2JEMA

Native family 12 xyloglucanase from bacillus licheniformis
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
232
structure length
232
Chain Sequence
ASSSNPSDKLYFKNKKYYIFNNVWGADQVSGWWQTIYHNSDSDMGWVWNWPSNTSTVKAYPSIVSGWHWTEGYTAGSGFPTRLSDQKNINTKVSYSISANGTYNAAYDIWLHNTNKASWDSAPTDQIMIWLNNTNAGPAGSYVETVSIGGHSWKVYKGYIDAGGGKGWNVFSFIRTANTQSANLNIRDFTNYLADSKQWLSKTKYVSSVEFGTEVFGGTGQINISNWDVTVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Characterization and Three-Dimensional Structures of Two Distinct Bacterial Xyloglucanases from Families Gh5 and Gh12.
pubmed doi rcsb
molecule keywords ENDO-BETA-1,4-GLUCANASE
source organism Bacillus licheniformis
molecule tags Hydrolase
total genus 71
structure length 232
sequence length 232
chains with identical sequence B
ec nomenclature ec 3.2.1.151: Xyloglucan-specific endo-beta-1,4-glucanase.
pdb deposition date 2007-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01670 Glyco_hydro_12 Glycosyl hydrolase family 12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2jemA00
2DCYA 3AMMA 3LGRA 2BWCA 1XNBA 3WT3A 1UU4A 1H0BA 3HD8B 3MF9A 2D97A 1KS5A 1XNKA 2VG9A 1QH7A 3B5LB 3MFAA 3VHNA 3M4FA 1IGOA 2B42B 1OA3A 5K9YA 1OA4A 1YNAA 4HKLA 1OLRA 3VZNA 1HV1A 1W2UA 2B45X 5K7PA 3VHOA 1NLRA 3B7MA 4XPVA 1UU6A 2DFCA 2VULA 4XQ4A 1UU5A 4S2FA 4S2DA 1C5HA 3WX5A 3AKPA 3LB9A 2D98A 4HK9A 4IXLA 3VZMA 4XQDA 1REDA 1KS4A 1XNCA 1XYPA 3AMHA 1T6GC 4HKWA 2BW8A 3WY6A 3WQ7A 3WXPA 1UKRA 2C1FA 3AMPA 3WP4A 1HIXA 4XQWA 3WP6A 2JICA 1BVVA 2B46X 3MFCA 1H8VA 3WP5A 1REFA 1AXKA 1H4HA 1H4GA 5EJ3A 3VGIA 1XNDA 4HK8A 3WR0A 2DCKA 2BWAA 4HKOA 1ENXA 1H1AA 3AKSA 1TE1B 2JEMA 3WQ0A 1F5JA 2VGDA 3AKTA 4S2HA 1OA2A 1XYNA 1HV0A 3WQ1A 1C5IA 3AMNA 4S2GA 5HXVA 3RI9A 3VZLA 4H7MA 1BK1A 1PVXA 1XXNA 2NLRA 3AKRA 3VLBB 3ZSEA 2DCJA 2Z79A 3VZJA 2DCZA 3MF6A 2VUJA 3VHPA 1BCXA 2DFBA 1REEA 3VZOA 2BVVA 2NQYA 1OLQA 3RI8A 3VZKA 3VL8A 2F6BA 4NPRA 3WP3A 3O7OA 1XYOA 2QZ3A 2JENA 1QH6A 3EXUA 2QZ2A 3AKQA 3VL9A 3AMQA 1M4WA
chains in the Genus database with same CATH superfamily
1COV1 1WMFA 2FCUA 2C9AA 1W39A 3E6CC 1AYM2 3LFMA 4I30A 5LASA 2ZXQA 1WCKA 3LA2A 1O8SA 2W1WA 4IGPA 2VE1A 4YW3A 4I09A 3R4DB 3VBOA 1YQ2A 3SH5A 3K4DA 4E2GA 5A6ZA 1D4VB 4FOQA 4QPGB 3DKWA 2ZGNA 1HX6A 5EHDA 5FV3A 5JPNB 5FDBA 3BPZA 4N43A 1ZA4A 3A0NA 4QMAA 4Q4V1 2Y64A 1ND2C 1WLWA 3J8F1 2ZGLA 5CFDC 4EQVA 1W0PA 4J25A 4XCBA 5FXVA 4FT8A 1HJGA 5FZLA 4CCMA 4LNVA 1US3A 2JDMA 2ZX2A 1Z7S2 2JDKA 5GM0A 3WX5A 3K77A 3ZYGA 5JR2A 4LA3A 3ZXFA 4IXLA 5CFCC 1PO12 1GMMA 4V1PA 4V2WA 1LOBA 1X82A 1YQCA 1OPMA 5KXBA 1NT0A 2A3XA 1BK0A 4E4HA 1T6GC 1W6MB 1R1A1 4M0HA 4CYDA 4HPKB 4CP9A 1EUUA 3MPPG 4YG3A 1KFUL 2J1EA 3WW4A 3RMYA 1D2SA 1MZ6A 2OYZA 3WXPA 1ZREA 1W6NA 2D3PA 3DYPA 1ZZ8A 4TXWA 2BYVE 1J59A 4FAHA 3CDZB 2HBTA 4E27A 5IK5A 3VBOC 4D0QA 1CJPA 2ID4A 2JKBA 5LBFA 3I3MA 4WV8A 5A6QA 1S0JA 3I3DA 3TRSB 5FQ0A 3VGIA 1C8M3 3PLQA 5FMDA 2QNKA 2ADDA 4P08A 2H6CA 2JDAA 1KEXA 5A3TA 4XFBA 1EV12 4UOJA 1H2MA 3GCXA 1OLMA 4JGZB 1UNBA 1H1AA 2ZX1A 1V6JA 4CSWA 1DYPA 2EIBA 2JEMA 5A7SA 2VVFA 1RUE3 4KBBA 3UESA 1MS5A 5CG9A 1HRI2 1V00A 5FY5A 1Y3TA 3O1TA 1MZEA 1YQ6A 3UNPA 3FHIB 1B09A 3BTXA 2OS2A 4ATFA 2WYSA 3SQOA 1U12A 1YHFA 3RI9A 2Q4SA 3SCHA 2WFF2 3E5UA 2XWJB 1XXNA 1SLBA 4RQPB 1U5YA 5IAXA 4PT6A 2CAUA 4HVQA 2CHHA 3MO4A 4YM1A 2DCZA 1ASJ2 1W6OA 3O1PA 2B8MA 4LXLA 1UKGA 3PUAA 3DKQA 1FXZA 2HWB3 4TN7A 2H6BA 2UWBA 1FT9A 1N3QA 1CX4A 3I4IA 5DUUA 5LEKA 2JDZA 3H7YA 2RS53 3EMRA 1KD7A 2W46A 2DVGA 5LA9A 1UPSA 1CAVB 2JE7A 5FZ1A 4BDVB 5BNPC 4XMIA 2F6BA 5FPLA 3KV9A 3MLKA 3NRUA 3AVSA 5FPBA 2WFPA 5FCCA 3ZFFA 5GALA 2D3RA 1OI6A 5FTTC 3D0SA 1AR62 1JMUB 2QQMA 2ZKLA 5IT6A 4QB1A 4YARA 1GZ9A 3B94A 5A1LA 4PF1A 3IIIA 1XC6A 3WF4A 4Y1VA 2HWD3 4XF1A 1OFSA 1RUE1 1Z0HA 3A0KA 1MS9A 4BIFA 1QH7A 1Y43B 1Y9GA 2DTYA 1VBE2 4G3YC 3LEMA 3POYA 5FJKA 3SISA 4HN1A 4CEWB 4WM7A 1OOPB 2CU5A 4AR2A 1FATA 4V2VA 5FYBA 3OPZA 1YNAA 1LKNA 4HKLA 3BI3A 2CNAA 1H9PA 1X9PA 3GXUA 4IEUA 2A75A 1RUD3 5IFTA 1NLRA 2Y26A 3RMXA 1SFYA 3HN3A 2W92A 4LBQA 1ACCA 4HN0A 4SBVA 4XQ4A 1IKPA 2HWC2 4QWNA 4S2FA 5CKQA 3DECA 1SLTA 4NWVA 5EWSA 4R9CA 4CCOA 2RS51 4CUCA 3ZLIA 2QBXA 3LB9A 1V6NA 4MV2A 3U78A 4NHLA 3C7GA 2O8OA 1CONA 3NNLA 1DIWA 5JMOA 3ELNA 1OKQA 2YG0A 1CZTA 1ONAA 2ZAHA 3HQRA 4KI5M 3ILNA 2R043 2V73A 2W91A 4MXWB 2RJKA 2TBVA 1Q3EA 5FK8A 1NCQC 1WGPA 4URTA 1UPIA 4MH0E 3ZYRA 2DVBA 5FPAA 3GALA 3NV3A 2OQ6A 4BLJA 1ZRRA 5JVVA 1XQNA 5C8CB 2HWD1 2D7FA 3B9CA 4IV1A 3UK9A 1X9TA 1BLZA 4CUAA 3HNYM 4EWDA 5CKNA 4ARXA 3KHCA 1GWLA 3H1WA 4QX1A 3KCCA 4LJHA 3UKVA 3UKTA 5KHGA 2BGCA 3E6BA 4AVBA 1H4HA 2YC2A 4NHYA 4CRQA 1UYPA 4PJYA 4AI8A 2XR4A 2Y6HA 4JRLA 5ANNA 3K51A 3SC7X 5FZ8A 1QMJA 1W90A 3Q8BA 1AYM3 1ALYA 2EIEA 1HB3A 1GSLA 2G9ZA 2XLAA 3VDDA 4O65A 4PBOA 1TE1B 1RUD1 2VMFA 3NNGA 3VKNA 1E5HA 1YLLA 2WQ4A 5E6HA 2X29A 3J9SA 5DZGA 1MPXA 1QJZA 4A44A 4RS5A 4X6RB 1RHI2 5K8SA 3I3EA 4D6SA 4WVVA 3C7FA 3DXUA 1WD3A 2AGSA 3MICA 2HH9A 4AI2A 1UMHA 5FMOL 4OQ9A 4D69A 1RL3A 4NHKA 3CBNA 2R041 4DB5A 3VN4A 3ZDVA 1PNGA 5JCTA 5FLHA 3PVOA 2LRPA 1WW5A 1AL0G 3D82A 2JG8A 3IT8A 4CEYC 5F7UA 4NAOA 5I8TA 1UZZA 1OSGA 1R093 1OF4A 4ZU4A 1ULEA 1Z7S3 2JG9B 5DQ0A 