2JEMA

Native family 12 xyloglucanase from bacillus licheniformis
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
232
structure length
232
Chain Sequence
ASSSNPSDKLYFKNKKYYIFNNVWGADQVSGWWQTIYHNSDSDMGWVWNWPSNTSTVKAYPSIVSGWHWTEGYTAGSGFPTRLSDQKNINTKVSYSISANGTYNAAYDIWLHNTNKASWDSAPTDQIMIWLNNTNAGPAGSYVETVSIGGHSWKVYKGYIDAGGGKGWNVFSFIRTANTQSANLNIRDFTNYLADSKQWLSKTKYVSSVEFGTEVFGGTGQINISNWDVTVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDO-BETA-1,4-GLUCANASE
publication title Characterization and Three-Dimensional Structures of Two Distinct Bacterial Xyloglucanases from Families Gh5 and Gh12.
pubmed doi rcsb
source organism Bacillus licheniformis
molecule tags Hydrolase
total genus 71
structure length 232
sequence length 232
chains with identical sequence B
ec nomenclature ec 3.2.1.151: Xyloglucan-specific endo-beta-1,4-glucanase.
pdb deposition date 2007-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01670 Glyco_hydro_12 Glycosyl hydrolase family 12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2jemA00
2DFBA 3VHPA 3VHNA 3AMNA 2JICA 3O7OA 4IXLA 1TE1B 2DCKA 1QH6A 3WP4A 3LB9A 1XYOA 1XYNA 2VG9A 3WR0A 1REDA 2DCZA 3WP6A 3AMHA 3VZLA 3WP5A 3AKQA 1NLRA 1QH7A 3AKTA 3AKRA 3EXUA 3WT3A 1M4WA 4S2GA 4NPRA 3B5LB 5K7PA 1XNBA 1PVXA 1XXNA 3RI8A 2D98A 1H0BA 2BVVA 1UU4A 3WX5A 4S2HA 3HD8B 1OA4A 3LGRA 2NLRA 3VZNA 1OLQA 1AXKA 1XNCA 3VL9A 4HK8A 1HIXA 1BCXA 4HKLA 4HKOA 1H4HA 3M4FA 3AMMA 1OA3A 1H4GA 3MF6A 1KS4A 4HK9A 3WXPA 2NQYA 3VZKA 2F6BA 2DFCA 1BVVA 3MFAA 1H1AA 1XNKA 1KS5A 2Z79A 1UU5A 1HV1A 3AMQA 3AMPA 2VUJA 4S2DA 5K9YA 4XQDA 3WP3A 3WQ7A 1YNAA 3VLBB 1BK1A 3VZJA 3VZOA 4H7MA 1HV0A 3MF9A 1REEA 3WQ1A 1OA2A 3MFCA 3WY6A 2BWCA 2JENA 2B42B 4XPVA 2B45X 3VHOA 5HXVA 4HKWA 5EJ3A 2VULA 3AKSA 3WQ0A 3VL8A 2JEMA 1IGOA 2D97A 4XQ4A 2BW8A 2C1FA 1REFA 1XNDA 2BWAA 3AKPA 3VZMA 2B46X 3RI9A 3VGIA 1W2UA 3ZSEA 1ENXA 2VGDA 1OLRA 1F5JA 1T6GC 1UKRA 1UU6A 1C5HA 1C5IA 1XYPA 2QZ2A 2DCJA 4XQWA 1H8VA 4S2FA 2QZ3A 3B7MA 2DCYA
chains in the Genus database with same CATH superfamily
3KV5A 2JG9B 3T2QA 3HJRA 3O7OA 1GWLA 4OCTA 4RL7A 3D82A 1DCSA 4PLMA 1TME3 4QPIC 3TYJA 5C4WA 1ZZ8A 1RVF2 4XHBA 5A3WA 2VOKA 2DCTA 5GLUA 1R082 5K0UB 1PGSA 1PGW1 3WW3A 1S2KA 1VLNA 2XMLA 3NKGA 4HFSA 1BBT1 2VUAA 2AREA 1OKQA 2HWC2 1JYWA 1G9BA 1UOFA 4E4SA 4LBNA 4XURA 3I54A 5FIXA 1U5ZA 1PVXA 1XNBA 4N9IA 5B4XA 5FLJA 4GB32 3VBSC 3I2JA 5FZ9A 3OD0A 2ETEA 1H0BA 4CDUC 4XC9A 2VC9A 4MHUA 2MEV1 3AL5A 1CZSA 2VL4A 3K51A 3ZO0B 1GFF2 2UWBA 1JU4A 1UY4A 2B4KA 2XJQA 2BGPA 1W2AX 1X33A 1RUJ1 4XACA 4OVEA 1JXNA 3N9QA 3URFA 4BCUA 4CPBA 4M3CF 5BPXA 3MLJA 4HMZA 1YQ6A 4MYEA 2VECA 1BLZA 2PHLA 5FZBA 3PU8A 3LPFA 5LASA 4Z92B 5EJ1B 2J1AA 4QB1A 1KS4A 1I9RA 3ZDVA 1PVC2 1AUYA 5A32B 3VD7A 2YUEA 3MW2A 1W6MB 2JB4A 2CDOA 3ILRA 1EV13 1A34A 4QDRA 4XDQA 1QOTA 3WDYA 4AXOA 4A6OA 3T0BA 1YI7A 4XJZA 5JZGA 1HV1A 5IATA 1YI9A 2UYBA 3IBMA 2QCSB 1AJKA 2EA7A 4NPMA 3GALA 2G1MA 3ES1A 2ORXA 4P9YA 4WV8A 4D7YA 3WHUA 4XQDA 5HCHA 2ARBA 1DP0A 1T2XA 2W39A 3I3BA 5C70A 3MV11 3WQ7A 5FXVA 3CBNA 2XJVA 1MZFA 2YBSA 3AP4A 1RITA 1LEMA 3IPVB 5IVEA 4J25A 2PHRA 1M06G 2QQOA 4TSVA 3A21A 3USUA 5BNNC 5J48A 5F7UA 2QUOA 4XMIA 2VY0A 4NN0A 2DUQA 2VTXA 2Q1ZB 4FAHA 2YB7A 3POJA 2ZEZA 3K46A 3BUCA 1J3QA 4CP0A 3O1VA 4I0BA 4IV3A 2YPDA 1BBT3 4QWNA 1G9FA 3KB5A 4XFGA 4JDMA 5ANQA 2ENRA 1POV3 3B93A 3IT8A 3TEXA 5BNQA 2RDQA 2HBTA 2RS31 2X5IA 2OX0A 5I0DA 4FPJA 3PUAA 4EN8B 2BNOA 5DUUA 3POIA 3POYA 3WSOA 4XZUG 2X8KA 3VBFA 2X09A 1AXYA 3OGSA 2DTYA 4I0WB 5DUVA 4AFDA 2MEV3 1S0DA 2VE1A 4LKDA 5CBLA 3R05A 4R9AA 3AJYA 5AC92 3OOXA 4WVMA 4L8QA 5CAZA 4JRAA 1RUC3 4AFAA 2BGOA 5KC6A 1W2UA 1RUJ3 2G9FA 2WBKA 3IDEA 4FP3A 4CCJA 2CY6A 2Q8OA 4LBKA 1T6GC 1AX2A 2PTMA 4L92A 1PM7A 3JB8A 3U07A 1MQTC 5A3UA 3SCFA 1UN1A 4B4RA 1NA1A 2YY1A 3H50A 4JKKA 4NHXA 2YG0A 5T5OA 4YW2A 5F1RA 4Y4RA 1GYKA 1RUE3 4MGKE 2RR13 3I2GA 4P14A 4DEQA 4PF1A 4DZGA 2DCKA 1BZWA 5L7OC 1NCQC 4IGPA 4PT6A 3FLPA 1D0HA 4I01A 1UXXX 4K1ZA 3RMXA 4CDQB 1OD3A 1RC6A 3ZYGA 1PO23 4WM7A 3LEMA 2DCZA 3IAQA 1H1MA 5EFUA 2E51A 3RYPA 2RM22 1CAVB 2XBO2 1AR92 3NMBA 4AI0A 2ZCWA 4NAOA 4XF9A 3H8RA 4S2GA 1UY3A 2I07B 2VR4A 4M4RA 5FPZA 2O8QA 3F95A 4D6RA 2A3XA 3HOBA 3CQOA 5JXJA 3OD4A 1PNFA 2RDSA 2WZR1 3S30A 1GNYA 4BB3A 4LBQB 4DUXA 2P37A 5FYYA 4O9EA 1VAKA 3LA7A 3JXSA 3NNFA 2VUCA 4HKOA 2DURA 4IEQA 2JWPA 4KG8A 4YW5A 5CA6A 4AAPA 1Y3TA 1OA3A 4XUNA 3W59A 4ES8A 4K6BA 1HRV2 4A2UA 4UFKA 2NQYA 2ZAAA 4IEPA 4PHZA 2OQ7A 5D8AA 4UF0B 5C8CB 2VCCA 1YQ5A 3PNAA 1XNKA 2XL9A 1FOD1 3USSA 1UU5A 2WO3A 3RSJA 1RHI2 5CFCA 3TN92 4XIKA 4IEWA 3B9CA 4HANA 4XAEA 2W1WA 2AC1A 3C8XA 3GXUA 1OKOA 3JBG3 2HEYF 4W65A 3WW1A 4IW3A 1WUVA 1QJU1 1XOYA 2B7YA 2ZHLA 1S0FA 4JHTA 4JTOA 1ZZ9A 4CEWC 1Z78A 1O3SA 2W1QA 4UAPA 4E8CA 5C71A 4NIHA 3LSDA 2WN2A 4QKFA 4PBOA 2UWAA 1GNZA 1LCLA 1OQEA 2RJ2A 3K48A 4CSWA 4YVSB 2VBBA 1ND3B 1YQCA 4EZHA 4C8DA 2BWCA 5F6KA 4BU2A 5A6YA 1GZWB 3HNMA 5JCTA 4RR3A 1NZCA 3HPNA 1W03A 2WLQA 1NZIA 2K0GA 3RZKA 2JIJA 2P6CA 2WO2A 1F9KA 1HQNA 2GNMA 3IZOA 4E2QA 3K77A 3AZYA 4QQHA 3VD9A 3FLRA 3KLSA 5FXZA 3O1SA 4IE5A 5FZEA 2ARCA 1Z7S1 2R49A 4P5HA 5KXEA 1J1TA 1POQA 2JB8A 3ELNA 4V2WA 5BNPA 