNA 4HPKB 2NM1A 1UWWA 1FAYA 5EJZB 2EAKA 3VDBA 2LTNA 2YC2A 4QPIC 3ZN6A 4R4XA 1JZ2A 4ZPIA 2EIDA 2YV8A 2V5DA 3QH6A 1JZ7A 1OA4A 3E5QA 3IPVB 1HB4A 2BDRA 2RM21 2D6NA 5IVYA 4QXKA 3WZ1A 3ZFFC 4CCKA 4KU7A 4FO9A 5JUVA 3AJYA 3VBUB 4BQXA 1QJX2 4PBPA 5A80A 4N8MA 1RL3A 1ZNPA 1XSQA 2QQOA 1CPNA 2GNDA 1QJY3 1ONAA 4IDZA 5K4LA 3ZLIA 5A3MA 2MEV1 3H8OA 2B8MA 2JD9A 4V1PA 2YBPA 5AVPA 3VZKA 2Z4FA 4BQ4A 4B1MA 3ZFEB 3WG2A 3NNLA 3UK9A 4MVTA 1MQTC 4K3UA 1OSGA 4CVUA 4HLTA 1JU4A 4YVWC 3SXWA 1DQ2A 2RM22 1MZ6A 3J7NA 4HANA 5FK7A 5C3OA 1VLNA 3RDIA 3I59A 3QH7A 3RGBA 1YXWA 3LFIA 4AXOA 1Y9QA 5FYYA 3SC7X 1XSRA 2IFWA 5L19A 3UKVA 5GJ6A 1CAUB 1T6GC 5CZKA 2A6ZA 4XF0A 1ENQA 4PI2A 2XBO3 2KR2A 3MUZ1 3WT3A 5FP3A 5C3QA 3P6BA 5EHDA 3BU0A 1R092 2MEV2 4LR4A 4QKNA 1EUTA 2BGOA 4QHBA 4UW4A 4IV1B 5L36A 2NPIA 3IIIA 1QEXA 1VALA 2FDHA 1XNTA 4IL7A 2BEOA 4MHUA 4QHZA 4AEDB 4ISRA 1IKPA 4CU6A 5CA6A 4LBLA 2QTWB 3LFMA 1ASJ1 4FVVA 4P00B 1FMD1 2O8QA 5T5PA 4Q27A 1GNYA 4HK9A 4DEVA 2VBDA 2D6OX 2P4EA 5FJHA 1ZBA3 4XJWA 1WLCA 4M3CA 3ZM8A 4XAAA 1CAWA 1GWMA 1PNGA 2Y6HA 4Z1VA 4QM8A 1BHGA 3O14A 3RWKX 4GZ9A 4XDQA 3ON7A 3MICA 2PHUA 3GYDA 5FYSA 5JXIA 2WSUA 1W05A 4ZHNA 2ZHKA 3CZJA 2X09A 2P5BA 1ASJ2 4WM7A 5LW9A 4WVWA 4JDNA 4LKSA 4KBZA 4CDWA 4RFRB 2ET1A 5A3NA 2XLAA 4B3NA 5F6KA 1Q8VA 4JGYC 4FPLA 2XJQA 4HONA 1O3SA 1V6NA 3FJSA 2V73A 4JTOA 2RS51 4WZFA 2A1XA 3MFAA 5FJKA 4GIQA 1QNYA 3KWVA 3SKVA 3ACHA 3ZOIA 4AK3A 1WW6A 2ORXA 1MVEA 2Q30A 3EYPA 3WF3A 4N43C 2YC0A 4XUPA 3RYRA 3UV9A 4DUWA 1J1LA 4CCOA 4P9JA 3AKRA 3FE5A 4AR2A 3KT1A 1LRHA 5B4NA 1DDLA 4BE3A 1MS0A 2OIIA 3PMEA 1F5FA 2VNOA 3TN93 3K4ZA 3GJAA 1ZZBA 3O1OA 2I2SA 1FV2A 3OSDA 4YVSB 2RS52 4H7MA 2JG8A 5LA2A 1RXFA 1GZWA 2B9UA 2PHLA 1H8TB 2PHRA 3VBOA 2L9LA 2IXHA 3HVDA 5F2WA 2VMFA 4FOVA 4O7XA 1UZYA 1DLCA 3NKGA 3DL3A 5FYTA 4XJAA 2QUOA 3MIDA 4NR1A 2V4AA 1MZEA 4CEYA 2Q4SA 4CUCA 3HBZA 4FTEA 2JENA 3NVCA 4FOQA 4ZU5A 3C7FA 2W92A 3AYAA 5EXOA 4K40A 1NXD1 4AAPA 4IERA 3VKNA 1TME3 3GBFA 1DYKA 2IWGB 4W6YA 3C7GA 1I3HA 1EPWA 2VY0A 4FBFA 3OCPA 4EN0A 2JDYA 3GBGA 3D5OA 3NWKA 4H3WA 1V6IA 4F8AA 1YWKA 5F39A 1N1SA 4GB33 1MVQA 1WW5A 2EALA 3HQUA 3E6DA 1EV13 1W9TA 3AP6A 1NCQB 2G9FA 2HBTA 3GALA 3HD8B 1EAH2 4LHNA 4YW6A 