2JEPA

Native family 5 xyloglucanase from paenibacillus pabuli
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
363
structure length
363
Chain Sequence
ADASQIVSEMGAGWNLGNQLEAAVNGTPNETAWGNPTVTPELIKKVKAAGFKSIRIPVSYLNNIGSAPNYTINAAWLNRIQQVVDYAYNEGLYVIINIHGDGYNSVQGGWLLVNGGNQTAIKEKYKKVWQQIATKFSNYNDRLIFESMNEVFDGNYGNPNSAYYTNLNAYNQIFVDTVRQTGGNNNARWLLVPGWNTNIDYTVGNYGFTLPTDNYRSSAIPSSQKRIMISAHYYSPWDFAGEENGNITQWGATSTNPAKKSTWGQEDYLESQFKSMYDKFVTQGYPVVIGEFGSIDKTSYDSSNNVYRAAYAKAVTAKAKKYKMVPVYWDNGHNGQHGFALFNRSNNTVTQQNIINAIMQGMQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords XYLOGLUCANASE
publication title Characterization and Three-Dimensional Structures of Two Distinct Bacterial Xyloglucanases from Families Gh5 and Gh12.
pubmed doi rcsb
source organism Paenibacillus pabuli
molecule tags Hydrolase
total genus 144
structure length 363
sequence length 363
chains with identical sequence B
ec nomenclature ec 3.2.1.151: Xyloglucan-specific endo-beta-1,4-glucanase.
pdb deposition date 2007-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2jepA00
5DT5A 4P8WA 5BXRA 4DUVA 1UWIA 4UQBA 4D6HA 3EMCA 1JYWA 1TA3B 3QGVA 1KR1A 1UKTA 2WCGA 4UOZA 5A3HA 4C7DA 2BVTA 4JCMA 5HPOA 1WZMA 2YLAA 1UD6A 1DHKA 1ODZA 2VC9A 4XZWA 3VGDA 4RE3A 1BAGA 2VO5A 5AC5A 2ZXQA 3ALFA 3GH7A 2PWHA 2OYKA 1S46A 3SUTA 1JYVA 1JZ6A 3IJ9A 1V03A 2EPMX 2WVSA 3DYMA 4A3YA 2CKRA 5A8MA 2EXOA 2GUYA 1ISWA 1D3CA 4UNIA 1P6WA 5BXTA 1DTUA 2GK1B 4PTWA 1J0IA 3VMNA 4XX6A 3RDKA 4FLSA 4UFHA 1UR1A 2WVUA 1DWHM 1UWTA 1EHNA 1XH0A 2PB1A 2QPUA 3AZTA 3MO4A 4URIA 4Z2JA 2OWXA 4B3LA 4IISA 3T2PA 6A3HA 2CEQA 4KH2A 1IZJA 5I79A 4U31A 4BQ3A 4M81A 1FFQA 4HZ8A 3PZQA 1WO2A 3PZMA 1E5NA 2WWCA 2WB5A 3WH8A 1E0XA 1Q6FA 5ABEA 4HPHA 2EBNA 1VEPA 3EDEA 2VZVA 1H0IA 3KZSA 1MVYA 1X6NA 2G41A 1OGBA 3VNYA 3KL3A 3TOPA 1V6XA 2PWFA 4EAMA 3OGSA 3GH5A 3VD4A 4NI3A 1HJVA 5IHRA 3NSMA 4U33A 1U2YA 1J12A 4S3KA 5FL0A 3VILA 2D0GA 1CGYA 5A6SA 2DGAA 2FH6A 4W85A 4BZYA 1E6XM 1MYRA 1V3IA 3WBAA 1TMQA 4JCLA 2O9PA 3WQ8A 1GOQA 3FHQA 3SCTA 4ZE4A 4J3TA 3ZSTA 4JFTA 1V02E 1MFUA 4AIOA 4LX4A 4JZ5A 2BV9A 1CYGA 4P8UA 4AEEA 4TTGA 4W93A 2X1IA 1XHGA 1XH2A 4CD6A 4B15A 3WH7A 2G3MA 3CHDA 4RE2A 4CU8A 5BCAA 2X8RA 5DO8A 2WSKA 3M6DA 3MSDA 3AMGA 3FY1A 3CLWA 3WKZA 3CUJA 3HMCA 3EDFA 2VTFA 3OG2A 4Z2KA 4JKLA 5JUVA 2J8FA 2PBOA 3BAKA 1RD6A 4DUXA 1M53A 3BSGA 3W6LA 5HNNA 4NZCA 1H1NA 5A6JA 1NWRA 4MB4A 3BLPX 3PZVA 3WQWA 3II1A 2J78A 3CHEA 1E56A 1EDGA 1UWUA 4DWSC 1BYBA 4GZEA 5BROA 4ACZB 1UA3A 1ZBWA 4EE9A 2WHJA 4A3HA 3FNDA 2J79A 1AVAA 1IT0A 3I3DA 3HU7A 4V27A 2EPNA 3LPFA 4TOQA 5E0FA 3WELA 2G3JA 2WVVB 3MSGA 4W88A 1GQKA 3W25A 3N13A 4A4AA 3KE0A 4U2YA 3WH6A 4BF7A 1JI2A 2DPEA 2J7GA 1C8YA 3VDHA 2ZUWA 2VZUA 1AMYA 3TTQA 1G0CA 1KQZA 3NUKA 3WNNA 2YKKA 2DEPA 1U30A 3AOFA 3AISA 3WDJA 2ZX8A 5AYIA 2XM2A 1HKKA 2WM0A 3CH9A 2FH8A 4UFKA 4LYQA 3AZSA 1KB3A 2NT1A 4V28A 1UH3A 1FH8A 3I3BA 1TZ7A 5CXPA 1FH9A 1XCWA 1K9TA 3AMKA 5GPRA 3WMSA 1DWFM 1J0KA 3AHXA 2DSKA 5BYWA 3KWXA 3MUAA 3ARWA 1XYZA 2X0YA 5I77A 3FHAA 5CPTA 3BLKA 3APGA 3AIVA 3OLIA 4MJ2A 5D9OA 2WYSA 3ZJ6A 4D6DA 1JD7A 4BQ4A 4CVWA 1BG4A 3AIEA 3OZPA 1GORA 3U7VA 2AOSA 3RM4A 5CLTA 3AMDA 5ABFA 1QW8A 4WKFA 4CD8A 4DUWA 2VZOA 2EPOA 2BY0A 1G9HA 1KQYA 1SR0A 1V0MA 4Z2IA 4AD0A 2UY3A 1V3MA 2VVNA 7CGTA 3HJEA 1AQ0A 1CGVA 2EQDA 1UWRA 1EA9C 4AD3A 4WF7A 3RCNA 3ZM8A 1E9LA 4AISA 1BHGA 1ITCA 1PZ2A 1HNYA 3VIPA 1H5VA 2YOCA 1K9DA 5CQ1A 1BF2A 4ZE5A 3MU7A 8CGTA 4BS0A 1BLIA 1W9VA 2GJRA 3A3HA 5HOSA 3SUUA 3WF4A 3UERA 3WD1A 1C93A 4AZGA 1UH2A 3CUHA 1LF1A 4J3WA 3ZR5A 1GQLA 2E9MA 1W1VA 4MAVA 2YLLA 1XRVA 3OZOA 4E4PA 1I75A 2DH3A 2ZX9A 3WQVA 3AIUA 4QFUA 1HKJA 4D1IA 3BXWA 2XIIA 1GW1A 1JXKA 2GFTA 2VRQA 2V3GA 1OBAA 3THCA 1KBKA 1VFOA 2G4FA 3VM5A 1FA2A 3VDAA 4TX8A 1GQIA 1EQPA 4AEFA 1CLXA 2Y4SA 3WUBA 1UH4A 2V5DA 1NOWA 1E55A 4Z2HA 3CBWA 1V6UA 1CENA 4BQ5A 3WEZA 1WAWA 3W0KA 1BPLB 2ZOXA 2W4XA 6TAAA 2J7BA 1B3XA 3AS2A 3TP4A 1EHAA 1TCMA 4W5UA 3SCVA 3W4RA 2V5CA 3VIGA 3PHAA 4W7VA 4M56A 2BVYA 4HPGA 1CGUA 2WXDM 4GPNA 3L4TA 1TG7A 1ISZA 1MW2A 1CXLA 2V38A 5A6AA 2XFYA 3MMUA 3ARRA 4TTUA 1KWKA 3VMPA 2TAAA 3WF1A 1C3FA 3VIKA 1UQYA 1ESWA 4AD2A 2W91A 1YQ2A 4J3XA 4J3VA 1UD5A 2IXUA 5GNXA 1VB9A 4PMYA 5JIPA 5F7UA 4J7RA 4EANA 3DYOA 3G6MA 1W9DM 1OGSA 3ZJ7A 4OBRA 3WQ4A 1YHTA 2VL4A 1QI0A 3DC0A 3CPUA 3VM7A 3WH9A 3OB8A 3W27A 1EOKA 1LLOA 4OOZA 3K8LA 4AIEA 2XPKA 3FN9A 4HMCA 4GKLA 4H04A 3FAWA 4P7NA 1PIFA 4KGJA 3D5HA 3F4VA 1K6AA 2WHMA 3T08A 3VMOA 5A6MA 3VGEA 3LPPA 2IUZA 2XSBA 1VAHA 3VX1A 2HVMA 3CO4A 3VD9A 2DH2A 1VIWA 2YA1A 2VX7A 4U5KA 4HU0A 4PTVA 1B9ZA 3KL5A 3ARPA 1KCLA 4MB1A 2ZXAA 2J7FA 2XGBA 2BXYA 1N82A 5CPSA 1GVIA 2XUCA 4C7FA 2D23A 4ATLA 5EBAA 4KGLA 3T2OA 4HOXA 2D3LA 1CGXA 4QAWA 5I3DA 5E6ZA 3AIQA 4LQ1A 4AD5A 1NP2A 1PPIA 1RH9A 3N15A 1OD8A 4FF5A 5ABFB 2WHKA 2WZEA 2J77A 1GHSA 5JBEA 2A3BA 4BQ2A 2CBVA 2J25A 3AHVA 2GDVA 2PBGA 3SUSA 3GXDA 5HPCA 3QHOA 2OSXA 3WFZA 1RPKA 3W37A 1E0VA 4FLOA 3AIRA 4CCDA 2CXGA 4KWUA 3VIJA 2EPKX 5E0CA 1V3JA 3ZQ9A 1IV8A 1IZKA 2E4TA 4H8UA 2BXZA 2D3NA 1LL7A 1E72M 1QHPA 4OBSA 3BAJA 3ECQA 3WEMA 5D8WA 1OCQA 4AZ7A 2PWGA 1WE5A 1AQMA 4R5EA 3NDYA 3VINA 1LJYA 5BRPA 4Q22A 2D24A 