2JEPA

Native family 5 xyloglucanase from paenibacillus pabuli
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
363
structure length
363
Chain Sequence
ADASQIVSEMGAGWNLGNQLEAAVNGTPNETAWGNPTVTPELIKKVKAAGFKSIRIPVSYLNNIGSAPNYTINAAWLNRIQQVVDYAYNEGLYVIINIHGDGYNSVQGGWLLVNGGNQTAIKEKYKKVWQQIATKFSNYNDRLIFESMNEVFDGNYGNPNSAYYTNLNAYNQIFVDTVRQTGGNNNARWLLVPGWNTNIDYTVGNYGFTLPTDNYRSSAIPSSQKRIMISAHYYSPWDFAGEENGNITQWGATSTNPAKKSTWGQEDYLESQFKSMYDKFVTQGYPVVIGEFGSIDKTSYDSSNNVYRAAYAKAVTAKAKKYKMVPVYWDNGHNGQHGFALFNRSNNTVTQQNIINAIMQGMQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Characterization and Three-Dimensional Structures of Two Distinct Bacterial Xyloglucanases from Families Gh5 and Gh12.
pubmed doi rcsb
source organism Paenibacillus pabuli
molecule tags Hydrolase
molecule keywords XYLOGLUCANASE
total genus 144
structure length 363
sequence length 363
chains with identical sequence B
ec nomenclature ec 3.2.1.151: Xyloglucan-specific endo-beta-1,4-glucanase.
pdb deposition date 2007-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2jepA00
1OB0A 1BHGA 3PZ9A 5D9OA 2RGLA 3W82A 1UD2A 4X0VA 3NCOA 5E0FA 3GH4A 4UQBA 2J7GA 4PSPA 2RGMA 1RPKA 3CUHA 2Q8XA 5A3HA 4GIAA 1WKYA 4ZXLA 4GI6A 2G3MA 3GXMA 1WZLA 4JHZA 1E6RA 1C7TA 3AIEA 5AY7A 4FLSA 1Q6FA 4IUGA 4B9ZA 3F5JA 2W5FA 1CLXA 1MQPA 1OGBA 4M80A 4HU0A 2DH3A 3AZTA 1RH9A 2CBVA 1LG1A 3SUTA 2YOCA 2NT1A 2WBGA 5CPQA 4GQRA 1JZ7A 1MQRA 4YHGA 4CGTA 1CIUA 2IUZA 2VR5A 3W0KA 1ZL1A 3F4VA 3L4WA 8A3HA 1FFRA 4KWUA 1BGAA 1D2KA 4W88A 4UQDA 4PMUA 4L4PA 4TTGA 3TTOA 3WUBA 2ZUUA 3BCFA 1DP0A 1ZU8A 3WF0A 1JNEA 4YHEA 4PMOA 1JYNA 4IISA 5EB8A 4PTXA 1V0KA 1LJYA 1HF6A 2X2YA 2DSZA 2PWFA 3WDPP 2CKSA 2NSXA 1OT1A 2JALA 2OSXA 3PHAA 2XVGA 1MQQA 3BAWA 3VU2A 1KWGA 4H7VA 4JFSA 3VIJA 3W6LA 4B15A 2EEXA 4AIEA 2O9PA 1BYAA 2E8YA 1JF6A 5HXMA 2X05A 1CBGA 1VJSA 4JAWA 3ARRA 3UR8A 3LPFA 4JL1A 2ZWYA 1XD0A 4XZBA 3K8LA 3WIJA 1KR0A 2VTFA 3WF3A 6TAAA 3ARYA 3D3AA 1Q6EA 1UZ4A 1MW3A 3T2QA 4DWSB 3PTQA 2G8ZA 4LXFA 2WMGA 2VZSA 2QMKA 3WD0A 3J7HA 1IV8A 1CGTA 2XM2A 4LX4A 3ZT6A 1J12A 1EXPA 2VO5A 1Q6GA 5FIPA 3L4UA 1BTCA 1GQLA 3CZLA 2WWCA 4JHOA 1UUQA 3IAQA 3ARVA 1TCMA 4CKQA 2WCAA 3GM8A 4W93A 2YBTA 1GHSA 1JDAA 3L4XA 1C3FA 1BLIA 4HA4A 4EAMA 5CLWA 3VM7A 3FN9A 3N18A 2QLYA 4PTMA 1DEDA 1KGUA 5I79A 4QFUA 1J0JA 5A8OA 1V0MA 3MUZ1 3IAPA 9CGTA 2WK2A 3MUAA 4ATWA 2GJXA 4J7RA 3CHCA 2VX4A 1UWSA 5I23A 3U57A 2VCBA 3VINA 3VGHA 1B3VA 3WD2A 4D6JA 1E6NA 1W3JA 1A3HA 2VL4A 5ABHA 5D4YA 3I3EA 2ZXQA 2G4FA 1XV8A 1JZ5A 3F5LA 2J7EA 1TVNA 4NF7A 5DT5A 3ZSSA 2J8GA 1V3HA 1GQKA 1CNVA 4GI8A 1GUVA 2OYKA 1BYCA 3L2LA 4CU7A 3BSHA 5CLTA 2BVYA 1PIFA 2BNJA 4NI3A 4UNIA 1HJXA 3T2OA 1CGXA 2TAAA 2ESCA 2XPKA 3CTTA 1EQCA 4KH2A 4U5KA 3AS3A 4YPJA 4J3SA 3WH8A 4KRUA 1E6XM 1HP5A 5HOSA 5C8BB 4IPNB 4N0RA 1V3LA 1WPCA 4JL2A 3AICA 4W8LA 1W1VA 1R85A 2EXOA 2A3HA 2GK1B 7A3HA 5LA2A 2E3ZA 3B8SA 4JKLA 1VB9A 1E4MM 2UY5A 1C7SA 3VGGA 4QCEA 4JZ5A 4D1IA 4MJ2A 1R7AA 4UFIA 1B9ZA 5I77A 1HKIA 4JCMA 2BY2A 1E71M 5AYIA 1E43A 5E70A 1GCYA 2DSVA 3OZOA 4M24A 4Z2LA 4UFLA 5M03A 4PMRA 3HU7A 2PI6A 1QNPA 2WVVB 1UR8A 2ZICA 4AD5A 1ZJAA 3BAKA 2EQDA 1XSIA 3WD1A 3BAYA 3PZNA 2XVPA 5C70A 2J62A 2G3JA 2CESA 4WKFA 4ACYA 3CLWA 4H8HA 3ARPA 4WF7A 5E9AA 3AHZA 1CGYA 4ZE4A 2XFRA 1B2YA 4J3VA 1C90A 4BQ5A 4D6GA 3CHDA 1M04A 1DWIM 2J75A 4U33A 5IHSA 4ATLA 3KEHA 3OG2A 2NW0A 3OGVA 3WH7A 3GXIA 2DT0A 1ECEA 1EO7A 1VRXA 3EDEA 1FP8A 