3FE5A 2CAUA 3H9AA 4IE4A 4ITCA 2OW4A 2WZR3 4MH0E 2RS11 4LUMA 5FY5A 3WNOA 5C33A 3RI9A 4QXBA 1VRH1 5C9AB 2WNUA 3P5BA 1RUH3 4G4FA 5GZFA 4UXAA 3VDCA 1WW4A 4AFCA 3KV9A 3OYWA 4FPCA 4FTSA 4YM1A 3AJZA 4Q4Y2 5H9QA 1AL23 2FDGA 2QQLA 2QZ2A 5T55A 3KZ4C 3WCRA 2OZ6A 3OGGA 4AI3A 1MACA 2A5ZA 3FZ3A 5EJZB 2Q5TA 4XDPA 1KFXL 1OUXA 2VZQA 2WL1A 3THDA 2GZWA 4QGNA 3WW2A 3W5MA 3ORJA 4C91A 1O7FA 4YARA 3MUZ1 1FOD3 1MS5A 1G7YA 2WS92 3NKTA 5BXXA 1IS3A 4FSJA 5DAVA 3A7QA 5FYCA 2WAOA 5FZ7A 4AE2A 1C3HA 3ZSKA 1V9U2 4QX1A 1QJU3 3TEYA 2AACA 3IIAA 3U1XA 1QJX3 5F39A 5I8SA 3FL7A 2R1BA 2WA4A 2JDPA 1CZVA 4CP9A 1XXNA 1R1A2 1R64A 2D6MA 2A7AA 1DGRN 2P3KA 4XIOA 1V6NA 3DYOA 3ZFFA 2FDKA 5DPNA 1UPIA 4S2HA 5JIAA 5CFDB 5I0RA 4AWDA 1UW8A 4QB2A 4XEZA 2WWUA 1GQHA 3T4HB 4AHZA 4Z07A 1UOGA 1YFWA 3KCCA 3J8F3 1MVEA 4GQ7A 4JGYA 2E9QA 1WLTA 3RQ0A 4AEDB 1UIJA 4DXRA 3FBYA 4GMP1 4NHLA 3UNPA 3M4FA 1SLIA 1KDMA 5C6CA 1Z7S3 2EXKA 2XHNA 2CU5A 4YZ3A 4LA3A 2DFCA 1AX1A 4UFMA 3ZFGC 1UMHA 2QQNA 1GWMA 4MGIE 4IE6A 3WDWA 2OXBA 5C4WB 1ASJ2 4H3WA 2PHWA 2JG9C 1ZM1A 1DYKA 4BK5A 4G3YC 2IXKA 2WWSA 4FOQA 5B4NA 2EF6A 2IVJA 3NJVA 5JI7A 3VBUA 4DQAA 2C26A 4Q4V2 3WP3A 1F5FA 4OZXA 5K0UC 3LE0A 3VKNA 4KWLA 1EPWA 2ADDA 3SH3A 5J3UA 5LA2A 3J7HA 4A45A 2HWD2 5FZDA 3MF9A 1D4VB 2D6PA 2RJLA 3MICA 4WVVA 5H9PA 2BV4A 2V09A 2ZEXA 3AYCA 3ZFEA 4GWNA 2VTXJ 3VBHA 1H2LA 1QQP1 2WT0A 5FP9A 4BQ2A 1Q5OA 1RUG2 3GDBA 3RZZA 3LZZA 4LKEA 4CCOA 3LAGA 4A7YA 4XJWA 1LTEA 2JJ6A 1MZ6A 5IJRA 5IVVA 3GM8A 1ZBE3 4H7LA 3RJ2X 3MIDA 4QX0A 4CDXC 3HAGA 2VMFA 3N9MA 2JEMA 4HG6B 1VBB1 1LR5A 2WJSA 2ZGMA 2J42A 4KI5M 3ZN4A 1OQ1A 1XNAA 3EYPA 4CCLA 3C7OA 1BKZA 4XQ4A 1ZRRA 2YFUA 1BMV1 5FAXA 3ACLA 3HQUA 4MGTA 1F35A 1HJFA 4KH9A 4W4ZA 4Q8KA 3E6CC 4B1MA 2G19A 3ZLIA 5JZGB 4UFJA 1OLRA 1XU2A 1YYNA 2V5DA 3PLQA 4IETA 4XJ8A 1IOAA 3N4MA 4UT5A 4BQ5A 5LEKA 4R8HA 3R4DB 2HKXA 5EQUA 2X05A 4OUEA 1LESA 3HT1A 3WF1A 2QQJA 1JTZX 1ZBA1 5BUVA 4RGAA 1W9FA 1WMFA 1VB4A 1WLCA 4LTAA 3USUB 1RUF1 2YXSA 5KXCA 1J3RA 3PVNA 2DUOA 5KXBA 5F2WA 5L9BA 3OBTA 1K42A 2VW2A 3BGAA 3R6SA 1AR82 1RYYA 5A3NA 1QJY1 2H6CA 1VMFA 4LK7A 2JKXA 4IV3B 3V0BA 1BYHA 1QJFA 1W8FA 1NXMA 3EXUA 3M3QA 4QGLA 4AQ2A 1OHFA 1VMJA 2X5IB 4ASMB 3ZMNA 3CJXA 2JG8A 2YGLA 4LHKA 3BTAA 3VBFB 3WDVA 1AYM1 4OFGA 3RI8A 4ZZ5A 3NJXA 1XE0A 2J1EA 4QKBA 1GQPA 2BVVA 3ROUA 1PK6A 3Q8BA 4DXTA 4WVMB 2YBPA 1S2EA 1X7NA 3C7FA 4QX2A 1UYXA 2VAUA 2VNOA 1OPOA 1YIFA 2ES3A 3NNLA 2IUWA 4L97A 1BEV2 4LOTA 4HETA 1QF3A 4QM8A 5LEJA 2F17A 2R041 2FCVA 5JSPA 2UY9A 4MO3M 3CJIA 4Q5OA 1H4GA 2ZMNA 4JGZA 1NA1B 5LA1A 3WXPA 3LA3A 1OLMA 5JOWA 1W6NB 1C1LA 1VIWB 2Z79A 4AVTA 5FOBB 3EO6A 3ZR5A 1J83A 2BOJA 1JYXA 1LECA 1RUI2 1GU3A 3POBA 4WM7B 5FJHA 3DCQA 5F3GA 5K9YA 4CDQC 1JZ4A 3HNYM 4QD2A 1E5IA 1JS9A 4WVZA 1EYBA 1DIWA 4CDWB 5IK4A 1Q56A 3CU7A 4UBGA 2V4AA 2NYYA 3ACHA 1ZBA3 2R16A 3M3EA 1Y43B 2XJUA 1W0OA 4YFZA 3O1MA 1UY0A 3ZKUA 5T54A 1GZTA 5FYTA 3M70A 1ODNA 2VOXA 2D44A 1SHWB 3DPRC 5KHIA 3MV01 1PX3A 4TYSA 3VHRA 1QJY3 3C7EA 4EE2A 4KG0A 1OFNA 1X9TA 5LCWL 1OVPA 1FMD1 4AQSA 3LIHA 3ZXEA 4YW6A 4KWJA 3S57A 1Q8OA 2XLGA 2GNDA 3P6BA 1D4M1 3WQ0A 1MR5A 1JYNA 3QLQA 1HB1A 4AAXA 1ZRDA 1AYM3 3UESA 1WMEA 1DLLA 3GHMA 4CP2A 2LRPA 3MGUA 3ZXKA 1V00A 5A70A 5D8AB 2J22A 1VJ2A 5FOJB 4XF0A 1WW5A 4XJAA 3A0NA 1QXPA 4LIVA 5A3OA 3ZSEA 5FYIA 5CFCB 1OQDA 3U78A 5C8CC 3BN6A 1YIPA 2OQ6A 5FPXA 2ZGNA 1SFNA 3M3CA 3UGHA 2R043 2PLV2 1MS8A 3TRSB 4P5YA 2EXJA 1URXA 5HCFA 2CHHA 2HWF3 5JXHA 3B7MA 3NAPA 4IE7A 1I1EA 1KGYA 3AL6A 2KXLA 5I0TA 4XHXA 4F83A 1DHKB 3N3HA 1QY4A 1IQDC 3IDCB 3LEGA 4BXSV 4LITA 1FAYA 3PIGA 4RR3B 4AYUA 1B09A 5M0TA 2LUWA 2ZGTA 4YVSC 1ND3C 2HLEA 5FYSA 4FTEA 3GZAA 2YMZA 4ZU5A 2JD9A 1W6QA 5T50A 1LENA 2VNVA 5A1FA 1U0AA 3RZJA 4E4HA 1W39A 3TWIA 1MZEA 1NQJA 4LQRA 1FATA 2Y38A 5BNPB 4HXCA 1R092 4BPZA 1A3KA 1JZ5A 2N7GA 4BISA 1HN1A 2WQ4A 2XJPA 4JCKA 3NV3A 5LW9A 4Y1YA 2WNUB 3MIEA 1AXKA 3D0JA 2AH2A 2W0XA 2ZS6B 3AP7A 2GMPA 3LFMA 3OYWB 4YGEA 4B3NA 2HWB1 1D4M3 1YWKA 4PLOA 1MS1A 2XVGA 3KV4A 5FZ1A 3WNXA 5C9AC 2ILMA 1SPPA 1IHMA 3AXDA 3I4IA 3AVRA 3A22A 4Q4W3 3OUIA 3H3ZA 1L3JA 3H1YA 4CUAA 3B9IA 1JODA 2AYHA 2DVAA 3LEIA 4QX5A 2FMYA 4JKLA 1N3OA 1DGWX 2KM2A 5EYYA 2PHFA 5LBCA 3ST7A 1QXJA 3KWVA 4N7UA 2WFF2 3OBZA 2W47A 5DAWA 4INDA 2DU0A 2R061 3T0AA 4DRVA 3ZOIA 5FPBA 3JD71 1QEXA 4XDOA 3OCPA 3UL2A 1OBNA 4DFSA 5J96B 1VBA2 4LT5A 4Y33A 3R4SA 1VBD1 3MYXA 2B5HA 3I2DA 1LHUA 1GV9A 2D40A 2GNBA 4RHV2 4CP9B 2WC2A 3BU0A 2VQUA 3RNSA 3MFCA 1C8M1 3ZFFB 1W9WA 2XB6C 4QPYA 2YPJA 5FQ0A 4EROA 4YZ4A 3H42B 1EAH1 3AYDA 4Q27A 3WNNA 1H1IA 3GBWA 4DS0A 4UOJA 5A7WA 3AP9A 4JGYB 4FFGA 1W8WA 2QDRA 3PTYA 3ABZA 5GKAC 2VULA 4QT6A 3AKSA 2D6NA 4JTNA 3BU7A 4Y1UA 2FDHA 2A6WA 1I5ZA 1W6OB 4AEDC 4JZRA 1A8DA 3T1MA 1LHVA 1RVF1 2WNVB 2K46A 1ZVFA 1C8NA 2FMDA 2C1FA 4AEKA 1REFA 2Y0IA 5FRAA 4AI1A 1RMU3 1GWKA 5I0UA 1ALYA 2GC0A 1GBGA 2HWC1 2HWE2 4M3CA 4IV1A 1JH5A 4QM9A 5FO8B 3RZHA 1TQ5A 3HN3A 2DF7A 4UBHA 3NNJA 5C4WC 2PAKA 3VBUB 2HWB3 3MPPG 2GC1A 1JN2P 4NHYA 3J7NA 1ULGA 4CEYA 5FPVA 2D6LX 2QQIA 2ZX0A 1RIRA 3H3UA 4Q4X3 4TLGA 4XOGA 3SCHA 1UPSA 5FZGA 1HXS2 3RDIA 2X29A 4DRRA 2DFBA 3VHPA 4FPOB 4IQPA 2KD7A 4P9IA 2JICA 2ZMKA 4I30A 3DYMA 3ZXJA 4LBQD 1YFUA 3GCWA 1XB9A 1PO13 