2CERA 1KXTA 3ZT5A 1C8XA 8A3HA 3WNLA 1UR0A 1ODUA 2YDQA 3VIHA 5HBFA 3GXIA 1GJUA 2DT1A 4UOQA 5IFPA 4QLLA 1KCKA 3WQ6A 1JNEA 4HP5A 1JDDA 4GZIA 4AZIA 1NP0A 1CGWA 4OKDA 4TVCA 1BYDA 2NW0A 4W7WA 4S3JA 5CPQA 4MB5A 3BAYA 5A95A 1DWGM 5KEZA 2V3EA 3EDJA 1JI1A 2J62A 3SIMA 1F4AA 1LL6A 1G5AA 2O9OA 3FW6A 2W5FA 4UQ9A 1FFRA 4PMZA 4AZCA 4CKQA 3CZ8A 2CBJA 3SCRA 4AMCA 4J3SA 1JL8A 1KXQA 1TFVA 3VPLA 2YIHA 1V0KA 4U2ZA 1C7SA 3U57A 3WL0A 2D20A 2DSWA 2VX5A 1O7AA 4DM2A 1NWTA 1VRXA 3UG5A 1B3VA 5D9NA 4GQRA 1ZL1A 5FKYA 4D6GA 1JZ2A 3L4VA 4H41A 3PBGA 3RO8A 3ZT6A 3A4AA 3WFLA 2Y8KA 2JIWA 2VZSA 3LPGA 3VIMA 3IJ8A 3AYSA 5IXEA 3TTOA 3AYRA 3ALGA 4D71A 3GDBA 2CCRA 1WDRA 3VD3A 3B8SA 5EFDA 4U5IA 3WF3A 3T0BA 4IPNB 4D1JA 1J11A 1UOKA 1CXFA 1XD0A 1ZBKA 2Y24A 3FAXA 1GOIA 3CHCA 4WK9A 3O9NA 4YHGA 3VUPA 4L4OA 4W7UA 1DWAM 2QPSA 2A3HA 1QNPA 1TVPA 4PN2A 4X0VA 2GSJA 1XGZA 1C90A 3IAQA 3VGGA 2ZE0A 4JKKA 5IHSA 1GOMA 3WMCA 4CD5A 1R7OA 1W1TA 3AJ7A 1VFMA 4OZOA 3QHNA 3PZUA 2W67A 3AS3A 1MWOA 2BNJA 1JGIA 4LYRA 4FLQA 4Y7EA 2QV4A 3AXXA 3UETA 1VEMA 1H0GA 2UY4A 4EKJA 3OBAA 4D6IA 2XIBA 3VDBA 1RP9A 1UA7A 1E70M 2J7CA 3GBEA 4PMQA 1OT2A 1NOFA 1NOUA 1OIMA 3A4WA 3VOCA 1UR2A 1VFFA 2YL6A 2EJ1A 1QNQA 1M03A 1E1EA 1OSEA 3RM8A 1H11A 5C71A 2O9RA 3DYPA 3F5KA 2J74A 2F61A 3A6OA 3SUVA 3ARZA 2DT0A 4W5ZA 3VD5A 2VNCA 5A6BA 2Y5EA 1Q6DA 1J18A 1EGZA 1EXPA 3N9KA 4QP0A 3AROA 2WBKA 4J3UA 1XD1A 2DIJA 4HZ6A 5I24A 5CJ5A 1EO5A 3QOKA 4PUEA 5GNYA 3PTKA 4HMDA 1OM0A 1V02A 2XFRA 4HOZA 5I5RA 2BHUA 5I78A 1TE1A 3RIKA 1NWSA 2ZWZA 3OLGA 5M17A 2VCCA 1CIUA 1MXGA 1E73M 2A3AA 3SCNA 1UHVA 1B1YA 2BHZA 1QNSA 4N42A 3VKKA 4AD1A 2AAAA 3AHZA 3EBVA 3WNKA 3W28A 5KZ6A 3WQ5A 3OA5A 2VRJA 2WWDA 1C91A 3GNPA 3WIJA 5DMYA 2WMIB 2ZUUA 4JFSA 1QVBA 3TTYA 4CN4A 1XV8A 1VF8A 3ZIZA 2D0FA 3EYPA 2W66A 4QCEA 1CDGA 3DECA 1UR9A 1U33A 3IAPA 4CU7A 2YDSA 3SCWA 1ISYA 4GO9A 1WP6A 4XV0A 2V3DA 3GYCA 2CHNA 4PUDA 1VJSA 3GNRA 3WD2A 5A8OA 5IDIA 1X6LA 3F5LA 4HMEA 4XUYA 3NSNA 2OSYA 4DWSD 2J8GA 2W92A 4Q7NA 2MANA 4H8HA 3AMCA 1UR4A 2E3ZA 4MNKA 2CKSA 5BWFA 3VDCA 1QBBA 2VMFA 1W9PA 4B9YA 2DT2A 4AZCB 1V3KA 5CG0A 1OD0A 2O9TA 5CZKA 2J7DA 4PEEA 3CGTA 3GXFA 5ABHA 5A1AA 3B9EA 3S2CA 2G8ZA 2WMGA 3ARSA 4R27A 4UFIA 4UFMA 1GOWA 1HKMA 3VNZA 1JZ3A 4XZBA 3ZMRA 4CUCA 3DHUA 3B9AA 2XVKA 3EMZA 1GVYA 2J7EA 3K4DA 2CPUA 1B2YA 4JFUA 2OLHA 1WB0A 2E0PA 4H2CA 1HN1A 1CLVA 3RJXA 3EDDA 1J0YA 1FOBA 4CD4A 1E4NA 2YJQA 1NWUA 3D3AA 2WAGA 1C7TA 4D6FA 5A2AA 4MJ4A 3MMDA 4X9YA 3BCFA 2NT0A 1CPUA 4K68A 4UR9A 5FL1A 1TUXA 4LPCA 2XVLA 2DSVA 1E15A 1JF5A 2BY3A 3L2LA 1BFNA 4QLKA 1MFVA 1MW1A 4PMOA 1OGGA 4YN5A 1H4PA 5LYRA 4JL2A 1PIGA 3BAXA 3MV11 1UQZA 4WSJA 2WC7A 5CGTA 1JF6A 1QHZA 2XSAA 3MUIA 5JIWA 1OWQA 3CZKA 2XVNA 4CD7A 4P8XA 1ZBVA 3CUGA 2WCAA 2NSXA 4E2OA 2QMJA 1HJQA 3PTQA 1R85A 1W3KA 1QHOA 5D9PA 3UR8A 3WDHA 4QLJA 2DSUA 3N12A 3WNMA 2QF8A 2GDUA 1ZB5A 1JD9A 4ATDA 5AC4A 1DWIM 4AYSA 1F4HA 2CETA 2X0HA 1UZ4A 4V2XA 2VQUA 4JFWA 3T2QA 3G6LA 2OYLA 4F66A 2WVTA 1GPFA 2G3NA 3LMYA 3ARUA 1SMDA 4WIWA 4GINA 4FMVA 4GZJA 2D22A 2OYMA 1CXIA 2FHFA 1NQ6A 1LWJA 3RM9A 1W32A 1W1PA 1B0IA 3QHMA 3ARVA 7A3HA 2FDMA 4PTMA 3RILA 4KRUA 3T09A 3VX0A 4P7QA 2VR5A 1HL8A 3OIHA 2ZX7A 2ZWYA 1HP5A 1ISXA 1DWJM 1HJWA 4AXNA 2BS9A 2BY2A 4NRSA 5D8ZA 1KGUA 1PAMA 2A3CA 2YA0A 3L4ZA 4UFLA 1B31A 2YA2A 5DF0A 1A47A 1PX8A 4JKMA 1E3ZA 2CIPA 3ARTA 3M46A 3FXYA 1Q6GA 1US3A 2D1ZA 4IPLA 1XH1A 2WKGA 3AZRA 3GBDA 4HZ7A 2YL9A 3CZGA 5A6KA 4TUFA 4AC1X 1UZ1A 1XSIA 2EEXA 3UR7A 1UD4A 4N0RA 3W81A 4UZSA 1JZ4A 2YBTA 3PZNA 5A94A 1LL4A 5CSUA 2ZIDA 3PTMA 1BSIA 5I23A 1QNRA 3PN8A 4EK7A 3W29A 1UKSA 3AHTA 1H3GA 1CBGA 2XTKA 4UOJA 3M7SA 4ACYA 4H8VA 2ZXBA 3SEPA 1KFWA 4MNMA 4HOWA 2W61A 3W82A 2BFGA 4TVUA 1CZ1A 3WY1A 4MPKA 3KEHA 3L4YA 1E6ZA 3SCQA 1R86A 1KXHA 1UD2A 1G94A 1O6IA 4CN1A 1NH6A 2JE8A 5C8BB 1D2KA 3GNOA 3WENA 3L2MA 3N18A 1E6SM 1J9YA 2PWDA 1E3XA 3WNPA 5FOOA 3HN3A 5A8QA 1KWGA 1US2A 3VIOA 3CIVA 1E5JA 2RGMA 5AY7A 3QR3A 3WUEA 4GQQA 1BYAA 1E6RA 4GI8A 3N1AA 1CXEA 1PZ3A 4W8LA 3WH5A 1GONA 4WSKA 2RGLA 4XB3A 3CZEA 3O6AA 4ZENA 1B90A 2DIEA 3WEOA 1AQHA 2CBUA 1OIFA 1GQJA 2WC4A 2WK2A 3SURA 1HJSA 3WDPP 1B3ZA 4HTYA 4UQEA 1QI2A 5FD0A 5IFTA 2VZTA 1SYTA 4AZ6A 1WCGA 4W8AA 2DSZA 2VUYA 3BAWA 4P7LA 4MDPA 1VFUA 4H7VA 2WHLA 1W3JA 2FHBA 2WMIA 1E6QM 1CXHA 4IM4A 1E43A 3VO0A 1L8NA 4E8CA 3J7HA 3W6MA 2XM1A 2YDRA 4P7RA 3U5UA 3NIYA 4JAWA 4QCFA 2WLYA 4OOUA 4UQAA 2QMKA 2WC3A 1LG1A 1M01A 2WSPA 1PX3A 2XG9A 3CMGA 4NRRA 1H09A 4UZUA 2XHYA 1NM9A 2Z1SA 3TA9A 2D2OA 3W26A 3BMWA 1V3LA 2Y2WA 4MNLA 1UWQA 4M82A 4MB3A 2Q8XA 1HKIA 4CGTA 5BXPA 5I0DA 4PCSA 5JBFA 1CWYA 2JF7A 4JIEA 1MQPA 2VCBA 2XJ7A 3I3EA 4U3CA 5I2UA 3GH4A 3VU2A 1B3WA 2CESA 5BRQA 1ECEA 1V08A 3ARYA 4ATWA 4HA4A 1ZJAA 3F5JA 1WDSA 3BC9A 4PSRA 1M04A 3MS8A 4D6CA 1W91A 1VBUA 2WMFA 1LQ0A 5EFFA 1QW9A 2E9BA 1FP9A 3POHA 1K9FA 2GJXA 4B3KA 1FH7A 1KGXA 4D6JA 1QI3A 1MQQA 1PJ9A 3MUZ1 1BVNP 1FHDA 1G1YA 1WNOA 4W89A 1G01A 1ITXA 1Q6CA 3WF2A 2J47A 1FP8A 3WUGA 2OWCA 4ZEPA 3L4UA 2ZUTA 1W2VA 2JF6A 1XCXA 1E4MM 1R87A 2ZUSA 3IANA 1JNDA 1TVNA 4UCFA 4PMRA 4ZXOA 4HA3A 4DM1A 1J01A 5E6YA 4HA1A 3N17A 2QHAA 4JFVA 3AMLA 1MXDA 1GZJA 1WPCA 3NYDA 4TX6A 2YL5A 2GVYA 1Y7VA 1HP4A 3UESA 5ABGA 3L4XA 