2F2HA 5D9PA 3PTKA 3AMDA 1OGGA 5A8NA 2V3FA 4UQ9A 1JXJA 5A6JA 1JAKA 4TVCA 1EGZA 1F4HA 4H04A 4W84A 5CGTA 3VIMA 3WL0A 2IXUA 3QHNA 2PWHA 3JUGA 3K46A 4AYSA 3IJ9A 2CPUA 5CZKA 3BLKA 5JIPA 4HP5A 1HJWA 1XC6A 2W4XA 3DECA 1W1YA 5HPCA 3ZT7A 1W3LA 1Q4NX 1WB0A 1J9YA 3SUWA 3SUVA 1H3GA 2V3DA 2OYMA 2MANA 1ISZA 1JG9A 3U7VA 4GXPA 3ZJ8A 2Y24A 5ABGA 2DT3A 1J0ZA 1V3MA 3T0BA 2FHFA 2UWFA 4TX8A 2WLZA 2WCGA 3HMCA 2W92A 4P8VA 1NOWA 1H49A 2D20A 1HN1A 2DGAA 4JFWA 2WMJA 4GZEA 1E73M 2O9TA 3KL3A 5JIWA 3EYPA 1UR2A 1XYFA 1NWSA 1ISWA 1FH8A 1PZ2A 3AIWA 3OGRA 1E1FA 5CJ5A 2BS9A 4LYQA 5DF0A 1GQJA 4PSRA 3B9AA 3O9NA 4OZOA 2OSWA 3T0DA 5IDIA 2OYLA 3PN8A 4MAVA 4XZWA 1CLVA 3EMZA 3WDJA 2J77A 3ECQA 1MWOA 4D6IA 1FHDA 1PZ3A 1G5AA 4CD4A 1PBGA 4UQAA 1H0IA 2WMFA 1W1PA 1W9PA 1SFSA 2BVDA 2YLAA 5FKYA 3G6MA 1UWIA 3TONA 2XIIA 1YQ2A 1XRVA 3ARXA 2PWGA 4AZ5A 2ZX7A 4CN6A 4FLRA 5A6LA 4CCEA 1FFQA 5FOOA 2WAGA 4BZYA 2WMIB 1VAHA 3EDFA 1GW1A 2WMIA 1QBAA 3RILA 2O92A 4HU8A 1E5NA 3G6LA 3W25A 3AIQA 4CD7A 4HZ7A 2VQUA 1K9TA 1PPIA 5LYRA 2WVSA 4D6FA 2CITA 3VX1A 2BY0A 3WNLA 2WPGA 3CZGA 4FLOA 3K4DA 2YL5A 3VIKA 3FAWA 4HZ8A 1ODUA 4HZ6A 3U7BA 1HVQA 5CQ1A 1E56A 3CBWA 2CBUA 2W62A 3N13A 5E0CA 2VT0A 3W27A 1CECA 3MS8A 4CVWA 2A3CA 3QHMA 1LWJA 3SCQA 1FHLA 1W2PA 2VNCA 5A2CA 4MNMA 4PYSA 3QHOA 3BXWA 4WJXA 2F8QA 2FDMA 4U5IA 3DYOA 2EPLX 4MB1A 1UD6A 1ZBWA 2EBNA 3RJXA 1OD8A 1VF8A 3M6DA 3CGTA 3MUY1 4UFMA 1H41A 1HL8A 2YJQA 4JFTA 4UR9A 3VIPA 1WZMA 4UQCA 4X0NA 1L0PA 2WVUA 2V5DA 1QW8A 2B31A 4A4AA 3QOKA 3WNKA 3LMYA 4AY1A 4JIEA 2NT0A 1XH2A 1H2JA 1FOBA 2A3EA 2CKRA 3WQ5A 1V08A 3S2CA 1QW9A 4XV0A 2WVTA 4CN4A 1K9EA 1E72M 4B16A 4IPLA 1BFNA 2FH6A 5FD0A 3VGBA 3FY1A 2BY1A 4V2XA 4MPKA 1V6VA 4Z2JA 1UD4A 5I0DA 1QI5A 1F4AA 4LYRA 1M7XA 4PMQA 1GJWA 1JDDA 3WMBA 3ARWA 4D6HA 4GI9A 3WUGA 3FNDA 5KEZA 3BAXA 4QLJA 2ZX6A 2ZWZA 4AW7A 1MFVA 2J78A 1B31A 5CPSA 4C7FA 3UEQA 3AIBA 4DM2A 1TFVA 3ZO9A 2X8RA 5BXTA 1WNOA 1HX0A 1E40A 1LLOA 3W6MA 1JFXA 1QPKA 3AHVA 1H1NA 1XHGA 3BLPX 1AMYA 3VGEA 4UOZA 2Y5EA 3I3BA 4M82A 1GOMA 4W5UA 3CUFA 3FXYA 1OINA 3PZVA 4PMVA 3KE0A 1KWKA 3B9DA 1OGSA 1UWUA 1WCGA 4CD6A 4DWSD 5IFTA 1GVYA 3GNPA 1JZ3A 4BCEA 4R27A 1EOMA 1B90A 1E0WA 2YL9A 3POCA 4ACZA 3ZR5A 1NP0A 5A6BD 2V3EA 1D3CA 1EDTA 1KR1A 4RL3A 4H41A 1J0IA 1HNYA 5HBFA 1NWTA 1J0KA 5DEZA 2PF0A 3NYDA 1UR4A 1GVIA 2AOSA 1X6LA 1RP8A 1VBRA 1J18A 1J0HA 3AROA 2DSUA 1DWFM 1CYGA 2J7DA 3VIHA 3SCOA 5A2BA 1C8QA 4AZIA 1ISYA 3W24A 3DHPA 4U3CA 3AIVA 1Q6DA 4HA1A 4AD1A 4R5EA 1BG4A 1CZ1A 1LG2A 2Y2WA 1E6SM 1ZJBA 2WWDA 3GXFA 4D6EA 3ZIZA 3CMJA 3NJ3A 1UZ1A 4J3XA 4RE4A 3SCRA 4PMYA 1NWRA 6CGTA 4AMCA 1ZS2A 5BROA 4CCDA 1GONA 1GNXA 2C8NA 3I3DA 2Y4SA 1WDQA 1IZJA 1ESWA 2V5CA 2YA0A 4NZCA 3OA5A 5JBEA 2EPOA 2CIPA 2CBIA 1DWAM 4X9YA 5I78A 3AIUA 1JFHA 2E40A 4Z2HA 2DIJA 4HMEA 1V6XA 4V27A 2OLHA 4AZHA 3VDBA 2XGIA 4TX6A 1CXKA 1B3ZA 3N17A 1BF2A 2JEQA 3AJ7A 3GYCA 4W89A 5A6MA 1JYXA 1ISXA 2J7HA 4PUDA 3IJ8A 5BYWA 3PZQA 5EBAA 1E15A 2WANA 5IXEA 1DHKA 1GHRA 4P8UA 1J01A 2W66A 4MADA 5F7UA 3ARQA 5CXPA 2GVYA 3VO0A 2FH8A 1ZB5A 1ZBCA 3ZJ7A 3QOMA 2VQTA 1RD6A 2YL8A 4AD2A 2CHOA 3CUGA 1ITCA 4FLQA 3ARTA 1DTUA 1V02A 5D9NA 5BCAA 1C91A 5DO8A 3WMSA 4K68A 2QPUA 2XVNA 1C8YA 2W61A 4J27A 3TTYA 3UG3A 1UG6A 3S6TA 2DT1A 1UWTA 2JIWA 3WH6A 2WC4A 3VUPA 2CETA 1UKPA 4QLLA 1QNSA 4PMNA 2ZUMA 2CXGA 1LQ0A 3KL5A 5CPTA 1BG9A 1TA3B 1TMQA 4ZFMA 4QCFA 1MXDA 1UKOA 5GNXA 4UTFA 1UA7A 3WNNA 2WXDM 3SUSA 3BCDA 5GPRA 4GZJA 1B0IA 1V3KA 