3TB0A 1PK6C 3VHPA 3P3NA 5K0UA 3DPRC 5LATA 3IWZA 1DU3D 1PO13 3PUIA 4C90A 5FLIA 1UYYA 3WW3A 4AFDA 3U75A 2WABA 3HQXA 5C4WB 3AP7A 4MADA 2VMGA 2X8KA 3ACLA 2QZ3A 3ILRA 3PU8A 4FPFA 4Q4Y2 2BBVA 3KVAA 3KZ4C 4BIOA 1S2EA 3U4XA 1M4WA 2P3IA 4KGGA 4Q2FA 3FBMA 4MG2A 1EPZA 1SMVA 5A3OA 1F8VA 4IV3A 1AYM1 4JRAA 1AF9A 2XXZA 4LPLA 3ZYFA 3ACGA 1O4YA 2QQIA 3D4KA 1HQWA 4CDXC 5FPZA 4CDQA 2B9VA 5BPXA 5FMBA 1SDDB 1CJDA 3A22A 2OT7A 3VHNA 2PQSA 3PVEA 4NE9A 3K46A 2Q5TA 4YM2A 1BKZA 1OH3A 2RJLA 4FVVA 4IETA 5DZFA 5FZOA 5L7OA 2VBPA 2XPJA 1EV13 1XU2A 1UOBA 5FYYA 2OVUA 3HIFA 5F32A 2H0BA 5JOZA 4XXPA 5J37A 5DAQA 1WKYA 3VBRC 4D6QA 2JG8C 4A6SA 4MUVA 5C9AB 2A6VA 4TZDA 2LS6A 2Y0OA 3SXWA 1C28A 1RB8G 3N3HA 1ULFA 5BNNC 2B7YA 2QTWB 2J1SA 1HRI3 1Z7S1 5I91A 4Q8LA 3USUB 3N9MA 5K0UC 3ZN6B 3W59A 1W6QA 1PO11 3C7OA 5CIRA 2YDEA 5GLVA 1ND2B 4J6GA 4YW5A 4GKYA 3RSJA 1NE4A 1DGLA 1ZRIA 4EN7B 3T0BA 2JXAA 3AZXA 4DO0A 1PVC2 5E16A 1VIWB 4HANA 2DTWA 1ASJ3 2PELA 5CFCB 4IV3C 4KWLA 4XILA 2PFWA 4NUBA 1Z78A 1HDKA 3K75B 2ZZQA 1CPNA 5IUQA 3KQ4B 4XQWA 3BKZA 4PBPA 1O3RA 2ZX0A 4H55A 1RXGA 1O3TA 3I2IA 2RDQA 3NL1A 3NO8A 1RGSA 1PGL2 2WO3A 4X8NA 4JDMA 3NJZA 3MV01 1UX7A 1UYXA 2XJUA 1AR63 2WNUB 4M3CA 4N9IA 1EV11 4XJWA 2WBKA 2WA3A 3PJYA 5JXIA 1J84A 2YV8A 3IDCB 3PIGA 1ZZ9A 3WVJA 1C1FA 2UWCA 1Q56A 4Q0SA 5IK8A 1OVPA 4QM8A 3VBFB 4YM3A 5F3EA 4RR3A 1UWWA 3RDIA 3IDEA 3ZM8A 1HRI1 2XKOA 3HEIA 4B1MA 1VBE3 2NPIA 3T2PA 1C57A 5A6XA 1O3SA 2J1VA 3AM2A 5DXDA 4IW3A 4IEXA 4TWTA 4O7XA 2R1BA 5IFPA 4XC9A 4FXKB 5LY2A 3H0OA 1UN1A 3ACFA 2VOVA 3C8XA 5GZEA 3ZVXA 1S0FA 2YMZA 3VKLA 2CWMA 3UT0A 4ZZ8A 1VMJA 1HKDA 2BERA 2C4XA 1ENSA 1ASJ1 1RITA 2WAAA 5LEJA 1W06A 4MGTA 2VW2A 2HWC3 2WQZC 5K4LA 2DFBA 5A7WA 1RUG2 1L3JA 4QPGA 1AZDA 1RUF3 3NAPC 2VL4A 1JYIA 2VMIA 2RE9A 2GH8A 2QDRA 1I5ZA 1UF2C 4Y4RA 5JR7B 1LHUA 4CP2A 2ZMLA 3KF3A 3LWCA 3PHMA 4TLFA 5FYMA 5HV4A 2ZHMA 1GOGA 1AR61 3MW3A 5FFOC 5SV5A 4LBJA 3ROUA 3WEZA 4OI1A 1BXHA 4DFSA 3C7HA 4N90A 2GZWA 3WNNA 4Y26A 4HMZA 4C0HA 3KHBA 1UX6A 2EXJA 1UU4A 1O59A 4ZHNA 3PJQA 2XBO2 5A3MA 1VBC2 1CN1A 4GQ7A 4AQSA 2VOKA 4OI0A 1JYTA 2E7TA 1VBE1 3B5LB 2VXJA 4JX0A 1G9DA 3R0RA 3RJRA 4CP1A 2MEV2 5CB7A 2B42B 3IPVB 4MX3A 4HPKA 4DOUA 1HQLA 1OA4A 2YBPA 3B93A 3SCGA 1JZ8A 1ENQA 2J42A 3ZSMA 3Q8FA 5T55A 2J7MA 2ZHLA 1AJOA 1HV1A 3MV11 1LRHA 2WS93 5FXWA 4C0BA 3MIEA 2RG4A 3VHOA 4W6YA 2UURA 3RYPA 4M4RA 2QQKA 2HWC1 2YPDA 1RHI3 1CAXA 1MR5A 2VZRA 1KDKA 4PI0A 4QPGC 1C1LA 3KM5A 1RUI2 1X36A 1AR92 1I3HA 3R4SA 5DDJ2 5L9RA 4BWOA 2TNFA 1JOJA 4XHBA 1XNCA 1UAIA 4XOGA 4IE7A 2IXJA 4JKMA 4NAMA 5T5PA 1VJ2A 1ULCA 5D1IA 5FAXA 5EPAA 3AJZA 3SEPA 1HB2A 3CIHA 5FP7A 5BUVA 1HRV2 1IOAA 2X10A 4QPIB 4XEZA 1YI7A 4Y20B 2QDNA 3MZHA 2OUHA 3LDRA 1YJLA 3MIBA 3QOPA 3ZDSA 1RMU2 3OG2A 4HONA 1BVVA 1PZ7A 2EICA 5FY8A 2FBEA 2JE8A 1NCQB 3OUIA 1H8VA 3P1IA 2OZ6A 4OHWA 5JOWA 2WO2A 4LE3A 1YC61 4AI3A 4GA9A 2WT1A 2QQJA 3ZIXA 4Q4Y3 3H8OA 5FP3A 3N7LA 5G05L 4ZPIA 3MBWA 4QX5A 3ZO0B 4IE5A 3SNMA 3S5QA 1STMA 3C2UA 2ZGTA 1ENXA 3BALA 5IHRA 4HOOA 4LHNA 1VBB2 4AAXA 2VQ0A 2QQPA 1EAH2 3WDUA 2PAMA 1RHI1 3MW2A 4B4RA 1DHKB 2RHPA 1CAWA 3W5MA 2PHLA 4N8MA 3HN1A 3WQ1A 3P6BA 3I7DA 1BQPA 3I49A 3MGUA 2R072 2VZQA 3BCWA 4W8JA 1W8TA 3KVBA 4JGZC 4A2UA 4YZ1A 4YW7A 1W0OA 3ZSLA 1UZWA 1DYOA 1NA1B 1YFUA 4META 2ZMNA 3V64A 5EFUA 1ZA7A 2QQUA 3D5OA 3IMMA 2WWUA 4XBLA 3UKNA 2BU9A 2HLEA 1QXRA 1OOPA 2BVVA 4CEYB 1RUNA 5FZ7A 2C6SA 1BEV3 5LCWL 3J7MA 2VW1A 2P3JA 2JDPA 1CIYA 4RQPC 4LHKA 5DN2A 4Q4Y1 1X33A 3J7HA 5JWPA 1YQ5A 4K1YA 2HEYF 2VZVA 5F5AA 1F9KA 2DCYA 4QQLA 3O1SA 2UU8A 5CYYA 1CQ9A 2WJSA 5J09A 4LBKA 5FYZA 4FPEA 2RV9A 2WAOA 2JWPA 1WA6X 3AVRA 1LB2A 2VMCA 4GXLA 4K3UA 4K8RB 3CKHA 3GGLA 5JI7A 2ARAA 4CU9A 1GV9A 4MXWA 3TNPB 1JZ4A 4XUPA 2E26A 5K9YA 3H42B 1QOSA 1UY1A 3H3LA 3HT1A 4CDXB 4DY5A 3OBZA 1YQ8A 3IDBB 1F31A 1UY3A 3I2GA 2Y6FA 4RGGA 3WG3A 2YHJA 5C8CA 3THTA 2DVDA 2D5FA 3NQHA 1JXNA 1SLIA 4AG4A 1EYBA 2ET7A 1SHWB 4WM8A 2ZTNA 3MW4A 5EP9A 3UGFA 2HEVF 2OA2A 3LKJA 4RL7A 3AKPA 5FZFA 2WSUA 4CEWC 1C8NA 2ES3A 2VOWA 2Z5WA 3KV6A 4GMP3 3SKVA 3VBRB 1HLCA 1PX3A 1X7NA 4R4XA 2GMPA 1W8OA 1W9YA 4P9LA 5ABJB 2ENRA 3BYWA 4EN6B 5A3NA 1PVC1 1OD3A 4NIHA 1FAYA 5FYHA 1F2NA 1RC6A 1X8EA 1ZBA2 2XUEA 3FZ3A 5FZKA 3J26N 5IYYA 3CLPA 1JYCA 1UKRA 3KGLA 4I0WB 4ISRA 3G6JB 5CAZA 1NXD1 2D6NA 5FY1A 3ON7A 1RUG3 3SH3A 1E5IA 4JTNA 3TAYA 4DXZA 1X8MA 4EJRA 4HETA 4QQOA 3DYOA 4RFRB 2BNOA 3GF6A 3R4UA 3HPNA 5JZGA 2IWGB 3GZEA 4K20A 3WUCA 1PGL1 4BQWA 5KR7A 1G9AA 4QX3A 5I0RA 4UF0B 1D4M2 2VO5A 3WF0A 2DU0A 2D3SA 4ORFA 2BWAA 3WDXA 1Q8PA 2A3YA 4M4PA 4N7IA 3RNSA 4XIOA 4N53B 3KD4A 1W8ZA 3D3AA 4Q4X2 4NRQA 5LZ6A 3AKSA 3OOXA 5JSPA 1AXZA 3LEIA 2HEWF 2P34A 2ZHKA 5D8AB 4UFMA 2XBO3 2A3WA 4IDZA 1VBC3 5IVYA 3WQ0A 4KWJA 3RFRA 3HNBM 4XUTA 3BOWA 3ME2A 4S2HA 2F4PA 1MQTB 5C4WA 4BM8A 4QQHA 4PIZA 3WNKA 2W52A 4GMP1 4E4ZA 2VZOA 4B8EA 4E4DX 5C6CA 1HN0A 5A3LA 1IKQA 4MYEA 3DEMA 4IERA 1LU2A 4JQTA 4YGBA 1V0AA 1PHMA 1XE0A 4IGOA 3ZOIA 1AVBA 5A33B 2IXHA 3B9IA 3N9NA 5JMCA 3JQWA 3AFKA 2YYOA 3EO6A 5T5OA 2VBDA 5JSRA 1PMHX 2GP5A 2VQTA 1JODA 1SACA 1WMXA 1CVNA 4J1XA 4QXBA 5T5LA 1LNSA 4BJ0A 4ZU7A 1RUG1 5KC5A 4ASLA 2VOTA 1RUI3 3Q9OA 1UMZA 4BXSV 3V0BA 2B4KA 4DNYA 4XF3A 3VL8A 4P5HA 