3SCPA 3GTNA 3CUFA 2ZUVA 1UYQA 3RJYA 3K8MA 4W86A 1JZ7A 4NSBA 4GO8A 3WD3A 2WMJA 1WDQA 1JYNA 1XSKA 3K46A 3ZOAA 4KMQA 1W3LA 3GM8A 4Z2GA 2JFEX 4PRWA 3AS0A 3POCA 5FCZA 3WDQA 1I1WA 1BG9A 1E6PA 2FGLA 2BHYA 3OLDA 2VVSA 1X1NA 1HF6A 4M1RA 1JZ5A 5A6BD 4AD4A 4YPJA 3SCSA 2XYLA 3CUIA 1JAKA 4UQDA 4B16A 4ZFMA 3BGAA 1R7AA 3AS1A 3AICA 4OJYA 1XC6A 4PBGA 3LPOA 1TR1A 2VOTA 4E8DA 4CCCA 2WCSA 1E71M 2VI0A 4ML4A 3UG3A 1UWSA 4W8BA 2BY1A 3MANA 3TTSA 2DQXA 4D6EA 3RMEA 3BSHA 1E0WA 4PTXA 4F79A 1CNVA 4PMDA 3VGFA 1HX0A 1CGTA 5LA0A 3VGBA 4LYPA 2F2HA 1DEDA 1UD8A 1VBRA 3AHYA 3PZTA 1SFSA 3VTRA 5C70A 4UQCA 2AMGA 3UG4A 3S6TA 2C8NA 1JFXA 2OSWA 1XSJA 5ECUA 2ZXDA 4PCTA 2E40A 3ARQA 2VX4A 2X2YA 1Q6EA 3EMQA 2WMKA 1LG2A 1J0HA 1UG6A 1OT1A 2DT3A 5DFAA 3OLEA 4GI9A 1LWHA 1M7XA 2J4GA 5M03A 2G3IA 1GUVA 1JYXA 1QPKA 1HT6A 3SCOA 4UFJA 3AIWA 5CLWA 2F8QA 5D9MA 4GXPA 2C7FA 3QOMA 3NCOA 4MDOA 1HVXA 3A47A 1E4LA 2GJPA 4B9ZA 3T0DA 2PC8A 3L4WA 1Z32X 1GJWA 1JIBA 2FGZA 2UWFA 3KL0A 4RL3A 2JEQA 5LA2A 2PF0A 1VENA 2ZUMA 1KBBA 2X05A 3OGRA 2CHOA 5JBDA 4NF7A 1W3HA 2IXVA 2YL8A 2EO7A 3WF0A 2VQTA 2UY5A 5A2CA 3K8KA 2CITA 3IK2A 4TXEA 3MUY1 4GIAA 4M24A 1A3HA 2ZX6A 3UCQA 1W2PA 3SUWA 1OINA 1NARA 3MMWA 1QBAA 4WJXA 1DP0A 4UTFA 2VT0A 1V6VA 3W38A 4X0NA 1ISVA 3AXHA 1V3HA 3NJ3A 2WBGA 1UUQA 1JFHA 2PWEA 1QI5A 4AZBA 5D4YA 1EIBA 1CXKA 1EO7A 1OB0A 3BMVA 2FHCA 5GQBA 4PMUA 1JDAA 1H41A 1EDQA 4M8UA 5CGMA 2CYGA 1HL9A 3CZJA 2WNWA 2GJXB 1JDCA 1V0NA 4DWSA 2WZIA 1VEOA 2JIEA 4BA0A 3W24A 2XFFA 1MW0A 3VGHA 5TD4A 2XWDA 1GNXA 1WZLA 3WN6A 1WZAA 1GOKA 5LA1A 3WD0A 1EDTA 2C0HA 3RPMA 2W63A 5HDRA 5M5DA 1V6YA 2JALA 1TA3A 2EPLX 4JL1A 4IUGA 1V6WA 1JG9A 2ZICA 3PZGA 4PMXA 2WW5A 5DT7A 5A69A 5A8NA 4F8XA 2XVPA 1C92A 1HIZA 3SCUA 2VJXA 1RP8A 4FLRA 4WLCA 5M3WA 5AYBA 1MW3A 3PZIA 2BVDA 3CMJA 3O2LA 1UD3A 1BQCA 2WPGA 3M07A 1WDPA 1J10A 1ZBCA 1BVZA 3CHFA 5GNZA 2OWWA 2J7HA 5I6SA 1V0LA 2X09A 2JEPA 2ESCA 4LXFA 1HXJA 4ZXLA 5A8PA 2GK1A 3BCDA 4C7GA 4CN6A 3N11A 1CEOA 4CCEA 1K9EA 1ZS2A 1B30A 4MTVA 1W9UA 5E09A 2VR4A 1I1XA 1J0ZA 3OGVA 4JHZA 2UY2A 3UEQA 4AW7A 1UKPA 1W9BM 3WSUA 3WMBA 7TAAA 1GHRA 2Y8VA 3ZO9A 4F9JA 1QI4A 4M29A 4MADA 2VX6A 4JHOA 1PEZA 1D7FA 4AIUA 4OUEA 5EMYA 2A3EA 4MNJA 1GCYA 2Z1KA 1C8QA 1UKOA 4HU8A 2XGIA 4D72A 2V3FA 3ZJKA 1KR0A 3WUFA 3ARXA 4RE4A 4PMVA 4QDMA 1QNOA 1XYFA 1KGWA 3VD7A 4W84A 1GOOA 1UR8A 1FHLA 3U5YA 1JZ8A 1ZJBA 3MKKA 3MV01 2W62A 3WD4A 1ZU8A 1CECA 2CBIA 3ZT7A 1W1YA 4F9DA 1KXVA 1UKQA 3JUGA 5CSYA 5HXMA 2VRKA 3ZR6A 4WKHA 3U7BA 3WL1A 1E4IA 3TONA 1H49A 2DDXA 1SMAA 6CGTA 3VIIA 3E1F1 1BGAA 1H2JA 2VURA 3DHPA 2WANA 4YHEA 2WKLA 3ZSSA 3AFBA 3BAIA 1R8LA 1WZKA 2YBUA 1EOMA 5BXSA 3EDKA 3NDZA 3CZLA 1EQCA 4P8VA 3N04A 3T0AA 2D0HA 3B9DA 5FIPA 2VCAA 3AQUA 3WDRA 3CTTA 3VVGA 1J0JA 3IJ7A 2E8ZA 4PMNA 1VJZA 2J75A 1HJUA 4GI6A 4PYSA 4AWEA 4J28A 1E40A 5E9AA 4PSPA 2XWEA 1WKYA 3GZAA 1JAEA 4P7OA 3ZJ8A 1L0PA 2QLYA 5EB8A 4AY1A 4L4PA 4U3AA 2E9LA 1E6NA 1EH9A 1MQRA 4KRTA 4CVUA 1W9XA 1QOXA 4WKAA 3PZ9A 3BH4A 5E70A 2WMHA 4FK9A 4TVDA 3K1DA 4CU6A 3W53A 5A6LA 1E1FA 3GXMA 2HISA 3THDA 3WDIA 1CTNA 1BYCA 1BTCA 3NSXA 1Q4NX 3AIBA 4M80A 1PBGA 1BGGA 2WLZA 4ACZA 4W87A 2WZHA 2PI6A 4BCEA 4OIFA 3PZOA 3A4XA 3K4AA 4J27A 2CNCA 5A2BA 1JXJA 1PX4A 3VIFA 4MAZA 5DEZA 1HVQA 9CGTA 2ZX5A 4DWSB 4Z2LA 2ZUNA 2WVVA 2E8YA 4AZ5A 3WNOA 3AI0A 3WBEA 2XVGA 4LGXA 2B31A 1B3YA 3AXIA 4AZHA 1HJXA 2O92A
chains in the Genus database with same CATH superfamily
5DT5A 3S42A 5BXRA 3I4EA 4GGBA 1UWIA 4D6HA 2PTWA 3EMCA 4GCXA 1FWJC 1KRCC 4AIBA 4QITA 1UKTA 4HK7A 1L2QA 3TYEA 5A3HA 4C7DA 3KZPA 1UD6A 2F6XA 7REQB 1S5MA 1ODZA 2VC9A 4OVXA 5AC5A 4ADSA 1JGMA 3ALFA 3QLDA 4ROQA 3WJYA 4AY8A 3MHUA 1V03A 2AQOA 3DYMA 4A3YA 3BPWA 2CKRA 1YRRA 1ADDA 3LRKA 2EXOA 3S2LA 2GUYA 2RJHA 3PBYA 4WEVX 3JR2A 3ZLFA 3W7DA 3GZ3A 2OO6A 1J0IA 4NJHA 5C54A 2PDNA 1UR1A 1XLLA 1DWHM 1EHNA 3AZTA 2INEA 2H3BA 1LP6A 4IJCA 3TQKA 2OWXA 3T2PA 4F4RA 4GC3A 6A3HA 1FBAA 4KH2A 4LF1A 3LTYA 5I79A 4U31A 3WQCA 3UPBA 4JYDA 4HZ8A 4L65A 2WB5A 4Q8TA 3JZEA 2I7GA 4AF0A 1ONEA 4DJDD 4JBRA 1OGBA 3VNYA 3KL3A 3TOPA 2Q3OA 4EAMA 3OGSA 3VD4A 3V5FA 1TX2A 4DO4A 1QMLA 4FOKA 4AC7C 2ZA3A 1U2YA 3T8LA 2UBPC 2JK2A 4JTDA 2PTZA 2D0GA 1CGYA 1GVRA 1E6XM 1MYRA 3CMFA 3OPSA 3E9AA 1TMQA 4JCLA 2O9PA 1K8YA 2OFJA 3QSRA 2AL1A 5AKQA 5I02A 1PIIA 5EYWA 4B4HA 4AIOA 5AC8A 1TTJA 1ONWA 5FJOA 4XO6A 3LHTA 4JZ5A 3GHSA 1CYGA 4AEEA 4TTGA 1QR7A 3H2NA 4PTDA 3WH7A 3QGKC 1JCNA 3SY5A 3CPRA 4LUTB 4TR9A 3FY1A 4XKMA 2ZBTA 3G3DA 2JKAA 2FQIA 2R24A 5I3IA 1VBGA 3EKZA 3TWBA 4FO4A 3W6LA 4LW7A 3ZZ1A 1Z3NA 2WJEA 3NL3A 1R3SA 5A6JA 1EBHA 4G8TA 3EWZA 3PFMA 2Z25A 1W54A 4QJ3B 4S38A 3EWBX 3EEZA 3CHEA 4O16A 4YTQA 1EDGA 4WXYA 4DWSC 4FXRA 3NZQA 3IV3A 3OVPA 3SN1A 4GZEA 5DBUA 5BROA 1E0UA 1UPPA 5LNWA 4IMDA 4DI9A 4PH6A 1XJBA 4EE9A 2WHJA 4A3HA 5AZ1A 3QZ6A 4XVEA 3V5CA 1IT0A 1JJKA 3HU7A 4DQWA 4NJIA 3LPFA 4IMGA 3R0DA 3UWYA 1KM2A 3BUVA 1GQKA 3LTSA 3MSYA 4U2YA 4BF7A 2J7GA 1YLVA 2P50A 3NL6A 1TR9A 5CSRA 1KQZA 3NUKA 4O17A 2DEPA 1V51A 4C6JA 5D37A 3PBMA 5KETA 1UUOA 5AYIA 2A7RA 2AKZA 1TPDA 4UFKA 1QOPA 2NT1A 3TAKA 3RN6A 4V28A 1UH3A 1TZ7A 3VNKA 3H4WA 1K9TA 3AMKA 3G0UA 1VHNA 1J0KA 2EPHA 3AHXA 3KWXA 4LOCA 2X0YA 3NWRA 1OF8A 1KTNA 1S38A 