1ZRIA 4LMFA 4UW3A 2LALA 5FYVA 1S0DA 2QDRA 2F17A 1ODNA 2VMEA 1JZ4A 2OZJA 4XFFA 1Q8OA 2XLFA 5K0UB 1CESA 5AVAA 2ZPXA 4PF5A 1XNCA 4S2FA 1VRH1 2J1RA 4I0BA 4YGCA 2P3KA 5HXVA 3RYPA 3VDDA 2ARAA 5B4XA 4IQPA 4C90A 4EWDA 1JHNA 1LKNA 1BBT1 4JGZB 4SLIA 3VV1A 4AQSA 4DXSA 3DPRC 2YU2A 3GCWA 4O61A 3DYPA 5BNNA 2EIGA 3H1YA 1O6UA 3SLIA 4GJZA 4R9DA 1OKOA 1UKRA 4K8RB 2ETEA 2EXIA 2ZZQA 1C5HA 2R042 5FPZA 4YZ1A 1CQ9A 5IK7A 4CP9A 4DQAA 5FUPA 1GP4A 4QPIB 1OA3A 4A4AA 1ZRDA 3O0WA 1HX6A 3ZXKA 5E88A 1OLME 4CU7A 4C1XA 3VKOA 5CFCC 3N36A 3J8F2 1C8M1 4XVHA 3ZFFB 1BBT2 2RS31 2UY9A 1WLWA 2D6LX 3PTYA 4S2HA 2BNNA 2VXJA 2HWD3 4XFAA 2XPJA 3ZSEA 4LT5A 1ZZ9A 2WKKA 4RQPA 1R1ZA 2DUOA 1AX0A 1CJDA 2HWE1 1LNSA 5T52A 1C4RA 4CCNA 4OZOA 2BJSA 2ZGLA 3GHNA 1HKDA 2VMIA 4NWVA 3RMXA 5AC91 1MQTB 2PXJA 1IPKA 1Y43B 4ZZ5A 3WV6A 1F8VA 4YVWB 3JXSA 4QDQA 1CPMA 3I8TA 1COV3 3FBMA 5IWFA 4LQRA 2RS32 2RMU3 5T5JA 2ZMKA 4OMDA 1A78A 1H1AA 1W90A 2D3SA 2HYKA 2JECA 1GV9A 2ZCWA 4IEUA 4KGGA 4LOSA 1S0EA 4HKLA 1KDMA 3FX3A 3OUJA 4HSJA 1LOFA 2D6KA 1F35A 1K5MC 4ARXA 4EE2A 5C6CA 1QJY2 3NMBA 2PQSA 4I02A 5ANNA 2QQPA 4UYBA 2C9KA 3N9PA 3AC0A 3VZMA 1LULA 1AUYA 1W8OA 3N7LA 1LESA 2IVJA 3R0RA 3VBHA 3T30A 1QU0A 2VOWA 1KITA 1WA4A 1WGPA 3GCXA 3HAGA 3O1VA 1RUE3 4BYYA 1EP0A 1AVBA 1UY1A 3PURA 4QB6A 5IK4A 1JODA 3D0SA 3DF0A 1RHI1 5I91A 1OHFA 1H6YA 4ZS3A 1JI6A 1JYXA 2XBO2 1SBEA 1W9WA 3MLJA 4ITCA 4Y20A 5K7PA 3ZMOA 1QMJA 2VZRA 5FY9A 2WA3A 1PO13 2Q5TA 3Q8FA 4XQ4A 1TE1B 4AAXA 1I5ZA 1EPZA 2KA3A 1F5JA 5FZGA 2CGPA 4XXAA 2VQTA 1RGSA 3WD5A 2VMHA 3M1HA 2JWPA 3PIJA 4NHLA 2QNKA 2V5YA 3GZAA 4GWIA 4G4FA 4RR3C 3S6PA 4JGYB 3ZXFA 4HFSA 1JOPA 1RHI2 2WWSA 1OVPA 4L8QA 2MNGA 4LUMA 2ARCA 5IFTA 4JCKA 5JMOA 4ISQA 4AFAA 4WV8A 2GMPA 3UT0A 4XTMA 1V6JA 3B3QE 3WVJA 2W1QA 1ACCA 3A4UA 2PMWB 2BOIA 4SBVA 2WIIB 3VBSA 2XKOA 1NA1A 2XJUA 3LPFA 4N43B 5IATA 5I0UA 5LRRA 2AGSA 5DZFA 3PNAA 1W9SA 5IK8A 2GMEA 3J9SA 3PVEA 1ND2A 1GMMA 3C3VA 4KBBA 4AHZA 2W1UA 3POYA 3I2KA 4RFT0 3K4AA 5FZLA 5T55A 5EIYB 2Q8CA 5A3UA 2ZXQA 4RHV3 2DF7A 4FTBA 1K3IA 3IDBB 5C8WA 4MLOA 1FNZA 3H50A 3V56A 5C71A 1AR83 4MHRA 2BU9A 2P34A 4LOTA 1J3QA 2JE8A 2VECA 5FPBA 2TUNA 5IAVA 1UZWA 5ANQA 3WDYA 2VMDA 2C0ZA 4C0BA 2UWAA 3MZHA 1XB9A 4R52A 5EQUA 2RR11 3AP7A 4Z2WA 2UU8A 3NAPB 2VW0A 5D8AC 4YPJA 4E2SA 1POV0 2BW8A 5FO8B 4FTSA 3CJXA 3VBRC 4AI0A 3NKTA 4IE5A 3V0BB 2H0BA 1DG6A 1MPXA 5FZFA 5LK5A 2TBVA 3ZYFA 2WS93 3D0JA 4FXGB 3TN92 3BPSA 4YM3A 3FN9A 3H1MA