1K42A 1MS3A 1MZFA 4QXCA 1UZ0A 2NMNA 4OHZA 3VDCA 3EHKA 4Z82A 1GUIA 3U1XA 2JENA 3FBYA 5A7NA 5IVBA 4BHPA 1US2A 2JKXA 2OQ7A 4I01A 4QHZA 1HRV3 4BISA 3AMMA 4JDNA 1WCSA 5GZFA 3RZGA 2JG9C 1AL22 4W50A 2OXBA 3USUA 2VU9A 1LGBA 3UL2A 3ZN6A 4Y1YA 2OUJA 4ZZ5A 5J1XA 3MLLA 2D97A 2XBO1 4Z2WA 1VBC1 1ND2A 4XE9A 2VG9A 4Y1ZA 5DG1A 5CFDA 4DY3A 5C4WC 4IEVA 2MEV1 3INAA 3ALQA 1CX1A 2YC0A 3PU3A 1OH4A 5FLJA 1OVSA 4DINB 5CFCA 2RR12 4LHLA 2WZEA 2WO7A 3FLTA 4FP3A 4ATEA 1JBCA 5LK7B 4U36A 1VBB3 3N36A 2QUOA 5DUWA 1OUXA 4EWAA 5K7PA 5KXDA 3F2ZA 1CESA 1EAH3 4LO4B 4CCEA 3IDAA 5FWEA 5AFBA 2FMYA 4HXCA 1RUI1 3PNAA 1AR91 4Y5TA 5DDJ1 5H9PA 4Q8KA 4Y1UA 2D98A 2YGMA 4XBNA 4XQDA 1A78A 4AFBA 2VTXJ 1F4AA 2R073 1PZ9A 5GLUA 5F1RA 5JDBA 3W9AA 4OHVA 3K3NA 5C70A 1ODNA 2RS12 4WVWA 5F5QA 2D6MA 3VD3A 5C9AC 5F37A 4E2SA 1N3PA 1HRV1 2BBAA 3J7NA 4FPKA 1UQXA 2VM9A 3VKOA 1H9WA 2XJQA 1GQHA 3JBG2 4D7SA 5C3QA 5LY1A 1RUC2 3WNMA 5A32A 3AFGA 3PMSA 4JC1A 2G9FA 3ZXGA 3H3ZA 3S0MA 1DQ6A 5I8SA 2EA7A 2YU1A 2PTMA 3W5NA 3LAGA 4P9IA 3U07A 1EPWA 5HPOA 4Y1XA 3AJYA 1T6BX 2V5DA 1L7QA 4UFKA 4XYXA 4AGGA 5C3RA 1YWKA 4C91A 1RVF2 3MIFA 1J3RA 1NAEA 2E51A 5KHHA 4GALA 1JUIA 4K40A 4I0BA 1IPJA 2KXLA 2LM3A 5LA0A 5HV0A 3FC0A 5B4XA 1BYHA 1Q5OA 2HBUA 5DAXA 4NJ4A 1VBB1 2W1SA 3CMGA 1V6OA 5FYSA 5F8PA 4A41A 4MGQA 1WLCA 2BQPA 3WQBA 1EAH1 4OYUA 4U2AA 5FKCA 3AL5A 4LO5B 1POV0 3S57A 3ETQA 4CA9A 2ZHNA 2W1UA 2WNUC 3LSEA 4G9SB 1Y9QA 2ATFA 2R071 3VBHB 5LA1A 4LA2A 3NW4A 2ILMA 1O4TA 2RJ2A 3OUJA 3PTRB 5BNPA 4AXOA 1IG0A 1GZWB 1N1SA 4GWMA 1W8HA 3VBFC 2CTVA 2DVFA 2NYYA 3H1MA 4MHRA 3VBSB 2JB4A 4CU7A 2GALA 3WDWA 1DP0A 1GP5A 5E89A 3PL0A 1U5XA 3G7DA 1J83A 3JB8A 3RYRA 3VZOA 5T50A 2P6CA 3IPVA 5FO8B 5FBJA 1V6LA 1YO8A 1BBT2 2X5IB 5F5CA 1W8NA 2BDRA 5F6LB 3O7OA 4LR4A 1JUHA 1AX1A 1WBLA 3A4UA 1QH6A 5F3IA 1PMIA 1HB1A 5CG8A 4YSFA 4AI1A 1W0NA 2YUEA 3LEKA 4AI9A 5FOJB 4EN9B 5I8YA 1LTEA 2VMDA 3CJXA 3KCYA 2GU9A 4OHYA 3AK0A 2QQNA 1S55A 2QE3A 4SLIA 4HSJA 5IK7A 2ARXA 3VUOA 1QF3A 3MFAA 2IXIA 1YUDA 3IAPA 4B7KA 3BODA 1D4M3 3GBFA 3GZAA 2GC0A 2QJVA 1IS3A 3W58A 3RZJA 1YIFA 3M70A 2UY8A 5FZ6A 4RD7A 3O1RA 4Q4X3 5CEHA 2GAUA 2PLV2 1NY72 2VVEA 3FFZA 3KF5A 4MGYE 3VZNA 4OULA 4DIQA 4XIKA 4CCKA 4P9YA 1BZWA 4IE6A 3ZFEC 1GBGA 1UD1A 4WVMB 2WQ8A 2DUPA 4AFAA 1NCQA 3OGVA 4DXRA 5T54A 1UU5A 3POSA 2CL2A 2AACA 2XVLA 1QOOA 1IZ3A 5GLZA 4Z07A 2XJPA 1GWKA 1Q8OA 2ZGPA 1NCRB 4QHBA 4XAAA 3BTZA 1W2OA 1GLHA 3THDA 4FFIA 2WA4A 2ZKNA 1XYPA 3P5BA 1A34A 3I8TA 2E33A 3R6SA 1ZX5A 4L8QA 5DPNA 3N4MA 4XMAA 5JIAA 2G9GA 1ZBA1 3I2FA 3HNMA 5EXOA 2BW8A 3VD7A 4PQ9A 2WWSA 3AXDA 4RYDA 2NMOA 4Q1PA 1LR5A 2AYHA 2VCMA 3RWKX 2ZMKA 4W6XA 3TNQA 1N1YA 4KU8A 4MVTA 4AZZA 3ZXDA 2B9UA 1XBFA 4F7ZA 1XOYA 5FUNA 2ZZJA 4X8PA 5GLTA 2DBIA 2R7EB 1DQ4A 1S4CA 2ET1A 3O1OA 1GANA 4JAAA 1H4GA 4M3CF 4LQRA 2ZGRA 1D4M1 4KNCA 1XSRA 3EYPA 4HKOA 2BUKA 2Q0AA 2HYKA 1NA1A 4YW1A 4QPIC 1DLCA 5HCFA 3MIGA 4Q4X1 1AL23 4XBQA 5B2GB 2ZX4A 3VB9A 3ES4A 3OGGA 1CPMA 2IC1A 4BYYA 2J1UA 1H6YA 2ZS6B 1OFNA 4GWJA 5CKMA 5A80A 4CEYA 4BOWA 2VGDA 3AKTA 2K9ZA 4AVVA 4AW7A 1PM4A 3NSTA 1QJEA 2A6WA 5CNAA 2W95A 2VZTA 3APBA 2ZA9A 1H8TC 1PK6A 2WLPA 4FPHA 1Q8SA 3DPRA 5DAVA 2F4LA 3I97A 4ZKTB 3S6PA 2E31A 3AYDA 4OVEA 1Q43A 4QHOA 3TN92 1NX9A 3SH4A 5FZAA 3JXSA 1W2NA 1UOFA 3N7MA 3SITA 1NOVA 3T4HB 3BN6A 1BCXA 3O0VA 1K5MB 2P3YA 4XJAA 4OI4A 2CDOA 4YW6A 4BK4A 4G4FA 2FDKA 1DDLA 1W6PB 4NIGA 4CDXA 3RI8A 2HWF2 5FY0A 1S0BA 1UCXA 1GNYA 4K6BA 3WP3A 2A6ZA 1W9WA 2VJXA 2E63A 3FLRA 4HVOA 2ARBA 4QQPA 4Y22B 5BYNA 2DURA 1QQP2 2P17A 5EQUA 3VL9A 1WZXA 1NA1C 4AF9A 3I3BA 3GDBA 2VMHA 2YGLA 1AL21 4CDWB 1PZ8A 1XNBA 1UY4A 2J1RA 3D0JA 1RUC3 3JBG3 5IAVA 2E6VA 3I59B 3U14A 3ASIA 3HD8B 3WT3A 3VBRA 2IXCA 2W0XA 3HT2A 4BQYA 3T2OA 4QDRA 2QFEA 2V4VA 2W68A 4NVPA 2WZPP 1JHJA 1QJX2 3B00A 3FX3A 3E6DA 1D7PM 5BNNA 4XDOA 4C1WA 3OY8B 3M3OA 1QOTA 4JHZA 3CU7A 5FZDA 2RR11 4OZXA 4DPNA 1OQ1A 3ZXKA 4L11A 4Q29A 5FJHA 4XABA 2X09A 2ZGUA 1G7YA 1G9FA 2AEZA 5FZMA 3QH6A 1TNRA 2BPA2 4YW4A 3CJIB 3ZFGB 2AZ5A 4AQ6A 4FOVA 2Y8KA 4UF0A 3GJBA 5AFEA 1LULA 4ZXEA 2HYXA 3J7LA 4KMQA 3EJKA 1H1IA 2RS11 2XGXA 3PUQA 4PDWC 1O4ZA 3QACA 1N47A 2VUAA 5LBCA 1A6CA 5C5UA 1AX0A 2D93A 1W99A 1F5FA 2WYFA 3AMQA 5D8AA 3JBG1 5CVRA 1RUC1 4NROA 4TLGA 4NRMA 3NMBA 3I2JA 2JICA 3T2TA 4PIXA 5FRAA 3WNXA 4AVAA 2Q8EA 3RPQA 2PHXA 3OB8A 4PIYA 1BBT3 2VOXA 3RZLA 1DQ0A 1DGWX 2VD7A 2XJVA 4E4SA 5LA2A 1AXKA 2FZ1A 4YWAA 3WOGA 4UXAA 4CCNA 5ABJC 1OQEA 1OKOA 4YZ2A 3SKJE 4CTEA 1OHFA 1VBA2 5KHJA 1H2LA 3POGA 1XNAA 2O1QA 1TMF2 2W94A 5AVPA 1J3QA 2WFF3 4XJZA 3GZTB 4GWIA 3OBAA 4COUA 1ZRCA 1FX5A 1CWPA 1B35B 1SZBA 4CUBA 4O9EA 1SCSA 2BEOA 4QX8A 2Z4FA 4KGQA 5L36A 1RUJ2 3DCQA 2G19A 3DV8A 4RSUA 5JIUA 1XYNA 1GOHA 2CWSA 3AMNA 4N53C 1JYWA 1GYKA 4QPWA 4D6RA 3NAPA 4RHV2 2PLV3 3ZXAC 4QKDA 4OCTA 1QJU2 2OX0A 4W4ZA 4ARYA 3RZMA 2RMU2 4YVSB 3VLBB 5D8AC 1DGWA 2ZCWA 3ZYHA 2WNVB 3DXTA 1A8MA 3MF6A 2TUNA 1TEIA 4DRRA 3GZUC 1MQTC 2EVXA 2RDSA 5C8WA 1ND3C 4R9DA 1Y4WA 1UOGA 4OLLA 3POBA 4UBHA 2PHUA 2NZ9A 4XJ9A 2WINB 3S7IA 1S0CA 1BBT1 2RS32 3KMHA 4COWA 1A3KA 2YC4A 4XDPA 3GHNA 1XYOA 4JVAA 4LLOA 2IFWA 1NG0A 3EXUA 2BGPA 2CYFA 2GC1A 4FTEA 1KXGA 4JQRA 4IEOA 5F39A 2P4EA 2LTNA 3WF2A 1LHOA 3WHTA 2AC1A 