4A8LA 5D9OA 4MJ2A 1KKRA 2PURA 4INFA 4BQ4A 3P2VA 4BEUA 3AIEA 3OZPA 3U7VA 4FNTA 1QW8A 4CD8A 3URBA 4LCRA 3QTGA 2UY3A 3KDOA 1DORA 4HK6A 3HJEA 4EP8C 1V5XA 5A5WA 1XIMA 3UWZA 1UWRA 3RCNA 1E9LA 3P82A 4AISA 2IPWA 1FWIC 3MJMA 1FKXA 1VPYA 1H5VA 5CQ1A 3ZLGA 4ZE5A 2E25A 2E7FA 5KSWA 4JY9A 1N8WA 2D69A 1BLIA 3L0GA 3V36A 1W9VA 2GJRA 4I5XA 5HOSA 2NQ5A 3WD1A 1EFZA 4AF0B 4DY1A 5KITA 3DX5A 1H63A 3PBVA 3CUHA 1NTHA 2E9MA 4FOJA 4MAVA 2G95A 1I2RA 3NPUA 1JQVA 4FI4A 4JIIX 3CC1A 4E4PA 2ZX9A 3E96A 3ITLA 5AOUA 3PJUA 5C9XA 3BXWA 4I5UA 4JNYA 5FJIA 3GUGA 1KBKA 1VFOA 1DJGA 4PBEA 4XD5A 1FA2A 1QO5A 1GQIA 1FWCC 1UH4A 4IQLA 1NOWA 4A3RA 4Q8MA 4Z2HA 3HQOA 3CBWA 4L64A 2PWUA 3B0XA 2AKMA 2W4XA 4BI5A 1B3XA 3ISIX 1SJDA 4LFYA 2V5CA 4W7VA 4QSFA 3PVFA 3ES7A 1XBXA 2Z28A 3B0PA 3STPA 1ISZA 4U28A 3WQOA 4WJ8A 3MMUA 1OYAA 1QDSA 1XYAA 3L5MA 3WMLA 3VIKA 1NDWA 4AD2A 3JS3A 4BKNA 3NVDA 4J3XA 3IWPA 3MDWA 2ZVIA 4HVXA 3Q37A 4WY0F 3EB3A 2QJMA 3HPFA 4CLMA 2PD9A 4JIQA 1W9DM 2C14A 1YHTA 3VKDA 1WAUA 3AYTA 1K02A 3W1TA 3DC0A 4S2CA 1K70A 4ADTA 3DKJA 1LLOA 3K8LA 3UWQA 3PULA 4CNOA 1MXSA 5HJXA 4XZNX 2WHMA 1OC6A 3E38A 3RXZA 4L56A 1TYGA 1UZDA 2BOEX 4E0CA 1H50A 1SO5A 4AHQA 1WKDA 2VKZG 2HVMA 3CO4A 1F6PA 4FAMA 3L5LA 3UXIA 2HJPA 2VX7A 3LLXA 1AD1A 4FXSA 4PCNA 3REQA 2BX7A 3QKZA 2O7SA 4LB3A 2VP8A 1EYWA 3BOLA 3CV6A 3ERPA 2XUCA 4NZJA 4C7FA 3KRSA 2D23A 2YW4A 3QF0A 2PS2A 1A5SA 4GH3A 4LQ1A 1NP2A 4IIEA 3N15A 1O5XA 2R94A 1GHSA 4K6AA 5JBEA 2A3BA 2C91A 2J25A 5D2WA 1POKA 1KM3A 5HPCA 3PANA 1OFOA 3WQPA 1ONXA 3AIRA 9RUBA 3G1SA 2OZ0A 2DP3A 2FJKA 4RNIA 3DESA 3ZXWA 1V3JA 2QCDA 3PP7A 4H8UA 1RHCA 4JTFA 1LL7A 3NA8A 1TZ9A 2Z4GA 3ICJA 4OBSA 2ZDRA 5AVHA 1OCQA 3ORWA 4L9XA 2NVCA 1LJYA 2D24A 2OEMA 4HJFA 4Y6GA 1OFQA 1C8XA 1H5YA 1Q45A 4ROPA 1UR0A 3S5NA 3WX7A 3TJLA 1FX6A 3CEUA 3TNBA 1O1ZA 3LRMA 3WQ6A 1JNEA 4AZIA 4HHMA 4JN7A 4TVCA 4W7WA 1FWGC 4S3JA 1FWRA 3VYLA 2FIQA 1I4NA 3F4CA 4JIRA 1DWGM 1GTHA 3FJNA 4NXKA 4I9MA 3EGJA 3QW4B 4NILA 3L21A 3FSTA 2O9OA 2W5FA 4UQ9A 1FFRA 1F7BA 3FOKA 2CBJA 4J3SA 4XKYA 5CJNA 1KXQA 1TFVA 4PUWA 3WLOA 3C0JA 4DM2A 1NWTA 1A50A 3UG5A 1B3VA 2HE8A 5D9NA 3EWYA 1ZL1A 5FKYA 4D6GA 4NAFA 3LSCA 1A0EA 3WFLA 2GJNA 4AU0A 4DF2A 3AYRA 4D71A 3S8HA 5D2XA 1YNYA 3BW2A 4XSLA 4IICA 4LNCA 3PUDA 3VD3A 3UJ2A 2L5HA 4IGSA 4GZ7A 2W79A 3T0BA 3UVIA 1CXFA 5FJUA 2GQ8A 2ZADA 4YYCA 4O8RA 1BWLA 1PV8A 1OF6A 4XZIA 3L5AA 1NELA 4GC4A 4WK9A 4L4OA 4W7UA 3URAA 2QPSA 1QNPA 1TVPA 4X0VA 1P0KA 3IAQA 2V5BA 4GY7A 4ENLA 1EB3A 4RK8A 4I8YA 4CD5A 3LCXA 1FQ0A 3QHNA 5DRIA 5C2XA 4GX8A 3AS3A 2BNJA 1JGIA 3KP1A 2QV4A 1RR2A 3F7JA 1VEMA 2UY4A 2RHGA 1XUUA 1RK6A 3BOFA 3LCGA 4PCPA 3PNZA 3REQB 1UA7A 3FDGA 4LRSA 3W2UA 3CM4A 4PMQA 4UTWC 1OT2A 1NOUA 2JGQA 1UR2A 2WOQA 4JEQA 1WOBA 1E1EA 1TPVA 3RM8A 4WSHA 2E67A 3CQHA 4NUWA 3WBXA 2ISSA 4O4VA 1EWEA 3KP0A 5F2LA 2HSAA 3RAOA 5CC7A 1XCFA 1EGZA 3AROA 2WBKA 4J3UA 3SGUA 3FA4A 3QOKA 2X7VA 3PTKA 4HMDA 4KT2A 5HR6A 4GABA 5DY2A 3ONCA 3DKLA 3WLTA 1SJBA 1TE1A 3IVSA 2Y7EA 4RZBA 1MZRA 3EA1A 3OLGA 4PUJA 5JH2A 1ZNNA 2QCDB 1TPH1 2A3AA 3SCNA 2D2HA 2HTMA 1UHVA 4C6KA 3R89A 1B1YA 2FZ8A 2Z0IA 1DJXA 1QNSA 2BHZA 3VKKA 1DIOA 4Z1AA 5KTLA 3EB2A 3VI2A 1V7AA 1P5BA 4HKPA 2CLOA 3Q2DA 3G77A 3GNPA 2POTA 3M44A 3WIJA 3YPIA 4JFSA 3RU8X 3TTYA 4RXGA 4CNTA 2W66A 4K7VA 4I6VA 2VEFA 3DECA 4GO9A 1V7YA 5FA5A 3GYCA 3KLKA 1K7FA 2CHNA 4PUDA 1Y0EA 5C0QA 3HV8A 1TV4A 3ITYA 3G3MA 2OSYA 2W92A 2MANA 4H8HA 4PFMA 3MSRA 4JTEA 1QBBA 5TAOA 2DT2A 4IG2A 4W9TA 1DJHA 4R7WA 4HJWA 1WUFA 4V33A 3GXFA 4K7YA 4XKYB 3V1PA 2ZKMX 1UIPA 4C91A 1KFEA 2G8ZA 4UFIA 3VNZA 2QUUA 1O5KA 3MP3A 4NAFB 4G5DA 5LNSA 1F73A 3QMSA 1H7WA 2EG8A 1UC5A 3BSMA 2OLHA 1WB0A 1L6GA 1CW2A 3VCCA 2RDXA 4LUSA 1FOBA 4CD4A 4PUMA 2YJQA 4WD0A 1N8FA 4OE7A 4D6FA 4GVHA 4MJ4A 4X9YA 4DIAA 4HN8A 2GQ3A 2P5NA 3STEA 4S2BA 4O12A 2QJGA 4R33A 3V4BA 3E3HA 4LPCA 3VXGA 3G18A 3TDFA 4QLKA 3EX4A 4PMOA 3PUEA 1OGGA 4YN5A 3N19B 5F2GA 3L65A 2P0IA 3MV11 4M5PA 1YPXA 4WSJA 4J40A 3FGCA 2OT0A 3S6DA 5JIWA 3CZKA 3MUCA 4IFRA 3DGRA 4P8XA 4E2VA 3CUGA 2NSXA 3KRUA 3W87A 4E2OA 3SN4A 1W3KA 5D9PA 3UR8A 2DSUA 1FWTA 4UIOA 2C79A 1JD9A 4AYSA 1K8ZA 4EX4A 3B4UA 4HPXA 3TW9A 3N3MA 3PPCA 1UZ4A 4V2XA 4U4MA 2X7WA 2RDUA 1KRBC 2QCEA 4QBXA 3AC0A 1RVKA 3ARUA 4GXMA 5FEXA 1TQJA 2YX0A 1WUEA 3GTHA 3BGJA 3VZYA 2YB1A 1AZ2A 1O94A 4O0KA 4CNNA 1RUSA 4A29A 4Q6JA 2FHFA 4DEFA 3B8DA 3VOIA 4N9DA 1B0IA 1EZWA 2Z26A 3LCFA 3LI1A 2QDEA 4BY3A 7ENLA 1GYNA 1SR9A 2VD9A 1ICSA 4P7QA 2VR5A 3QFEA 1LBMA 1TTQA 1VKFA 3LZ5A 1TWWA 4QQ3A 3P61A 3CL8A 4DJEC 3LHUA 4L1GA 4UFLA 1TCDA 3B0VC 4JKMA 2PRHA 4KIEA 3T0TA 1E3ZA 4UR7A 2Q8ZA 3KBNA 3ARTA 3FXYA 1Q6GA 1US3A 2D1ZA 2WKGA 4GHRA 4OBTA 2YDAA 3AWOA 4BF5A 1SQ7A 5A6KA 4LCSA 2PDPA 1K1DA 2VDGA 3CQ0A 1UD4A 1H61A 4N0RA 3U2CA 4KW2A 4A35A 1JZ4A 2YBTA 3PZNA 1DJWA 3C2FA 1Z41A 6ALDA 1JDFA 2E1WA 1BSIA 2ZIDA 1UKSA 5T8GA 3AHTA 3E6EA 5E0KA 3M7SA 4ACYA 3UA4A 1TJ2A 3SEPA 1KFWA 1JVNA 3ABQA 3WY1A 3KLLA 3LUTA 4RNJA 3RCYA 5HJLA 1G7UA 4JPGA 1L6FA 3GC4A 3SRHA 4CN1A 2JE8A 5MKGA 3GNOA 3WNPA 5FOOA 5A8QA 1KWGA 1QASA 4NHVA 3VIOA 3CIVA 4J2MA 4IG2B 4DNMA 2RGMA 3LD5A 3S2NA 3MCMA 2QGHA 1BYAA 1ZENA 1KKOA 3NM1A 2RDTA 4LH8A 5D2YA 3R0UA 3UWWA 3D0CA 2GGIA 5D38A 3CZEA 2G97A 2NVAA 2WC4A 