chains in the Genus database with same CATH topology
4FXKB 1LOEA 4O9GA 5KHJA 3ZFGC 1SQ4A 3JB4C 5DUUA 2ZAHA 1O5UA 1X8EA 1WLTA 1N3OA 2HWF3 1RUJ3 1G6NA 1MS8A 2A3YA 2IZWA 2WQ4A 4DMIA 2I45A 1Q3EA 1TMF3 2UWBA 2W0XA 1LHOA 4ASMB 1HRI3 3B7MA 4DRRA 1CX4A 2VG9A 3PHMA 1VR3A 5JZGA 3WG1A 5C8CA 1CD3G 3DPRB 1BJQA 3UL2A 4XE9A 3ZPYA 1VBE3 3M3QA 3RI9A 3RYKA 5GLTA 1G9BA 1EV12 5FMOL 3WQ1A 2NMNA 1DZQA 5CB7A 2JEMA 1LGCA 1ZVFA 1JOJA 1GKBA 1SLTA 3MF9A 5H9QA 4EWAA 5KXBA 2D93A 2B46X 1XNKA 2XJRA 3SNMA 1PO23 2A3WA 3LZZA 2KM2A 2YGMA 4H55A 4KL1A 5CFCB 1LHWA 3RI8A 4RS5C 1A6CA 3S0MA 2DVDA 4XQDA 1S0JA 3R4DB 4XPVA 1CN1A 1VBB3 2YY1A 4E4ZA 4IV3A 4OHYA 3D6EA 5FLJA 4XHXA 2HWD1 3TNQA 1FOD1 4Q29A 1JUIA 3HT2A 3I7DA 3FLTA 4XF3A 4Q0VA 5K8SA 1QJU1 2RJKA 3B9IA 1UAIA 4PQ9A 5BNOA 2D7FA 4XF1A 2UYBA 3ILRA 3APBA 4CDXC 2JG9A 2IXLA 4AFMA 5FLHA 3TRSB 4BH9A 1X8MA 2WQZC 2HWD2 3AXEA 3FBYA 3OBTA 4JV4A 1APNA 1DYPA 2X29A 1K5MB 4O9EA 4YZ3A 1FOD2 4ES8A 3SCFA 3N7MA 1EY2A 4WVZA 5GZEA 2PAKA 1QJU2 2WINB 4FPOB 1NCRA 3AZYA 2FZ2A 2QZ3A 3CJIC 4B4QA 3SMHA 4IEWA 1S0GA 4I09A 2P37A 3IKWA 4URTA 2WNVA 1QWRA 5L7OA 1COV2 2YDEA 2VNGA 1MR5A 1VAVA 2XLGA 3AKTA 4CEWC 2O1QA 3VBFA 4Q1PA 4OHWA 4Y1VA 1OOPA 2CL2A 3CLPA 2ARXA 2AZ5A 3JD73 4XQWA 3JBG1 3JUUA 3IM0A 1SACA 4N9HA 1CIWA 3RZZA 1QQP1 4TSVA 2ZGPA 4FPGA 2ARBA 4PLOA 4IXLA 4FPJA 2Z2SB 4P9LA 3QLQA 4MX3A 4LBKA 1QH7A 1QJZA 4NVPA 2AH2A 2ES3A 3PJYA 1QY4A 4N53A 1QXJA 1GSLA 3BPZA 1WUVA 1PO12 3KD4A 1MS9A 1H4HA 5J37A 2VULA 4NPRA 3IDEA 1N3QA 4A7YA 4JQRA 4A2UA 3ZDSA 4LBNA 4YZ5A 3B69A 4IEXA 4Y5Z0 2NZ9A 2ZJCA 1ZA4A 1VBA3 2ZACA 1CAVB 4DY3A 4OUSA 1IOAA 2YPJA 2GC0A 1AR81 4KWKA 3USUA 2QFEA 4YGBA 3EBRA 3TBDA 4AVSA 1D2QA 4FQ4A 1FNYA 1L3JA 3RJ2X 5D8AB 1RUD3 3VBRB 4ASLA 4YARA 2NP0A 2DU0A 1ZREA 4IEPA 1W6PB 2RHPA 3M8LA 4WM7C 4RHV2 2Y0OA 4CDWC 3ZN5A 3ZFGB 1H1MA 5T5OA 3WX5A 1URXA 1AR82 1H1IA 3AXDA 3L9JT 2WLQA 5FRAA 3IIAA 4GH4C 3AP9A 2K0GA 3M70A 2HWF1 2IXKA 4ONUA 2R073 2VOVA 4AQ6A 1TNRA 