2FCVA 5IATA 2D44A 2WFF1 4CXWA 4B4PA 5JUVA 1KJRA 1O91A 1YJKA 4YW2A 1ULOA 2Q8CA 1MS4A 4AEKA 5HI0A 3IZOA 4BB3A 4UW4A 4PHZA 4YM0A 2NM1A 4A6OA 2VCCA 3WLUA 3I3QA 5KHKA 2AREA 2D40A 3ACHA 4IEWA 4P9WA 2VZPA 1UY2A 4MZUA 1LGCA 4K21A 3KLSA 2R30A 4XUNA 1PO22 2PLV1 3FUOA 1NY71 4K8FA 2PHWA 4CUGA 4FPGA 4NPLA 4AK3A 5LWBA 1FNYA 2IZWA 3N35A 2W39A 3LOBA 1I5PA 1V6MA 4W65A 4O9GA 3SLIA 1C5HA 5FZ4A 3T0AA 1RUH2 4OZOA 2W9XA 4Q1RA 3KSCA 1SCRA 1MS8A 1KS4A 3ZFEB 3NJXA 3AMHA 5T52A 4CPBA 2DDUA 4FCAA 4A7KA 1W6MA 4NHMA 3CZJA 4M01A 3TN93 1AXYA 4YLZA 4NPMA 5GJ6A 2IFRA 1RYYA 5IJRA 5A6YA 2BGOA 4NWWA 2C1FA 1NQDA 2PHDA 2XG3A 4Y33A 4XETA 1W9SA 3EB7A 4FQ4A 3GYDA 2VW0A 4Y5Z0 3NVCA 4HLTA 1QXJA 2FQPA 2HWF3 3CO2A 3T09A 5JI9A 2QQWA 5FQ0B 1FI2A 1HJFA 1G86A 1GP4A 1QQP3 2YXSA 3N7KA 2XQXA 5BNOC 1J58A 1FMD2 4FO9A 4WBBA 4A7ZA 2V72A 1QEXA 2PYTA 4FTSA 3WD5A 4L92A 3RJ2X 2VR4A 5JXHA 1E57A 1NKGA 4JGZA 4NN0A 1YFYA 4OUEA 4PI2A 1CZVA 2X5IA 4TSVA 2P2KA 3RGBA 1QJX3 1UXZA 3MIDA 1S0GA 1AR72 1FV2A 3EBRA 1XE8A 1W3VA 3JB4C 3H1YA 1S0EA 3N7JA 5EZWA 1HN1A 4AE2A 3VZLA 1QHDA 5C3SA 2Q1FA 2A70A 2XVKA 3KV4A 3POWA 4QXHA 4XF0A 5L73A 1M06G 3FN9A 4KG0A 3AKRA 1GOFA 3AL6A 4GH4C 1PGSA 2KR2A 3S30A 3TN91 4RQPA 3WW1A 1W9TA 3LZZA 1H8TB 3WDTA 4QT6A 2CY6A 5SV8A 1VAMA 1NLQA 1HB4A 2PHTA 4E2QA 2ZAAA 3POEA 2JDNA 2WZR2 2GC2A 3FE5A 3ZYPA 3LA3A 4P00B 2MNGA 4XJUA 2HWF1 3VBHC 2D6PA 2Y38A 4CE8A 3F95A 4URAA 1CAVA 5EJ1B 3ZFFB 1QQP1 2DV9A 3MI8A 2KA3A 1S2KA 3VBSC 3OCPA 4PLMA 5FPUA 5IWFA 3AZYA 4WVMA 2VBBA 4FFGA 5KWRA 3POJA 4EZHA 3CQOA 2Q1MA 3MF9A 4BQ2A 1SBDA 3OD4A 2YPJA 1HQNA 1NCRA 1OMIA 4ONUA 2X5IC 3KT7A 4GIQA 2XQRA 1MS0A 4BPZA 1QJX1 2Y6LA 2V5YA 5DABA 2ZEWA 2IXKA 4BK5A 4TYSA 3TEXA 2VECA 1OA3A 3ZKYA 1VBA3 4CEWA 4Q26A 3UGHA 4BZ4A 4KWKA 4QXKA 4FFFA 1TMF3 1SLCA 3OYWB 2HJIA 4UYBA 3ZYJB 5JXGA 1VMHA 4NIDA 1V9U2 4FPYA 1W2UA 3VV1A 3I2OA 3U0ZA 2MHFA 1O3QA 1PVC3 4HT1T 1N1TA 1POV1 3ZIWA 4ET7A 4BQXA 1OQDA 2GN3A 3RZZA 1RUJ3 4B1LA 4A4AA 2DU1A 1GU3A 2I2SA 3DGTA 3E5XA 3HJRA 3OGJA 1W04A 2IUWA 2ZBJA 1GR3A 4RHV3 4YGDA 2E7AA 1OURA 3KGZA 3POFA 2BNNA 4AWDA 3OPTA 2FDIA 2RMU3 2JX9A 5FZIA 5J48A 4IEYA 3I54A 3WQ7A 3B02A 3IKWA 2W5FA 4LTAA 4P9JA 4PDWB 1VB2A 4BMBA 1NCRC 1YFWA 2LALA 1YCIA 2G4IA 3MFCA 4A7YA 2B39A 1KQRA 2RS33 1ZNPA 2OKXA 3MUZ1 4COYA 5IVEA 3AXEA 5FYIA 4FPOB 3M7AA 1O5UA 4E8CA 4HK8A 1VBA1 1SDWA 4LEJA 4OMCA 5IVVA 3LFIA 1TMF1 3UV9A 3D6EA 2ARCA 3TBDA 4WZFA 4LT5A 4ZS3A 5HCHA 2O0OA 1K5MA 4LKDA 4MGZE 4XFGA 4MLOA 1Y7BA 2FD8A 4GAZA 5AVAA 1C8M2 1RUJ1 1ENRA 2JJ6A 2GNDA 1PGW2 2VCBA 4AEMA 1GZCA 3HBKA 5CBLA 4DMIA 3O1VA 2PN5A 4N9HA 3DUIA 4YGCA 1PO23 4RHV1 2BTVC 5DG2A 1WCUA 3T2QA 1BK1A 4BQ3A 5A7QA 1QJU1 5FPVA 4Q0UA 1GWMA 1S0DA 2RMU1 3JZVA 4LBOA 2GH2A 5EYYA 5FMCA 2P5BA 3ILFA 5FY4A 3ZSEA 5FWJA 3IMNA 5GKAC 5E8AA 3VZJA 2MPFA 1SFNA 1AJKA 2AH2A 2NN8A 3DYMA 3OD0A 2GC3A 2VVDA 1RUH3 2JG9A 3OBRA 1REEA 1NLSA 5FZEA 2EAKA 4MO3M 3IAQA 2RS31 3CF6E 2K0GA 4UT5A 1DQ5A 4NO4A 4FSJA 1V6KA 4DEVA 3BUCA 2MEV3 3EQEA 1WMDA 1ND3B 3J4UH 4R52A 4XFIA 4ZXKA 5FZGA 3ZPYA 2C26A 1UO9A 3LGRA 5FXXA 2XH6A 3BIEA 2EAAA 2HWB2 2JD4A 3CHXA 3FWEA 5DZEA 1K5MC 2YB7A 1UY0A 3WG2A 3ZFGA 1JH5A 5FZ3A 5C33A 4I0AA 3RYKA 1KRIA 2JE9A 3K3OA 4FAGA 2A6XA 3V65A 1O7FA 1KFXL 1OUSA 1FYUA 3LEGA 2XHKA 2CAVA 5FZOB 2JDYA 1AR93 1FMD3 5DDJ3 3OBTA 5GZDA 4BMEA 4AHXA 3GJAA 3VKFC 1PO21 4YZ5A 4CDWC 1OLRA 1SBFA 4DS0A 4HZFA 1R64A 1OT5A 2DUQA 1NXMA 2W2IA 2Y60A 3AP5A 5C5TA 3N9OA 5FO9B 3OTFA 3V0AB 2VXRA 2R1DA 4GB32 4LO6B 5C9AA 1RINA 2GMEA 4XPVA 2CGNA 3M3EA 2VZUA 3OPWA 2VUCA 1G9CA 4TTGA 1RUH1 1AYN2 1AR73 4Q5OA 1MVEA 4LKEA 4XVHA 2WN2A 4NIIA 1RMU3 2E9QA 1XU1A 4JCKA 5FBZA 3VBUC 3Q8CA 1REDA 1W2TA 3ZR6A 5GLWA 4DEQA 3C3VA 4AQ2A 4FFHA 5HCBA 4FPCA 3THCA 1DFQA 4FPJA 4HKWA 5HXMA 1PIV2 3HMYA 3OGSA 2DUOA 4CDUC 1JZ5A 3CJIC 3ZFGC 1ZZCA 2C5DA 1WLTA 2BV4A 2WZR3 1WUVA 4QU1A 2Y34A 4QKFA 1J1LA 1ULPA 2DWRA 1JTZX 3BPSA 5GZGA 1QDCA 3RWNA 1NQJA 2RVAA 5IVFA 1IHMA 4M3CB 2PAKA 1FMD1 1WCDJ 4YZ4A 5CU1A 1KGYA 3M2MA 4NRPA 4QGMA 2WNUA 3CL1A 2P37A 3ZSJA 5JXJA 4GKXA 4KWUA 2EF6A 3LIHA 2NP0A 1ZRFA 2DYCA 3GBGA 3LF7A 4LO8A 2YFUA 1ZZ7A 4GJZA 1J3PA 1LOFC 2W08A 2VNRA 2BZDA 2GNTA 3VBFA 3RZKA 1RUOA 5BNOB 4DZGA 1KITA 2ZGSA 2UYAA 3LOIA 1NYWA 1YIPA 2FMDA 2ZEZA 4LLFA 2XMLA 1AR71 4LULA 1OA2A 1F35A 1R1ZA 3WSOA 2JECA 1RMU1 1C3HA 1HV0A 4X6QB 3QCWA 1C5IA 1QY4A 4AEDC 5HXVA 2BVBA 2VTFA 1VMFA 4H7MA 1V9U3 2J1TA 3AC0A 1DLLA 3QD6A 4P14A 4PQQA 2J22A 5FZ9A 2JB8A 1B35C 2ZABA 4LBNA 2VUJA 1LCLA 5A7WB 4BQ4A 4ES8A 3QLQA 2WZR1 5GZCA 1K45A 2AEYA 2GNBA 1LAJA 4GH4B 3KCXA 3VKMA 2D6KA 4XTMA 4A45A 5JLVA 1LENA 3MYXA 5F5IA 3ZN5A 4AVTA 4CCDA 3ES1A 4L0PA 1RJ7A 4YVSC 2QKDA 2WNVC 3VDBA 4RFT0 4W6WA 3TYJA 2A71A 3Q8AA 1R092 2AR6A 4CXYA 4NOTA 1O6UA 4RGKA 4AGVA 3AX4A 3MDPA 3OEBA 2Z69A 1BMV2 3HOBA 2UYBA 3HQUA 1V6IA 5DUXA 4QD2A 5EJZB 1NUKA 4R4ZA 3T3YA 4MGKE 2O14A 3QH7A 5FIXA 4AL9A 1UIJA 4CP0A 1LODA 4LBLA 4ZONA 2WNEA 1J1TA 2R49A 3AP4A 3RQ0A 3ZFEA 4JGYC 2Y0IA 2BFUS 4UI9L 4UW5A 2XLGA 4QX7A 2X05A 2XKPA 1CIWA 3O5SA 5C3PA 3PTYA 1V9U1 1SBEA 4UWDA 1SEFA 3NJYA 1I9RA 3FLPA 4GJYA 3O0XA 1PM7A 2WC2A 4B29A 4Y4YA 5CA6A 5BNQA 3ZMNA 3KS7A 2P6HA 1ZBA3 4RN5A 3ZSKA 1CAXB 4BA6A 4XUQA 1JZ6A 3NNMA 4S2DA 5LB6A 