4OMCA 2QFEA 4PIZA 3ZFEB 4AR2A 3VBHB 3BIWE 3GF6A 3MO4A 3F2ZA 1X82A 3SH5A 1OOPA 1HLCA 3H8OA 4EN6B 2XWBB 1EV11 1WCKA 2R063 2VBDA 1PVC1 3JD73 3AKTA 4FPFA 4C0HA 2DV9A 3PUIA 5A3PA 1W28A 4BMBA 1NLSA 5GM0A 1Q3EA 1WCUA 1J1LA 1GOHA 4XZPA 2DVDA 5DDJ3 3ZIXA 2R073 4PI2A 4F7ZA 4FVVA 1C8M3 1UZ0A 1L7QA 3IMNA 4K40A 4DINB 1LGBA 2VNRA 1UU4A 3Q8EA 4P00B 5GLZA 5E16A 1RL3A 2VZRA 3A4UA 1EAH3 3CZUA 4MSVA 3OGVA 3ZYHA 4LHSA 1X36A 3BIEA 1F4HA 2CWSA 1XNCA 3E6BA 4JC1A 2A1XA 4RSUA 4FOWA 2H0BA 2QTWB 2PN5A 5D21A 1CIYA 1YQ2A 3NV1A 3W58A 4AEJA 1XQNA 2IC1A 2DBIA 1OF3A 3KCXA 2B39A 3MF6A 4U36A 1B35C 4XW3A 3LD8A 5LZ6A 1RVF3 1POV1 4E27A 3O12A 5L36A 1IG0A 1R083 1W9SA 1V6JA 2ZX3A 3P1IA 4KGQA 4YVWA 5GLTA 5A1LA 1SFPA 1KS5A 2WO7A 2HWC3 1MZ5A 4AGVA 1NXD1 4MGZE 4OI4A 4PIYA 5I8YA 5JLVA 4LLOA 2JE9A 3VDDC 1ACCA 4GB33 3X29B 4PJYA 2DYCA 4GWJA 4NRPA 2YBKA 5DQ0A 1RUC1 4ORFA 5J09A 5JMOA 1NG0A 3ATGA 2P1BA 4PQ9A 3MZHA 4N43A 5DZFA 4IV3C 3RVHA 2JG8B 3OBRA 1CIWA 2W52A 1PMJX 3FHAA 1UX7A 5FLIA 2DVGA 2EXHA 1K45A 4MXWA 3RZMA 1JUIA 1O5LA 3FC0A 1Q8VA 1S0IA 2X5IC 5FFOC 1HKDA 4BYYA 4OHYA 2VXRA 4K8RB 4WM8C 3W21A 4X6QB 4AGGA 1PK6B 5GZGA 2R0HA 4XF4A 4QPGA 3I2IA 4U2AA 3VBFC 4AZZA 4YSFA 3UYJA 1RUE1 4FFFA 2RR11 2Y64A 4R9CA 4COYA 4UFIA 4KU7A 3KGZA 2NZ9A 4M01A 1PVC3 1WW6A 2RG4A 3K4ZA 4OUSA 2PHTA 5A80A 2RMU2 4LORA 1RJ8A 3BPSA 3VL8A 4HSLA 4OZOA 4COUA 1PO21 4V1PA 4KQ7A 3D4KA 4JGZB 4RYDA 1NE6A 4W50A 1UY2A 3KT1A 2A6ZA 1O4TA 4FPYA 2AR6A 1QOSA 3OG2A 1LRHA 4MXVA 1NA1C 2Y26A 3VZMA 2BERA 5JOZA 1IPSA 2Q0AA 2RM21 2XBO1 1AR91 2VCAA 1COV2 1LU2A 1ULDA 3T1LA 5HXMA 3LSEA 3ZYFA 3JUUA 4QPIA 1UU6A 1GOFA 1IS5A 2W68A 3DXTA 1C5HA 1XYPA 4NVPA 4QHZA 2XL7A 3T30A 2DCJA 2JDNA 4XQWA 4XCBA 4MGSA 4WZFA 4LIUA 1UWWA 1WMXA 1NKGA 4IEZA 1FXZA 4CDWC 1C28A 2F4LA 2DTWA 3AFKA 3LFIA 1TE1B 1Z0HA 4BJ0A 1LGNA 1S0JA 4I02A 4CU7A 3AZXA 4CCDA 3AK0A 4NR1A 2D5HA 4FAGA 4XFCA 4OULA 5E1RA 1X8MA 4BQ1A 4CDUA 4EZ4A 4OQ8A 1QDCA 2XJRA 3AMHA 1GP6A 4CZSA 5FZ4A 3FN9A 3OB8A 3OF1A 2XDVA 2P34A 1UYZA 5FLHA 3C7GA 5AC93 3OGRA 1RGSA 5A3LA 5JSRA 1H9WA 1ZRIA 2YDEA 3JBG1 5CU1A 4PI0A 3HT2A 3TN91 3WF2A 4KBZA 3RYKA 4AHXA 2VOTA 4QXKA 4IEVA 3WX5A 3MIGA 5D8AC 1HB2A 2XG3A 3JQXA 5DUXA 2TNFA 3ALQA 1SLAA 1NX9A 3E5XA 3WG2A 5DMYA 1HIXA 2E7TA 1VPHA 4RGGA 2ZGOA 5CFCC 4UI9L 5FR3A 2B8MA 4PDWA 4Y3OA 4Z82A 3AMMA 2WABA 1SDWA 2W1UA 1X50A 5I8TA 1VBC2 3GZUC 1LKNA 5KBFA 3NAPB 5DAPA 1QKQA 1OUSA 2A3WA 3VZKA 3RFRA 5F8PA 4BWOA 4BK4A 2XHKA 2F6BA 4Q1RA 1ST8A 4B1LA 4Z8BA 2K9ZA 4FPLA 1C4RA 3ZDSA 5L19A 4OLLA 2GP5A 2RM23 5JMCA 2XBO3 1AR93 2WYSA 3A23A 1SMVA 1JZ2A 4JKMA 1S1AA 2XONA 1NLQA 4HBNA 5BNNA 3ME2A 3HNBM 3ITQA 4IEYA 3UKVA 2CTVA 3ZXDA 5FZ6A 5IVJA 4RR3C 1W6QB 3PHMA 5GLVA 1LOCA 4LBJA 1W99A 1RUH1 1W2NA 2Z5WA 5CIRA 5EXOA 3VLBB 1GICA 1O4ZA 1RXGA 1BK1A 1QNYA 1YFYA 2VQ0A 3C7HA 4P9WA 3VZJA 4RA0A 4UW4A 1IS4A 1AL21 2WZEA 3UGFA 1T6BX 4LBMA 2VMDA 3MLKA 4BQXA 1LHWA 5FKCA 5E8AA 3IDBB 5LA9A 4QU2A 2BOIA 1SG3A 1V6IA 1JYCA 2XR4A 4Q4Y1 5BNPC 3QACA 5FUNA 4AVSA 4JRLA 3MDPA 2E7AA 4TXWA 5HXVA 2PQQA 5FZ0A 3MPBA 1HRV3 4YLZA 3AC0A 2P5BA 2TUNA 4LEJA 2SBAA 4KWKA 2WNUC 2RS32 4MLOA 1SPPB 2P4EA 4CRQA 2V5YA 5FPUA 3MIBA 5FY0A 4Y26A 5I93A 1UY1A 5JR7B 1RHI3 3PURA 1NY72 2E26A 3DN7A 3OSDA 3TN93 4CE8A 1MQTA 3ZSMA 2WDBA 2ZTNA 5CG8A 2JECA 1QJX1 3KVAA 3AKPA 3K2OA 1ND2A 3PVEA 1EUUA 2VO5A 2D5FA 3SEEA 3H1WA 1UXZA 1UD1A 4A42A 1W8HA 1CPMA 2XKPA 1NCQA 3H1MA 4NWWA 1V6MA 1WA6X 1IS6A 1IZ3A 1R1A1 1TNRA 2VXJA 5FK7A 3GNEA 1YO8A 3ZMOA 3J8F1 3RZGA 5F9TA 2VZ3A 2W94A 3VKOA 3AMNA 2Q8CA 2PYTA 5J98B 1ZZ6A 5IVYA 2MHFA 3O1PA 1GKBA 4Y20A 3KVBA 4K21A 2WAAA 3MIFA 4MVTA 4LO5B 2Q1FA 5FQ0B 3PIJA 4YGDA 1JZ6A 2GH2A 2C5DA 4AL9A 1QOOA 1XYNA 2ADEA 2ZBJA 4BM8A 2RS52 3ZFFC 2OUJA 5C3OA 3BOPA 5A7WB 3POWA 3ZYJB 3FX3A 4M00A 1POV0 3T4VA 1TG7A 3BALA 4DUWA 2VUDA 4N9HA 5F6LB 1K3IA 4GKYA 2DVBA 4DOUA 3T09A 4BQ4A 1V70A 2BVBA 2YC4A 4HVQA 1DQ6A 3I7DA 3VBOA 3JZVA 2AZ5A 2OS2A 1RUNA 3IMMA 4HZFA 1AZDA 5FMOL 4Q4Y3 2OVUA 1XE8A 4H14A 3W9AA 2WNVC 4GULA 3B00A 2NLRA 3R0RA 4IV1B 3SCGA 2IXLA 1SBFA 2WIIB 2ZZJA 4UW6A 5FYUA 3LDBA 4GA9A 5C7GA 2GNTA 2OA2A 3OPZA 3E6DA 2HWD1 2QVSB 4N53A 4NAMA 5I0SA 4CEYB 2VQAA 1ZZ7A 2BNNA 3ACFA 3VBUC 1O5UA 4CU6A 3I97A 2WS93 1RUG1 2BYVE 1JW6A 4FPKA 2QQKA 1K5MC 3EBRA 3WDXA 1ZBE1 5FY4A 4UWDA 1LAJA 1H6YA 1V9U3 1I3HA 3WLUA 4CEWA 1PGL2 1GP4A 1P8JA 1OOPB 2Y6HA 1HDKA 4AI9A 1YJLA 3VBHC 3AVSA 1ZNPA 3G6JB 1KXGA 3V64A 1VMHA 1CONA 1R1A3 3AX4A 2LROA 4C0BA 1HN0A 3B94A 2E53A 3MBWA 5JVVA 2QNKA 4ZONA 2QQPA 4AFBA 5JAXA 1RUOA 3SISA 5LA0A 2R30A 5L73A 1XSQA 3CHXA 4EN7B 4CXYA 1YRZA 4HL0A 1GZCA 1GMMA 4FQZA 1MEC2 2VW1A 3FLTA 4DPNA 3A0KA 1W8ZA 3TNPB 3VHOA 1G9CA 3GGLA 4R52A 3RYRA 1LNSA 3H3LA 4LLFA 1D2SA 1XNTA 4XVHA 3L2YA 5FY8A 2NMOA 4CXXA 2WLPA 4NOTA 2VZ1A 3SNMA 1JZ3A 1ASJ3 2XOMA 4Q0SA 2V4VA 4LE4A 5T5PA 2ZA9A 3BTXA 4YVWB 1RB8G 1XPWA 1GQGA 2PMWB 2RS12 4MHRA 4OQ9A 3RRDA 1WA4A 1LULA 2ZX4A 4Q4V3 4OHZA 1VRH2 3MI8A 1SBDA 3JU9A 1A78A 2GN3A 4XUTA 3AXEA 2YFZA 3MW4A 5F5AA 1F5JA 4QHOA 2BP6A 2HWD3 1UKRA 3N9LA 1EPZA 4HLTA 2C0ZA 1O8SA 2JDAA 1MVQA 3UKNA 4N43B 4B4QA 5C8WA 1OURA 4A7KA 1RUG3 3PVBB 1YXWA 1TVGA 1N1YA 3HQRA 1LODA 2K2SA 3PTRB 4L99A 4NIAA 4MXWB 3VN4A 3O1RA 5CG9A 5FTTC 