5G1YA 3SURA 1HJSA 1E1CA 1T40A 3WDPP 2GVLA 5AYZA 2J6VA 5FI8A 1B3ZA 3OO2A 3VZZA 4MJMA 4Z1DA 3FFSA 2YXXA 4DBUA 4I7UA 4LUSB 2WMIA 1E6QM 2X40A 3W7OA 2YDRA 4DJDC 1EA0A 3KRZA 3HQ1A 4OOUA 3PPFA 1AODA 4V1XA 1LG1A 1UMLA 5HA7A 2EG7A 2XHYA 3R5EA 1NM9A 1DJIA 2Z1SA 5CAKA 3TA9A 2P8CA 4DELA 4WY0A 1IYXA 1UWQA 2GZXA 4MB3A 4QRNA 3FGCB 3K1GA 4IQJA 3NYZA 5BXPA 4CGTA 3GO2A 1NDZA 3HQPA 3RK8A 4PCFA 1A5CA 1KLYA 3O63A 2RKXA 3M47A 4RDYA 3TJXA 3E5BA 4C6OA 1RJQA 1V08A 3TVAA 3F5JA 1KO0A 1WDSA 4GUIA 4KCWA 1QW9A 3POHA 2GJXA 4D6JA 1FUYA 1WNOA 4W89A 5CSSA 3ANYA 4XVDA 1FP8A 3NZPA 3TZNA 3PY2A 2P0OA 2JF6A 3W76A 1XCXA 4ZQOA 3NL5A 4ZO9A 5LHEA 1R87A 1NSJA 3KXQA 2QJJA 4PMRA 4PMJA 1ZPTA 4ZXOA 3PSVA 4C6MA 1X98A 3FYOA 3UD6A 4HA1A 1FWBC 3QYQA 2QHAA 3AMLA 6REQA 5FJPA 1EIXA 4TX6A 3N73A 1IHIA 3FX4A 2A6NA 5DQPA 2JBMA 3U2EA 1LBLA 1F9CA 1A3WA 4MWAD 5FF7A 3SCPA 2ISDA 1VFTA 3LQLA 3DZ1A 1KCZA 1UYQA 2VD8A 1F3WA 1PYFA 5G1TA 1AD4A 4W86A 1SW0A 3W9ZA 4FSAA 3ZOAA 2RDWA 4MYXA 5GVJA 5IRPA 2JFEX 4PRWA 4LAMA 4J35A 2AQVA 1GJPA 3AYVA 3W6YA 4M1RA 1NAL1 4YPJA 5U4NA 1CX9A 2D2GA 3CUIA 3T1GA 2GVEA 3AICA 4DLMA 1XC6A 1TR1A 1TPWA 4ORMA 2WCSA 5MKGB 3UG3A 1YPFA 1OFRA 3MANA 3T55A 4S1FA 1MMFA 3RMEA 4YXGA 3F2DA 1EF2A 3TCEA 4S3EA 2OXNA 4LYPA 4O53A 1TV8A 2O0TA 3UZXA 4NX0A 3PZTA 2JGYA 4YVPA 5C70A 3MVIA 2AMGA 3WLIA 3UG4A 3S6TA 1OYBA 3PJTA 3TSMA 2ABBA 3UWVA 4QJ5B 3M5XA 2E40A 3ARQA 3HGSA 2VX4A 3EMQA 2WMKA 1LG2A 2E5DA 4GI9A 2NLYA 4OTKA 3VOHA 2J4GA 3IGSA 1E1CB 3B04A 1NJJA 2DJLA 1QPKA 4RZ6A 2F8QA 4OGZA 4GXPA 3QOMA 1HVXA 3A47A 1E4LA 1QRQA 3PF3A 2PC8A 1YIXA 3OHIA 1GJWA 2ZTKA 1LZOA 2Y7DA 3KL0A 3SI9A 3W71A 4IF2A 1DV7A 4C6DA 3W22A 1VENA 3NQ7A 3GFXA 3DC8A 4RDWA 2CHOA 3PG9A 4NF7A 1R2TA 3CPGA 2PLJA 3GHRA 1W3HA 3V16A 1ALDA 3C52A 5HUPA 1XG4A 3LI0A 3ABZA 3K8KA 1RBOB 3N6HA 3WLPA 1C29A 1A3HA 2HWGA 3NURA 4M24A 3D47A 3UCQA 3SUWA 3PM6A 1DP0A 4ZZ9A 3EWCA 1ZP4A 4PULA 2ZC8A 1V6VA 4AEOA 3WQEA 1ISVA 3AXHA 1QATA 5DX7A 1V3HA 3TLLA 1A5BA 4Y9NA 3KX6A 1QI5A 3DFSA 1EO7A 4NZ4A 4OUIA 2FHCA 3LG3A 3SJ3A 3GVRA 4IJBA 1TPEA 1IEQA 1H41A 3WBYA 6ENLA 1S2UA 5E1QA 2GJXB 4QG9A 1JDCA 3OU8A 4ZO7A 4DWSA 1VEOA 2JIEA 4BA0A 1PDZA 2P53A 3W24A 1MW0A 2PTYA 1G4EA 3RX2A 1GNXA 1LOQA 4CQCA 4Q8OA 1GOKA 4X22A 2Y5JA 4MMWA 3IGXA 3LN3A 5M5DA 8TIMA 3GE7A 4JL1A 4NL1A 4F0MA 1V6WA 1QCWA 3N25A 2ZICA 2WW5A 4QJ4B 1M5WA 3BLOA 5A69A 1C92A 1HIZA 2ATMA 3GDKA 3PZIA 3TYAA 1P7TB 1S5TA 4G2DA 4LJ3A 1Z42A 4KFOA 4U10A 1IEWA 2WPGA 4O10A 2X30A 1ITQA 4Y9PA 3NEHA 1VFLA 3CIWA 3MKCA 2A21A 3LGGA 3GNDA 4XAFA 2PLKA 4H9VA 4PB3A 5IBXA 3TX9A 5A8PA 2GK1A 5LIUX 4CN6A 3O06A 3GIQA 2WQDA 2WJZA 3LRLA 3Q58A 1B30A 4DNHA 1EX1A 4JHZA 4AW7A 1UKPA 3UP8A 2DVTA 2Y61A 1FWFC 5T9BG 2XZ7A 1A49A 1R3VA 1PEZA 3HPAA 1SFLA 4LU0A 5EMYA 3OEXA 4CQ9A 4I6KA 4L1WA 4HU8A 2XN2A 3WUFA 4PMVA 1XYFA 3DFTA 3VD7A 4RV8A 1GOOA 4MM1A 2OEJA 1UR8A 3U5YA 3FEQA 1JZ8A 1ZJBA 3MV01 1XDJA 3DFPA 4FIRA 3ZT7A 3EB4A 4F9DA 2WKJA 3N14A 1UKQA 3JUGA 2WSYA 1H7NA 2BODX 4AVOA 4XIMA 1XGEA 6CGTA 3VIIA 2VURA 3DFHA 3O6CA 3UYIA 4IIDA 3AFBA 3M0MA 4JTLA 1WZKA 3LYEA 4Q4KA 5I7GA 2UV8G 3EDKA 5AVNA 1Z6KA 3MBFA 5MF5A 4IQDA 5TNVA 3T0AA 3LLFA 3QY7A 4TV6A 2VCAA 1OCJA 2PDQA 4JQ3A 4YS1A 1DJYA 4QE1A 4K8GA 1RK5A 3IJ7A 4LY4A 4PYSA 3PB0A 4AWEA 3RR4A 5E9AA 4E6MA 3LCIA 4O28A 2PDKA 2PDUA 3H53A 1WKYA 1LRNA 2E5CA 5EB8A 4AY1A 4ZSUA 1X8FA 3OTRA 1E6NA 1Z8AA 1MQRA 3QZEA 2P3EA 1Z44A 2I14A 5E70A 4FK9A 3HB9A 4B90A 3K1DA 1TWDA 2HISA 1UMYA 4Z1CA 3EX6A 1MUMA 3WDIA 4ICCX 3MUXA 1CTNA 1BTCA 3NSXA 1ONRA 1Q4NX 4EF8A 3HO8A 3NQEA 4M80A 2OVLA 4KFPA 1BGGA 2WLZA 4CCZA 3U6WA 4HB7A 2R1LA 1O12A 2XU2A 2G37A 5BOOA 2OQHA 1B3OA 3EA2A 4J27A 4MUZA 3TYZA 5DCEA 1R9YA 4Q32A 4D8AA 4I7WA 2ZX5A 4DWSB 3H24A 5C9ZA 4QQUA 2E8YA 3N9RA 4AZ5A 4F0HA 3AI0A 3SZ8A 1TZZA 4FP1A 3A5VA 5D05A 3SFKA 4LBRA 1XS2A 1L6WA 1JYWA 1QOQA 4DPQA 2FGBA 3R25A 1YDVA 1KR1A 1Z69A 2WCGA 3S83A 4UOZA 5K4ZA 5HPOA 1WZMA 4PRRA 4PE8A 1IT7A 1R9XA 4LWWA 4O50A 4RE3A 5LIXX 3TNOA 3F4NA 2ZXQA 3NNTA 2QCNA 4KESA 4OU1A 4IJRA 4US5A 2PWHA 3S0CA 3NFUA 4LAOA 5G2IA 2IKJA 3USZA 3GX9A 4HU3A 3MZNA 4A8RA 4GQ0A 3BG9A 4B2DA 1D3CA 1JPKA 4GMEA 4MZYA 3W07A 3LLDA 2GK1B 4PTWA 3VMNA 4XX6A 4FLSA 5LNRA 4URIA 4IISA 4Q7IA 2CEQA 2ATSA 2PP0A 2YB4A 4DX3A 3GB6A 4BQ3A 3GAYA 1GT8A 4TX9A 5CZSA 3TE9A 3PZMA 1E5NA 3WH8A 1E0XA 3M0YA 1GGOA 1XLGA 3W84A 5ABEA 3ZYZA 2EBNA 1J79A 3TC7A 2Y0FA 3ABXA 2VZVA 3EDEA 3O1NA 4FXJA 3KVKA 1H0IA 3AALA 1F3XA 5JU6A 2TYSA 2FTYA 2ZTJA 1W3TA 3VUSA 4Z08A 1EJVC 1WYIA 2GSHA 3WQDA 5AC7A 4HZMA 2JKPA 4HIBA 4S3KA 5FL0A 3VILA 4GFSA 2DGAA 2FH6A 1XYLA 5F1UA 4MFDA 5J04A 4W85A 1V3IA 1WKFA 3WBAA 3TN3A 2J13A 1RLCL 4GCAA 3VCNA 1E9IA 1GOQA 2NZLA 5C6MA 7ODCA 4LVGA 3ZVIA 1UIOA 4JFTA 1EGVA 1V02E 2XIQA 2CWNA 1NF7A 3ITTA 3S5SA 1QK2A 1R3WA 2BV9A 4FOUA 1F6KA 2X1IA 2HS8A 1XHGA 2Z1VA 3QBUA 4GX9A 4B15A 2BP1A 3CHDA 1Q2RA 5XIAA 3SRFA 1P0BA 2CHRA 1YKWA 2WSKA 3MSDA 3AMGA 2ICSA 3CUJA 5JMUA 2VTFA 4Z2KA 3KOWA 1IXQA 3BAKA 3MJYA 5HNNA 1KA9F 3TZFA 1VS1A 3A13A 4UCGA 2GOKA 6PTDA 3R8HA 4GBUA 1PVNA 3BLPX 2GSEA 3C2OA 3HA1A 3WQWA 3VKBA 4ZTXA 3VC5A 5BMXA 3N9SA 3SQMA 2YCLA 2Y88A 3L0NA 4WUIA 3UY7A 4ZR8A 1SUXA 1UA3A 4O1BA 4NJJA 1W8GA 3G8RA 3GDRA 1J6OA 1GQNA 3H23A 3TYUA 3FNDA 