2EVXA 1VBC3 4LHKA 3TB0A 4AE2A 5LRSA 2VMGA 3MIBA 2RS11 1W6MB 4XFIA 2ZGQA 1X82A 4FP3A 4PDWC 4W6XA 1ZZ6A 1Y7BA 4WM8C 2GU9A 2JG8C 2A73B 4JRLA 1MACA 1VBE1 5GALA 4RA0A 2HWF2 1RUJ2 1SLIA 1PVXA 5GLVA 4AI1A 3RWNA 1HXS1 1TMF2 2DCZA 2O8OA 4P9GA 5FPXA 1SCRA 5EFUA 5T50A 4XETA 2RS12 4BOWA 1XE8A 5C9AC 4RS5B 3MF6A 1YYNA 2ZX3A 1C5IA 1WMDA 4P5HA 4AFBA 4FOYA 4Q4Y3 3B94A 4KNCA 4OI1A 4AEMA 1VBE2 2OVUA 1HW5A 1KQRA 1YLLA 3ALQA 1E57A 1V70A 3MW3A 5F1RA 2ZBJA 3OY8B 5KC6A 2WNUA 1QJX1 4WVMA 5J98B 3TAYA 3KCXA 2OUJA 4LUKA 5ACA3 2ZX2A 2D43A 1PGL1 2DUQA 1PO22 4GMP1 3BODA 1UPSA 1ENXA 4MGZE 4YLZA 1NQJA 1W0PA 1W6NA 2JE7A 4CDXB 1XYOA 2Z69A 4RD7A 4CDQA 2AUYA 1VBB2 2X5IC 2BVVA 4HSLA 4HPKA 3H7JA 5DDJ1 4E4DX 4JDOA 4EN8B 4HETA 2WT1A 4XFBA 1AYM1 1B35C 4M3CE 2ZS6B 3IPVA 3AZZA 5BNNC 1JYCA 3FLPA 3CJIB 1VBD3 3ROUA 4WBBA 3VBUA 4BIOA 1PGL2 5FQ0B 4OI0A 1R091 2JX9A 4Q4X1 2VQAA 1VB2A 4AFCA 3VZJA 4CEWB 1DHKB 2IXIA 3E6CC 5I8TA 3WW2A 3CNAA 5DDJ2 3WXPA 1JBCA 3AKPA 2R16A 4LBQB 1AYM2 1RMU3 1AXYA 1UF2C 2GAUA 2ZGNA 4F7ZA 1YRZA 2BNOA 3JD71 2WJSA 5I0TA 1UIKA 4AF9A 2ERFA 4YW1A 1VP6A 1CAUA 1SLCA 1NY71 4XMIA 5KHKA 4Q4X2 1AR73 1BVVA 3IT8A 3MFCA 2VXRA 4IV1A 1ZX5A 4AEDA 2ZGOA 5KHIA 2XH6A 4NHKA 3U07A 3V65A 1AXZA 3JD72 4MXWB 2YMZA 2ZMNA 1BYHA 2WZR3 4LLFA 3D82A 4X8NA 1C8NA 1NY72 1ENSA 2YROA 1RUF3 2GSYA 1RUG1 2A71A 4PIZA 4P9XA 4S2DA 2R6QA 2D40A 1DQ0A 2E9QA 1FI2A 4AHWA 1DQ6A 5GLZA 1PMIA 3GZUC 4GXLA 4AG4A 4QM9A 3MPBA 1UZZA 3IMNA 4M3CB 3MIHA 4AGGA 1J3PA 2CWMA 2DCJA 2GNBA 1D0HA 4G9SB 3UKNA 2R32A 2A70A 4YFWA 4MUVA 1RUG2 4BWOA 3RJRA 2XB6C 2HWB3 3ES1A 3VKMA 1ZRFA 5JAXA 4OULA 2JJ6A 4Y1YA 3QCWA 1VBA2 3NO8A 2W39A 3B5LB 1CAXB 1N1VA 4GH4B 4YW2A 2OPKA 4Q4V3 3ZYPA 1G9DA 3BCWA 4YVSA 3S7EA 4L2NA 4KQ7A 4AGVA 1H8TA 3T2TA 1OQ1A 4D7YA 2H0VA 4XF9A 1YIPA 3O12A 4E2QA 4PDWB 4QT6A 5A3LA 4BMEA 1GFF2 3WHTA 1EAH1 2R1BA 2BNMA 3FUOA 4WM8B 2A75A 3ENRA 5CFDB 3ILFA 1DQ5A 2DVFA 1AL0G 2BWAA 2IFRA 1PNFA 2GC2A 1AL23 1DLLA 4Q8KA 4C91A 4YM0A 3OTFA 1DF0A 5L73A 1VBC2 5JOWA 1RUC3 2FZ1A 3NV2A 5JMCA 1OQEA 3U0ZA 5C9AB 2DV9A 4FCAA 4HVOA 4XW3A 5GZCA 4HKWA 3AYEA 1NCQA 2R041 5IUQA 3AMHA 4JTNA 1QH6A 3WQ0A 2XL7A 3ACLA 4LA2A 1ND3B 4BHPA 4KWJA 5K0UA 3ZX7A 3BIWE 3J8F1 4L97A 