1UWRA 1V0NA 1MFUA 1UR0A 2VURA 4XUYA 3AS2A 1XSJA 1VFOA 2EJ1A 4OIFA 2D1ZA 4MAZA 2ZUVA 3BGAA 1UA3A 1RP9A 3A47A 4BS0A 3DC0A 4M29A 2OWCA 1HXJA 4B3KA 3GBDA 2CEQA 1CXLA 2DT2A 1NQ6A 3ZT5A 1VFFA 1DWJM 4AXNA 1H09A 1P6WA 1V0LA 3PZIA 1XCXA 6A3HA 2BHZA 1O7AA 3VTRA 1TUXA 1E1EA 3WMCA 4HOWA 5A1AA 5IHRA 3TP4A 4HMCA 3NDZA 3QR3A 3SCVA 3AZSA 2VRJA 2PBGA 2YDSA 3W53A 3ZQ9A 3KWXA 1UHVA 1BVNP 1Z32X 1E55A 3UCQA 1BYBA 5TD4A 1E4LA 1KCKA 3D5HA 3WH5A 1HJQA 4MNLA 4NRRA 4AEEA 1QI2A 1HT6A 1UD5A 4W86A 1HL9A 1PEZA 2BV9A 2D23A 1KGWA 1E3ZA 1E4IA 1KBKA 3U5YA 3WFLA 1DWHM 1VFUA 1V6YA 5CG0A 2WKGA 3CO4A 4D6DA 4CU8A 1KXQA 1YHTA 1CDGA 2GJPA 4PEEA 1B30A 4PCSA 4MB4A 2J47A 3AXIA 1JXKA 4AWEA 4UCFA 2UY3A 1WDRA 4GQQA 2A3BA 4BA0A 3TA9A 4CU6A 2GJXB 1HKJA 4W87A 4E8CA 1UKSA 2PWEA 1B1YA 3MU7A 1LL7A 3VD3A 1GOKA 3ZJ6A 5I3DA 5HDRA 1GQIA 2FGZA 5AC4A 3WQVA 4NSBA 3RJYA 4OJYA 1W9DM 2EO7A 3CUIA 4JFUA 4DWSC 1MVYA 1JZ2A 2WZEA 3MUIA 3A4AA 3ZMRA 1G01A 2DSWA 1LWHA 3II1A 3T08A 1BQCA 4XB3A 5E6YA 2VRKA 1B3WA 2W63A 3N9KA 3M07A 4TTUA 4AZGA 2VVSA 4GO9A 5A8PA 1SMDA 3EMQA 2WHLA 3MMWA 3WNOA 1C8XA 3M7SA 3NDYA 1CGUA 1KXTA 2PC8A 4FK9A 3CZKA 3K8KA 3VVGA 3CZJA 3L4VA 3BAJA 4EANA 3T2PA 1MW1A 3GDBA 4L4OA 4Z2GA 4DWSA 3DYPA 1O6IA 4TXEA 2GSJA 2GJRA 3BSGA 4E8DA 1UR9A 1EO5A 4W7WA 3GH7A 4WKHA 1CWYA 2VZVA 3MANA 4Z2KA 4PRWA 5A2AA 4UQEA 4PUEA 2G3NA 3PZUA 2XWEA 5FL1A 4PBGA 2WYSA 3RPMA 4AEFA 5AC5A 1OCQA 3LPPA 1U2YA 1VBUA 1VFMA 3W4RA 3CIVA 1EA9C 2VOTA 1C93A 3W28A 3OZPA 1WDSA 4W7UA 1KQZA 4H2CA 3MKKA 3AMLA 4PTWA 3E1F1 3AFBA 4ZE5A 3BMVA 3WELA 1V6WA 3RM9A 5IFPA 3DHUA 4AZCB 3SCTA 3ALGA 5DT7A 1HKKA 3VILA 3WQWA 2ZIDA 4MDOA 4BQ4A 5I6SA 5BRQA 1A47A 1G1YA 4W85A 1W9BM 3WNPA 3AISA 3ZM8A 2YKKA 5M17A 2ZUNA 3WDIA 4DUXA 1B3XA 2VX7A 1HJUA 4UFHA 3NSXA 3L2MA 5BXSA 1VENA 1J11A 2HISA 4AC1X 4NRSA 3MMDA 1CEOA 4ML4A 2VX5A 2WCSA 3VMOA 3FW6A 1U33A 1NM9A 5LA1A 3UR7A 1BVZA 3MO4A 4F66A 4P8XA 4QAWA 2DEPA 1GZJA 1VIWA 3EDKA 5JUVA 4OOZA 1W32A 4OKDA 4J3UA 3B9EA 4EE9A 3WQ6A 2CBJA 1PX8A 1CPUA 2W91A 2D24A 4WSJA 3KL0A 3NUKA 4AD0A 3FHAA 4Q7NA 5BRPA 1MYRA 1V3IA 4XX6A 2JF6A 1W9VA 2XIBA 4W8BA 1QNQA 1X1NA 4DM1A 1J10A 3TTSA 3VNZA 4WLCA 1QOXA 2WKLA 1ZBKA 5CSUA 3AMKA 1SMAA 1W2VA 5C71A 4M8UA 1NWUA 3AQUA 4S3KA 1OD0A 2VMFA 3NIYA 3BAIA 4KRTA 3WF4A 4F9JA 3WQ4A 1W9XA 4ZENA 2CERA 3SIMA 3AYRA 4LGXA 7CGTA 4U31A 1UD8A 2OWWA 4Y7EA 3AHTA 2GUYA 1OT2A 1CXEA 4LYPA 2XHYA 3ARZA 3VKKA 4PMZA 1JZ8A 5D8WA 3W37A 1WO2A 2ZE0A 1TZ7A 2J74A 3VMPA 1U30A 3OIHA 1JIBA 5FCZA 1UR1A 3VNYA 2Y8KA 4MTVA 4TVDA 2JIEA 2PB1A 1BAGA 4QP0A 2J7BA 1LL4A 1W91A 2WBKA 1UH3A 1OSEA 4E2OA 1K9FA 1CXIA 3AIRA 4U3AA 2UY2A 2E4TA 1IZKA 4P7QA 3RO8A 3F5KA 3VD9A 3OGSA 2D3NA 4FMVA 2JEPA 5EFDA 4OBRA 2XGBA 3VGDA 2J79A 4UOQA 3WDQA 3APGA 5I24A 1L8NA 3RDKA 2ZX5A 1EHNA 4M1RA 4AIOA 1XGZA 3PZMA 2J8FA 2X0YA 2XVKA 1D7FA 1BSIA 1FH7A 1PAMA 1JZ6A 1J0YA 1TA3A 2C7FA 2XSAA 4UZUA 2D3LA 2F61A 1CENA 4HOZA 3AHYA 2GK1A 4HA3A 1JDCA 3WEOA 2FGLA 3WDRA 1KGXA 1AVAA 1HJVA 2XFYA 2XWDA 1E4NA 1GJUA 4OUEA 2XFFA 4V28A 2A3AA 4QLKA 5ABFB 1GPFA 5ABFA 3WH9A 2YA1A 4PTVA 1EDQA 5JBDA 3A4XA 1QBBA 1M01A 5E6ZA 2ZXAA 2AMGA 2BHYA 2VUYA 2EPKX 1PIGA 1KXHA 3AI0A 3CZEA 4FF5A 3PZTA 1K6AA 1UH4A 1C92A 8CGTA 4M56A 4CD5A 2BHUA 3MSDA 1EDGA 2XVLA 1HVXA 2D0FA 1PJ9A 2YL6A 2FHCA 1US3A 4P7RA 3VMNA 4Q22A 5EMYA 2PBOA 4J3TA 2YDQA 1GOIA 3SEPA 1US2A 3AXHA 2BXYA 4CCCA 2WHJA 1NOUA 3VX0A 5EFFA 4UFKA 4UOJA 5BXRA 5A6BA 1X6NA 3QGVA 2QPSA 2VCAA 4F9DA 3THCA 2WNWA 