3WZ1A 4GULA 2XOMA 4ASKA 1GKBA 4LBQD 4QX0A 4DUWA 4XCAA 3WW2A 1Q8VA 4N43C 3KWVA 2RDNA 2FDFA 4AQTA 3RZHA 1UZYA 1G6NA 5LBEA 4CZSA 2FDHA 1WLDA 1WW4A 4XHXA 1H1MA 3KT1A 4XURA 4A3XA 3KB5A 4EN0A 3HVDA 2W47A 4YFWA 2YY1A 1TME2 4XXAA 4UW3A 5M0TA 4EWEA 2D6LX 3ZMOA 3N9PA 4QPIA 1GNHA 4INDA 4XFCA 4FQZA 4Z8BA 4Y20A 3TWIA 3WP6A 3H8UA 1ZBE2 2B46X 4J1WA 4COZA 2XUMA 5A70A 1VRBA 5A7PA 1DQ1A 2VCAA 1FOD2 3MLJA 2V09A 4LORA 2WZ8A 1DGRN 5IVCA 3TEWA 1YFXA 3B3QE 2JIJA 4Y24A 1GFF2 2XB6C 4I3PA 1H8TA 4D3WA 4D8MA 2EALA 2EXIA 3FUQA 5DMYA 1XRUA 2E32A 4A3ZA 1VE0A 4ZY9A 1UW8A 2D5HA 2Q30A 1UIKA 1NE6A 1MEC2 2FHRA 5HCAA 5FZHA 1RXFA 5H9QA 1SQ4A 3VD5A 5FUPA 5FKBA 1CAWB 1LOCA 2E53A 5FK7A 1C8M1 1H30A 1PGW1 1SLLA 4H14A 3UGGA 4IE4A 1PMJX 4P5YA 1S0IA 4OFGA 5DAPA 2JIGA 1PVXA 2EIGA 2VNGA 4Q0QA 2XJTA 2NLRA 2HWE2 3HAGA 2ZGKA 1JYXA 1ZM1A 4GB33 2BOJA 2J1AA 1D2QA 1W8UA 3FHQA 5KXEA 1CGPA 3HBZA 3FHAA 2YU2A 2AUYA 1G9BA 1AYN3 5ERLA 2Q1ZB 4GMP0 2ORXA 2A73B 2QVSB 4Z1VA 2NQYA 5JOYA 3W21A 4HL0A 3PVBB 4UFJA 3VZKA 3BVCA 3JCIA 3OYWA 4NHXA 4PLOA 2F17A 5I0SA 1JU4A 2LW8A 4XFHA 3O1UA 1IS6A 3T1MA 2QZ2A 2Z42A 3JQXA 4KL1A 3NKTA 1PIV3 2WUHA 2CSGA 4QM9A 4XAEA 4FPLA 2A7AA 2HWB1 4Q0PA 2BWCA 4CVUA 4I02A 2RR13 3OF1A 3H7JA 1BJQA 4A42A 2VTXA 3LDKA 1RUF2 2OPWA 1QWRA 1CAUB 1E5SA 1KS5A 2VQUA 3L9JT 3NV4A 4DXTA 2B5HA 4EN8B 4KBZA 5I0UA 3NNJA 3ZFFC 2CV6A 1UZVA 1IGOA 4HBNA 3AB0A 2WR9A 3MUY1 3ZX7A 3WNPA 1OLME 3Q8EA 1H2NA 5A1AA 2C24A 2Q8DA 2H0VA 1I1EA 2Y6GA 2TEPA 2IVJA 2RS13 2B45X 3E1F1 3VHRA 4PDWA 2N7GA 1CZSA 2GNMA 2WT2A 4GB31 4WM8B 3PUSA 5H9RA 1HW5A 3FJSA 3VDAA 1YRZA 1LGNA 1NZCA 4YVWB 4WM7C 1QJFA 1AYN1 2ZEXA 4ISQA 3DN7A 1TNFA 2WRAA 3ACIA 3H3UA 3ENRA 4QB2A 3NWKA 3VZMA 3AZWA 3N9LA 3WG4A 4CCCA 1PX4A 2ZPXA 1AR82 4HVRA 2WS92 2Y6KA 4LK7A 3ZN4A 4EROA 5J96B 1XNTA 5ABJA 4L2NA 5FR3A 1RVF3 4D7YA 1S1AA 1PIV1 4JKKA 3K48A 3D8CA 3LQCA 4QKNA 3VBUB 3T4VA 2OW4A 2ADEA 3AMPA 1QIQA 2X53S 2XJRA 4KQ7A 3OEAA 3WP4A 2PHFA 4NMIA 4CU8A 5JOXA 2R062 2YZ4A 5JZGB 1DCSA 3LE0A 3JUUA 3E97A 2WSVA 3M3QA 3TOJA 3NV2A 4FTBA 5DAWA 4E8DA 1LU1A 4CDUB 5KXCA 5KBFA 1YYNA 5L9VA 5ACA2 3SEEA 2W87A 4H7LA 3VD4A 4GZ9A 1MVQA 4IV1C 4N53A 1Y9MA 4LOSA 4Q27A 3S5AA 3BGAA 2WT0A 4IESA 1CD3G 1QU0A 2VPVA 4CU6A 3AYCA 1FPN2 5C3OA 2WL1A 2PMWB 5DUVA 2YBSA 5FP9A 4PCRA 1WMEA 4P02B 1MQTA 3JD72 3WV6A 1QXPA 4XFFA 5G04L 4DRVA 1GP6A 4CCLA 1ND3A 3KV5A 1OC1A 4N7UA 5EYXA 1OXCA 2RM22 4NR1A 4JV4A 3VDDC 4XF4A 5CZKA 1LEDA 3CZUA 1WWYA 4CCJA 4RA0A 1ZVFA 2Z2SB 4HG6B 1RVF1 2O8QA 2ORZA 1OD5A 1JW6A 5A33A 4EYUA 4RS5C 4LK6A 2VY0A 4QQ2A 3NNFA 3SHRA 3BU0A 4AEDB 1L7RA 2PAEA 5AC92 2DCTA 4OMDA 1HXS2 2GDFA 1N1VA 1WD4A 3V0BB 3ZXJA 4I2OA 1K12A 1IPSA 2BFUL 2WIIB 3HR9A 1K5JA 1OLQA 4K9SA 3LCPA 4IEPA 5A3PA 3RVHA 2QCSB 2VC9A 4IUGA 5E1RA 4Z92B 3WCRA 5FXZA 2P3KA 1E5RA 5CISA 3AKQA 3OUHA 4AEJA 1VPHA 4MHUA 1R091 1TME3 4K1ZA 3V0AA 5D21A 1UOJA 3M3IA 3MEPA 2GMMA 2ZX3A 4KG8A 3AZVA 4LOTA 4UW6A 5I93A 1SPPB 4LBMA 1MS1A 1BMV1 1VBD2 1H0BA 1QJY2 1ZBE3 4YFZA 5FYCA 5CFDB 1BEV2 2PQQA 1JU3A 3L2YA 3ZXEA 1LOAA 5APAA 1RIRA 1JZ2A 2ZOEB 3I2KA 1FOD3 4UFHA 3V56A 5KC6A 3A21A 2R32A 1GQPA 2BOIA 4CPBD 1G8WA 4FOYA 5I0TA 5CADA 2I74A 3N9QA 4ITCA 3HWJA 2WDBA 4EV0A 2OPKA 1R082 1LHVA 4JGYB 4CDQC 4OQ8A 1MEC3 4Y3OA 5FP8A 5ISLA 4XF9A 1UU6A 3WINE 3PDQA 1XSQA 2K46A 5ANQA 1JI6A 2W1QA 2XL9A 5L7OC 4LE4A 1W05A 3WCSA 1VLNA 3ZXLA 2WO1A 5FP4A 4HK9A 2E7QA 5IW0A 3VBOB 5A1FA 3GNEA 4ZS2A 5FPXA 3KQRA 4BCUA 3R05A 1U0AA 2LROA 3ORJA 4E9KA 1PNFA 4AOCA 2HWE3 4JDOA 2IXLA 4BQ1A 1AUYA 2JDUA 2XWBB 1TME1 2YROA 4XJ8A 4LO7A 1TVGA 3WY6A 1LHNA 1LJ7A 2FDJA 4N43B 5BNOA 5A7OA 1DYKA 5A32B 1ZBE1 3PMEA 3AYAA 4LHSA 2QQLA 3L2HA 5EV7A 4LUMA 5BY5A 1XPWA 4MGIE 1JN2P 4KH9A 1FOD1 4O61A 4BU2A 4C1XA 1JYVA 1H2KA 3K4ZA 2FZ2A 2UY9A 1QDOA 2WNOA 3WR0A 2K2SA 2DCKA 5BXXA 4BXFA 1EP0A 1UMIA 4LKSA 2R6QA 2ZACA 4IEQA 4Q4W2 5KHIA 3IN9A 5H9SA 3GCWA 5F3CA 1WW6A 3FFQA 4Z2AA 4CP9B 1VRH2 2D6OX 1JZ7A 1MEC1 3SMHA 4GH4A 4MOAA 4YPJA 1VR3A 2KM2A 1D0HA 1W6NB 1WCQA 1XB9A 5FYUA 1W9FA 2A5ZA 5LRSA 3B01A 5IVJA 3LD8A 5FZ0A 2GSYA 4XW3A 2XVGA 2QQOA 4IEZA 3WG1A 5BNPB 1ZYBA 2EIDA 3VBHA 1FNZA 2WN3A 3LIGA 2HWE1 3ABZA 4RR3C 4FI9A 5T3NA 3LA7A 4YZ3A 5TSWA 3CNAA 1GZWA 5A3UA 1POQA 3VBSA 4IGQA 4ZU5A 4DXSA 3WNLA 1W8FA 3K4AA 1XJAA 1LECA 2ZGMA 4JZRA 4QU2A 1JOPA 2VZ3A 4QB6A 4QKBA 4RGAA 2IVIB 2C9KA 4D7TA 1AR83 3U37A 2HKXA 4LIVA 2SLIA 1K3IA 1COV2 2FCTA 2V4AA 1GNZA 2P1BA 1W3XA 4QDSA 3WDYA 1RUF1 2R063 3ZYIB 5B4NA 1DQ2A 1U5ZA 1W6OB 1IG3A 4IL7A 3AP9A 1XNKA 5L9BA 3FMGA 4Q0VA 2WWJA 4NIAA 1POV3 5F2WA 2ETEA 5F9TA 4M3CE 5ACA3 2LUWA 3T0DA 5J36A 3MIHA 4UFIA 3P3PA 4B3NA 1KJLA 4OI2A 3ST7A 3H8XA 3H8RA 4L9BA 4Q4V2 3J8F2 4DUVA 4MSVA 4AGRA 5I0DA 4WVZA 1FPN3 3IM0A 2DFCA 3BOPA 3K2OA 5FY9A 1LEMA 4D94A 1IS5A 1JHNA 3JD73 4AFMA 1V70A 5F3GA 1D0GA 1DBNA 2UWAA 4L97A 1JS9A 4EZ4A 1DGRA 4H2AA 1W2AX 2RM23 1LOEA 1AR81 3NKGA 5E88A 2CGOA 4OHXA 2WS91 1S2BA 3O12A 2KD7A 3BTYA 1QGLA 1R1A2 4WM7B 1AX2A 5T5JA 3SCFA 3VD9A 2BRTA 2VZ1A 4BQ5A 3U11A 1LOGA 1T2XA 1WA4A 3S7EA 2CDPA 1UL9A 3A7QA 1CR7A 3USSA 5AC93 2WLQA 4QX2A 3T08A 2EXHA 1HXS3 4JHTA 2Q8OA 2R061 1FV3A 1WBFA 2XJSA 5J98B 5FZBA 3O0WA 3QBQA 4LBQB 1JZ3A 3WP5A 3THPA 2JD9A 5J3UA 2OZJA 2AENA 