4CU8A 4URAA 4ZZ8A 1MS4A 5FMOS 3RJRA 4EJRA 1N1VA 3PUSA 3AZVA 3GHNA 3LKJA 5HI0A 3ZR6A 4QPGB 4TLFA 4DMIA 2Z42A 4E4DX 1D0GA 2GALA 4F8AA 4NIGA 1MPXA 1NYWA 1PK6C 3WUDA 2VZSA 3ECQA 1DZRA 1GZ9A 2Y6LA 2CL2A 2ZX1A 4GH4A 1ZREA 3WT3A 1H2MA 3GJAA 5T52A 4QQPA 5FPAA 2Q30A 4YPJA 3FFQA 2W2IA 1W0PA 3CEWA 3LDRA 1NCRA 4HN1A 5LRRA 4JGZC 3POGA 3ZYBA 4KWUA 1RUI1 4A3XA 2JDYA 1RUD2 1O6UA 4LBOA 3VD5A 4CUGA 3Q9OA 3SKVA 4M4PA 2QKDA 4BA6A 1SLCA 4FFIA 1UQXA 5ERLA 1UNBA 3SC7X 4QPIB 2MNGA 4HKLA 3S7IA 5ACA2 3UKTA 5FYZA 4JX0A 1IQAA 2OPKA 5JOXA 4D7TA 2HEWF 4LHNA 3ZM8A 2IZWA 1UIKA 4IGQA 5CISA 2I45A 4CCCA 1AX0A 1AR83 4CUBA 3MFAA 2WT1A 5K0UA 3MHZA 5LY1A 4HSJA 2YV8A 3KM5A 4GWIA 1W9YA 1LOBA 2V72A 1W6PA 2WO1A 1L7RA 1EY2A 3SMHA 3CIHA 4LJHA 4BLJA 2VCBA 3IN9A 4Y4YA 3KT7A 2NP0A 4K1YA 4P9XA 2X10A 4SBVA 3U4SA 3ZYRA 1KJLA 4NJ4A 5FMDA 3OEBA 3UJOA 3JCIA 3VZOA 4MZUA 1VB2A 3RG0A 4I3GA 2ZGQA 2AUYA 4CDXA 5C3SA 1BEV3 1QQP2 2HWF1 2XXZA 3EB7A 2L9LA 5LBEA 4A6SA 5IAVA 1CAXA 4AGRA 2VOVA 2B42B 1UAIA 5JXGA 1CR7A 2PLV1 1FI2A 5GZDA 3R4UA 2QBXA 1WMDA 4JVAA 2XQXA 3EMRA 1JZ8A 5FY9A 3AB0A 2Y0OA 4AI2A 5F37A 5EJ3A 2WA3A 4RQPA 3LDKA 2E63A 4PDWB 4X8NA 4EN0A 1VBB2 3B69A 3DUIA 3JQWA 1Q8QA 1TEIA 1Y9QA 2VNGA 2F4PA 4Q26A 4ES9A 1BMV2 3OEAA 1OH3A 1RUI3 1SEFA 2BFUL 3NAPC 3NJZA 3ZXGA 2EXIA 1ULPA 5IK8A 3SKJE 3ZKYA 4NE9A 5JPMB 1UOJA 4OI2A 5ABJA 5BNNB 1ZZCA 2ID4A 5GALA 1DG6A 2WZPP 3RWKX 5KHJA 5FUIA 3FHQA 3I3MA 4P9GA 4B7KA 4ISRA 1R091 1W90A 1O3TA 5FZOA 5BV6A 1E5SA 4DIQA 5FREA 3KQRA 2ZHKA 2OUHA 3KSCA 4ASLA 3HBKA 3VV1A 1DZQA 4WBBA 4J6GA 3FJSA 3O0XA 1RUF2 2JDZA 3VD3A 1G9DA 3J26N 1QH6A 4FP2A 4Q4W1 3TAYA 1FPN2 1ODMA 3ENRA 3WINE 3OPWA 4FPHA 4BIFA 4NRMA 1U5XA 5FYVA 3ETPA 4OHVA 1H2NA 1NLRA 4TN7A 4V2VA 4XAAA 3POSA 4UYBA 2VM9A 1AR72 5FCCA 4HN0A 3WNPA 4N8MA 3GJBA 5FY7A 2ZACA 4GJYA 1G86A 4QMAA 4QKNA 3N36A 2D98A 4XF3A 1TMF2 5DZEA 3P3NA 5LK5A 4AHWA 2E33A 1SLTA 1CAWA 5T5LA 3WF3A 5AVAA 2WFF1 2C9AA 1ND2B 4C90A 2PLV3 4K20A 2NN8A 4XFAA 2FDJA 5F3IA 5FWJA 1O59A 3M3IA 1DYPA 3VL9A 4XXPA 4AW7A 3ZYPA 4E8DA 2ARAA 2VBPA 3ASIA 4IESA 4EWDA 2WRAA 1PIV2 3U4XA 4DUVA 5APAA 4RHV1 1DGWA 1H8TA 4O61A 3FUOA 1G6NA 3RGBA 5CKMA 3SHRA 5A6ZA 3HWJA 1QU0A 1SCSA 2IVIB 3OY8A 4Y20B 5DUWA 3SQOA 4JDOA 5DG1A 3AP6A 1ZA7A 2LS6A 3MW3A 4NMIA 4YFWA 4YG6A 4ONUA 1H2KA 4XYXA 2VPVA 1RMU1 2ET1A 2WINB 3DPRA 3EQEA 4W6YA 2VVEA 1R093 3KMHA 5EZWA 4RFT0 4B8EA 4JHZA 2VU9A 1DLCA 2J1VA 1SQ4A 2R7EB 5D2AA 2QQVA 1NOVA 3VBOB 2BFUS 3AZZA 4Q4X1 1WWYA 4PCRA 3ON7A 3CLPA 2JENA 1LHOA 2D43A 3DXUA 4CU9A 4Z1VA 2D7FA 5JIUA 2D6OX 1PO11 1YCIA 1FMD2 1DGRA 1GNHA 2IXHA 2WWJA 4HKWA 3VBRA 1HB3A 3I2HA 2RVAA 1BVP1 4IV1C 4N53B 4QHBA 3AYEA 5B2GB 1HQWA 2J7MA 1U12A 2A75A 1LOFA 1CJPA 1BJQA 3NJYA 1S4CA 2GMMA 2ZGUA 1CWPA 4RFRB 1QWRA 2WFF3 2BWAA 2JE8A 5CZKA 4CEWB 4COVA 2B46X 4CCMA 1ENXA 5DDJ1 2SLIA 2R071 2VGDA 1UL9A 1S0GA 1VBA3 4YNIA 4BLIA 5G04L 1Q43A 2GMEA 1GUIA 2QQMA 4FCAA 2W91A 2Y6KA 2WNOA 1OOPC 2WT2A 1OT5A 4RHV3 3MEPA 5FZHA 3THTA 1WBLA 3WG1A 4O9GA 2OIIA 3LQCA 1MS3A 1W0NA 3T2OA 5CFDC 4RN5A 4IEXA 4QX8A 1CAUA 2BDRA 3PMSA 3K4AA 4IXLA 5FO9B 2FZ2A 1YEWA 2Z69A 1Q8PA 3RWNA 5CKQA 5JWPA 1AYN2 5AFBA 4A41A 2W5FA 2Y34A 4XFIA 5DAQA 3SH4A 1KRIA 2J1SA 1R081 2EIDA 3PMEA 1G9AA 2P3JA 1WZXA 4IE0A 3I49A 2AEYA 3AKQA 1VR3A 1WLWA 2WR9A 1VAMA 4L11A 4ET7A 5C3PA 5K7PA 2WSUA 4P9JA 4XTMA 2EIGA 4A3ZA 3RS6A 3IKWA 3NL1A 4FXGB 1HRI2 1VAVA 1VBE2 1KD7A 2GC2A 2HWE3 2HYXA 2IFWA 2JKBA 2ZX2A 5FZLA 2ZAHA 1O3QA 1CZTA 2D3RA 4ATEA 3OGJA 4GZ9A 5FXWA 1XU1A 3THPA 5FMBA 3WUCA 4QU1A 4E2SA 5FDBA 3KHBA 4YVWC 4ISQA 1AR62 1QXRA 1HXS3 2W92A 4DY5A 1W8TA 3WW4A 2Y6FA 1BCXA 5F32A 4AVCA 4GIQA 3VKLA 1GP5A 1I6XA 5F3CA 4YW4A 1N1SA 5FUPA 3UGGA 4KBBA 4RS5A 4ZHNA 2IXCA 1PZ7A 4MGYE 2UU8A 5LBFA 5C3QA 3WF0A 4C1WA 2W08A 4XE9A 1DU3D 3MLLA 1SFYA 1BQPA 4YM2A 1IPJA 2WN3A 2W87A 1WD4A 3KV6A 1VRBA 3N7JA 2A6YA 3S5AA 2YROA 3FUQA 1LB2A 4META 4IDZA 1BHGA 2BBVA 4S2DA 2BNMA 1H30A 2NMNA 5A1AA 4GH4B 3WHTA 1S0EA 1NQDA 1LEDA 1W2OA 2VQTA 1HW5A 2I2SA 4NIDA 1VBD2 1QHDA 1V6LA 4H7MA 4OHXA 5JZGC 1YJKA 2ZGPA 5FMCA 1REEA 4JAAA 1NCRB 1WW7A 4BZ4A 2E6VA 4O7XA 3O14A 3ETQA 3PVOA 1MS0A 5BNOA 4DXSA 4SLIA 3LIGA 1NT0A 3THCA 4AEDA 5JR2A 1E5HA 2WSVA 5E88A 2JE7A 2ORZA 3VB9A 1JUHA 5J37A 1TME2 1IG3A 5FPLA 2A71A 5CB7A 4FTBA 4Z2AA 4EYUA 5HCAA 3ZN6A 5FXXA 2BJSA 1Q8SA 1QJZA 1IGOA 2WZ8A 2ZGRA 5A7OA 1W06A 2BW8A 3KF5A 3I3EA 4Q0UA 5FZMA 3ZIWA 2NPIA 3ZPYA 4BQ3A 5H9RA 5AC91 5ACA3 4PIXA 3WQBA 1W6PB 4KL1A 4KNCA 1CESA 3GZTB 1APNA 5FKBA 4CCEA 2YGMA 2B9VA 2P3YA 2D93A 1UO9A 4BQYA 5ISLA 2R0FA 2ZGSA 4LA2A 1J59A 2BBAA 4W6XA 3KS7A 2BRTA 2ARXA 1W2TA 4GXLA 5JI9A 3B01A 1WLDA 2VZTA 3AFGA 4NPLA 4Q1PA 3CJIB 4XMAA 1TZOA 5FP3A 3S6PA 3SITA 4CDXB 3NNGA 4UFLA 4LMFA 1CAXB 5K4LA 2RMU3 2FBEA 3QOPA 4GAZA 2E7QA 3WVJA 2H0VA 2G9ZA 4FFHA 2BU9A 3WR0A 1OD5A 2YZ4A 3SEPA 1EV12 1VBC1 1AVBA 3WV6A 4RQPB 1STMA 2LW8A 1IKPA 5FWEA 2VZOA 4QKDA 3WDTA 2TBVA 4AF9A 3DL3A 4IGOA 4AVAA 1COV3 4PDWC 5EPAA 4WM7C 3ACGA 4K9SA 5IVCA 2OZJA 3I2OA 5A3TA 1ENSA 4A7ZA 1JHNA 2KA3A 2AENA 3L9JT 4NUBA 1YHFA 1B35A 2G4IA 4Y22A 3ZX7A 4NO4A 1OLQA 5GZCA 1W8OA 4XFBA 1AXZA 1UF2C 4IEOA 5A6XA 3T3YA 4X6RB 4AQ6A 4ZKTB 3M1HA 3UETA 5ABJB 4I0AA 3VBSA 3U0ZA 3WCSA 