1CXFA 2VJXA 4C7GA 1W9UA 3A3HA 1JD7A 3MSGA 4MJ4A 3EDDA 1HIZA 3WSUA 2ZOXA 1WAWA 3CPUA 4DUWA 2ZUSA 2XM1A 4EKJA 3BH4A 3SCWA 1XYZA 1FH9A 3WKZA 5AYBA 1UYQA 1KBBA 4JKMA 4ZXOA 4ATDA 3WL1A 2CCRA 2EPMX 1W3KA 4MNJA 4GKLA 1JL8A 3W38A 3GH5A 1G94A 3W81A 4AD4A 1JF5A 1VJZA 2WZIA 4AZ6A 1LL6A 5I5RA 3BC9A 3AZRA 5ABEA 3UESA 4P7LA 2JFEX 1VEPA 3L4ZA 1QHPA 3VDHA 1E6PA 2WC7A 4D72A 2IXVA 2XSBA 3CHEA 2PWDA 5M3WA 1JI2A 1I1XA 4EK7A 1MXGA 2QMJA 3K4AA 3WFZA 1TVPA 2V3GA 1I75A 3EBVA 4U2ZA 2BFGA 1E9LA 2FHBA 2CNCA 3MV01 2DH2A 3CUJA 3WEZA 4AZ7A 2WZHA 1QI4A 1V02E 2VCCA 2VZTA 4WKAA 3UERA 4A3YA 5A94A 4KMQA 4UZSA 2VRQA 1UQZA 1ODZA 1AQ0A 1HKMA 1WZAA 5LA0A 4IM4A 1WDPA 2DQXA 3FHQA 1BGGA 5GNYA 3UG5A 1R8LA 3CH9A 1V03A 3VD4A 3AYSA 1E3XA 5A95A 4OBSA 4PMDA 4MDPA 3N12A 1KXVA 2J7CA 2YA2A 1R7OA 4D71A 5E09A 1XCWA 4JCLA 3SCUA 3GNOA 4CUCA 2DDXA 2ZUTA 2Y8VA 1AQHA 3ZSTA 1SYTA 2WLYA 1UKTA 3VM5A 3VD5A 1KB3A 3TTQA 1UWQA 4PMXA 3AHXA 4PCTA 1MW2A 1CGWA 2G3IA 1NH6A 5GQBA 2ZUWA 2CHNA 1UKQA 1MW0A 2D0GA 2WHMA 3THDA 3A4WA 3IJ7A 2WHKA 4BQ2A 2VX6A 1TE1A 4ZEPA 2WC3A 1QHZA 3L4YA 3N04A 5D8ZA 1OBAA 2E9LA 1GOQA 3OLDA 2VZOA 3OLGA 1TR1A 4A3HA 2YIHA 1R87A 3VDAA 4WSKA 4GPNA 3GXDA 3LPOA 4TUFA 3TOPA 3OLEA 5D9MA 1XSKA 4B3LA 1BPLB 2BY3A 2VI0A 3MV11 1S46A 1SR0A 4D1JA 1TG7A 4H8VA 1LF1A 2XUCA 4W5ZA 3VOCA 4OOUA 3WQ8A 2J7FA 3VGFA 1QI0A 3WBAA 1V3JA 3UG4A 1V6UA 2JF7A 2OSYA 4HPGA 1PX3A 3SCSA 4KGLA 1XH0A 3WNMA 2XTKA 1GOWA 4TVUA 3DYMA 1UH2A 1JI1A 2G41A 3BMWA 2XYLA 4E4PA 3PZGA 3WF1A 2V38A 3ALFA 1H11A 2VC9A 4WIWA 2WMHA 5ECUA 2YDRA 3L4TA 4C7DA 1H4PA 3O2LA 5JBFA 2GFTA 3W29A 3WUFA 3ZR6A 5HPOA 4YN5A 4J3WA 2WW5A 5A6KA 4AISA 1GORA 4LQ1A 1XD1A 5A6SA 1M53A 1K9DA 2VVNA 2C0HA 4W7VA 3VIGA 2XJ7A 4CD8A 1E5JA 2AAAA 2O9OA 1EOKA 4S3JA 2DSKA 4MNKA 1ISVA 1WE5A 2Z1KA 2EPNA 3K1DA 7TAAA 4GINA 3AXXA 2YLLA 5KZ6A 3NSNA 1N82A 2VZUA 3RIKA 2E8ZA 3WD3A 1CXHA 3CHFA 2ZX8A 1OM0A 4MB3A 2X1IA 1BYDA 1CTNA 1EHAA 1Q6CA 2ZX9A 3FAXA 3N1AA 5I2UA 1QI3A 1IT0A 1WZKA 2J25A 1QNOA 4AZCA 1H0GA 1EIBA 3M46A 5GNZA 3HN3A 5DMYA 3A6OA 3OBAA 1FA2A 5DFAA 2DIEA 3NSMA 4RE3A 4W8AA 2ZXBA 2Z1SA 3WDHA 3N11A 3VIFA 1E0XA 3SCNA 1OIFA 3EMCA 4CN1A 3OB8A 1AQMA 2E0PA 3ARUA 1JGIA 2WM0A 1E0VA 5A69A 1EQPA 3RMEA 1XH1A 4BQ3A 2QF8A 2XG9A 4M81A 4AD3A 4N42A 3RCNA 2D0HA 4P7OA 3WUEA 3WBEA 1VEOA 3VIIA 1H5VA 4LPCA 2WSKA 4F79A 3VPLA 4U2YA 1I1WA 3ZJKA 4AIUA 3CZ8A 3O6AA 2O9RA 4WK9A 1JAEA 3ZOAA 1UD3A 2GDUA 2BVTA 3VD7A 1EH9A 2D22A 2YBUA 4CVUA 1B3YA 1E6QM 1UOKA 4JFVA 4TOQA 1HJSA 1NP2A 1JD9A 1G9HA 2E9MA 5A8MA 5BXPA 4MB5A 4URIA 3IANA 1OWQA 1G0CA 2WB5A 2WVVA 3N15A 3GTNA 4GZIA 3VIOA 4HMDA 4DUVA 5BWFA 1NARA 4Z2IA 4F8XA 1M03A 3MMUA 1KQYA 4J28A 1ZBVA 4RE2A 2HVMA 4B9YA 1NOFA 1JZ4A 2X0HA 3KZSA 3AS0A 3AMGA 1QVBA 3SCPA 4JKKA 1E6ZA 3K8MA 1FP9A 1Y7VA 3ARSA 4GO8A 2VR4A 3W26A 3SUUA 4ACZB 5FL0A 4D6CA 3PBGA 4HPHA 1KFWA 1OIMA 3HJEA 1WP6A 1JNDA 3T09A 2QHAA 1UQYA 2DPEA 4HTYA 1ITXA 4KGJA 1QNRA 2JE8A 3AOFA 3WD4A 3EDJA 1VEMA 2D2OA 4PN2A 2J4GA 5A6AA 3WENA 1W3HA 2BXZA 1E70M 1GOOA 3T0AA 1QHOA 2QV4A 3WF2A 2ZXDA 2W67A 3POHA 3RM8A 3WEMA 3AS1A 2E9BA 4QDMA 4H8UA 3PZOA 3OLIA 4AZBA 5HNNA 4P8WA 2WSPA 3CMGA 5A8QA 5M5DA 1JYWA 1CGVA 2WMKA 3LPGA 4UFJA 3SURA 3RM4A 3U5UA 1DWGM 3GZAA 3IK2A 1R86A 2X09A 3VDCA 4P7NA 2UY4A 1PX4A 2CYGA 2GDVA 1JYVA 4BF7A 3AMCA 2OWXA 3PTMA 1HP4A 5CSYA 3GBEA 3WY1A 4HOXA 5CGMA 3GNRA 3WN6A 3UETA 1W1TA 1KCLA
chains in the Genus database with same CATH superfamily