4HD5A 2VDHA 3DIPA 3I3DA 1IGSA 4QHRA 3DERA 4W88A 1QPNA 4C6BA 3WH6A 1VZWA 4LVAA 5F2MA 1DBTA 1A80A 1RPXA 3Q67A 2DPEA 4GXWA 3V35A 3SSJA 3VDHA 4PB5A 1AMYA 1G0CA 1IR2A 1UASA 2REQA 4G56A 4DN1A 2WJFA 1HZYA 1DIDA 2O56A 2WM0A 3B0YA 3H2AA 2FH8A 1XLMA 4ZQCA 3TIMA 2ZA1A 1FH9A 1W37A 5HMEA 2IKHA 1LDCA 4EPBC 3MUAA 3FJ6A 5I77A 3FVDA 5EMKA 5CPLA 4RE0A 3BLKA 3AIVA 5I06A 1XM3A 1X6UA 1EP2A 2WYSA 3U4FA 1BG4A 2DZBA 4MLRA 5CLTA 3AMDA 4AQLA 1F8IA 1LUCA 4Z0SA 4DYEA 2VZOA 1V0MA 3AXKA 2ZDSA 4HNNA 2VVNA 3IUDA 4DPPA 1KM4A 4DRSA 2A0NA 5C9RA 2EQDA 3G1RA 3ID7A 4UTHA 3ZM8A 3TXVA 4LALA 2PP1A 5K9XA 1J5TA 1BF2A 3AO0A 3SM0A 3GQYA 4BS0A 8CGTA 4LNYA 3DFOA 3A3HA 2BGNE 1PXGA 3UERA 1C93A 1FCVA 3O07A 1TJRA 3DG6A 3T81A 1EX5A 4AZGA 3I7RA 1R30A 4P61A 3OZOA 4F2BA 2DH3A 2FMNA 1VBHA 1K8CA 5HQMA 5DMNA 4QFUA 1HKJA 1MEWA 2FVMA 3EOOA 4D1IA 3LHWA 1GW1A 2VRQA 3PNUA 2V3GA 2HDJA 3UXDA 1FCUA 4EVZA 1EC7A 3B0UX 2OG9A 1JCJA 1EQPA 4F2UA 1CLXA 3WUBA 1CENA 3E2VA 3WEZA 1WAWA 3W0KA 1BPLB 1CLKA 4O54A 2E6DA 2W3ZA 3UPMA 2J7BA 3AS2A 2X1TA 1DL3A 4DVOA 1SZRA 3ITCA 2Y7GA 3PHAA 4HGXA 3W7KA 2BVYA 1EUNA 3NQ6A 4A22A 1CGUA 2WXDM 1PKLA 4GPNA 2VR2A 1UBSA 3L4TA 1PDYA 1MW2A 3PJWA 3FLUA 4MUPA 2J8TA 1KWKA 3UJEA 3R7MA 4O4WA 1UQYA 1ESWA 3TLQA 3R4IA 3PAJA 3PBUA 4TU1A 4J3VA 1UD5A 1VB9A 1A5OC 4PMYA 1XYCA 3HV9A 3ITXA 2YCLB 5F4SA 3DYOA 3G1AA 1YNPA 1XW8A 4OBRA 3PWGA 1QI0A 3QM3A 2R6OA 2HPIA 1GEQA 5E5CA 3VM7A 5KINA 3W27A 1EOKA 4OOZA 4AIEA 3FN9A 3OODA 2WNQA 3DHFA 3DFNA 4GKLA 1AJ2A 3O05A 4JQ1A 3QFWA 3JW7A 1DQXA 2DZVA 4ZSTA 5A6MA 4YTSA 2ZZ4A 3CO8A 4M3PA 2REQB 2NQLA 5CZJA 1XPYA 5H91A 3SB0A 3GC2A 5ENLA 4GVFA 4HU0A 3GFYA 4K39A 3MP5A 3GR8A 1B9ZA 3KL5A 2GGEA 2YCJA 4C60A 4MB1A 2J7FA 4PA8A 2BXYA 1N82A 1VBJA 4NT0A 1GVIA 1U1UA 2V5JA 4KGLA 4HOXA 2D3LA 2PDIA 4ZCWA 1CGXA 4O11A 3CAKA 2V81A 2PWVA 4MYAA 3RRXA 1XFCA 4JTIA 1PPIA 2OEKA 3BGGA 4FF5A 3W1XA 3UGRA 2WHKA 1LUCB 4UC5A 2J77A 4A2SA 2CBVA 3AHVA 2XH2A 4NKCA 3SUSA 3GXDA 1QUMA 1BQGA 2VGFA 1DXIA 1E51A 3URQA 4NXSA 4B5UA 4PUNA 3CHVA 1GEHA 4ZGYA 4AWSA 3WJZA 4CCDA 2VFFA 3KOFA 1MNZA 5C5YA 2R1PA 3EAUA 3VIJA 4M0XA 2VWSA 1QXLA 5BW6A 1B5TA 2BXZA 2OODA 3P62A 4AWUA 1E72M 1QHPA 4FHAA 3WCZA 2TMDA 4AZ7A 3GWQA 4US5D 4XUGA 4R5EA 1XG3A 3H2MA 3KHDA 8A3HA 5FACA 2RH9A 4HCLA 1ODUA 4B2DD 2R1NA 4OV9A 2OTDA 1GJUA 1JUBA 2DT1A 1AH0A 5IFPA 3L68A 3V0UA 1KCKA 1LCOA 1KLZA 1NDVA 5U7SA 5H8PA 1JCYA 3QYSA 4MB5A 5A95A 2IS7A 2V3EA 3QY8A 2J62A 3RRAA 1G5AA 4MWAC 3FW6A 4OWGA 3KCLA 3WBWA 2ZVRA 4CKQA 2CXEA 3MBDA 4U2ZA 3CWNA 4UMAA 1HO1A 2ZQ0A 2D20A 2DSWA 2FLIA 2VX5A 1O7AA 1M65A 1HFBA 3BZGA 3GYEA 2ALDA 3GDLA 3IARA 4H41A 1UOZA 1NF0A 2JIWA 3EX2A 3LPGA 4HCHA 4F40A 3AYSA 5IXEA 1Q8JA 3VNMA 3MB9A 3C2VA 5EMUA 4EPKA 4OQVA 2R14A 3WYZA 3SQLA 4CQBA 3HFYA 2EF9A 2X16A 2PGFA 4IPNB 4D1JA 1J11A 3MT1A 3OW1A 1RJRA 5DMMA 4JTKA 1PZ0A 3FAXA 1KTBA 3UW6A 1GOIA 2OU4A 3CHCA 4IUOA 2RFGA 4KEZA 3RITA 3HQNA 3WLJA 1SGJA 2A3HA 4PN2A 2TPSA 2GSJA 1EPXA 4HHHA 1K4HA 4JKKA 2NUWA 5IHSA 1R7OA 3CWOX 1WV2A 2QUVA 1G4TA 4YWIA 4GYPA 3FS2A 4LYRA 1OEPA 3KOZA 3B03A 4IZGA 3TYDA 3UETA 4A2RA 3WJXA 3M6YA 3CUXA 4EKJA 3A22A 3OBAA 4HBKA 3THQA 2Y8UA 3QH2A 2ZZ6A 3RPDA 1RP9A 2J7CA 3GBEA 3A4WA 3VOCA 4ILSA 4LVDA 1QNQA 3G5EA 1OSEA 5HNRA 1H11A 5C71A 2O9RA 3DYPA 4UMBA 2PFHA 4GKTA 2GWNA 2J74A 3A6OA 3F5KA 3SUVA 2FTPA 3M64A 4R7JA 1NEYA 3VD5A 4QE4A 2Y5EA 1J18A 2DW7A 3N9KA 1DE6A 4OV4A 2DIJA 2H8XA 3GKAA 2XH7A 3C86A 4PUEA 3FIGA 4UNLA 3A4JA 1OM0A 4FALA 4R7OA 2XFRA 4AAJA 2I56A 2I5IA 4HOZA 2B7OA 4RW5A 2OGYA 2ZWZA 4HK5A 4DLFA 2QULA 1G7VA 2QCFA 4Z1YA 2VCCA 1CIUA 4N4QA 1S3TC 1JCMP 3CV7A 4EPDC 3NQMA 4O52A 4ZB5A 3GR7A 3UA3A 4HPNA 1GKQA 1YADA 3WO8A 1R5YA 1GOXA 1XYBA 2VHLA 3OA5A 4WDXA 2ZRYA 2OZ3A 3W00A 3L7RA 2ZUUA 3SR7A 1QVBA 4I7VA 3M41A 1XV8A 3P0XA 4C6CA 3H2FA 3EYPA 5HNUA 1CDGA 3NPXA 2KAUC 3H2EA 1GG1A 1U33A 2FJUB 1WP6A 4QG6A 3GNRA 5A8OA 1X6LA 1PS9A 4CQ8A 4J5NA 2HNEA 3F5LA 3NSNA 2ZCGA 5FSEC 3N4EA 4JXCA 1M6JA 2J8GA 1L6YA 2ZZ7A 4Q7NA 1VCFA 4MNKA 4AY7A 3U48A 3QC0A 3VDCA 3KOYA 1W9PA 4B9YA 4LB4A 1V3KA 5CG0A 4Q4RA 2O9TA 4NZFA 2J7DA 4GA8A 5J5RA 5XINA 4PEEA 5G5IA 1U1HA 4QM1A 2CLFA 1W1A1 2QEZA 5A1AA 3MHFA 4L61A 4JDYA 4EAYA 3AUJA 5HWJA 1HKMA 3RMJA 1JZ3A 4XZBA 1FHUA 4Q6XA 2QUTA 2Z2AA 4FX7A 3K4DA 5EMJA 3TKFA 1IGWA 1MDLA 1HN1A 1CLVA 1UP2A 3RJXA 2I16A 3B9OA 1JPDX 2C15A 1AW1A 3SBFA 3A21A 1LLWA 2NT0A 4XD4A 3W88A 3LHYA 3H6OA 1TUXA 1SZGA 2XVLA 4POCA 3E0IA 4LV4A 3C0QA 3EWUA 1MW1A 3O16A 3G1DA 1PIGA 3NVTA 3B4YA 3Q65A 3PBWA 1SSDA 5CGTA 4S3CA 3UWEA 5DCBA 1M7PA 3E49A 2WCAA 4OFCA 2V69A 3TMQA 2QMJA 4K38A 3WDHA 4LY8A 4QTGA 3A3XA 2Z7GA 3N12A 2F9RA 5LIKX 1ZAJA 4ATDA 3BG3A 8RUCA 1DWIM 2XFWA 2DUAA 3BV7A 2CETA 2X0HA 2PDJA 4JFWA 4DJFA 1W3NA 3UZZA 3R6IA 3I6EA 4PL2A 4IMAA 1W17A 3OP2A 4AMAA 4FMVA 4GZJA 4KCVA 2DZUA 3NM3A 3P5YA 1PHQA 4KEVA 1LWJA 4HHPA 1W32A 1ME9A 2FDMA 4RV3A 2I5GA 3VX0A 2FTWA 4X61A 2ZX7A 2ZWYA 1HP5A 2GVGA 3HGOA 1HJWA 1HKVA 2VFGA 3INPA 3GR4A 2GDQA 5D8ZA 3IGHX 1MUWA 4RX0A 1M9HA 2A3CA 3HTWA 1JPHA 3EKLA 2Z00A 1WXYA 3BDKA 4GY0A 4JTRA 1F05A 3AU6A 3NO3A 4IPLA 1XH1A 1GZGA 3AZRA 3BE7A 4MKSA 3GBDA 2HV5A 2DV0A 2EEXA 3QMRA 2E77A 5HINA 2PDXA 3UR7A 4L6OA 3NDOA 4UZSA 3TR2A 4AH7A 3N6QA 3TN6A 1H62A 3P93A 