5FZKA 1BXHA 4HPKA 4LULA 5FZ8A 3U14A 5F5QA 4D7SA 1PGW2 5FZOB 5JSOA 4HK9A 1HRV1 2Q1MA 1BBT2 4UW3A 3KD4A 3VDDA 2BTVC 4L9BA 2VD7A 2Y6JA 4YYOA 4JQTA 1NUKA 3M3OA 4YM0A 5EP9A 3GBGA 2W1SA 4DY3A 4XJUA 5KXDA 1YC61 5FYMA 4Z2WA 2RV9A 4QB6A 2VCMA 5C3RA 1RHI1 2MEV2 1DZTA 3NNMA 4YW1A 1L7LA 2A3YA 4WM8A 1DQ4A 3FBMA 2XKOA 4ZU7A 5LWBA 1O3RA 1RUC2 2TEPA 3HVDA 3PUQA 4XABA 1RUJ2 1NY71 3UT0A 4NIIA 4YG3A 3U75A 5HBAA 4HVRA 4LKFA 1LJ7A 1HV0A 4XILA 2A70A 4XUPA 4AG4A 4AVBA 5IFPA 2FDFA 4AFMA 1UYYA 3WEZA 5CYYA 4BDVB 3WG4A 1CAWB 3IWZA 5FV3A 3I8TA 1G8WA 3G7DA 2B45X 1RUE2 1VE0A 2RR12 2UY8A 2JD4A 5EHDA 1XE7A 5FP8A 5JXIA 1VBC3 2V73A 2Y6GA 3CO2A 1ND2C 4FI9A 4CPBD 1WCDJ 4XBQA 1LHNA 2P6HA 2ZABA 3CL1A 2EALA 1JOPA 4FQ4A 1W6NA 4LHLA 1ZRFA 1PO22 1H8TB 3ILNA 5KR7A 4BOWA 2X53S 2D97A 4GALA 4K8FA 1ULEA 3BKZA 1KJRA 2YYOA 4YRDA 2RS51 5LRSA 2VW0A 3OY8B 5A7SA 1JBCA 3LCPA 1ENRA 4COWA 4CDWA 2CGNA 1SDDB 2RHPA 2PAEA 4D3WA 2PHUA 4XF1A 2ZGLA 4GJZA 4E9KA 2DBNA 1DQ0A 2W9XA 3DPRB 3I3DA 5CKNA 5F2SA 5CNAA 3EHKA 5KWRA 3LA2A 4XJ9A 4FPGA 4IUGA 5FYHA 2DCYA 2HJIA 2Q4SA 3OBAA 2VOWA 3VHNA 2IXIA 1W8NA 5F5CA 1SBEA 2UURA 4KGGA 2FD8A 1AF9A 2CV6A 1ONAA 4PLNA 2WS91 5DN2A 3OJBA 3RPQA 4BH9A 2RS33 3VBOC 5FZFA 2ET7A 5HV4A 1NE4A 3Q8FA 3CZJA 3WP6A 3K3OA 3VZLA 1V9U1 1QH7A 3VBRB 3AKRA 2JX9A 1N3QA 3TEWA 2HH9A 2LALA 3CNAA 3B5LB 2JDHA 2ZGKA 4NPRA 5FZCA 4ZXEA 1FNZA 1QDOA 2ZZQA 5L7OA 1VALA 1WBFA 3JBG2 4N53C 2RE9A 4L0PA 4URTA 1H6XA 1PGL1 5AFEA 5GLWA 1JOJA 3QBQA 3POFA 2BPA2 2DWRA 1WGPA 1GR3A 3BTZA 2C4XA 1OVSA 1W04A 1OC1A 3NVCA 4CTEA 5AVPA 4HT1T 1LOGA 4K7JA 4COZA 1W8UA 4W6WA 1CPNA 2WUHA 2HEVF 2VH9A 4Q0QA 4CCKA 1JOBA 4X8PA 5FYBA 1EP0A 1UOBA 4OHWA 2CGPA 1SCRA 2B9UA 4HONA 5J1XA 1D7PM 1CAUB 4LXLA 4YW7A 1MEC1 3BI3A 3ZXLA 2GH8A 4AHYA 2RS53 2YC0A 4JGYC 1US3A 1ZA4A 4ZS3A 5GJ6A 3ZN5A 4B29A 1ASJ1 3ACIA 3BB6A 2FDIA 1LU1A 2FCTA 3EJKA 1FNYA 1JU3A 3AMPA 2WZR2 2Q8EA 5IK5A 1KITA 2PHDA 4LNVA 5LB6A 2A6VA 2UYAA 4M3CB 4Q4V1 3M8LA 2GSYA 3U37A 1RUH2 3ES4A 4MUVA 4Y1XA 5HPOA 4RGKA 3L2HA 2FZ1A 2VMGA 5EWSA 4EN9B 1N47A 2ZHNA 1AL22 4O65A 1JYVA 3HMYA 4QXHA 1OA2A 4YWAA 2P3IA 3D8CA 3FFZA 3O0WA 3I59A 3NV2A 3S7EA 4ATFA 4QDSA 4BQWA 5A6QA 3FHIB 3W20A 2IWGB 1S0BA 4CUCA 1SZBA 1VP6A 4KMQA 5LY2A 3TNQA 4EQVA 2XGXA 1DGLA 1FOD2 3QH6A 1OI6A 3ZFEC 3ZXAC 2P2KA 2FHRA 2J1RA 3OUHA 3QH7A 4RS5B 5TSWA 4M0HA 3VUOA 3IB3A 1HJGA 4OI1A 1QJU2 2CYFA 1QJX2 2JXAA 5IT6A 4W8JA 4QPWA 1XNDA 4LUKA 2ATFA 1QNWA 2LTNA 3FMGA 1ZYBA 3BVCA 5FBZA 4M0NA 5LATA 5LK7B 4FOYA 2FCUA 5IUQA 2ZPXA 5F5IA 4AQTA 4PBPA 3FWEA 1O8PA 4A44A 5I91A 2DDUA 3O1UA 4BE3A 3KT4A 1YFXA 2GC3A 3K3NA 3NRUA 3TEZA 1FYUA 1I5PA 4LK6A 1FV2A 4S2FA 3WNLA 3J8F2 3DEMA 4XCAA 3ZVXA 1RUD1 2PFWA 4GH4C 1MEC3 5FZAA 3N7KA 3T0DA 1XC6A 3J4UH 2EAAA 4FOVA 1JYTA 1Z7S2 4OMDA 5A33A 3D6EA 5BNOB 4RD7A 1GANA 3H7YA 3HBZA 3WP4A 4EWAA 1NCRC 5CEHA 1W9TA 1AR81 2VG9A 1WD3A 2C24A 4R9BA 1REDA 2G9GA 2JIGA 1W6OA 3AM2A 3OPTA 4TTGA 1CX1A 2PAMA 3DV8A 4IL7A 2PELA 2GP3A 1K12A 2WNVA 3N35A 4ZY9A 3ZN6B 1M4WA 4BXFA 3ZXFA 1CN1A 1DQ1A 2RS13 4DB5A 2UWCA 2YHJA 2MPFA 5FP4A 4QQLA 1DDLA 2XVKA 1VRH3 2JDUA 3B3QE 4XBNA 1CD3G 3K75B 1A8MA 4D0QA 1FX5A 2CNAA 1ENQA 2VZPA 1OA4A 4YM3A 5JDBA 1K5MA 2R1DA 1CX4A 1OFSA 3VZNA 2O14A 2JG8C 3OTFA 2PHXA 1FV3A 2CDPA 1BEV1 4FT8A 2QQUA 4HK8A 4QDQA 3HIFA 2KR2A 1X9PA 5IYYA 2DUPA 2W46A 2VJXA 4JQRA 3UV9A 3V0AA 3VDBA 3E1F1 3U10A 2GDFA 4AVVA 2H6BA 1ZBE2 3VDAA 1BVVA 4H2AA 3S0MA 1LOAA 1PHMA 2AGSA 3HQXA 3U11A 3T2TA 3IM0A 2A73B 1LOEA 2WNEA 2CGOA 4QAWA 3CJIC 2E31A 3VKFC 2VUJA 3UK9A 5C5TA 1HQLA 2Z2SB 3GBFA 4YZ5A 4LBLA 2OKXA 2VMEA 2E32A 3PL0A 4MOAA 5IVBA 5FY1A 4QXCA 3ZFGA 1N3PA 3BODA 2W95A 4DEVA 1RUD3 4AI8A 1JHJA 4RQPC 1KDKA 2JG9A 2RJKA 4YGCA 1RJ7A 3WQ1A 5FZIA 4R4ZA 1KEXA 2O1QA 3WY6A 1OF4A 3PDQA 1PX4A 3J7LA 4GMP3 4Y22B 1B35B 4NRQA 4XXAA 5E89A 4YW3A 2BUKA 2XQRA 3OUJA 5A7NA 3KCYA 3LF7A 2XLAA 3LPGA 5LBBA 2J1UA 3VBSB 5L9RA 2OPWA 1JMUB 4HPKB 3WG3A 4CDUB 4Y5TA 5ABJC 1IKQA 3BCWA 4N90A 2JDKA 5IAXA 3VDDB 1FPN1 4CVUA 2DVFA 4MX3A 4Q0PA 5C5UA 3V0BB 5KHHA 4LO4B 4ARYA 2VMCA 4XUQA 3E5QA 3GZEA 4E2GA 3VGIA 3P3PA 3DGTA 3N9OA 1AR71 1XJAA 4WM8B 3T2PA 4ASKA 4NHKA 3PU3A 5FJKA 1C5IA 1YQ8A 3I2FA 5BYNA 2XLFA 3WOGA 3K4DA 1TMF1 2XJTA 2I74A 3N7LA 1A6CA 1QQP3 4ZPIA 5DZGA 5FK8A 2VVDA 1KFUL 2EIEA 5GZEA 4FXKB 5A32A 2OYZA 4Y5Z0 1W6MA 1Y9GA 2YC2A 5KC5A 5A7PA 4YZ2A 3HR9A 5H9SA 1O91A 2A6XA 3LB9A 1UMZA 1Y9MA 4E4ZA 1PIV1 1O4YA 1XYOA 4YG0A 1GOGA 3IDAA 1PZ9A 3N9PA 1OLME 1VBB3 3D3AA 3ZPOA 4D8MA 5BY5A 3KQ4B 4P02B 1UZZA 3WP5A 2EICA 4LPLA 1CVNA 4Q0VA 5A3MA 5J7MA 2ERFA 4R9DA 4LO6B 5KHKA 3H7JA 3RZLA 2RDRA 3IPVA 4Y24A 3V56A 2ZXQA 1V6OA 1F31A 1JZ7A 3W5NA 3UJQA 4UW5A 4DNYA 1C57A 1CJDA 2QDNA 2VMIA 1Y4WA 3C2UA 1DF0A 1H8TC 2QJVA 2R32A 3M2MA 2R6QA 3NSTA 1US2A 4G9SB 4HVOA 1ZBA2 3JB4C 4P9LA 5EIYB 2QQWA 1JI6A 1DBNA 3HD8B 3I2KA 3BOWA 4MGQA 3C3VA 1U5IA 2WKKA 1F2NA 3DECA 3O1OA 4XBLA 4BIOA 3APBA 4GB31 3WNMA 5JOYA 1H4HA 1DQ2A 1RUF3 2EVXA 2CSGA 1QJY2 3D0SA 1YLLA 2Y60A 1FPN3 2VMHA 1N1TA 1UZWA 1PMIA 3N9NA 4I3PA 5FZ3A 3ZSLA 1LGCA 3ILFA 2VVFA 2ZEWA 3LOIA 1AYM2 1SLLA 1ULOA 1UYPA 2XWJB 3O0VA 3CDZB 4LO7A 4QX3A 1AR73 4TWTA 1Y7BA 1MQTB 3S5QA 2BEOA 4MADA 5E6HA 1QIQA 1EUTA 3B02A 4IERA 1PMHX 