4EWND 3SSZA 1F3XA 1OJXA 1ECQA 1H7XA 4X0VA 4UQBA 4L65A 2J7GA 2RGMA 4IIEA 2GVLA 5TAOA 3VC5A 4JHZA 3HQPA 3AYTA 1M65A 1Q6FA 1U5HA 3F5JA 4MYAA 3PJWA 2NQ9A 1OGBA 4HU0A 2DH3A 3AZTA 2NT1A 4FR6A 4IPIA 5CPQA 1TPH1 2VR5A 3L4WA 4G9PA 4WGXA 1D2KA 1HW6A 4M51A 3H26A 3SR7A 4TTGA 3OPSA 3WUBA 2ZUUA 3VZYA 5HJXA 3BCFA 3WF0A 2Y8UA 4IMGA 4O8RA 4QS6A 3E96A 4IISA 3WLTA 2CLPA 4LBSA 2D2GA 4DYEA 2DSZA 3DAQA 4B2DD 1QTWA 2D69A 2XH4A 2CKSA 2NSXA 2GUBA 3I68A 3PHAA 3T05A 3UU0A 2EF9A 2O55A 4JFSA 1EEXA 2DW7A 4LOCA 1XL9A 4GXWA 3GHTA 1J4EA 3A13A 2EEXA 5F2LA 2E8YA 4DZHA 3LCGA 1ITUA 4XZ9A 5TF0A 2IQTA 1Q63A 1VJSA 3D6NA 1KNWA 3IIZA 1ZUAX 4AHQA 4KW2A 3P5YA 1XD0A 3UNDA 2HZGA 4ZVJA 1SSDA 5FSEC 1KR0A 2Y0FA 4C6FA 4FXSA 3WF3A 2QGYA 6TAAA 3KRUA 5DCEA 4PFHA 3TYDA 5TBOA 1MW3A 1LWIA 4LXFA 2WMGA 2VZSA 4QE5A 3J7HA 2ADAA 2HV5A 2RJGA 5K9XA 2QUMA 3O7UA 3CZLA 5KSWA 3IAQA 3HGSA 3TJ4A 3UWYA 4NQ1A 1FWEC 3CWHA 1OX5A 3AWNA 3GM8A 3HM7A 1P48A 4KFNA 3QH2A 4GNVA 3W1PA 1JDAA 3L4XA 4NKCA 1BLIA 4EAMA 2QLYA 2Z1VA 1TPDA 4AU0A 2VM8A 1KGUA 1PXGA 1SZNA 3URAA 5DLCA 3MUZ1 2H90A 2WK2A 4MOZA 3UXIA 4R33A 1MDRA 3VGHA 2PURA 3VOHA 3WD2A 1E6NA 4D6JA 4UXDA 4OE7A 3SQLA 1RZMA 2GYIA 1XV8A 3EX1A 4NF7A 5FJOA 1OQFA 4IIGA 2NX1A 1V3HA 3PUDA 4EPBC 4EOUA 1CNVA 1GUVA 3FVMA 4GUHA 1R3YA 5CLTA 2BNJA 4NI3A 4FOJA 2YZRA 5LHEA 1CGXA 2TAAA 3CTTA 4GYFA 1FWIC 3Q58A 1EJSC 3L9CA 3AS3A 3M1ZA 4Q8QA 4U5KA 4YPJA 2P3ZA 4J3SA 4PULA 4S3BA 3REQB 4IPNB 3WJYA 4A3RA 1W1VA 1R85A 1ZCCA 2GK1B 3NVTA 2OZ0A 2E3ZA 1DJGA 3QF0A 1C7SA 2B7NA 1UW9A 5FJIA 2QCMA 5CAHA 1TWDA 3ITYA 1AFSA 3MWAA 2PAJA 4JPGA 2RDUA 1SZRA 5I77A 3PWGA 2BY2A 1E71M 3K13A 1L2QA 4B4FA 1O5RA 2E68A 3FEMA 3W7QA 5G1MA 4UIOA 3AXKA 2RFGA 3EEZA 3BGGA 4GC3A 4UFLA 1FWWA 1FVPA 4Y8EA 3FV9A 4FI4A 4QSFA 4KWOA 1V4YA 4AD5A 3O6CA 2GQ9A 1VC4A 4ORMA 4IJBA 3JRKA 2H6RA 4OGZA 4ACYA 1UWAA 1WKFA 6ENLA 3AHZA 1CGYA 3VKJA 4ZE4A 2XFRA 4J3VA 4BQ5A 3VKAA 5IHSA 4ATLA 5JQ9A 3UJEA 3W1AA 2GSHA 3OGVA 4JTCA 2GGJA 1X8FA 1ECEA 3G1XA 2F2HA 5D9PA 4BF9A 4IIDA 3AMDA 3BLOA 4GA8A 4HU3A 4NAFB 3GS6A 4LF1A 5HINA 1UROA 4IHCA 2ANUA 4XKYA 1F4HA 4HHMA 4H04A 5CGTA 1S2VA 3LQGA 2IXUA 1EJVC 2O7QA 1I8JA 2FJUB 1XICA 5C2CA 4N9BA 1KBLA 4AYSA 3H53A 3K4WA 1HZYA 2BGSA 3QVQA 1QW7A 5CZKA 3S8HA 4UTLA 5JIPA 4HQVA 4S3AA 2ZA2A 4JTDA 3L21A 1W1YA 3KBJA 3XISA 3E2SA 4O4WA 1J9YA 3SUWA 4IQJA 2Q3OA 2OYMA 1K77A 1ISZA 3QMTA 2V68A 3ZJ8A 5ABGA 1VQTA 5DY2A 5HMEA 3T0BA 2CFFA 1QT1A 3GX9A 2WCGA 3LLDA 1K6WA 4RDYA 4R85A 3UWZA 4P8VA 1T8QA 2ZCGA 4JFWA 2WMJA 2O9TA 3WLJA 5J04A 3L12A 1PZ2A 3AIWA 3OGRA 1EGMA 5CJ5A 2NVAA 4QIUA 3B9AA 4N4PA 3T0DA 1N8WA 3PN8A 4MAVA 1GZGA 4XZWA 1CLVA 3P3BA 3TFCA 2J77A 1MWOA 1PZ3A 2HK1A 2Y5JA 3GSMA 4QE4A 2WMFA 4PTNA 3NQDA 5SWUA 3G6MA 3DN5A 1JPHA 4A8RA 1YQ2A 3Q65A 4A29A 3OJGA 2C1HA 4M19A 1M7JA 3GVWA 3P60A 4IT1A 1NELA 1U1JA 2OJPA 1VHCA 4XO7A 5FOOA 2WAGA 1LQ2A 2WMIB 1VAHA 3EDFA 4JYFA 2Y5SA 4EWJA 4JNYA 4OTKA 1YTDA 4HZ7A 1K9TA 1ONXA 1PPIA 2VGGA 2WVSA 5AHMA 3N4AA 5D2XA 4UTWC 3G1HA 3VX1A 3W1MA 2WPGA 4KWVA 3VIKA 2PGEA 5CPLA 1ODUA 4HZ6A 3QRHA 3IIVA 3U7BA 5D2WA 2QYGA 5H91A 3V3WA 4N9DA 3U4AA 3N13A 1L6WA 1SFLA 1VP5A 4MYXA 4V15A 2VT0A 3CMFA 1R0MA 5C6MA 1Z8AA 4XUGA 5LGXA 1ZENA 3OYZA 3UWEA 1LWJA 1O1HA 2VNCA 1LOLA 1QPRA 5A2CA 2ZDRA 3QFWA 3QHOA 4WJXA 3BLDA 4EPKA 4LVBA 4MKVA 4U5IA 3GVVA 1ZBWA 1VF8A 3FA4A 3OG3A 4JFTA 4YLWA 2Y7EA 4UR9A 1S2UA 2BVWA 3UXKA 4Z0JA 1QFEA 1XH2A 2A3EA 5C0QA 3UD6A 2NQZA 4MGGA 1GK8A 1RXOB 5HK4A 3EA3A 4IPLA 3BG5A 1BFNA 