1LL4A 5A94A 3PN8A 3MMTA 5LKYA 2OQLA 4TO8A 2YZ5A 1JUKA 1XX1A 4GJ1A 4MNMA 1K8XA 3UXKA 1V79A 1Y5WA 4MPKA 5LGXA 3KEHA 1RQHA 4JQ2A 3E74A 4H6RA 2A85A 1KXHA 3I4KA 4YIWA 1SVDA 5C8BB 1RJPA 3T44A 1D2KA 5H8UA 3WENA 3L2MA 1E6SM 2PGWA 3GD6A 1W5PA 3KS6A 3HN3A 4KQNA 4KETA 3QR3A 4GQQA 4GI8A 3BVJA 3WK0A 4LEQA 2E68A 5EA9A 3QSTA 2DFAA 3WH5A 1G67A 4JR5A 4WSKA 4ZOBA 2RGLA 4XB3A 4ZENA 1B90A 1QPRA 1OZQA 4DBDA 2CBUA 3PG8A 2Q02A 1T8XA 2DORA 1ADSA 3UZJA 2DSZA 4P7LA 1VFUA 4UUIA 3H7UA 1W3JA 2FHBA 2VFHA 1Q7MA 1L8NA 3ATZA 3TQVA 4NQ1A 1MO0A 3NIYA 4QCFA 4EF9A 4Y9OA 2OMAA 3E02A 4UQAA 2V8ZA 4DUOA 4UXDA 2WC3A 1S2CA 3H7RA 1M01A 4O1DA 3CIXA 3NQ2A 1HO4A 4H8NA 3CMGA 3AJXA 4NRRA 3FV9A 1H09A 4DZIA 4UZUA 4BFAA 3WJWA 2ZA2A 4LVFA 2D2OA 3U0HA 2CZFA 4DYKA 2Y2WA 4LCQA 3FXGA 4O14A 4QXIA 3GHUA 3FYYA 1LRQA 5FEZA 1XPGA 3I3EA 4U3CA 5I2UA 3GH4A 1YPIA 3VU2A 9XIAA 1Q3NA 3E2RA 3CU2A 3H4GA 4FNPA 5I3KA 5BRQA 1ECEA 3ARYA 3KFTA 3UNTA 3TEVA 1M04A 4GQGA 1KM0A 3W3OA 1K9FA 1FH7A 2QS8A 4F0RA 1BVNP 1FHDA 1G1YA 1Q6CA 3B06A 5A8GA 3LTPA 1W56A 1XFBA 3MO7A 1E4MM 3BZJA 2X0SA 1JNDA 2R82A 4QS5A 1TVNA 4UTUA 4UCFA 1KTCA 2FVKA 1XR2A 5DBTA 3FK4A 1W0MA 1ZRQA 4DM1A 3DAQA 4JFVA 5D30A 3EWXA 4ERAA 4HMNA 3NQVA 4H4IA 3UESA 4CNUA 4YL2A 4QNWA 2PPGA 4QAIA 3L2IA 3Q4DA 4Q8WA 1NIUA 3RO6A 4AVFA 1JZ7A 4NSBA 4LT9A 4AZHA 4K1GA 1WDQA 3R43A 1ZP3A 4FR6A 3CQJA 3GM8A 5J8LA 2EKGA 3AS0A 3PAOA 1E6PA 1OK4A 3E0WA 3WK3A 3OLDA 3W1PA 1HF6A 1JZ5A 4CEUC 3HMJG 3TOYA 4AD4A 4QS6A 1FWSA 1IEIA 4OJYA 3LPOA 2VOTA 4E8DA 4YVXA 1JCLA 5IOBA 1UWSA 1ICPA 3M0JA 4HA0A 1U22A 2IKIA 4YJ5A 4PTXA 1I0BA 2W0UA 3VGBA 2FZBA 2G96A 2F2HA 1TPUA 2NWSA 4MGGA 4AX6A 3G24A 1UD8A 3AHYA 3VTRA 4JTHA 4UQCA 1XIDA 2C8NA 1T6MA 1EXBA 4ZOEA 3W83A 1BF6A 3SY1A 3I7QA 4PCTA 1Q6EA 1UG6A 1OT1A 3KS5A 5DFAA 3CWHA 5LSMA 2BGSA 3UPWA 1OABA 2Y5SA 5K3VA 2YXGA 4G1NA 4NJGA 1X39A 1JYXA 4H2HA 3OYZA 1HT6A 1RA5A 3E0VA 3SECA 3XISA 3HGRA 2CZ5A 5D9MA 4GIEA 2GJPA 2P3ZA 3NQDA 3DI1A 1PKNA 1Z32X 3BOXA 2ZRZA 1TWIA 3MI3A 2ZRVA 2UWFA 1AA1B 1XIBA 4KIRA 3FEMA 2HNHA 2V5LA 1KBBA 3VNDA 4S3DA 4GACA 1BXBA 4CNSA 1JRBA 4ZVJA 2YL8A 3FCPA 2PZNA 6TIMA 4WDUA 3R94A 3GU2A 2VQTA 2UY5A 1WQ5A 4IMCA 3MUY1 3LA4A 4XAZA 5IBXC 2PCQA 1OINA 1P1XA 1NARA 3RGTA 4UTFA 2CU0A 1QWKA 1N2VA 3W38A 3IEBA 3RFAA 5K4XA 3NL2A 3NXFA 4Y96A 2GUUA 3V75A 3NJ3A 1UUQA 1IE7C 3WQGA 5D4YA 3BLDA 1YNQA 1OJXA 1RD5A 1KM1A 1CXKA 5TQLA 1Q13A 1ZAHA 4NZ1A 5H6HA 8XIAA 1YE4A 3GNNA 2WNWA 5C55A 2JKEA 1XRTA 3IUIA 1XBYA 3B9NA 3ZFHA 5G2HA 1FXQA 4GLEA 3LHZA 3NO1A 5TD4A 3IJQA 5LA1A 1EDTA 1GVQA 2W63A 5DRCA 3S2MA 5HDRA 4UTIA 1TA3A 3H8AA 4FPSA 2XIOA 4JTAA 3GLCA 5DT7A 3W73A 3MP4A 4F8XA 2GJLA 1RP8A 1AJ0A 4RDZA 2ONEA 1D7KA 2BVDA 3K13A 3O2LA 1SM9A 3M07A 3T4WA 4DJFD 1R9ZA 1ELSA 4UB9A 2V0TA 4IH3A 5B80A 5XIMA 2OWWA 4RKAA 2X09A 4GI4A 7PTDA 2ESCA 1DHPA 1XI3A 4LXFA 4LUYA 3W7CA 4DXXA 2X42A 5BU9A 1K9EA 1GZ1A 2QIIA 3SADA 4QX4A 4MTVA 1W9UA 3OGVA 3L12A 3UEQA 1GW9A 3UFYA 3GRIA 1GHRA 2QUNA 5EL1A 2EJAA 5G4HC 3QXBA 3TK7A 3ES8A 1QI4A 4MADA 2VX6A 4JHOA 1D7FA 4RW3A 4A8IA 2CLEA 5EY5A 1C8QA 4UTKA 4JQ4A 4F3HA 3VABA 4D72A 1O66A 1XF0A 2E6FA 3ZJKA 3W7PA 1VGAA 3ARXA 1ZFJA 3IIVA 4EXBA 3LGEA 1KGWA 4W84A 3GTXA 1T41A 1VFHA 3O0FA 3R58A 2W62A 1CCWB 5B7YA 3NQ8A 1W1YA 3T42A 3AAMA 3PWIA 3W7MA 1KM5A 2VRKA 3MI6A 3U7BA 1XIFA 1E4IA 1TIWA 1H49A 2DDXA 4IP4A 3M9YA 1H7OA 5TF0A 3ZSSA 3TW7A 2RJGA 2ODOA 3S5ZA 5CAHA 5BXSA 3NDZA 3MY9A 1EQCA 3T4CA 3TFCA 3OHMB 1TIMA 2F6UA 2PDLA 3C56A 1PKMA 5M2FX 2Q8LA 2ALRA 1W1IE 4JTGA 3VVGA 2E8ZA 3M0IA 2PU1A 2C1IA 4K8EA 4J28A 4ML9A 1Q4WA 4PSPA 5LXEA 2W27A 3P5ZA 4P7OA 3ZJ8A 4M6UA 3CB8A 2QAFA 2ON3A 1PWMA 1SW3A 4CVUA 2VWTA 2DW6A 2G5WA 1ITUA 3I7SA 3FYPA 2OELA 3W53A 5A6LA 1E1FA 3GXMA 2C1HA 4EACA 4YYFA 1VHCA 2O4QA 3OQ8A 3W1NA 1DIEA 1PBGA 3IIZA 1JR1A 3NAVA 4OIFA 1VR6A 1C8VA 1VIZA 1LQAA 3K4AA 4LBSA 4JYFA 1JXJA 1PX4A 3UR2A 2GVJA 1P0EA 2PDFA 2XINA 3ME3A 2ZUNA 2WVVA 2BWGA 3MA8A 4Q4SA 3UBPC 1OX6A 3WBEA 2XVGA 2R91A 3I68A 4DUVA 1M7JA 1H7PA 4Y90A 1EJ7L 4UQBA 1ME8A 4Y9MA 1Q63A 1TA3B 1OCBA 6XIAA 2BVTA 4JCMA 2YLAA 1FCBA 1TELA 3KBJA 4XZWA 3VGDA 1BAGA 1ZJIA 1S46A 3SUTA 1RA0A 2A1YA 1JZ6A 4LAZA 1HGWA 1YEYA 4TMCA 3UJFA 1XICA 2EPMX 4JX4A 3EOUA 1POJA 2PCEA 5EKYA 1SJCA 4WCJA 3U8GA 5HATA 4L6HA 1DTUA 1GPWA 3N2TA 3RDKA 4XBKA 2OPJA 4UFHA 2NQZA 1UWTA 2QPUA 3S5YA 3MO4A 4ECLA 2A2IA 4IP7A 2ZZ3A 2EGZA 4B3LA 1KFKA 1XIJA 2A7PA 1VLWA 5L6UA 3UXLA 2CLPA 4M81A 1FFQA 3GSMA 3PZQA 2NUXA 2WWCA 1Q6FA 2VC6A 4WGXA 4HPHA 3CQKA 1VEPA 1KFBA 2QJHA 2F2KA 4FR1A 2G41A 5CC6A 4X2PA 2PWFA 3GH5A 4NI3A 5AZ0A 1HJVA 1J96A 5IHRA 1F07A 1LM1A 3MQTA 2P1FA 3NSMA 1ZSXA 3S1UA 3GFZA 3HG2A 3CQIA 4NVTA 3QLLA 4BZYA 4MPQA 4BJHA 3D3FA 2E6YA 3BCJA 2PDCA 2IPFA 2C18A 2P88A 3BLIA 3QQ1A 4ZE4A 1LORA 1AUSL 1BWVA 2HMCA 4LX4A 2BVWA 3TR9A 1OHLA 1F3EA 4M1BA 4P8UA 3LM7A 4O0ZA 4CD6A 3MCOA 1P1MA 3WJSA 1R3QA 4DB7A 1FWWA 1XLHA 1OG6A 4B4FA 1QPQA 4RE2A 4F0SA 3GHTA 4CU8A 1LROA 1OADA 2X8RA 3H54A 4OHQA 5CEWA 1FWEC 5BWAA 3EOSA 4N6FA 1UZHA 3CLWA 1SZNA 2J66A 3HMCA 3WKZA 4MWAA 3EDFA 1ZAIA 3L9CA 3OG2A 5I3FA 4JKLA 5JUVA 2J8FA 1RD6A 3GAKA 1TPC1 1M53A 1H1NA 3CV1A 3W70A 2GOUA 1NWRA 4MB4A 1LT8A 4CNPA 1W5OA 1PTDA 4HPJA 4Y2WA 4ADUA 3A9IA 2ACUA 2AAMA 3N6JA 2SFPA 