2PXJA 3E5QA 4IE0A 3NJVA 3M3CA 5F6KA 1XNDA 5ACA1 1DZQA 1OF3A 5FYTA 2YBKA 1QNYA 4FOWA 2VQAA 1BVP1 2I45A 1O8PA 4XZPA 1DZRA 4L99A 5J7MA 5FREA 5FUIA 1W28A 2D43A 2XL7A 1VBD3 2Y6JA 1QJY3 2ZEYA 1YEWA 1QJU3 3MPBA 3RS6A 3IBMA 3WHUA 3LPGA 3UETA 4AFCA 1FPN1 3O1MA 3LPFA 4ASMB 4R8HA 1TQ5A 1NZIA 1IQAA 4LMFA 3ETPA 2I07B 1PK6B 3JD71 1MACA 4H3WA 4IV1B 5FO7B 1BHGA 1LHWA 3DPRB 4YYOA 2FDGA 2BP6A 1DF0A 3WF3A 4PLNA 2RM21 3PVNA 1DG6A 4S2GA 3I2DA 3PURA 1GICA 1R083 1IPKA 1VAVA 2VMEA 4AHZA 5FY7A 1ZZBA 1CAUA 4QGLA 1C4RA 2ZGQA 2Z79A 3M1HA 4MGSA 1SG3A 2W3JA 4C8DA 4QPYA 2JDHA 4R9BA 2VNOA 3H9AA 5AC91 1HXS1 1YI9A 3IB3A 3VDDB 2CGPA 1RTVA 4UBGA 3GBWA 1GQGA 5JAXA 1JOBA 1UYZA 4RS5B 1W6PA 2XDVA 1VP6A 3H50A 4COVA 1VB4A 2A1XA 4Y22A 2G1MA 1URXA 1F4HA 3AZZA 4BE3A 1GZTA 5LK5A 4XACA 2VNVA 3ZPOA 5LW9A 4YVWA 4AHYA 1VBD1 4P9GA 1QJY1 1OOPC 4CDWA 5C71A 2JG8B 1BEV1 3I59A 4LIUA 1RUE2 3BU7A 2A6YA 2DVAA 1YXWA 5BNNB 3TEZA 1APNA 2Y33A 2ZJCA 4I3GA 3M4FA 4EE2A 5K0UB 3CEWA 1RJ8A 3PUHA 4YNIA 4IQPA 3OY8A 4XTPA 4UAPA 3WNOA 2R16A 2XLFA 3VBUA 3POIA 4Q4W3 3WDVA 4F83A 2DBNA 4HFSA 3MHZA 3O14A 1R081 2GP3A 3BB6A 4AAPA 1VRH3 5C7GA 1QNWA 3X29B 3B7MA 1EUTA 4IV3B 2VULA 3IIAA 1TG7A 3LDBA 1VAKA 2ERFA 4YG6A 3WUDA 5JPMB 3UJQA 2PA7A 3NV1A 4LITA 3DL3A 4AVCA 4CDUA 5FOBB 3RRDA 2RS52 3CJIA 1U5IA 3FL7A 4CDQB 5EIYB 2GN7A 4AI0A 2EXKA 5C8CC 3AYEA 1Q8QA 3AP6A 4XUOA 1H6XA 2R0HA 1SLAA 4AVSA 4K7JA 3T1LA 5D2AA 4ES9A 4FBFA 5L7OB 2C0ZA 2RDRA 3ZYBA 3TEYA 1W03A 3LSDA 4WM8C 5JSOA 3W20A 3URFA 5LRRA 5HBAA 1P8JA 4HSLA 4YVWC 2OIIA 1HIXA 1EY2A 2HWD2 3UJOA 4KU7A 4JTOA 4AHWA 3B69A 3JU9A 3U4SA 5FZCA 1LOFA 2XONA 4YGEA 1X50A 1REFA 4DUXA 4M00A 4GD4A 1ST8A 5EJ3A 1N3OA 1ULDA 1W6QB 5FYVA 4QAWA 4Y5SA 3WF1A 3RG0A 1XE7A 1UXXX 1COV3 2L9LA 1ULGA 2PHRA 2R0FA 3C7EA 4P9XA 4Q4W1 3ZKUA 3KT4A 4YRDA 4DQAA 4AEDA 5IK4A 4OUSA 3DF0A 2VZSA 4QGNA 5F2SA 1VRH1 1MZ5A 5JZGC 3OGRA 1RUD2 4XFAA 4B7EA 3BTAA 3PIJA 1F5JA 1O5LA 4FXGB 5L19A 1F15A 4OUMA 2VH9A 3ITQA 1B35A 4FP2A 1DZTA 3ECQA 4F8AA 1ZRDA 3BIWE 3A23A 1IQDC 5LBBA 1KDMA 4F3JA 4JKLA 1A8DA 1W8WA 4M0NA 3NAPB 4UFLA 4R9AA 4BH9A 3ZR5A 1ODMA 1SFPA 1SPPA 5A3WA 3GHMA 1WW7A 2R042 4Q4V3 3J8F3 4LKFA 4MXVA 2VAUA 2ZGOA 1AHSA 1ZZ6A 4YVSA 2DF7A 1VALA 1OPOA 2DCJA 3GM8A 3OJBA 3I2HA 4XZUG 2WNVA 1IS4A 2QQVA 2YFZA 3OSDA 5BV6A 4YG0A 3ATGA 4XDQA 2SBAA 4QDQA 4LUKA 4RR3B 2BNMA 4B4QA 1L7LA 2XHNA 3T30A 1QKQA 1LESA 4PF5A 4NPRA 4BLIA 4CXXA 3M8LA 2BJSA 4WZCA 2VUDA 1R1A3 1I6XA 1TZOA 3UYJA 4GWNA 3U10A 4JGYA 4AYUA 1OBNA 5FMOS 1JYNA 2WKKA
chains in the Genus database with same CATH topology
1COV1 1WMFA 2C9AA 1W39A 3E6CC 1AYM2 4I30A 1WCKA 3LA2A 4YW3A 4I09A 3R4DB 3VBOA 3SH5A 4E2GA 1D4VB 4FOQA 4QPGB 3DKWA 2ZGNA 1HX6A 5JPNB 5FDBA 3BPZA 4N43A 1ZA4A 3A0NA 4QMAA 4Q4V1 1ND2C 1WLWA 3J8F1 2ZGLA 5CFDC 1W0PA 4FT8A 4LNVA 2ZX2A 1Z7S2 3WX5A 5GM0A 3ZYGA 4LA3A 3ZXFA 4IXLA 5CFCC 1PO12 4V1PA 5KXBA 1LOBA 1X82A 1OPMA 2A3XA 1T6GC 1W6MB 1R1A1 4M0HA 4CYDA 4HPKB 3MPPG 4YG3A 1KFUL 3WW4A 3RMYA 1D2SA 1MZ6A 2OYZA 3WXPA 1ZREA 1W6NA 2D3PA 1ZZ8A 2BYVE 1J59A 4FAHA 4E27A 5IK5A 3VBOC 1CJPA 2JKBA 4WV8A 1S0JA 3TRSB 5FQ0A 3VGIA 1C8M3 3PLQA 2QNKA 2H6CA 4XFBA 1EV12 1H2MA 4JGZB 1H1AA 2ZX1A 1V6JA 1DYPA 2JEMA 2VVFA 1RUE3 4KBBA 1MS5A 5CG9A 1HRI2 1V00A 1Y3TA 1MZEA 3FHIB 1B09A 4ATFA 1U12A 1YHFA 3RI9A 2Q4SA 3SCHA 2WFF2 3E5UA 2XWJB 1XXNA 1SLBA 4RQPB 1U5YA 2CAUA 4HVQA 4YM1A 2DCZA 1ASJ2 1W6OA 2B8MA 1UKGA 1FXZA 2HWB3 2H6BA 2UWBA 1FT9A 1N3QA 1CX4A 3I4IA 5DUUA 5LEKA 2JDZA 3H7YA 2RS53 1KD7A 2DVGA 1UPSA 1CAVB 2JE7A 5BNPC 4XMIA 2F6BA 3MLKA 2WFPA 5FCCA 3ZFFA 5GALA 2D3RA 1OI6A 5FTTC 3D0SA 1AR62 2ZKLA 5IT6A 4YARA 1GZ9A 3B94A 4Y1VA 2HWD3 4XF1A 1OFSA 1RUE1 1Z0HA 3A0KA 1MS9A 4BIFA 1QH7A 1Y43B 2DTYA 1VBE2 4G3YC 3POYA 3SISA 4CEWB 4HN1A 4WM7A 1OOPB 1FATA 3OPZA 1YNAA 1LKNA 4HKLA 2CNAA 1H9PA 4IEUA 2A75A 1RUD3 1NLRA 2Y26A 3RMXA 1SFYA 4LBQA 4HN0A 4SBVA 4XQ4A 1IKPA 2HWC2 4S2FA 4NWVA 1SLTA 5EWSA 4R9CA 2RS51 3LB9A 1V6NA 4MV2A 4NHLA 2O8OA 1CONA 1DIWA 3ELNA 1OKQA 5KC5A 1ONAA 2ZAHA 3ILNA 2R043 2V73A 4MXWB 2RJKA 2TBVA 1Q3EA 1NCQC 1WGPA 4URTA 1UPIA 4MH0E 3ZYRA 2DVBA 3GALA 3NV3A 4BLJA 1ZRRA 5JVVA 1XQNA 5C8CB 2HWD1 2D7FA 3B9CA 4IV1A 3UK9A 4EWDA 3UKVA 3H1WA 3KCCA 3UKTA 5KHGA 2BGCA 3E6BA 4AVBA 1H4HA 4CRQA 4PJYA 4AI8A 4JRLA 3K51A 1QMJA 1AYM3 1ALYA 1GSLA 2XLAA 3VDDA 4PBOA 1TE1B 1RUD1 3VKNA 1YLLA 2WQ4A 2X29A 3J9SA 5DZGA 1QJZA 4RS5A 4X6RB 1RHI2 5K8SA 4WVVA 1WD3A 2AGSA 3MICA 5FMOL 4D69A 1RL3A 4NHKA 4DB5A 2R041 5JCTA 3VN4A 1PNGA 5FLHA 3PVOA 4CEYC 1WW5A 1AL0G 3D82A 2JG8A 3IT8A 5I8TA 1UZZA 1OSGA 1R093 4ZU4A 1ULEA 1Z7S3 2JG9B 3TB0A 3VHPA 1PK6C 3P3NA 5K0UA 3DPRC 3IWZA 1DU3D 1PO13 4C90A 5FLIA 3WW3A 4AFDA 5C4WB 3HQXA 3AP7A 2VMGA 2X8KA 3ACLA 2QZ3A 3ILRA 4FPFA 2BBVA 4Q4Y2 3KZ4C 4BIOA 3U4XA 1M4WA 2P3IA 4KGGA 4Q2FA 3FBMA 1EPZA 1SMVA 1F8VA 4IV3A 1AYM1 4JRAA 1AF9A 1O4YA 3D4KA 1HQWA 4CDXC 5FPZA 4CDQA 5BPXA 1CJDA 3VHNA 3PVEA 2Q5TA 4YM2A 1BKZA 4FVVA 2RJLA 4IETA 5DZFA 5L7OA 2XPJA 1EV13 1XU2A 2OVUA 3HIFA 2H0BA 5JOZA 4XXPA 5J37A 3VBRC 2JG8C 4MUVA 5C9AB 2A6VA 4TZDA 2Y0OA 3SXWA 1C28A 1RB8G 3N3HA 1ULFA 5BNNC 2B7YA 1HRI3 1Z7S1 5I91A 4Q8LA 3USUB 5K0UC 3ZN6B 3W59A 1W6QA 1PO11 5CIRA 2YDEA 5GLVA 1ND2B 4J6GA 4YW5A 4GKYA 