2FH6A 1DBTA 1Z41A 3MCMA 4A8LA 4PA8A 3IARA 4MPKA 1ZAJA 1V6VA 5I0DA 4XAYA 4A35A 3FCPA 1M7XA 3IJLA 4PMQA 4NG3A 4AHOA 2ZE3A 1JDDA 4GI9A 4WDTA 4LAOA 3BAXA 1EIXA 1KM3A 2ZX6A 3OW1A 1MFVA 3UEQA 1VLIA 4GOAA 3AJXA 3ZO9A 1XYCA 3LG3A 1LLOA 3OVPA 8XIAA 4ES4A 2ODOA 1AMYA 4M82A 1M7OA 1ME9A 3N3TA 1GOMA 2BX7A 4A8IA 3CUFA 2OQHA 2XN1A 1VYPX 3CIWA 3PZVA 3H12A 3E0FA 4W9TA 2PEVA 1KRAC 1UJPA 3GNPA 1JZ3A 1EOMA 1E0WA 2FZBA 3POCA 1NP0A 1KC7A 3LY0A 4RL3A 2KX9A 1J0KA 2ICSA 5DEZA 4KFOA 4D8ZA 2PTWA 4FEZA 1RP8A 1VBRA 1FWCC 1ADSA 4L64A 3AROA 1OC6A 3QEZA 2J7DA 3SCOA 4ADUA 1C8QA 5A2BA 1ISYA 3AIVA 1Q6DA 3FJ4A 1VIZA 4HA1A 2Y7DA 1CZ1A 2Y2WA 1LG2A 4UTKA 3BQ5A 3GXFA 1YADA 1E0UA 4UTIA 5C5YA 3SCRA 2REQA 2YZ5A 4AMCA 4O14A 1GONA 2Y4SA 2X40A 2J24A 3N6QA 4K8HA 4V33A 2V5CA 4E5TA 1ITQA 1KTBA 1E9ZB 1DWAM 3QQ1A 1R6WA 1PDZA 5AC6A 3UT0A 3P6LA 4O52A 4V27A 4AZHA 3VDBA 2XGIA 2RDWA 3KOWA 1B54A 3KTSA 2DZVA 3FYOA 4GVGA 1TZZA 1L6GA 4DJDD 4S3GA 5MKGA 1JYXA 1XIGA 4ORIA 2J7HA 2A7RA 5IXEA 3KCJA 4DVOA 2Z2UA 4YWIA 2RKXA 4H83A 3TSBA 1IXOA 2W66A 4MADA 3DGBA 2YCEA 2HE5A 4O0KA 2FH8A 4ILSA 1GPWA 1F2JA 3LZ5A 2VC5A 1FCBA 3PJUA 3CL8A 3W2MA 2QNEA 4CQDA 4AD2A 3RYSA 2CHOA 4MF4A 4FLQA 3KXQA 1Z3NA 3R13A 3LCHA 4UUIA 5BCAA 2P8BA 3IIPA 2XVNA 3BOFA 4I6VA 2W61A 4GK8A 2EG6A 1UWTA 2HPIA 4C6BA 4HSNA 3V36A 2ONEA 2WC4A 3TROA 2CETA 3H24A 3ABOA 5HATA 3SGUA 4PMNA 2ZUMA 4ERGA 1LQ0A 1TMQA 4ZFMA 2PDGA 4EP8C 3WNNA 4O19A 4IWWA 4B5WA 4GZJA 1XW8A 2C0AA 1UR0A 1YX1A 3AS2A 2PODA 2VR2A 1VFOA 4OIFA 2D1ZA 3N6JA 5JVLA 4KETA 1RP9A 3ATZA 3DC0A 3C0JA 2PE4A 5LGZA 4KCUA 3PPCA 3MHFA 3ZT5A 3B8WA 1VFFA 3KOZA 1DKWA 3TZNA 1EFZA 1A5AA 4M5PA 1V0LA 4J2MA 1AZ2A 6A3HA 4XK2A 1LORA 2O4MA 3TYBA 2PC4A 4S3EA 5D04C 4LUJA 1TYGA 1WAUA 1QOPA 4HOWA 4V1XA 3ZVHB 1Q45A 1JQXA 3NDOA 4HZMA 2PCEA 1UBSA 1A53A 3TAKA 2VRJA 1I2RA 1FCVA 2HNHA 2CWXA 1Z32X 1IIGA 1GVOA 1KCKA 2FMOA 3GNNA 3R89A 3ZWSA 3NOYA 3KBMA 2WKJA 4AH7A 3EX4A 1UD5A 4DBSA 3PNZA 4GY1A 3B4YA 2Z1XA 1KTNA 2OEMA 2XU2A 5AFDA 1E3ZA 1E4IA 1KBKA 4IQLA 5CG0A 4S2BA 4D6DA 1DTNA 4CU8A 3FDGA 2GJPA 2JKAA 1EF3A 4DO7A 1JXKA 2VUNA 4FX6M 4AWEA 1FWRA 5IM51 5KZMA 3M0ZA 2PWEA 3MVTA 4Q6JA 2WNZA 4IGMA 4ROQA 1EC9A 1H7RA 3FYPA 5C9XA 2EG7A 3HZ3A 4PUWA 2JKEA 2OEKA 1IGWA 4HYVA 1JZ2A 3MUIA 3A4AA 1EKOA 1GWJA 1V93A 2TPSA 1NF7A 3II1A 4H2HA 3T08A 4K1WA 1B3WA 1V7AA 3O07A 4GO9A 1RQHA 3PANA 5BZAA 2WHLA 4O13A 1C8XA 3WNOA 2VFIA 4RZ6A 1QAPA 4KFPA 2FVMA 3CZJA 3KBSA 4H9UA 3TNBA 1MW1A 3GLCA 3GDBA 3GTIA 3APTA 2G95A 4Z2GA 2YCLA 3L68A 2GSJA 3LU2A 3R6IA 4L6HA 2YBVA 2VZVA 3EXSA 3V5CA 2XWEA 4KEZA 1R3SA 4PBGA 2WYSA 4NNAA 3P2VA 1SU5A 5BOOA 3BANA 3SY8A 1VFMA 3W4RA 1EA9C 2VOTA 5AHEA 3W28A 3P0XA 1WBHA 1PWMA 4MWAD 1SJBA 1K03A 2R6OA 3TYCA 5H1WA 2V2HA 4MY9A 3SJNA 3BMVA 1XIDA 1J79A 2ISDA 1GG0A 2PRHA 4OUIA 2PDYA 3FEQA 3WQWA 3ALGA 5DT7A 3TQPA 5I6SA 5BRQA 1A47A 1G7VA 3W7OA 4G7EB 3OQEA 2OB3A 3NZPA 4KIEA 2EHHA 3QGAC 3ONCA 4UFHA 1B3XA 4PL1A 5GVJA 5BXSA 1VZWA 1CEOA 1UJQA 3SY1A 4QJ1A 2EPHA 1QDSA 4UMBA 1BVZA 3CTLA 3UR7A 2XIJA 1YDYA 3TIMA 1AUSL 5JUVA 1ONRA 1W32A 3B9EA 2DQWA 6TIMA 4HYRA 4ZQPA 3GG8A 3HJZA 1EEPA 1ZJIA 5B80A 3UWUA 2CU0A 1ICQA 4ZQOA 4QBXA 4O17A 1DOSA 1BRLA 1W9VA 4JTEA 2XIBA 1QNQA 2OR2A 4F40A 1J10A 4HNTA 4INFA 3VNZA 4WLCA 1NFGA 2V67A 2WKLA 4Y8FA 1Q7ZA 1SMAA 1A5KC 4M8UA 3U2CA 4S3KA 3EOUA 3WF4A 1X96A 4US5D 4X22A 3G1VA 1EJ7L 2I5IA 1YYAA 4LGXA 3TC6A 3E74A 4U31A 1K8CA 1KM2A 1OT2A 2IKIA 3W37A 1WO2A 2ZE0A 1U30A 1WDWA 3LN3A 1DL3A 