3TQ0A 5HAOA 2EAWA 1UPMB 3II1A 3CB3A 1BEUA 4S23A 4NI8A 4YNGA 1E56A 3KWSA 2QPXA 1BYBA 1PL9A 1VPQA 3HFTA 4DYJA 1ZBWA 1A3XA 1AVAA 4YMZA 3TCSA 4E2DA 1OFBA 1MDRA 3NQBA 2EPNA 5E0FA 3WELA 5CCZA 4Z0JA 2WVVB 5DCDA 3D6NA 3NOYA 5HANA 3KOXA 1DVJA 2HEJA 1JI2A 2GUBA 1SPQA 1LLZA 3HGJA 1OC5A 2GGJA 1C8YA 3ITGA 3TTQA 1RV8A 1T5AA 7TIMA 3WNNA 5E9XA 2YKKA 4EXQA 1U30A 3S1GA 3AOFA 3AISA 3WDJA 2XM2A 1I2NA 3CH9A 5CZTA 4LYQA 4O0QA 1P6BA 3AZSA 4G7EA 1KB3A 4WQ6A 1S1RA 4JS3A 2QKFA 2ZRXA 3B8WA 3A64A 3A5FA 5GPRA 3AU2A 1DWFM 1X8CA 4Q3MA 2DSKA 4ZOAA 1D3HA 1A5LC 1JULA 4E4FA 3ARWA 3NZRA 3H12A 4NX5A 4Q8UA 1QAPA 5CPTA 4I3GA 2Y6ZA 4WZHA 4CVWA 3G1YA 1JD7A 4QEHA 3CYVA 1GORA 1SSGA 4X60A 1O95A 4GQBA 3RM4A 3K5XA 2R1MA 5ABFA 1P6CA 3SN0A 4JD4A 4DUWA 2EPOA 2BY0A 1G9HA 1SR0A 1GYMA 3FSUA 1F8MA 2WNNA 4LYKA 4XAGA 1CGVA 4PR4A 2XSXA 3B97A 1EA9C 2ASHA 4WF7A 3CAVA 1BHGA 1PZ2A 4ZOCA 3L66A 3N2BA 3UYCA 4BR1A 4HNLA 1K9DA 5H8MA 2DZPA 5T91A 3U2OA 4QISA 1A0CA 2PE4A 2J27A 1TO3A 4KF1A 3SUUA 4FIQA 5I3JA 4XTIA 3G1FA 2Y62A 2Z1XA 3G1XA 4ZTYA 2QIWA 3CYJA 4Q8QA 2PZ0A 1WA3A 1VLIA 3ZR5A 1W1VA 1PCWA 2YLLA 3N4AA 1I75A 1RZMA 3DFYA 1XYMA 3WQVA 1AJZA 1I2PA 5G4WA 5F2IA 2R9RA 4KPLA 2XIIA 1OBAA 3THCA 1NY1A 4PBFA 1IWBA 3KCJA 1GVFA 3VM5A 3VDAA 4AEFA 2I57A 2A7NA 3HBLA 3KBMA 3KDNA 3XINA 2V5DA 1W8SA 3RNDA 1AL7A 2BG5A 3F2CA 2QZRA 4PZVA 1V6UA 4M6QA 2ZOXA 1EUAA 3ITVA 1TCMA 2V2CA 3SCVA 1EP1A 3W4RA 3M4HA 1FXPA 3CK5A 5FJJA 4HPGA 4MWAB 2C6QA 1F74A 3BARA 5BOEA 1BWKA 4C6EA 1Y5VA 1UCWA 1XLJA 1KV5A 4IXXA 4I9TA 3T7VA 1J5SA 3T8QA 3N4FA 2V9DA 1TREA 4AVNA 2IXUA 2A79A 3QV8A 5JIPA 3T9PA 5FAJA 4EANA 1ADOA 1EJWC 2H9AA 4X63A 3G6MA 3WK2A 2QCMA 5LGZA 3ZJ7A 2WJDA 4GISA 3CPUA 1CT5A 3WH9A 4K8HA 1S5WA 2FPVA 4H04A 4P7NA 4KGJA 3D5HA 4AWTA 1AH4A 1K6AA 3R8GA 4JNMA 4L1XA 3DUGA 5CPNA 4O13A 4M7SA 3T08A 3VMOA 3F1QA 1F61A 3TH6A 4GBDA 4IPPA 4LAUA 3MZ2A 1BKSA 1V4YA 3LPPA 4R3UA 4XBSA 5CBJA 3R12A 2ZZ5A 3VD9A 1VIWA 2WZMA 4UNKA 3VE9A 4MFEA 1V8EA 1VPXA 2O55A 4H9TA 4YTRA 3ARPA 1KCLA 3NQFA 4KWOA 5D2TA 2ZXAA 4LV9A 2OKTA 5CPSA 2PP3A 4LC6A 4C6LA 2Z24A 4KCTA 3T2OA 1HGYA 3C6CA 5HULA 5AHIA 3C5QA 3AIQA 4AD5A 1RH9A 5ABFB 4N9BA 4L9YA 2WZEA 4H1ZA 4IMEA 2NQJA 4YVVA 3RF9A 2PBGA 3W75A 1G4SA 1YTEA 1E9YB 3TAOA 3QHOA 2OSXA 2NQ9A 4X9SA 4GG9A 3WFZA 1RPKA 3R8RA 4REQA 4FLOA 1XLBA 3AXMA 4Q33A 2CXGA 3SFWA 2ISWA 3CTLA 4MJZA 2OGJA 2EPKX 4F48A 3ZQ9A 2NXGA 1F6YA 1IV8A 1IZKA 2FZMA 3PSWA 2GQAA 3U9IA 3WLKX 1EPVA 3QEZA 3MW7A 1Q2SA 1NDYA 3UZ5A 1FDZA 4P5UA 3BAJA 2A5HA 3BL3A 4QGCA 1AQMA 3DU0A 3NDYA 2B4GA 1TQXA 2CERA 2IW0A 4IGMA 4ZMGA 1PTAA 5LXXA 1IR1A 1SO6A 2YDQA 3VIHA 5HBFA 4QNEA 5FEPA 4M51A 3TC3A 4QLLA 5H2ZA 1R2SA 1GVOA 4HP5A 1XLFA 1NP0A 1CGWA 2ZFAA 2NW0A 1O1HA 3OZMA 3W02A 4GYPC 3EA3A 1Q66A 1JI1A 3I6RA 3SIMA 1LL6A 2F38A 2DZWA 2G4JA 3LXCA 3GU1A 3I10A 3IJDA 2C16A 4PMZA 4AZCA 1K77A 4GNVA 2V67A 3CZ8A 3WLNA 3SCRA 4AMCA 2IQ0A 1VYPX 4RLIA 2YIHA 1V0KA 5G4EA 1YTKA 2PC4A 3UGVA 4MY1A 1JZ2A 1R46A 3PBGA 4O18A 1T0OA 3A4AA 2V30A 1SZEA 2VZSA 3IJ8A 3UZWA 1Z48A 3TTOA 4KRZA 3HOJA 2DY3A 5DMLA 3ALGA 3NQAA 3VNIA 3GDBA 4Q8VA 2OR2A 3LU2A 1SJAA 1WDRA 1W6TA 4NNAA 3GXPA 2NX3A 1L6SA 1LQ2A 5EFDA 4A8NA 4PC8A 2H9AB 4U5IA 3WF3A 4YCOA 3P0WA 4IMFA 4IPJA 1BXCA 1TPFA 3N29A 1ZBKA 4ZB0A 4MZ1A 4IIBA 1AW5A 3VC6A 4YHGA 3VUPA 5HQLA 1DWAM 5AHNA 4RPQA 2OX1A 4AB4A 1XGZA 3VGGA 2ZE0A 2OZTA 1GOMA 3WMCA 3AJ7A 1W1TA 1AFSA 3LB0A 2A3LA 2FVLA 2W9MA 1I60A 4FX6M 5K2ZA 2W67A 3EOEA 3LXBA 2BASA 4Y7EA 3AXXA 4EOUA 4D2JA 1H0GA 3A3WA 2VUNA 3P84A 5K7JA 3VDBA 2XIBA 3LQGA 1OY0A 1OVDA 1E70M 4HSNA 1NOFA 2GLKA 1VC4A 4TQTA 1I6NA 3QR0A 1DXEA 1M68A 1VFFA 3E0LA 2YL6A 2EJ1A 2GGGA 4XTDA 1M03A 4GUGA 2CLMA 5LHFA 1E9ZB 4C6NA 3ARZA 5I09A 3K2GA 2VFDA 4W5ZA 2OOFA 2IKGA 3SRDA 3RLGA 2VNCA 1K7EA 4QP0A 3U2ZA 3P14A 1XD1A 2BB0A 3WZ0E 3CV2A 2YXOA 4DBEA 5GNYA 1YE6A 4PTNA 3S6OA 1V02A 2HCVA 4ORIA 4REQB 4Q4QA 2IMRA 1PSCA 3IRDA 1QTWA 5I5RA 2BHUA 2NV2A 4IIHA 4PL1A 1KNWA 1UROA 3H7VA 3COTA 3PWAA 4S3BA 3M5VA 5D04C 4ZB2A 4IPIA 1XIEA 4W4QA 1MUCA 3SY8A 1IXOA 3OVGA 4AD1A 2AAAA 4GRSA 4V15A 4XZMX 3EBVA 3GVGA 4RJEA 3TUUA 5KZ6A 3WQ5A 3S9YA 2WM1A 4XO7A 4XISA 2KZHA 3JU2A 4KEMA 5DMYA 2WMIB 1NFPA 4QDWA 1A5AA 2D0FA 4QCEA 1GVEA 2J9XA 3IAPA 4HHLA 2YDSA 2PD5A 5BU6A 4XV0A 3SQSA 5HK4A 1M3UA 2P76A 4UBPC 5I03A 2BOGX 3FA3A 5CPMA 4XUYA 4LTSA 2NVDA 1NFGA 1UR4A 4WY0B 5BWFA 4Q8PA 4A05A 1FWHC 2R8WA 3LZ3A 4AYGA 2VMFA 2PF8A 4AZCB 4DJFC 5CZKA 4GYKA 4KEUA 2LLEA 2GQ9A 5EMLA 3E0FA 1XQLA 5ABHA 3W1LA 1TV5A 1T8QA 3B9EA 3S2CA 1TKKA 2WMGA 4R27A 4UFMA 5BMWA 5F4XA 1WOAA 3ZMRA 3DHUA 1GVYA 3H55A 5HJYA 1P43A 3IPWA 3LENA 1B2YA 4IX0A 4ERGA 4H2CA 4XG1A 1EJSC 1LRTA 4Z17A 2B81A 4PRTA 1W5MA 5HUOA 3MMDA 1HG3A 2NXIA 3BCFA 2HXUA 2V2HA 1CPUA 4UR9A 3CNYA 3BV4A 2DSVA 4JTSA 1JF5A 3L2LA 6REQB 1BFNA 2Q01A 3TYBA 3GDTA 5LYRA 4JL2A 3UT0A 3BAXA 5AHEA 4LF2A 3V7PA 2Z27A 2CWXA 3BICA 1QHZA 3MPGA 3BW3A 2G50A 1RVGA 1JRCA 1OWQA 4CD7A 3CEPA 5AHMA 1ZBVA 3W1AA 3VOJA 1HJQA 1R85A 3HM7A 5PTDA 1QHOA 4N9CA 4QLJA 1G69A 4WXZA 2X41A 1ZB5A 5AC4A 2YR1A 4N6EA 1OFPA 4TV5A 2VQUA 3CAQA 3G6LA 4HQVA 2OYLA 4F66A 3W1UA 2QF7A 2C0AA 3O6YX 3BWWA 2G3NA 3LMYA 1SMDA 3B8TA 3UU0A 1RXOB 1E0TA 4O1FA 1IQ8A 4GYJA 1CXIA 1TB3A 3RM9A 4KKXA