4J1XA 3TBDA 4LO8A 3VKMA 4ARXA 1PM4A 4DO0A 3IAPA 1TMF3 2ZKNA 4A4AA 1VBA1 1YUDA 4QQOA 5G05L 1FT9A 5IVFA 4ZXKA 3BYWA 1NCQB 3VBRC 2ZHMA 3T08A 5L7OB 4YZ1A 1HX6A 2R042 1RTVA 2O8OA 3POEA 4P08A 3Q8CA 1E5RA 3SLIA 2CWMA 3HEIA 2HWF2 1LOFC 1OPMA 4I2OA 1PIV3 3D5OA 3MUY1 4CDQA 4XPVA 4D94A 1SACA 2RDNA 3CMGA 3H0OA 4JV4A 2ZMLA 3WZ1A 1F8VA 4L2NA 3J7MA 5FO7B 1CAVA 5J36A 5SV5A 4NWVA 4BHPA 5IHRA 3HN1A 1RXFA 3INAA 1D2QA 1OSGA 3NO8A 5JUVA 4AEMA 4GWMA 4QX7A 1S0CA 1UKGA 5DXDA 3ZYIB 4AK3A 4AOCA 4GMP0 5KHGA 1AYN1 3AP5A 5FBJA 1ZRCA 1DFQA 4J1WA 1J3PA 2BZDA 1E57A 3CKHA 1OXCA 4C1XA 1R1ZA 4OYUA 3NQHA 2YU1A 2W3JA 2Q8DA 5T5JA 4LBQA 1ZX5A 5D1IA 2EIBA 4IEUA 2HWE1 2XH6A 2J1TA 1U5YA 2GU9A 3M7AA 4LKSA 3KF3A 4WVWA 5IFTA 2O0OA 1HRI1 1VBE1 4CXWA 3VD4A 1S55A 1S2BA 4OI0A 5A7QA 2QZ3A 3O1TA 1V0AA 5IK7A 1HXS1 1UX6A 5ANNA 1AJOA 1UZVA 1D4M2 5EYXA 3PUHA 4I09A 4NROA 5DG2A 5EV7A 4XETA 1CGPA 4UF0A 5C8CA 4CYDA 3KGLA 1AR61 1FMD3 4Q4W2 3KHCA 3I59B 3I3QA 3PJYA 4CEYC 4QQ2A 4Q29A 4Q8LA 3MIHA 3BTYA 3AZWA 1V6KA 2XVLA 3WF4A 2CAVA 5CVRA 5JPNB 4FO9A 4PQQA 1K5JA 2JDMA 1UMIA 4D6QA 3O5SA 1SLBA 2HBUA 3QCWA 2PXJA 4QGMA 4R4XA 1JYIA 4YGBA 3ZSJA 1AL0G 2BQPA 2PQSA 1WKYA 2VZVA 2YU2A 1F15A 3NV4A 4PF5A 4YVSA 2Y33A 4RS5C 1ND3A 4Y1ZA 3H8XA 4TZDA 1GZWA 3LGRA 1XBFA 1IPKA 1QMJA 5IWFA 2IFRA 2DU1A 5IW0A 1W3XA 4GKXA 4LR4A 3H8UA 4CA9A 1QGLA 4XTPA 2XUMA 1QJEA 4XFFA 3CF6E 3NWKA 1H9PA 4EV0A 4ZU4A 4EWEA 4JDNA 1AYN3 1PZ8A 1DYOA 2QE3A 5F3EA 1PNGA 2GN7A 2NM1A 4XFHA 5HCBA 3J9SA 1H1AA 1HB4A 1RINA 1ULCA 1X8EA 2ZOEB 3DKWA 2C9KA 1TME1 4UFHA 5A33B 5CADA 1UZYA 3SXWA 4F3JA 2AEZA 3LWCA 3TB0A 1OMIA 5C9AA 3TOJA 4KU8A 2ZEYA 1W05A 3AMQA 4DXZA 1MS9A 4Q2FA 5BNOC 2ZKLA 1KQRA 4K3UA 1HRI3 1RMU2 1VBE3 4ZS2A 3WD5A 2EAKA 1ZZBA 1OH4A 5ACA1 4LOSA 2P17A 3DKQA 4M3CE 1YNAA 2XJSA 4NHMA 2IXJA 4H55A 1W3VA 3Q8AA 3WDUA 2WYFA 4LE3A 3E5UA 2HWB2 4FBFA 1ULFA 3DYPA 4Q4X2 4Y5SA 3GCXA 1AR63 1J58A 5SV8A 1XSRA 4Y1VA 3DF0A 4WZCA 1BK0A 4XUOA 4GD4A 2WFPA 4N43C 5HV0A 2D6KA 1K5MB 1TNFA 1XRUA 3GYDA 2LM3A 1PO12 4FPEA 3BPZA 1F4AA 5DABA 4MV2A 5FP7A 4B7EA 5K8SA 2Y8KA 4MG2A 3AYAA 2RMU1 3WNKA 5T3NA 4B4PA 3V0AB 2VTFA 3RMYA 1AHSA 2D3SA 2WQ8A 3LEKA 4QPGC 2R062 2ZJCA 5L9VA 2D3PA 3JD72 1WCSA 2GAUA 1CQ9A 2XPJA 3LOBA 4D69A 2XUEA 1J84A 2FQPA 2VZUA 3N7MA 3NW4A 4OUMA 5CFDA 2BGCA 2HYKA 4N7IA 2WQZC 3E97A 5DDJ2 2R072 4CCNA 1COV1 2OT7A 3PJQA 4CP1A 1C8M2 3V65A 1VBD3 4BMEA 4D6SA 1UCXA 1EAH2 1NAEA 1C1FA 1DQ5A 1WCQA 3IIIA 1GLHA 2C6SA 2PA7A 4HOOA 5DAXA 1H8VA 2Z4FA 3ZFGB 3QD6A 1GSLA
chains in the Genus database with same CATH topology
2JG9B 3O7OA 4RL7A 3D82A 4PLMA 1TME3 4QPIC 3TYJA 5C4WA 1ZZ8A 1RVF2 4XHBA 2VOKA 2DCTA 5GLUA 1R082 5K0UB 1PGSA 1PGW1 3WW3A 1S2KA 1VLNA 3NKGA 4HFSA 1BBT1 2VUAA 2AREA 1OKQA 2HWC2 1G9BA 4E4SA 4LBNA 3I54A 1U5ZA 1PVXA 1XNBA 4N9IA 3VBSC 5FLJA 4GB32 3OD0A 2ETEA 1H0BA 4CDUC 3ZO0B 2MEV1 3K51A 1GFF2 2UWBA 2XJQA 1X33A 1RUJ1 3URFA 4OVEA 1JXNA 4BCUA 4M3CF 5BPXA 3MLJA 4HMZA 4MYEA 2VECA 2PHLA 4Z92B 1KS4A 1I9RA 1PVC2 1AUYA 5A32B 2YUEA 3MW2A 1W6MB 3ILRA 1EV13 4XDQA 1QOTA 3WDYA 4AXOA 1YI7A 4XJZA 5JZGA 1HV1A 1YI9A 2UYBA 3IBMA 2QCSB 1AJKA 2EA7A 4P9YA 3GALA 3ES1A 4WV8A 4D7YA 3WHUA 4XQDA 2ARBA 2W39A 3WQ7A 2XJVA 1MZFA 3AP4A 3IPVB 1RITA 1LEMA 1M06G 2PHRA 4TSVA 3USUA 5BNNC 5J48A 2QUOA 4XMIA 2VY0A 4NN0A 2DUQA 2Q1ZB 4FAHA 1J3QA 4CP0A 4I0BA 4IV3A 4XFGA 1BBT3 1G9FA 3KB5A 4JDMA 2ENRA 1POV3 3B93A 3IT8A 5BNQA 2RS31 2X5IA 4FPJA 4EN8B 2BNOA 5DUUA 3POYA 2X8KA 3VBFA 1AXYA 4I0WB 2DTYA 5DUVA 4AFDA 5CBLA 2MEV3 1S0DA 3R05A 4R9AA 3AJYA 5AC92 4WVMA 4L8QA 5CAZA 4JRAA 1RUC3 4AFAA 5KC6A 1W2UA 1RUJ3 2G9FA 3IDEA 4FP3A 2CY6A 2Q8OA 4LBKA 1T6GC 1AX2A 2PTMA 4L92A 1PM7A 3JB8A 3U07A 1MQTC 3SCFA 1UN1A 4B4RA 1NA1A 2YY1A 3H50A 5T5OA 4YW2A 5F1RA 1GYKA 1RUE3 4MGKE 2RR13 4P14A 4DZGA 2DCKA 1BZWA 5L7OC 1NCQC 3FLPA 1D0HA 4I01A 4K1ZA 3RMXA 4CDQB 1RC6A 3ZYGA 1PO23 4WM7A 2DCZA 1H1MA 5EFUA 2E51A 3RYPA 2RM22 1CAVB 2XBO2 1AR92 4AI0A 2ZCWA 4XF9A 4S2GA 2I07B 5FPZA 2O8QA 2A3XA 3OD4A 1PNFA 2WZR1 3S30A 4LBQB 2P37A 4O9EA 1VAKA 3LA7A 4HKOA 2DURA 4IEQA 4KG8A 4YW5A 5CA6A 1Y3TA 1OA3A 3W59A 4ES8A 4K6BA 1HRV2 4A2UA 2NQYA 2ZAAA 4IEPA 5D8AA 5C8CB 3PNAA 1XNKA 2XL9A 1FOD1 3USSA 1UU5A 3RSJA 1RHI2 5CFCA 3TN92 4XIKA 4IEWA 3B9CA 4HANA 3JBG3 2HEYF 4W65A 3WW1A 1WUVA 1QJU1 2B7YA 2ZHLA 1S0FA 4JTOA 1ZZ9A 4CEWC 1Z78A 1O3SA 3LSDA 4PBOA 2UWAA 1GNZA 1LCLA 1OQEA 3K48A 4YVSB 1ND3B 2BWCA 5F6KA 5JCTA 1GZWB 4RR3A 1NZCA 2WLQA 2K0GA 1F9KA 1HQNA 2GNMA 4E2QA 4QQHA 3AZYA 3FLRA 3KLSA 1Z7S1 2R49A 4P5HA 5KXEA 1J1TA 3ELNA 5BNPA 3FE5A 2CAUA 3H9AA 4ITCA 2OW4A 2WZR3 4MH0E 2RS11 4LUMA 5C33A 3RI9A 1VRH1 5C9AB 2WNUA 1RUH3 4G4FA 5GZFA 4UXAA 1WW4A 4AFCA 4FPCA 3OYWA 4YM1A 3AJZA 4Q4Y2 5H9QA 1AL23 2QZ2A 5T55A 3KZ4C 3WCRA 2OZ6A 3OGGA 4AI3A 1MACA 2A5ZA 3FZ3A 2Q5TA 1KFXL 2WL1A 2GZWA 4QGNA 3WW2A 4C91A 1O7FA 4YARA 1FOD3 1MS5A 1G7YA 2WS92 3NKTA 5BXXA 1IS3A 4FSJA 4AE2A 1C3HA 3ZSKA 1V9U2 1QJU3 3IIAA 1QJX3 5I8SA 2R1BA 2WA4A 1XXNA 1R1A2 2D6MA 2A7AA 1DGRN 2P3KA 4XIOA 1V6NA 3ZFFA 1UPIA 4S2HA 5JIAA 5CFDB 5I0RA 4AWDA 1UW8A 4XEZA 1GQHA 4AHZA 4Z07A 1YFWA 3KCCA 3J8F3 1MVEA 4GQ7A 4JGYA 2E9QA 1WLTA 3RQ0A 4AEDB 1UIJA 3FBYA 4GMP1 4NHLA 3M4FA 1SLIA 1KDMA 5C6CA 1Z7S3 