3DG3A 1EYEA 3AAMA 2Y8KA 4MTVA 4TVDA 2HWGA 1WUFA 3A3WA 3AIRA 4KBXA 1YDOA 5AC8A 3G2GA 2E4TA 3NL3A 4P7QA 3RO8A 1TV8A 3F5KA 1BQGA 4H19A 3VD9A 3L23A 2BGNE 4GC4A 2D3NA 4FMVA 3S83A 5M2FX 5F4WA 3ABSA 4UOQA 5K9DA 1XYAA 3RDKA 2ZX5A 3TXVA 5DMLA 1GVQA 3R8RA 5LZLA 1XGZA 2XVKA 1D7FA 2GQ3A 3FKKA 4HN8A 2C7FA 4Q4QA 1CENA 4MPQA 2E77A 2QCCA 3U6WA 4PODA 1UR3M 4HA3A 3WEOA 2FZNA 1FRBA 4QISA 3TLQA 3Q45A 3ABQA 1LUCA 1AVAA 2XWDA 3QZAA 1FBAA 4O1EA 1E4NA 1W6TA 1DJYA 2XFFA 4K7VA 3S1VA 4MLRA 4RDVA 2FKPA 1QCWA 3SIZA 1QBBA 5E6ZA 4K37A 2Z2AA 2EPKX 1PCWA 4A2RA 3UA4A 3CZEA 3PZTA 1EC8A 1K6AA 3WQGA 3BJSA 3E5BA 3GDLA 2A79A 3G5EA 2BTMA 3PK7A 2XVLA 3NVDA 3OTRA 1US3A 3B03A 1DORA 1F61A 4I5UA 4Q22A 1M1BA 2YDQA 3MKVA 3NURA 1GOIA 4DJEA 1KFEA 2BXYA 3C52A 5MKGB 1IWPA 1WXZA 4UOJA 5A6BA 1X6NA 4US5A 2Z1WA 3GE7A 5FF4A 3WJXA 1GEHA 1JCYA 2XINA 1KRMA 1CXFA 4C7GA 4A05A 3MSGA 3A3HA 1JD7A 4MJ4A 5RUBA 4K1GA 1WKEA 3WSUA 3V1PA 1WAWA 4DUWA 2XM1A 3SCWA 5CEWA 5LXXA 5CC6A 3PVFA 4WDUA 3EX2A 5KMYA 2NQLA 5AYBA 1UYQA 3NWRA 1IYXA 3SW6A 1L6SA 5T8GA 3E2RA 4IX0A 1W3KA 3P8IA 4Q8WA 1JL8A 3W38A 3W81A 1VJZA 4AZ6A 5I5RA 1RA0A 3AZRA 3DI1A 3QW4B 1XPGA 1TTIA 1VEPA 4LANA 3EWDA 1QHPA 1VFHA 3OBEA 2FVLA 4XWUA 2IXVA 3CHEA 2C16A 3K4AA 1JPIA 3WFZA 1TVPA 4LCSA 5G2HA 3VAVA 3RCMA 3K2GA 3S2NA 3FA5A 2X16A 1RQBA 2J88A 5KZEA 4LT9A 3W76A 4ZSUA 2WZHA 3W7CA 2VCCA 2VENA 3REQA 3UERA 4WY0F 3W22A 4Y9MA 2BWGA 1YTKA 1ODZA 3BURA 2ZC1A 3F4NA 2VOMA 1UP0A 2OVLA 3C2VA 3ITTA 5GNYA 4M1BA 5BMXA 1QXLA 4ZO9A 2WSRA 3ZWTA 2E6FA 2REQB 4L1WA 5A95A 4AC7C 4PMDA 2YA2A 3W7MA 4DRSA 4O1BA 2A6LA 3ANUA 4JCLA 3DU0A 2ZUTA 1XF0A 3ZSTA 3H7VA 1F3EA 1P1MA 1Y8BA 1RCQA 3DFSA 1UWQA 1PUDA 1MW2A 1CGWA 4DJED 1Z69A 1UKQA 3B05A 1MW0A 2I9EA 2VGFA 2A85A 2PWVA 3IJ7A 1SW0A 3BJFA 5HJLA 3TXZA 3EPMA 1KM6A 3L4YA 3P84A 4LALA 2FYMA 5D8ZA 3NEHA 3GKFA 3LXCA 4YYCA 2ACSA 3EOLA 3C86A 1TR1A 4FNUA 5I00A 2HPMA 4JQ2A 5HJYA 1XSKA 2BY3A 3EPNA 1JGMA 3VKCA 3VOCA 3M0XA 4OOUA 1W0MA 4C6EA 3WQ8A 2O56A 2CXEA 3SN0A 4H3DA 4JNZA 3WBAA 3UG4A 3UCCA 1V6UA 4D8LA 1J93A 2JF7A 2OSYA 4IL0A 4HPGA 2GGIA 3SCSA 3L66A 3QGKC 3ITLA 2YSWA 3NQBA 4GUGA 2VD8A 4F2TA 5C9ZA 1H63A 2XTKA 2R82A 4TVUA 3LBMA 3MQTA 3G3DA 4ADSA 1DHPA 3WQDA 4DJFC 3C61A 3LLXA 3QQ0A 4TO8A 1H11A 2W6RA 4E38A 3S5ZA 4C7DA 1H4PA 5JBFA 2E5DA 3UXDA 3F4WA 4H9XA 1KM0A 4AISA 1XD1A 2KZHA 2Z24A 1DQUA 3WLLA 1M53A 4W7VA 3VIGA 2XJ7A 2AQWA 4DJFA 4UCGA 1EOKA 2Z1KA 4ZMGA 1P0NA 4QEEA 4NAFA 3H55A 1XLLA 3TN5A 3BWWA 5KZ6A 1NQKA 4I90A 3ZLHA 3FSTA 1EP3A 1I0BA 4ZOBA 4E3VA 1CXHA 1DJHA 2ISFA 2PSNA 1CTNA 2ZX9A 3IRDA 5IDZA 1F8IA 1WZKA 2J25A 1RSCA 1T40A 2HMCA 4EF9A 3M46A 5GNZA 5E1QA 2FMNA 2OODA 4C6JA 3NSMA 3CH0A 4CNTA 3P81A 4RE3A 3H4GA 3ITVA 2BDQA 1CB7B 1PTGA 3WLPA 3EMCA 3FA3A 3DFQA 4DXVA 1AQMA 3ARUA 1AD1A 3MBFA 4G8TA 1E0VA 1KM1A 4M81A 4AD3A 3RCNA 4H01A 3UBPC 3S9ZA 3WBEA 2ZRVA 3OZYA 1IR1A 2YCJA 3H2MA 4XAPA 4LPCA 4F79A 3CHVA 3ZJKA 4C1NA 2OO0A 3GNDA 4AQLA 2O9RA 4WK9A 1JULA 1TTQA 1UD3A 3NM1A 1EH9A 1XGEA 3R0DA 1E6QM 4F48A 3WQOA 4JTGA 3W72A 4KKXA 4MB5A 4DNHA 5CSRA 2J9XA 2WVVA 4U4MA 3ZZ1A 3USZA 3NO1A 4DUVA 5LKYA 1NARA 3N9SA 3L0NA 3CPRA 1ZBVA 2PU1A 3KX6A 1I4NA 3W07A 3EEGA 2A3LA 5JH2A 1RAKA 3ARSA 3BG3A 5AYZA 4DXXA 4WOQA 3W26A 1OF8A 1W5NA 3SUUA 5FL0A 5A6TC 5A5WA 1WP6A 1JNDA 4H9YA 3T09A 2QHAA 2DPEA 2H8ZA 2BB0A 3WD4A 2NXGA 1FXQA 3ISIX 4IFKA 4PN2A 4QTGA 5A6AA 3PBWA 2H9AB 1TVLA 2BXZA 3R12A 4WSHA 1GOOA 3T0AA 5E93A 4Y90A 5FA5A 4ZR8A 2QV4A 3CASA 