3RSJA 1NE4A 1DGLA 4EN7B 2JXAA 3AZXA 1PVC2 5E16A 1VIWB 4HANA 2DTWA 1ASJ3 2PELA 5CFCB 4IV3C 4KWLA 4XILA 2PFWA 1Z78A 1HDKA 2ZZQA 1CPNA 5IUQA 4XQWA 4PBPA 1O3RA 2ZX0A 4H55A 1O3TA 3NL1A 3NO8A 1RGSA 1PGL2 4X8NA 4JDMA 3NJZA 4N9IA 2XJUA 4XJWA 1AR63 2WNUB 4M3CA 1EV11 2WA3A 3PJYA 2YV8A 3IDCB 1ZZ9A 3WVJA 1C1FA 2UWCA 1Q56A 4Q0SA 5IK8A 3VBFB 4QM8A 4YM3A 4RR3A 3RDIA 3IDEA 1HRI1 2XKOA 1VBE3 2NPIA 1C57A 1O3SA 3AM2A 5DXDA 4IEXA 4TWTA 2R1BA 4FXKB 3H0OA 1UN1A 2VOVA 5GZEA 3ZVXA 1S0FA 2YMZA 3VKLA 2CWMA 5LEJA 1HKDA 1ENSA 1ASJ1 1RITA 2VW2A 2HWC3 2WQZC 2DFBA 1RUG2 1L3JA 4QPGA 1AZDA 1RUF3 3NAPC 1JYIA 2VMIA 2RE9A 2GH8A 2QDRA 1I5ZA 1UF2C 5JR7B 4CP2A 1LHUA 2ZMLA 3LWCA 3PHMA 4TLFA 2ZHMA 1AR61 3MW3A 5FFOC 3ROUA 5SV5A 4LBJA 4DFSA 4OI1A 1BXHA 4N90A 2GZWA 4Y26A 4HMZA 4C0HA 1UX6A 2EXJA 1UU4A 3PJQA 2XBO2 5A3MA 1VBC2 1CN1A 4GQ7A 4AQSA 2VOKA 4OI0A 2E7TA 1VBE1 3B5LB 1G9DA 3R0RA 3RJRA 4CP1A 2MEV2 5CB7A 2B42B 3IPVB 4MX3A 4HPKA 4DOUA 1HQLA 1OA4A 3B93A 3SCGA 1ENQA 3ZSMA 5T55A 2ZHLA 1AJOA 1HV1A 1LRHA 2WS93 4C0BA 3MIEA 3VHOA 4W6YA 2UURA 3RYPA 2HWC1 1RHI3 1CAXA 1MR5A 4QPGC 1KDKA 1C1LA 3KM5A 1RUI2 1X36A 1AR92 1I3HA 3R4SA 5DDJ2 4BWOA 2TNFA 1JOJA 4XHBA 1XNCA 1UAIA 4XOGA 2IXJA 5T5PA 1VJ2A 1ULCA 5D1IA 5FAXA 3AJZA 5BUVA 1HRV2 1IOAA 4QPIB 4XEZA 1YI7A 4Y20B 2QDNA 3MZHA 2OUHA 1YJLA 3MIBA 3QOPA 3ZDSA 1RMU2 1BVVA 1PZ7A 2FBEA 1NCQB 5JOWA 1H8VA 4OHWA 2OZ6A 4LE3A 4AI3A 4GA9A 2WT1A 3ZIXA 4Q4Y3 3N7LA 4QX5A 3ZO0B 3SNMA 3C2UA 2ZGTA 1ENXA 3BALA 4LHNA 1VBB2 2VQ0A 2QQPA 1EAH2 3WDUA 2PAMA 1RHI1 3MW2A 4B4RA 1DHKB 2RHPA 1CAWA 2PHLA 3HN1A 3WQ1A 3I7DA 1BQPA 3MGUA 2R072 3BCWA 4JGZC 4A2UA 4YZ1A 1W0OA 3ZSLA 1NA1B 1YFUA 4META 2ZMNA 3V64A 5EFUA 3D5OA 4XBLA 3UKNA 1QXRA 1OOPA 2BVVA 4CEYB 1RUNA 1BEV3 2VW1A 2P3JA 4RQPC 4LHKA 4Q4Y1 1X33A 5JWPA 4K1YA 2HEYF 1F9KA 2DCYA 4QQLA 2UU8A 1CQ9A 2WJSA 5J09A 4LBKA 4FPEA 1LB2A 4GXLA 4K3UA 5JI7A 1GV9A 4MXWA 3TNPB 5K9YA 1QOSA 4DY5A 3HT1A 4CDXB 3IDBB 1F31A 4RGGA 3WG3A 2YHJA 5C8CA 3THTA 2DVDA 2D5FA 1JXNA 1SLIA 4AG4A 1EYBA 2ET7A 4WM8A 2ZTNA 3MW4A 2HEVF 2OA2A 3LKJA 4RL7A 3AKPA 4CEWC 2WSUA 1C8NA 2ES3A 2VOWA 2Z5WA 4GMP3 3VBRB 1HLCA 1X7NA 4R4XA 2GMPA 4P9LA 5ABJB 2ENRA 4EN6B 1PVC1 1FAYA 1F2NA 1RC6A 1X8EA 1ZBA2 3FZ3A 3J26N 3CLPA 1JYCA 1UKRA 3KGLA 4I0WB 4ISRA 3G6JB 5CAZA 1NXD1 2D6NA 3SH3A 1RUG3 4JTNA 3TAYA 4DXZA 1X8MA 4EJRA 4HETA 4QQOA 2BNOA 3GF6A 3R4UA 5JZGA 2IWGB 4K20A 3WUCA 1PGL1 1G9AA 5I0RA 1D4M2 2DU0A 2D3SA 4ORFA 2BWAA 3WDXA 1Q8PA 2A3YA 4N7IA 3RNSA 4XIOA 4N53B 3KD4A 4Q4X2 3AKSA 5JSPA 1AXZA 2HEWF 2P34A 2ZHKA 5D8AB 2XBO3 2A3WA 3WQ0A 1VBC3 4KWJA 3BOWA 3ME2A 4S2HA 2F4PA 1MQTB 5C4WA 4BM8A 4QQHA 4PIZA 2W52A 4GMP1 4E4ZA 4B8EA 4E4DX 5C6CA 5A3LA 1IKQA 4MYEA 4IERA 1LU2A 4YGBA 1PHMA 1AVBA 5A33B 2IXHA 3B9IA 5JMCA 3JQWA 3AFKA 2YYOA 3EO6A 5T5OA 5JSRA 4J1XA 1SACA 1CVNA 5T5LA 4ZU7A 1RUG1 4ASLA 1RUI3 3Q9OA 1UMZA 3V0BA 4DNYA 4XF3A 3VL8A 4P5HA 1MS3A 1MZFA 2NMNA 4OHZA 3EHKA 4Z82A 2JENA 3FBYA 4BHPA 4I01A 1HRV3 3AMMA 4JDNA 1WCSA 5GZFA 2JG9C 1AL22 3USUA 2VU9A 1LGBA 3UL2A 3ZN6A 4Y1YA 2OUJA 3MLLA 2D97A 2XBO1 4Z2WA 1VBC1 1ND2A 4XE9A 2VG9A 4Y1ZA 5DG1A 5CFDA 4DY3A 5C4WC 4IEVA 2MEV1 3INAA 3ALQA 2YC0A 5FLJA 4DINB 5CFCA 2RR12 4LHLA 3FLTA 4FP3A 4ATEA 1JBCA 5LK7B 4U36A 1VBB3 3N36A 2QUOA 5DUWA 4EWAA 5K7PA 5KXDA 1CESA 1EAH3 4LO4B 5AFBA 2FMYA 1RUI1 3PNAA 1AR91 5H9PA 5DDJ1 4Q8KA 4Y1UA 2D98A 2YGMA 4XBNA 4XQDA 1A78A 4AFBA 5F1RA 5GLUA 2R073 1PZ9A 3W9AA 4OHVA 2RS12 4WVWA 5F5QA 2D6MA 5C9AC 4E2SA 1N3PA 1HRV1 4FPKA 3VKOA 1H9WA 2XJQA 1GQHA 3JBG2 4D7SA 1RUC2 5A32A 3AFGA 3PMSA 4JC1A 2G9FA 3ZXGA 3H3ZA 3S0MA 1DQ6A 5I8SA 2EA7A 2PTMA 3LAGA 4P9IA 3U07A 1EPWA 4Y1XA 3AJYA 4AGGA 4XYXA 1YWKA 4C91A 1RVF2 3MIFA 1J3RA 2E51A 5KHHA 4GALA 1JUIA 4K40A 4I0BA 1IPJA 2KXLA 2LM3A 3FC0A 1BYHA 1Q5OA 1VBB1 1V6OA 1WLCA 2BQPA 1EAH1 4U2AA 4LO5B 1POV0 3ETQA 2ZHNA 2WNUC 3LSEA 4G9SB 1Y9QA 2ATFA 2R071 3VBHB 4LA2A 3NW4A 2ILMA 1O4TA 5BNPA 4AXOA 1GZWB 1N1SA 4GWMA 3VBFC 2CTVA 2DVFA 2NYYA 3H1MA 3VBSB 2GALA 3WDWA 5E89A 1U5XA 3G7DA 3JB8A 3RYRA 3VZOA 5T50A 5FO8B 3IPVA 1V6LA 1YO8A 1BBT2 2X5IB 5F6LB 3O7OA 4LR4A 1JUHA 1AX1A 1WBLA 3A4UA 1QH6A 1PMIA 5CG8A 4YSFA 4AI1A 2YUEA 5FOJB 4EN9B 5I8YA 1LTEA 3CJXA 4OHYA 3KCYA 2GU9A 3AK0A 1S55A 2QE3A 4SLIA 4HSJA 5IK7A 2ARXA 3VUOA 1QF3A 3MFAA 2IXIA 1YUDA 4B7KA 3BODA 1D4M3 3GBFA 3GZAA 2GC0A 2QJVA 1IS3A 3W58A 1YIFA 3M70A 2UY8A 4RD7A 4Q4X3 2GAUA 2PLV2 1NY72 2VVEA 3FFZA 4MGYE 3VZNA 4OULA 4XIKA 4P9YA 1BZWA 3ZFEC 1GBGA 1UD1A 4WVMB 2DUPA 4AFAA 1NCQA 5T54A 1UU5A 3POSA 2CL2A 2XVLA 1QOOA 1IZ3A 5GLZA 4Z07A 2XJPA 1Q8OA 2ZGPA 4QHBA 1NCRB 1GLHA 2WA4A 2ZKNA 1XYPA 3I8TA 3R6SA 1ZX5A 4L8QA 3N4MA 4XMAA 5JIAA 2G9GA 1ZBA1 5EXOA 2BW8A 4AI2A 4PQ9A 2WWSA 3AXDA 2NMOA 4Q1PA 1LR5A 2AYHA 2ZMKA 4W6XA 3TNQA 1N1YA 4KU8A 4MVTA 3ZXDA 2B9UA 4F7ZA 2ZZJA 4X8PA 5GLTA 1DQ4A 2ET1A 1GANA 4JAAA 1H4GA 4M3CF 2ZGRA 1D4M1 4KNCA 4HKOA 2BUKA 2Q0AA 2HYKA 1NA1A 4YW1A 4QPIC 5HCFA 3MIGA 4Q4X1 1AL23 4XBQA 5B2GB 2ZX4A 3ES4A 3OGGA 1CPMA 2IC1A 4BYYA 2ZS6B 1OFNA 4CEYA 4BOWA 2VGDA 3AKTA 2K9ZA 4AVVA 4AW7A 3NSTA 2A6WA 5CNAA 3APBA 2ZA9A 1H8TC 1PK6A 2WLPA 4FPHA 1Q8SA 3DPRA 4ZKTB 3S6PA 3AYDA 4OVEA 1Q43A 3TN92 3SH4A 3N7MA 3SITA 1NOVA 3O0VA 1BCXA 1K5MB 