1H2KA 1Z78A 3A0NA 4HZFA 2ZKNA 3AKQA 3S7IA 5LK7B 1GZCA 4JGZA 1OFNA 1D0GA 1KS4A 1LR5A 4Q4W3 2GC3A 3ZYJB 2QJVA 1GQHA 1N3PA 1AF9A 1YUDA 2XL9A 1W6QB 2R063 1UU4A 4PLMA 1J3RA 1GICA 2X5IB 1Q5OA 3OD0A 1MEC3 4Q4Y2 1W6OA 1F31A 1POV3 4AI2A 2VW1A 3KGLA 1S55A 4PJYA 1HRV3 1DZRA 5DG2A 4Y26A 2I74A 4QPIA 5FO7B 4CDUC 4IEOA 1B35B 5JZGC 5C8CC 3SCGA 4M0NA 4P9WA 4XBLA 2HWC3 1FXZA 5BNNB 5DUWA 3ZFFA 4N7UA 3THTA 3E5UA 4I0AA 5T3NA 2BUKA 3WLUA 2AYHA 3AB0A 3AM2A 1QGLA 5I0SA 3H3ZA 1PIV3 3D8CA 1QJY1 1RUH3 3NW4A 3HIFA 2ZZJA 1LB2A 3RNSA 3EXUA 4WVVA 3WW1A 3VLBB 1C1LA 1RC6A 3WHUA 4FPEA 4IEZA 2YYOA 5BNQA 2PHFA 1MQTA 3R4SA 4DS0A 4AI8A 3ZXJA 1UD1A 3IN9A 4NN0A 4YVWA 1RMU1 4F3JA 5JR7B 1LHVA 2CAUA 4EN9B 5DZGA 1VAKA 3VHRA 2WFF3 2D3PA 2JICA 2VOKA 5J48A 1VBD2 4FPCA 2GALA 2R0HA 4LBQD 4NO4A 4EROA 2XJSA 4P9YA 1IQAA 3FMGA 2XBO1 1V9U3 4Z07A 1LOGA 3EO6A 4IETA 4JAAA 5BNOC 3WDVA 3WW4A 5JDBA 5DG1A 4IESA 3JZVA 3T1LA 1F2NA 5DZEA 5KXCA 1RUOA 1AR93 1ULFA 4XILA 1RMU2 4XFGA 3MLKA 3SCHA 3I54A 4QPGC 1G7YA 4KGQA 1ZBA1 2D97A 4R4ZA 5JPMB 1H2MA 3DN7A 1YJLA 4AGRA 2A7AA 1H30A 3AFKA 1DGRN 3RQ0A 1AR72 2CY6A 3WY6A 1VAMA 1XYNA 2WNVC 3ETQA 1NLRA 3S30A 2TNFA 2XVGA 4AVTA 2K9ZA 4D69A 2VU9A 4GWMA 1C1FA 1D4VB 3JU9A 5A33B 5L7OC 4LBMA 4QGNA 1YFUA 3KCYA 2VGDA 1WMFA 2DFBA 4J1WA 1N47A 4YW5A 1D4M3 1ZBA2 3LA7A 3SH4A 4JGYA 4Y1UA 3ZSLA 1RVF3 2KXLA 1W39A 3ZIWA 3Q9OA 4Y1ZA 2QE3A 2P3IA 1PVC3 3EQEA 3MI8A 3G6JB 2WT0A 5JWPA 4DY5A 2DVAA 1JUHA 2XJVA 3P3NA 5JSRA 1SLBA 2CAVA 1AR63 1H9WA 1Q8PA 4N43A 4EN7B 1RINA 2JD4A 5FLIA 3E5XA 4K1ZA 3AYCA 1BZWA 4E4SA 1KXGA 3M7AA 1PK6C 2Z79A 4BLIA 1M4WA 5BNPA 3TN91 5FBZA 4N53C 4M0HA 4JDMA 4Q4V1 4BQ1A 5JIUA 1MS5A 3DKWA 2PHXA 2EXHA 4L11A 1BK1A 5CG8A 3BTAA 2Q8OA 3UKTA 4FPHA 1YFXA 1GR3A 1NE6A 1I6XA 3SH3A 1Z7S3 3IWZA 5JPNB 1BKZA 3B9CA 3JB8A 3NAPA 3KQRA 5CG9A 3WOGA 3VUOA 3ZN4A 3V0BA 2XHKA 4R9AA 1TME1 3OYWB 4Q4V2 4FPFA 2AENA 2W52A 3LGRA 1REFA 5LEJA 2NMOA 3DV8A 1R083 1O3TA 2OZ6A 2CWSA 4FQZA 4GB31 1RUC1 1YCIA 1WD4A 1ZBE3 4PBOA 4HL0A 1EV11 4AEKA 1ULGA 2E51A 4Z82A 1FT9A 1JTZX 2GDFA 3LOBA 1H8VA 4L99A 2BFUS 2DVGA 3OPZA 4H14A 2BTVC 2PHTA 1TME2 4MGIE 2XUMA 1PZ7A 1LODA 3PVBB 3H8UA 2QCSB 4FAHA 1V6LA 3W59A 1AL22 3MGUA 5T54A 