2EXKA 4YZ3A 4LA3A 2DFCA 1AX1A 3ZFGC 4MGIE 3WDWA 5C4WB 1ASJ2 4H3WA 2PHWA 2JG9C 1ZM1A 1DYKA 4G3YC 2IXKA 2WWSA 4FOQA 2EF6A 5JI7A 4DQAA 3VBUA 4Q4V2 3WP3A 1F5FA 4OZXA 5K0UC 3VKNA 4KWLA 1EPWA 3SH3A 5J3UA 2HWD2 3MF9A 1D4VB 2D6PA 2RJLA 3MICA 4WVVA 5H9PA 3AYCA 2V09A 3ZFEA 4GWNA 3VBHA 1H2LA 1QQP1 2WT0A 1Q5OA 1RUG2 3RZZA 3LZZA 3LAGA 4A7YA 4XJWA 1LTEA 2JJ6A 1MZ6A 4H7LA 1ZBE3 3RJ2X 3MIDA 4CDXC 3HAGA 4B4QA 2JEMA 1VBB1 1LR5A 2WJSA 2ZGMA 3ZN4A 1OQ1A 4XQ4A 1BKZA 1BMV1 1ZRRA 5FAXA 3ACLA 4KH9A 4Q8KA 3E6CC 5JZGB 1OLRA 1XU2A 1YYNA 3PLQA 4IETA 4XJ8A 1IOAA 5LEKA 4R8HA 3R4DB 2HKXA 1LESA 3HT1A 1JTZX 1ZBA1 5BUVA 4RGAA 1WMFA 1VB4A 1WLCA 4LTAA 3USUB 1RUF1 2YXSA 5KXCA 1J3RA 3PVNA 2DUOA 5KXBA 3OBTA 2VW2A 3R6SA 1AR82 1QJY1 2H6CA 4IV3B 3V0BA 1BYHA 1NXMA 3EXUA 3M3QA 4QGLA 4AQ2A 1OHFA 2X5IB 4ASMB 3ZMNA 3CJXA 2JG8A 2YGLA 4LHKA 3BTAA 3VBFB 3WDVA 1AYM1 4OFGA 3RI8A 3ROUA 2BVVA 1PK6A 4WVMB 1X7NA 2VNOA 1OPOA 1YIFA 2ES3A 4L97A 1BEV2 4HETA 1QF3A 4QM8A 5LEJA 2R041 5JSPA 2UY9A 3CJIA 1H4GA 2ZMNA 4JGZA 1NA1B 3WXPA 3LA3A 5JOWA 1W6NB 1C1LA 1VIWB 2Z79A 4AVTA 5FOBB 3EO6A 1LECA 1RUI2 4WM7B 5K9YA 4CDQC 4QD2A 4WVZA 4CDWB 1EYBA 1DIWA 5IK4A 1Q56A 3CU7A 4UBGA 2NYYA 1ZBA3 2R16A 3M3EA 1Y43B 2XJUA 1W0OA 4YFZA 5T54A 3M70A 5KHIA 2VOXA 2D44A 3DPRC 4TYSA 3VHRA 1QJY3 4KG0A 1OFNA 1FMD1 4AQSA 3ZXEA 4KWJA 1Q8OA 2XLGA 2GNDA 1D4M1 3WQ0A 1MR5A 3QLQA 1ZRDA 1AYM3 1WMEA 1DLLA 3GHMA 4CP2A 3MGUA 3ZXKA 1V00A 5D8AB 5FOJB 1VJ2A 4XF0A 1WW5A 4XJAA 3A0NA 1QXPA 3ZSEA 5CFCB 1OQDA 5C8CC 1YIPA 5FPXA 2ZGNA 1SFNA 3M3CA 2R043 2PLV2 1MS8A 3TRSB 2EXJA 1URXA 5HCFA 2HWF3 3B7MA 3NAPA 1I1EA 2KXLA 5I0TA 4XHXA 4F83A 1DHKB 3N3HA 1QY4A 3IDCB 1FAYA 4RR3B 4AYUA 1B09A 2LUWA 2ZGTA 4YVSC 1ND3C 4FTEA 3GZAA 2YMZA 4ZU5A 1W6QA 5T50A 1LENA 1U0AA 1W39A 3TWIA 1MZEA 1NQJA 1FATA 2Y38A 5BNPB 1R092 4BPZA 1A3KA 2N7GA 2WQ4A 2XJPA 4JCKA 3NV3A 4Y1YA 2WNUB 3MIEA 1AXKA 3D0JA 2AH2A 2W0XA 2ZS6B 3AP7A 2GMPA 3OYWB 4B3NA 4YGEA 2HWB1 1D4M3 1YWKA 4PLOA 1MS1A 2XVGA 5C9AC 3N4MA 3WNXA 4FTSA 2ILMA 1IHMA 3AXDA 3I4IA 4Q4W3 3H3ZA 1L3JA 3H1YA 3B9IA 2AYHA 2DVAA 4QX5A 2FMYA 1N3OA 1DGWX 2KM2A 5EYYA 2PHFA 3ST7A 1QXJA 4N7UA 2WFF2 4INDA 2DU0A 2R061 4DRVA 3JD71 5J96B 4LT5A 3OCPA 3UL2A 4DFSA 1VBA2 3R4SA 1VBD1 3MYXA 2B5HA 3I2DA 1LHUA 1GV9A 2D40A 2GNBA 4RHV2 2WC2A 3RNSA 3MFCA 1C8M1 3ZFFB 2XB6C 4QPYA 2YPJA 5FQ0A 4EROA 4YZ4A 1EAH1 3AYDA 4Q27A 1H1IA 3GBWA 4DS0A 3AP9A 4JGYB 2QDRA 3PTYA 5GKAC 2VULA 4QT6A 3AKSA 2D6NA 4JTNA 3BU7A 4Y1UA 2A6WA 1I5ZA 1W6OB 4AEDC 1A8DA 3T1MA 1LHVA 1RVF1 2WNVB 1ZVFA 1C8NA 2FMDA 2C1FA 4AEKA 1REFA 2Y0IA 5FRAA 4AI1A 1RMU3 5I0UA 1ALYA 2GC0A 1GBGA 2HWC1 2HWE2 4M3CA 4IV1A 1JH5A 4QM9A 5FO8B 1TQ5A 2DF7A 4UBHA 5C4WC 2PAKA 3VBUB 2HWB3 3MPPG 2GC1A 1JN2P 1ULGA 4CEYA 2D6LX 2ZX0A 4Q4X3 1RIRA 3H3UA 4XOGA 3SCHA 1UPSA 1HXS2 3RDIA 2X29A 4DRRA 2DFBA 3VHPA 4FPOB 4IQPA 4P9IA 2JICA 2ZMKA 4I30A 3ZXJA 4LBQD 1YFUA 3ZFEB 1PO13 2QFEA 4PIZA 3VBHB 3BIWE 3GF6A 3SH5A 1X82A 1OOPA 1HLCA 4EN6B 2XWBB 1EV11 1WCKA 2R063 1PVC1 3JD73 3AKTA 4FPFA 4C0HA 2DV9A 4BMBA 1NLSA 5GM0A 1Q3EA 1J1LA 4XZPA 2DVDA 5DDJ3 3ZIXA 2R073 4F7ZA 4FVVA 1C8M3 3IMNA 4K40A 4DINB 1LGBA 2VNRA 1UU4A 5GLZA 5E16A 1RL3A 3A4UA 1EAH3 4MSVA 1X36A 2CWSA 1XNCA 3E6BA 4JC1A 4RSUA 4FOWA 2H0BA 2PN5A 3NV1A 3W58A 4AEJA 1XQNA 2IC1A 3KCXA 2B39A 3MF6A 4U36A 1B35C 4XW3A 1RVF3 1POV1 4E27A 3O12A 5L36A 5GLTA 1R083 2ZX3A 1V6JA 4KGQA 4YVWA 1KS5A 2HWC3 1MZ5A 4AGVA 1NXD1 4MGZE 4OI4A 4PIYA 5I8YA 5JLVA 4LLOA 2JE9A 3VDDC 4GB33 3X29B 5ACA2 4PJYA 2DYCA 5J09A 3V0BB 1RUC1 4ORFA 1NG0A 3ATGA 4PQ9A 3MZHA 4N43A 5DZFA 4IV3C 2JG8B 3OBRA 1CIWA 2W52A 5FLIA 2DVGA 2EXHA 4MXWA 1JUIA 1O5LA 3FC0A 1Q8VA 1S0IA 2X5IC 5FFOC 1HKDA 4BYYA 4OHYA 2VXRA 4WM8C 4X6QB 4AGGA 1PK6B 5GZGA 2R0HA 4XF4A 4QPGA 3VBFC 4U2AA 4YSFA 1RUE1 2RR11 4R9CA 4COYA 4KU7A 3KGZA 2NZ9A 4M01A 1PVC3 1WW6A 4OUSA 2PHTA 2RMU2 1RJ8A 3VL8A 4HSLA 4COUA 1PO21 4V1PA 4KQ7A 3D4KA 4JGZB 1NE6A 3KT1A 2A6ZA 1O4TA 4FPYA 2AR6A 1QOSA 1LRHA 4MXVA 1NA1C 2Y26A 3VZMA 5JOZA 2Q0AA 2RM21 2XBO1 1AR91 1COV2 1LU2A 1ULDA 3T1LA 3LSEA 3JUUA 4QPIA 1UU6A 1IS5A 2W68A 1C5HA 1XYPA 4NVPA 2XL7A 2DCJA 4XQWA 4WZFA 4IEZA 1FXZA 4CDWC 1C28A 2DTWA 3AFKA 1TE1B 1Z0HA 1LGNA 1S0JA 4I02A 3AZXA 3AK0A 4NR1A 2D5HA 4FAGA 4XFCA 4OULA 5E1RA 1X8MA 4BQ1A 4CDUA 1QDCA 2XJRA 3AMHA 4CZSA 3OF1A 2P34A 5FLHA 5AC93 1RGSA 5A3LA 5JSRA 1H9WA 3JBG1 2YDEA 5CU1A 3HT2A 3TN91 3RYKA 4AHXA 4QXKA 4IEVA 3WX5A 3MIGA 5D8AC 2XG3A 3JQXA 5DUXA 2TNFA 3ALQA 1SLAA 3E5XA 3WG2A 1HIXA 2E7TA 4RGGA 2ZGOA 5CFCC 2B8MA 4PDWA 4Z82A 3AMMA 1SDWA 1X50A 5I8TA 1VBC2 3GZUC 1LKNA 5KBFA 3NAPB 1QKQA 2A3WA 3VZKA 4BWOA 2XHKA 2F6BA 4Q1RA 4Z8BA 2K9ZA 4FPLA 1C4RA 3ZDSA 5L19A 4OLLA 5JMCA 2RM23 2XBO3 1AR93 1SMVA 1S1AA 4HBNA 5BNNA 3ME2A 4IEYA 3UKVA 2CTVA 3ZXDA 4RR3C 1W6QB 3PHMA 5GLVA 1LOCA 4LBJA 5EXOA 1RUH1 2Z5WA 5CIRA 3VLBB 1GICA 1O4ZA 2VQ0A 1BK1A 1QNYA 1YFYA 4P9WA 3VZJA 4RA0A 4UW4A 1IS4A 1AL21 4LBMA 3MLKA 1LHWA 5E8AA 3IDBB 4QU2A 1V6IA 1JYCA 4Q4Y1 5BNPC 3QACA 4AVSA 4JRLA 3MDPA 2E7AA 5HXVA 2PQQA 3MPBA 1HRV3 4YLZA 2TUNA 4LEJA 2SBAA 4KWKA 2WNUC 2RS32 4MLOA 4CRQA 2V5YA 3MIBA 4Y26A 5I93A 5JR7B 1RHI3 1NY72 3DN7A 3TN93 4D69A 5CG8A 1MQTA 3ZSMA 2ZTNA 2JECA 1QJX1 3AKPA 1ND2A 3PVEA 