4XJAA 4OI4A 4G4FA 1DDLA 1W6PB 4CDXA 3RI8A 2HWF2 1S0BA 1UCXA 4K6BA 3WP3A 2A6ZA 4HVOA 2E63A 3FLRA 4Y22B 2ARBA 4QQPA 5BYNA 2DURA 1QQP2 2P17A 3VL9A 1NA1C 4AF9A 2VMHA 2YGLA 1AL21 4CDWB 1PZ8A 1XNBA 3JBG3 3D0JA 1RUC3 3WT3A 2E6VA 3I59B 3ASIA 3HD8B 3VBRA 2IXCA 2W0XA 3HT2A 2QFEA 2W68A 4NVPA 2WZPP 1QJX2 3B00A 3FX3A 3E6DA 5BNNA 4C1WA 3OY8B 3M3OA 1QOTA 3CU7A 2RR11 4OZXA 4DPNA 1OQ1A 3ZXKA 4L11A 4Q29A 2ZGUA 1G7YA 1G9FA 3QH6A 1TNRA 2BPA2 4YW4A 3CJIB 3ZFGB 2AZ5A 4AQ6A 4FOVA 5AFEA 1LULA 3EJKA 1H1IA 2RS11 2XGXA 4PDWC 1O4ZA 3QACA 1N47A 2VUAA 1A6CA 1AX0A 2D93A 1F5FA 5D8AA 3JBG1 5CVRA 1RUC1 3T2TA 2JICA 4PIXA 5FRAA 3WNXA 4AVAA 3RPQA 2PHXA 4PIYA 1BBT3 2VOXA 1DQ0A 1DGWX 2XJVA 4E4SA 5ABJC 1AXKA 2FZ1A 3WOGA 4UXAA 1OQEA 4YZ2A 4CTEA 1OHFA 1VBA2 5KHJA 1H2LA 2O1QA 1TMF2 5AVPA 1J3QA 2WFF3 4XJZA 3GZTB 4COUA 1ZRCA 1FX5A 1B35B 4O9EA 1SCSA 2BEOA 5L36A 4KGQA 1RUJ2 3DV8A 4RSUA 5JIUA 1XYNA 2CWSA 3AMNA 4N53C 1GYKA 3NAPA 4RHV2 2PLV3 3ZXAC 1QJU2 2RMU2 4YVSB 3VLBB 5D8AC 1DGWA 2ZCWA 2WNVB 1A8MA 3MF6A 2TUNA 1TEIA 4DRRA 3GZUC 1MQTC 2EVXA 5C8WA 1ND3C 4R9DA 4OLLA 4UBHA 4XJ9A 2PHUA 2NZ9A 2WINB 3S7IA 1S0CA 1BBT1 2RS32 3KMHA 4COWA 1A3KA 3GHNA 1XYOA 4JVAA 4LLOA 2IFWA 1NG0A 3EXUA 2CYFA 2GC1A 4FTEA 1KXGA 4JQRA 4IEOA 2LTNA 1LHOA 3WHTA 2D44A 2WFF1 4B4PA 1KJRA 1O91A 1YJKA 4YW2A 4AEKA 1MS4A 5HI0A 4UW4A 4YM0A 2NM1A 3WLUA 5KHKA 2AREA 2D40A 4IEWA 4P9WA 4MZUA 1LGCA 4K21A 3KLSA 2R30A 1PO22 2PLV1 3FUOA 1NY71 4K8FA 2PHWA 4FPGA 4AK3A 1FNYA 2IZWA 3N35A 2W39A 3LOBA 1V6MA 4W65A 4O9GA 3SLIA 1C5HA 1RUH2 4Q1RA 3KSCA 1SCRA 1MS8A 1KS4A 3ZFEB 3AMHA 5T52A 4FCAA 4A7KA 1W6MA 4NHMA 4M01A 3TN93 1AXYA 4YLZA 5GJ6A 2IFRA 4NWWA 2C1FA 1NQDA 2PHDA 2XG3A 4XETA 4FQ4A 3GYDA 2VW0A 4Y5Z0 3NVCA 4HLTA 1QXJA 2FQPA 2HWF3 3CO2A 5JI9A 5FQ0B 1FI2A 1G86A 1QQP3 2YXSA 3N7KA 5BNOC 1J58A 1FMD2 4FO9A 4WBBA 4A7ZA 4FTSA 2PYTA 3WD5A 4L92A 3RJ2X 1E57A 4JGZA 4NN0A 1YFYA 2X5IA 4TSVA 2P2KA 1QJX3 3MIDA 1S0GA 1AR72 1FV2A 3EBRA 1XE8A 3JB4C 3H1YA 1S0EA 3N7JA 5EZWA 4AE2A 3VZLA 1QHDA 2A70A 2XVKA 3POWA 4XF0A 5L73A 1M06G 4KG0A 3AKRA 4GH4C 3S30A 1PGSA 3TN91 4RQPA 3WW1A 3LZZA 1H8TB 3WDTA 4QT6A 2CY6A 5SV8A 1VAMA 2PHTA 4E2QA 2ZAAA 2WZR2 2GC2A 3FE5A 3ZYPA 3LA3A 2MNGA 4XJUA 2HWF1 3VBHC 2D6PA 2Y38A 1CAVA 3ZFFB 1QQP1 2DV9A 3MI8A 2KA3A 1S2KA 3VBSC 3OCPA 4PLMA 3AZYA 4WVMA 5KWRA 2Q1MA 3MF9A 1SBDA 3OD4A 2YPJA 1HQNA 1NCRA 1OMIA 4ONUA 2X5IC 3KT7A 4GIQA 1MS0A 4BPZA 1QJX1 2V5YA 2IXKA 4TYSA 2VECA 1OA3A 1VBA3 4CEWA 4Q26A 4BZ4A 4KWKA 4QXKA 3ZYJB 1TMF3 1SLCA 3OYWB 2HJIA 1V9U2 4FPYA 1W2UA 3VV1A 3U0ZA 2MHFA 1O3QA 1PVC3 4HT1T 1N1TA 1POV1 3ZIWA 1OQDA 2GN3A 3RZZA 1RUJ3 2DU1A 2I2SA 3DGTA 3E5XA 3OGJA 2ZBJA 1GR3A 4RHV3 4YGDA 2E7AA 3KGZA 2BNNA 4AWDA 2RMU3 2JX9A 5J48A 4IEYA 3I54A 3WQ7A 3B02A 3IKWA 4LTAA 4P9JA 4PDWB 1VB2A 4BMBA 1NCRC 1YFWA 2LALA 1YCIA 2G4IA 3MFCA 4A7YA 2B39A 1KQRA 2RS33 1ZNPA 4COYA 3AXEA 4FPOB 3M7AA 1O5UA 4HK8A 1VBA1 1SDWA 4LEJA 1TMF1 3UV9A 3D6EA 3TBDA 4WZFA 4LT5A 2O0OA 1K5MA 4MGZE 4XFGA 4MLOA 1Y7BA 5AVAA 1C8M2 1RUJ1 1ENRA 2JJ6A 2GNDA 1PGW2 4AEMA 1GZCA 5CBLA 4DMIA 2PN5A 4N9HA 3DUIA 4YGCA 1PO23 4RHV1 2BTVC 5DG2A 1BK1A 1QJU1 4Q0UA 1S0DA 2RMU1 3JZVA 4LBOA 2GH2A 5EYYA 3ILFA 3ZSEA 3IMNA 5GKAC 5E8AA 3VZJA 2MPFA 1SFNA 1AJKA 2AH2A 2NN8A 3OD0A 2GC3A 2VVDA 1RUH3 2JG9A 3OBRA 1REEA 1NLSA 2EAKA 2RS31 3CF6E 2K0GA 1DQ5A 4NO4A 4FSJA 1V6KA 2MEV3 3EQEA 1WMDA 1ND3B 3J4UH 4R52A 4XFIA 4ZXKA 3ZPYA 3LGRA 2XH6A 2EAAA 2HWB2 2JD4A 3FWEA 5DZEA 1K5MC 3WG2A 3ZFGA 1JH5A 5C33A 4I0AA 3RYKA 1KRIA 2JE9A 4FAGA 2A6XA 3V65A 1O7FA 1KFXL 1FYUA 2XHKA 2CAVA 1AR93 1FMD3 5DDJ3 3OBTA 5GZDA 4BMEA 4AHXA 3VKFC 1PO21 4YZ5A 4CDWC 1OLRA 1SBFA 4DS0A 4HZFA 2DUQA 3AP5A 1NXMA 5FO9B 3OTFA 3V0AB 2VXRA 2R1DA 4GB32 4LO6B 5C9AA 1RINA 2GMEA 4XPVA 2CGNA 3M3EA 1G9CA 1RUH1 1AYN2 1AR73 1MVEA 1RMU3 1XU1A 2E9QA 4JCKA 5FBZA 3VBUC 1REDA 5GLWA 3C3VA 4AQ2A 5HCBA 4FPCA 1DFQA 4FPJA 4HKWA 1PIV2 3HMYA 2DUOA 4CDUC 3CJIC 3ZFGC 1ZZCA 2C5DA 1WLTA 2WZR3 1WUVA 1J1LA 2DWRA 1JTZX 5GZGA 1QDCA 3RWNA 1NQJA 1IHMA 4M3CB 2PAKA 1FMD1 1WCDJ 4YZ4A 5CU1A 3M2MA 4QGMA 2WNUA 3CL1A 2P37A 3ZSJA 4GKXA 2EF6A 2NP0A 1ZRFA 2DYCA 3GBGA 4LO8A 1ZZ7A 1J3PA 1LOFC 2W08A 2VNRA 1RUOA 2GNTA 3VBFA 5BNOB 4DZGA 1KITA 2ZGSA 2UYAA 3LOIA 1NYWA 1YIPA 2FMDA 4LLFA 4LULA 1AR71 1OA2A 1R1ZA 2JECA 1RMU1 1C3HA 1HV0A 4X6QB 3QCWA 1C5IA 1QY4A 4AEDC 5HXVA 2BVBA 4H7MA 1V9U3 3QD6A 1DLLA 4P14A 1B35C 2ZABA 4LBNA 2VUJA 1LCLA 4ES8A 3QLQA 2WZR1 5GZCA 2GNBA 4GH4B 3KCXA 3VKMA 2D6KA 4XTMA 5JLVA 1LENA 3MYXA 3ZN5A 4AVTA 3ES1A 1RJ7A 4YVSC 2QKDA 2WNVC 4RFT0 4W6WA 3TYJA 2A71A 1R092 2AR6A 4NOTA 4AGVA 3AX4A 3MDPA 2Z69A 1BMV2 2UYBA 1V6IA 5DUXA 4QD2A 4R4ZA 4CP0A 4MGKE 3QH7A 1UIJA 1LODA 4LBLA 3ZFEA 2WNEA 1J1TA 2R49A 3AP4A 3RQ0A 4JGYC 2Y0IA 2BFUS 4UW5A 2XLGA 2XKPA 1CIWA 3O5SA 3PTYA 1V9U1 1SBEA 1SEFA 1I9RA 3FLPA 3O0XA 1PM7A 2WC2A 4B29A 4Y4YA 5CA6A 5BNQA 3ZMNA 3KS7A 1ZBA3 3ZSKA 1CAXB 4BA6A 4S2DA 3WZ1A 4GULA 1GKBA 4LBQD 3WW2A 1Q8VA 4N43C 4AQTA 1UZYA 1G6NA 4CZSA 1WLDA 1WW4A 4XHXA 1H1MA 3KT1A 4A3XA 3KB5A 4EN0A 4YFWA 2YY1A 1TME2 4XXAA 4UW3A 4EWEA 2D6LX 3ZMOA 4QPIA 1GNHA 4INDA 4XFCA 4FQZA 4Y20A 3TWIA 3WP6A 3H8UA 1ZBE2 2B46X 4J1WA 4COZA 2XUMA 1DQ1A 1FOD2 3MLJA 2V09A 1DGRN 1YFXA 3B