2JDZA 1LEDA 3PLQA 1RUC2 4GB32 4E2GA 3B00A 4XTPA 5IK5A 3R6SA 3LSEA 1HQWA 3ELNA 2D6PA 1HV0A 3H1WA 1UU5A 3B02A 2C5DA 3ZYIB 5B2GB 1POV1 4CDUB 2R49A 5CFCA 3HQXA 1IS3A 1LHNA 5HCBA 2P2KA 5FOJB 1LOCA 2EXKA 3BOWA 3OBRA 4YFZA 5GLUA 1H9PA 3U11A 2AR6A 4QQOA 2ZOEB 4Q4W2 5JSPA 3VZOA 3VN4A 3WNXA 4PLNA 2Y38A 2XVLA 2CNAA 2R062 4D7TA 1UU6A 4XFHA 4CP1A 1ZZCA 5HBAA 2VH9A 1QXPA 1HRV2 2D98A 3ZVXA 1RJ7A 2XVKA 4HK8A 1COV1 2DWRA 2HWC2 1WBLA 2RMU1 5H9SA 2PFWA 4QQLA 3L2YA 1NLSA 2SBAA 4YM1A 3PVOA 4KWLA 2Y26A 1K5MA 3VL9A 5ABJC 2R30A 4R9CA 4OI2A 4L92A 3GF6A 4K6BA 1RITA 4N9IA 2A6XA 4RSUA 3PVNA 4ES9A 1RUE1 5EV7A 3VKFC 2D44A 4QPGB 2RMU2 1UN1A 1X33A 4Q8LA 2D5FA 2RM23 1AZDA 1RUNA 3UJOA 2F6BA 2Y0IA 3AKSA 4YW4A 1FX5A 2YUEA 2ZGRA 4MV2A 1V9U2 1UL9A 1OLRA 1G9FA 4UW6A 4HN0A 3RMYA 1PO11 2MEV3 2ZABA 1AYN3 2B45X 2HEYF 2E7TA 5CIRA 4K9SA 3O0XA 4MGKE 4FOWA 3CF6E 4RR3B 4P9IA 4YRDA 1RUE2 5BUVA 2ZKLA 5JI9A 1S0CA 1HIXA 4XF4A 2ILMA 4D3WA 4FPYA 3K51A 4OLLA 1U12A 2BWCA 3RRDA 5FDBA 3N35A 2BQPA 1S0IA 1QNWA 4XBNA 1AR61 1XNBA 5I8YA 4ORFA 5T5LA 4K20A 3ZXAC 1J58A 1PK6B 1TEIA 2OYZA 1GQGA 3ES4A 4C0HA 1ASJ3 3MYXA 4RHV1 1D4M2 1FMD3 4R8HA 1RVF2 4XIOA 4YM2A 1XQNA 1CAVA 1MS3A 1LGBA 4XOGA 1ULDA 3AMQA 1PVC2 3IBMA 3X29B 4I3PA 3ZXGA 3E97A 2D6MA 1Q8QA 4Z8BA 1JW6A 3WDWA 4EV0A 1AR62 2BBVA 1ZZ8A 3ZMNA 3SH5A 4B7KA 2VQ0A 1AJKA 5D8AA 4LO7A 4JC1A 4GA9A 3VBRA 2PLV3 4OFGA 3N4MA 2XWBB 1QDCA 4D94A 1S2KA 1W6PA 2WS91 4Y22B 1IHMA 1QF3A 3WDUA 1MS1A 1DQ4A 2H6CA 2XKPA 3ZFGA 4INDA 3WCSA 4KU8A 2RS53 3ZSJA 3N3HA 1PGW1 2WC2A 5GLWA 4QGMA 2ZHMA 1CR7A 1PZ9A 2JXAA 1RUJ1 1REEA 3QACA 4EWEA 3GHMA 1V6OA 5I0RA 2A6WA 3ECQA 1GBGA 2AREA 1TMF1 4LO6B 1W2UA 5EJ3A 2Q1ZB 1LHUA 4D7SA 3C2UA 4I2OA 1HRI1 4UW5A 2WS92 1HLCA 1W6MA 2ZX4A 2WLPA 3QOPA 3L2HA 2P3JA 4HKOA 2QKDA 1OD5A 1PGW2 1XE7A 5A32B 1R082 1KFXL 1KFUL 3VBOC 2VOXA 3OGGA 3WP3A 5LEKA 1H8TC 1O4YA 1ZBE2 3ZXDA 2GC1A 3VHPA 2XJTA 3ZXLA 2IC1A 1UKGA 2B42B 1HRI2 3VZNA 2HKXA 1PO21 2LM3A 4CEYC 1WCDJ 1RTVA 4RS5A 3VHNA 4X6QB 2DTWA 5F5QA 1VBB1 1SEFA 2OA2A 1O3QA 3FUQA 1GANA 4RGAA 4DB5A 2DUPA 2YXSA 3MW4A 3WDXA 1SFYA 1SCSA 1CONA 5C4WA 1A8MA 2FHRA 5KWRA 1O91A 3LOIA 1UW8A 1MZFA 3OY8A 1NQDA 1WMEA 2EA7A 2F4PA 1ZRRA 3WW3A 4Q1RA 