2D5FA 3H1WA 1UD1A 1CPMA 2XKPA 1NCQA 3H1MA 4NWWA 1V6MA 1IS6A 1IZ3A 1R1A1 1TNRA 3GNEA 1YO8A 3ZMOA 3J8F1 5F9TA 3VKOA 3AMNA 2PYTA 5J98B 1ZZ6A 2MHFA 1GKBA 4Y20A 4K21A 3MIFA 4MVTA 4LO5B 5FQ0B 4YGDA 2GH2A 2C5DA 1QOOA 1XYNA 2ZBJA 4BM8A 2RS52 3ZFFC 2OUJA 3BOPA 3ZYJB 3POWA 3FX3A 4M00A 1POV0 3BALA 4N9HA 5F6LB 4GKYA 2DVBA 4DOUA 1V70A 2BVBA 4HVQA 1DQ6A 3I7DA 3VBOA 3JZVA 2AZ5A 1RUNA 4HZFA 1AZDA 5FMOL 4Q4Y3 2OVUA 1XE8A 4H14A 3W9AA 2WNVC 4GULA 3B00A 2NLRA 3R0RA 4IV1B 3SCGA 2IXLA 2WIIB 1SBFA 2ZZJA 4UW6A 4GA9A 2GNTA 2OA2A 3OPZA 3E6DA 2HWD1 2QVSB 4N53A 5I0SA 4CEYB 2VQAA 1ZZ7A 2BNNA 3VBUC 1O5UA 2WS93 1RUG1 2BYVE 1JW6A 4FPKA 3EBRA 1K5MC 3WDXA 1ZBE1 1V9U3 1I3HA 3WLUA 4CEWA 1PGL2 1OOPB 1HDKA 1YJLA 3VBHC 1ZNPA 3G6JB 1KXGA 3V64A 1CONA 1R1A3 3AX4A 4C0BA 3B94A 2E53A 5JVVA 2QNKA 2QQPA 4AFBA 5JAXA 1RUOA 3SISA 2R30A 5L73A 4EN7B 1YRZA 4HL0A 1GZCA 4FQZA 1MEC2 2VW1A 3FLTA 4DPNA 3A0KA 3TNPB 3VHOA 1G9CA 4R52A 3RYRA 4LLFA 1D2SA 3L2YA 2NMOA 2WLPA 4NOTA 3SNMA 1ASJ3 4Q0SA 4LE4A 5T5PA 2ZA9A 4YVWB 1RB8G 1GQGA 2RS12 3RRDA 1WA4A 1LULA 2ZX4A 4Q4V3 4OHZA 1VRH2 3MI8A 1SBDA 3JU9A 1A78A 2GN3A 3AXEA 3MW4A 1F5JA 2HWD3 1UKRA 1EPZA 4HLTA 2C0ZA 1MVQA 3UKNA 4N43B 5C8WA 4A7KA 1RUG3 3PVBB 1YXWA 1N1YA 4L99A 1LODA 2K2SA 3VN4A 4MXWB 5CG9A 5FTTC 1MS4A 5FMOS 3RJRA 4EJRA 1N1VA 3AZVA 3GHNA 3LKJA 5HI0A 4DMIA 4QPGB 4TLFA 2Z42A 4E4DX 1D0GA 2GALA 4F8AA 1NYWA 1PK6C 3WUDA 3ECQA 1DZRA 1GZ9A 2CL2A 2ZX1A 4GH4A 1ZREA 3WT3A 1H2MA 5T52A 4QQPA 2Q30A 3FFQA 1W0PA 3CEWA 1NCRA 4HN1A 5LRRA 4JGZC 4A3XA 1RUI1 1RUD2 4LBOA 3Q9OA 2QKDA 4BA6A 1SLCA 4QPIB 2MNGA 4HKLA 3S7IA 3UKTA 1IQAA 2OPKA 5JOXA 4D7TA 2HEWF 4LHNA 2IZWA 1UIKA 2I45A 1AX0A 1AR83 3MFAA 2WT1A 5K0UA 4HSJA 2YV8A 3KM5A 1LOBA 3SMHA 1W6PA 4BLJA 1EY2A 3IN9A 4Y4YA 3KT7A 2NP0A 4K1YA 4P9XA 4SBVA 3ZYRA 1KJLA 3UJOA 3JCIA 3VZOA 4MZUA 1VB2A 3RG0A 4I3GA 2ZGQA 2AUYA 4CDXA 1BEV3 1QQP2 2HWF1 1CAXA 2VOVA 2B42B 1UAIA 1CR7A 2PLV1 1FI2A 5GZDA 3R4UA 4JVAA 1WMDA 3AB0A 2Y0OA 4AI2A 5EJ3A 2WA3A 4RQPA 2E63A 4PDWB 4X8NA 4EN0A 1VBB2 3B69A 3DUIA 3JQWA 1Q8QA 1TEIA 1Y9QA 2VNGA 2F4PA 4Q26A 4ES9A 1BMV2 1RUI3 3NJZA 1SEFA 2BFUL 3NAPC 3ZXGA 2EXIA 5IK8A 5JPMB 4OI2A 5ABJA 5BNNB 1ZZCA 2WZPP 5GALA 1DG6A 5KHJA 4P9GA 4B7KA 4ISRA 1R091 1O3TA 5BV6A 5FREA 3KQRA 2ZHKA 2OUHA 3KSCA 4ASLA 3VV1A 1DZQA 4WBBA 4J6GA 3FJSA 3O0XA 1RUF2 2JDZA 1G9DA 3J26N 1QH6A 4FP2A 4Q4W1 3TAYA 1FPN2 3ENRA 3WINE 4FPHA 4BIFA 1U5XA 4OHVA 1H2NA 1NLRA 3POSA 1AR72 5FCCA 4HN0A 2ZACA 5DZEA 1G86A 4QMAA 4XF3A 3N36A 2D98A 4AHWA 1TMF2 5LK5A 3P3NA 1SLTA 1CAWA 5T5LA 5AVAA 2WFF1 2C9AA 1ND2B 4C90A 2PLV3 4K20A 2NN8A 4XFAA 3M3IA 1DYPA 3VL9A 4XXPA 4AW7A 3ZYPA 3U4XA 4IESA 3ASIA 4EWDA 1PIV2 4RHV1 1DGWA 1H8TA 3FUOA 1G6NA 3SHRA 3HWJA 1QU0A 1SCSA 3OY8A 4Y20B 5DUWA 4JDOA 5DG1A 3AP6A 4YFWA 3MW3A 4YG6A 4ONUA 1H2KA 4XYXA 2VPVA 1RMU1 2ET1A 2WINB 3DPRA 3EQEA 4W6YA 2VVEA 1R093 3KMHA 5EZWA 4RFT0 4B8EA 2VU9A 1SQ4A 1NOVA 3VBOB 2BFUS 3AZZA 4Q4X1 4PCRA 3CLPA 2JENA 1LHOA 2D43A 4Z1VA 2D7FA 5JIUA 2D6OX 1PO11 1YCIA 1FMD2 1DGRA 1GNHA 2IXHA 4HKWA 3VBRA 1BVP1 4IV1C 4N53B 4QHBA 3AYEA 5B2GB 1HQWA 1U12A 2A75A 1LOFA 1CJPA 1BJQA 2GMMA 2ZGUA 1QWRA 2WFF3 2BWAA 4CEWB 4COVA 2B46X 1ENXA 5DDJ1 2SLIA 2R071 2VGDA 1UL9A 1S0GA 1VBA3 4YNIA 4BLIA 1Q43A 2GMEA 4FCAA 1OOPC 2WT2A 4RHV3 3MEPA 3THTA 1WBLA 3WG1A 4O9GA 2OIIA 1MS3A 5CFDC 4IEXA 1CAUA 3PMSA 4IXLA 5FO9B 2Z69A 1Q8PA 3RWNA 5JWPA 1AYN2 5AFBA 4XFIA 3SH4A 1KRIA 1R081 3PMEA 1G9AA 2P3JA 3AKQA 1VR3A 1WLWA 4L11A 1VAMA 5K7PA 2WSUA 4P9JA 4XTMA 2EIGA 3RS6A 3IKWA 3NL1A 4FXGB 1HRI2 1VAVA 1VBE2 1KD7A 2GC2A 2HWE3 2IFWA 2JKBA 2ZX2A 1O3QA 2ZAHA 2D3RA 4ATEA 3OGJA 1XU1A 3THPA 4E2SA 3WUCA 5FDBA 4YVWC 4ISQA 1AR62 1QXRA 1HXS3 4DY5A 3WW4A 1BCXA 4AVCA 4GIQA 3VKLA 1I6XA 4YW4A 1N1SA 4KBBA 4RS5A 2IXCA 1PZ7A 4MGYE 2UU8A 4C1WA 2W08A 4XE9A 1DU3D 3MLLA 1SFYA 1BQPA 4YM2A 1IPJA 1WD4A 3N7JA 2A6YA 2YROA 3FUQA 1LB2A 4META 2BBVA 4S2DA 2BNMA 1H30A 2NMNA 4GH4B 3WHTA 1S0EA 1NQDA 1LEDA 1HW5A 2I2SA 1VBD2 1QHDA 1V6LA 4H7MA 4OHXA 5JZGC 1YJKA 2ZGPA 1REEA 4JAAA 1NCRB 1WW7A 4BZ4A 2E6VA 3O14A 3ETQA 3PVOA 1MS0A 5BNOA 4SLIA 4AEDA 2WSVA 5E88A 2JE7A 1JUHA 5J37A 1TME2 2A71A 5CB7A 4FTBA 5HCAA 3ZN6A 1Q8SA 1QJZA 1IGOA 2ZGRA 2BW8A 3ZPYA 4Q0UA 3ZIWA 2NPIA 5AC91 5H9RA 5ACA3 4PIXA 1W6PB 4KL1A 4KNCA 1CESA 3GZTB 1APNA 2YGMA 2D93A 2R0FA 2ZGSA 4LA2A 1J59A 4W6XA 3KS7A 2ARXA 4GXLA 5JI9A 3B01A 1WLDA 2FZ2A 3AFGA 4Q1PA 3CJIB 4XMAA 3S6PA 3SITA 4CDXB 1CAXB 2RMU3 2FBEA 3QOPA 3WVJA 2E7QA 2H0VA 3WR0A 1OD5A 2YZ4A 1EV12 1VBC1 1AVBA 3WV6A 4RQPB 1IKPA 3WDTA 2TBVA 4AF9A 3DL3A 4AVAA 1COV3 4PDWC 4WM7C 4K9SA 2OZJA 1ENSA 4A7ZA 1JHNA 2KA3A 2AENA 3L9JT 4Y22A 1YHFA 1B35A 2G4IA 3ZX7A 4NO4A 1OLQA 5GZCA 4XFBA 1AXZA 1UF2C 4IEOA 4ZKTB 5ABJB 4X6RB 4AQ6A 3U0ZA 3M1HA 4I0AA 3VBSA 3WCSA 1BXHA 4HPKA 4LULA 5F5QA 4D7SA 1PGW2 5JSOA 4HK9A 1HRV1 2Q1MA 1BBT2 4UW3A 3KD4A 3VDDA 2BTVC 4L9BA 4YYOA 3M3OA 4YM0A 4DY3A 3GBGA 4XJUA 5KXDA 4Z2WA 1RHI1 2MEV2 1DZTA 4YW1A 2A3YA 4WM8A 1DQ4A 3FBMA 2XKOA 4ZU7A 1O3RA 1RUC2 2TEPA 1RUJ2 1NY71 4YG3A 5HBAA 4HVRA 1LJ7A 1HV0A 4XILA 2A70A 4AG4A 4AVBA 4AFMA 3WG4A 1CAWB 3IWZA 3I8TA 1G8WA 3G7DA 1RUE2 2B45X 2RR12 2UY8A 2JD4A 1XE7A 1VBC3 2V73A 3CO2A 1ND2C 1WCDJ 4XBQA 1LHNA