1ZYBA 1YNAA 1MZ5A 4PIYA 1LEMA 3FLRA 1IS4A 3OD4A 1A3KA 4A3XA 1VRH3 4XMAA 5K0UC 3URFA 1LOAA 1HDKA 3VDDC 2FQPA 5E89A 4COZA 4BLJA 1G9CA 3BU7A 3MIEA 4JGZC 1I9RA 3LA3A 5ABJB 1AJOA 3V0AB 1YO8A 4A7KA 3H7YA 3LAGA 2B7YA 1JYIA 3CJIA 1W6NB 3JCIA 4A7ZA 2SLIA 5FQ0A 4LO5B 5DUXA 1U5IA 5AFEA 3OGJA 4IEYA 1OI6A 3ZN6B 4XIKA 4LO4B 1C8M3 1LU2A 1N1TA 4CEWA 3ZFEA 3FZ3A 4XXPA 5J7MA 1ENRA 1IZ3A 4RGGA 2RS33 4BMBA 3HT1A 3QD6A 4OVEA 1OQDA 4LBQA 3KLSA 4AQTA 1NG0A 1PM7A 1C3HA 4J6GA 4RQPC 2YGLA 3WR0A 2HEWF 3AZXA 1IKQA 3VL8A 4XEZA 2HWE3 1CJPA 1N1YA 5FREA 1AYN1 1O4ZA 1GYKA 2BFUL 4YGDA 5F6LB 5AC93 1DU3D 1U5ZA 4W6WA 2E7QA 1I1EA 2G4IA 1HQNA 3E6BA 2ZA9A 4LBOA 3I59B 4YNIA 5BPXA 1H4GA 1FV3A 3P3PA 3KM5A 4CP2A 4WZCA 3OJBA 2E6VA 4ZKTB 2C9AA 4MXWA 2RJLA 3DUIA 3MPPG 4N7IA 1LOFC 5AFBA 1H0BA 5E1RA 1AYN2 2TEPA 1H2LA 1M06G 1MS4A 3SISA 1V6MA 2DURA 4GULA 3MDPA 4MSVA 1X36A 2VVDA 3VBHC 3JQWA 1SLAA 1FYUA 1VBA1 1RHI3 4CRQA 2ZMLA 1RUI3 1DGLA 4AI3A 1QHDA 3QBQA 1CAWB 1C28A 4GALA 1OFSA 1Y3TA 3G7DA 4GWNA 4Z92B 5FMOS 4OHXA 3M3OA 1RUD1 4BCUA 1NE4A 5GKAC 4WM7B 2B39A 2PLV1 1NXMA 1BMV1 3WINE 4DZGA 4CDWB 1BXHA 2LUWA 1FMD2 2QZ2A 3HMYA 4AYUA 5EWSA 4FSJA 1LU1A 5SV8A 1R1A3 1FATA 3T1MA 4BZ4A 1PHMA 1CAXA 1U0AA 5DXDA 1BVP1 4GH4A 1VJ2A 3IDCB 3WQ7A 3ZYGA 1FPN3 2PQQA 3VBSC 1NA1C 2R071 5J96B 1RUD2 1VBC1 3OF1A 2Q0AA 3HWJA 3ME2A 2PLV2 3LKJA 1ND2C 2YHJA 4OZXA 2WZPP 1BMV2 2DU1A 3SITA 3ZSKA 4PDWA 4XHBA 3RSJA 3H9AA 5BNPC 3TNPB 2E63A 3NV1A 3RPQA 2A6YA 2CTVA 1WW4A 1WD3A 2GNTA 2JG8B 4WM8A 1GZWB 3RS6A 5KC5A 3VBOB 4COWA 4YG3A 1OA2A 2WSVA 3WP6A 5CFDA 1B09A 4LNVA 4G3YC 5IT6A 2R072 3HN1A 2RR13 3AP4A 4AHXA 4Y4YA 2VVEA 3D4KA 4CEYB 2ATFA 3JQXA 5GZDA 3RG0A 5C9AA 3WP5A 3NAPC 4YZ2A 4HVRA 4Q2FA 3WG3A 3UJQA 1RB8G 2VVFA 2C1FA 4Q4Y1 1GZ9A 4IEQA 1IS6A 4CYDA 1QDOA 2PA7A 2GN7A 2XGXA 5J09A 1DFQA 1ND3A 3VZLA 3AMPA 5J3UA 1QOSA 3MEPA 5J36A 2DCYA 2NYYA 1SLLA 3U4XA 1X50A 1DGWA 5ACA1 2IXJA 4I0WB 2GNMA 5JOXA 4AVBA 1BEV3 1W6QA 2B5HA 4P14A 4ATFA 1SBDA 2ZGSA 4Q0QA 2X5IA 4YG0A 3KS7A 3VDDB 4U36A 2MHFA 1LJ7A 2DTYA 4XJ9A 2GN3A 1B35A 1EYBA 2A6VA 5FCCA 4XFCA 4COVA 3KCCA 1ZM1A 4DRVA 5FO9B 4DOUA 3POSA 3ZYRA 4AVAA 1VBD1 3ST7A 5EYYA 1RIRA 5ACA2 2ZHNA 4AW7A 2IXCA 1W6OB 5GM0A 2BYVE 2GZWA 3NJZA 4Q0PA 1CVNA 5FTTC 1VRH2 4AVVA 4BM8A 4AHYA 4IV3C 1W0OA 4C1WA 5JCTA 1YI9A 4DINB 4JVAA 4RQPB 1NOVA 2WL1A 1FOD3 1HV1A 1WBFA 1O4TA 1KJLA 2PYTA 2OW4A 1QJU3 3H3UA 4X8PA 4QMAA 4UBHA 1UX6A 1AR71 3B93A 2JKBA 3NV3A 3AYDA 4K1YA 4ZU7A 1REDA 4XJUA 5BV6A 5HI0A 1C8M2 4E27A 3AX4A 1SMVA 2PTMA 2JG9C 4XZPA 5KHGA 1LCLA 3O7OA 3M4FA 1KDKA 2D5HA 1UPIA 4TWTA 3ATGA 4J1XA 2CV6A 2VUAA 5EZWA 1S0BA 1OMIA 4MYEA 5H9RA 3KT4A 1KJRA 2WZR1 3M3IA 3CEWA 1NCRC 2HWE2 2QDNA 4EJRA 3CU7A 3KZ4C 4TYSA 1RUF1 2MPFA 2HJIA 3VBHB 4CZSA 5AC92 3ILNA 4K7JA 2O0OA 3TYJA 4U2AA 3NL1A 5A33A 3J26N 1ZRCA 2PELA 3VBFC 1IS5A 3ZXEA 1OOPC 1RUI1 4M3CF 4AEJA 4XYXA 4EN6B 4Y20B 3JBG3 1SDWA 2WZR2 3A0KA 4LE4A 2DCTA 4KG8A 1QQP3 4LHLA 1TNFA 1U5XA 3V64A 1RUF2 2DVBA 3AFGA 2PHWA 2QVSB 1A8DA 2WFPA 1QKQA 3ZIXA 2HWB1 3FHIB 5HCAA 1QOOA 4B4PA 1R1A1 1DBNA 4H7LA 1Z0HA 4QPYA 1RUI2 4COUA 2GH2A 3HR9A 5JIAA 5KHHA 4BIFA 3VBSB 1NA1B 2ZGKA 1VIWB 5FAXA 4NWWA 1FPN1 1WW7A 4LBJA 3O0VA 1OPMA 4YG6A 1ND2B 2HWB2 1XNDA 3USSA 1O5LA 1ZZ7A 5SV5A 3U10A 5BNPB 4R9BA 1R1A2 1S0FA 4B8EA 3PMSA 4MZUA 3NSTA 4QGLA 1AXKA 2XWJB 3AP5A 4AWDA 3WG4A 3OYWA 1YFWA 1AL21 1FPN2 3M2MA 4S2GA 1DIWA 2Z42A 3LSDA 3BALA 3KMHA 3MW2A 5KBFA 5TSWA 2X8KA 4XJ8A 4QQPA 2XJPA 5CU1A 3LB9A 4YGEA 2HEVF 5K9YA 2CYFA 1H2NA 4QQHA 2CGOA 4QD2A 2CGNA 3DPRA 4META 1C57A 2WNEA 2EF6A 2RR12 2BGCA 4Q4W1 4GQ7A 1O7FA 1XU1A 2RS13 1GNZA 1DGWX 2R061 3M3CA 1BEV1 2PN5A 1MEC1 2VUJA 2W08A 2ENRA 4MXVA 4YSFA 5JZGB 1HRV1 3SHRA 5C8CB 4Q0SA 4CDUA 3ASIA 2WT2A 2ZHLA 1GLHA 4RL7A 2WA4A 1J1TA 2HWC1 4NOTA 1OLQA 1X7NA 1XYPA 3KB5A 4OUMA 2P17A 3DGTA 1HXS3 1GNHA 5E16A 1LECA 5D1IA 1PIV1 1LGNA 1RUH1 2Z5WA 2UWCA 3MIGA 1BEV2 3FFQA 3VGIA 1MEC2 5I93A 4IV3B 3TOJA 4YW3A 2R0FA 3GNEA 2JE9A 1BQPA 4DNYA 1XU2A 1IPJA 1KD7A 4NHMA 3WUDA 5C4WC 4UXAA 2WFF1 3R4UA 2ZGUA 4QU2A 1O3RA 4FPKA 2UY8A 4COYA 1OPOA 4UBGA 2WNUC 1QJX3 3W9AA 1V9U1 1PIV2 5CADA 1RUH2 3KSCA 2E53A 5BNOB 1U5YA 4GMP3 1OKQA 1Q8SA 4MH0E 4DPNA 3AZWA 5CVRA 2VPVA 4LEJA 4CDQC 4HMZA 2JG9B 1AR91 4KH9A 3LCPA 5DDJ3 4CP0A 2DFCA 1AYM3 4QPGA 1G8WA 2WFF2 3K48A 1D2SA 1NYWA 1QOTA 1NCRB 5JLVA 3GZTB 1UIJA 3MIFA 4M00A 4Q26A 5BXXA 3VBUC 1VB4A 2WNVB 4I3GA 1R093 1UCXA 4LO8A 5E8A