3FGCA 3HF3A 3OBKA 3STEA 3VNKA 1GG1A 3WF2A 3FDKA 1XLKA 2CW6A 1OC7A 1OFPA 4AZBA 3BTNA 3CV2A 4QAIA 2VEMA 4S23A 2WMKA 4UFJA 3LPGA 1LUCB 1DWGM 3IK2A 2X09A 4GBDA 1ZSXA 3GQYA 3DBNA 1NY1A 4NNCA 2NSOA 3CUXA 3JR2A 2OWXA 3LCWA 1HP4A 5CSYA 1F7BA 3GBEA 3WY1A 4Q32A 1VH7A 1XIJA 3H21A 1SW7A 1AW5A 1P1XA 1LROA 1OZQA 3PZ9A 5D9OA 4JICA 3UNTA 2B81A 1UD2A 3W82A 4L5ZA 4RLIA 3W7LA 4JHMA 3DG7A 3NCOA 2FB3A 3PBMA 3FJNA 4IP7A 4GIAA 1WKYA 1C8VA 4GI6A 2G3MA 3GXMA 1VCFA 4YU1A 1OHLA 1WZLA 2E6AA 2DY3A 1C7TA 5AY7A 4B9ZA 2QCEA 3OO2A 4M80A 4PRTA 3KBVA 3T0CA 1KKOA 3SUTA 4POCA 3A23A 4C60A 1JZ7A 3B0VC 4N02A 4MSSA 1ZL1A 3F4VA 1PL9A 3BZGA 4ROPA 3ZXWA 5KITA 1AG1O 3TQVA 4O1AA 4PMOA 5EB8A 4ALDA 1QU4A 3C8NA 1K8YA 1LJYA 1HF6A 3IGHX 3WDPP 2R1PA 4Y9OA 4LJ3A 4AWUA 3KBWA 4BI7A 2Z28A 2XVGA 5BOFA 2J6VA 4MUZA 3UJ2A 2QEZA 5FI8A 4H7VA 1IWAA 4CNNA 3W6LA 4AIEA 1BYAA 4G1NA 3ITOA 4G6CA 1CBGA 1IHIA 3WLSA 5AB3A 4S38A 2FIQA 3D46A 3ARRA 3UR8A 1PKMA 4XZBA 1IT7A 3K8LA 2QJHA 5F2GA 2VTFA 1JR1A 2I9UA 3PUOA 3ARYA 3D3AA 4NXKA 1Q6EA 3NGJA 4DWSB 4KEVA 3PTQA 2OEJA 2QMKA 3COTA 3QFEA 2C6QA 2HSAA 2X2GA 4ZTXA 2XM2A 1VCGA 4WY0B 2V81A 5DMNA 4JDBA 4YJ5A 4MWAB 2VO5A 1ICSA 1GQLA 4RDWA 4JD4A 5KTLA 1UUQA 2HE8A 1R38A 3OYXA 4K8GA 3ARVA 4CKQA 2WCAA 5JMUA 4W93A 2YBTA 4IQDA 4JTTA 2GWNA 3P8JA 1GHSA 1R2TA 4XBKA 3HMJG 3FN9A 2ACQA 3N18A 5I3KA 3W1QA 3C0LA 4PTMA 4Y9PA 4MY1A 4CNUA 4QFUA 1TUFA 3G0SA 4CQAA 1V0MA 3IAPA 1CX9A 9CGTA 3WMLA 2GJXA 4ICNA 1IEVA 3U57A 4EVZA 2FGBA 2Y7FA 3UR5A 5D4YA 2ZXQA 2PDQA 2G4FA 4IMCA 1JVNA 1JZ5A 2QDGA 2J7EA 1JCJA 2J8GA 3CQ0A 3L2LA 3N14A 1HJXA 3T2OA 2ESCA 5EU9A 2Q6ZA 2HJPA 3IWPA 3TN3A 3P14A 4HB7A 4PB5A 3O16A 4IIBA 2I57A 1H7WA 4CEUC 1VBGA 1E6XM 1HP5A 5T9CE 5HOSA 4E2VA 1V3LA 4W8LA 4JL2A 3AICA 2OOGA 3GDMA 3U0HA 1TX0A 2QVNA 2A3HA 2BOEX 4GUFA 4MKSA 3WLHA 3B8SA 4JKLA 1VB9A 2UY5A 4AAJA 3VGGA 1OFBA 2EAWA 4HT3A 4D1IA 5REQA 3DXIA 3LTPA 3OIXA 3KZPA 3T7VA 1KV8A 2OZ3A 4IPPA 1HKIA 4JCMA 3CB8A 3RITA 3GDRA 4YVXA 5G1YA 5AYIA 1E43A 1S38A 2YB4A 1GCYA 2DSVA 1CT5A 3I4KA 3OZOA 5FEWA 4Z2LA 5M03A 4PMRA 1TIWA 4F3HA 3WK2A 3BV4A 2WVVB 1UR8A 2ZICA 2F6XA 4UTMA 1S5NA 3BAKA 2EQDA 3GVGA 4V1YA 3WD1A 3BAYA 3PZNA 2VP8A 4AUBA 3B0UX 1B57A 4H8HA 4DAIA 4WF7A 5E9AA 3AALA 1MDLA 2IS7A 4Z1CA 1B2YA 2RH9A 4UMAA 5F2MA 4GGHA 1FTXA 3B9OA 1FWDC 4CNOA 4FA3A 3KEHA 3OG2A 3QMRA 2NW0A 7TIMA 2PZ0A 3MP5A 2DT0A 1Y65A 3EDEA 3WQPA 1FP8A 2POZA 5DBUA 3PTKA 1OGGA 3SJ3A 2V5LA 2NV1A 2F84A 2CZVA 2GOKA 1JXJA 1JAKA 1P6CA 4JXCA 4BWLC 2Q01A 4TVCA 1EGZA 7XIMA 3A64A 4W84A 2VGBA 3VIMA 4TV6A 1ZQ5A 4AF0A 5J8LA 1S3HA 3BLFA 3EOOA 1LCOA 1PIIA 2GQAA 3TDFA 4HP5A 1HJWA 3DECA 1Q4NX 1WXYA 3TEVA 1PVNA 1WB0A 5HR6A 3W6YA 1D7KA 4AWTA 2PRMA 1UPMB 4JYDA 1JG9A 4LV9A 2DU2A 2VKZG 1VFLA 3W00A 4NILA 2DT3A 4ZFCA 5G4HC 3W7NA 2ISVA 3CNYA 5K3VA 4TX8A 2WLZA 2W92A 3S6DA 2D20A 4QDWA 4X3ZA 2DGAA 2R94A 3W86A 1E73M 2FFIA 3VOFA 1XLHA 5JIWA 3BCJA 1NWSA 2I16A 1FH8A 3INPA 4JTAA 4KT2A 1W1A1 4C90A 5HUPA 3KAOA 2OSWA 1JUKA 1LDCA 1POKA 3B0XA 3S5SA 2PD5A 2PTZA 2PZNA 2O0TA 3EMZA 4H7CA 4O0QA 3WDJA 1BXBA 4JQ1A 2PD9A 2A1YA 1H7OA 1FHDA 3UVIA 1G5AA 2W3ZA 4UQAA 3LHVA 1MUWA 4IG2B 1T7LA 1XWYA 3GIPA 3UZJA 3QQWA 3AC0A 2YLAA 2PDUA 1UWIA 3IEBA 2DVUA 3TONA 1XRVA 1GYMA 2ZX7A 4CN6A 3VCCA 3GXTA 1ZFJA 3H6OA 1AW2A 2A2IA 3EA2A 5HNRA 3RILA 4ZGYA 1XXXA 3G6LA 3QYQA 3W25A 1W17A 3AIQA 2DP3A 3LM7A 1OFDA 5IBXA 4YTSA 2VQUA 4C6IA 3ONBA 4HPNA 4JEQA 2CITA 2IPGA 3CZGA 3K4DA 3OU8A 1MO0A 1YE6A 1HVQA 3D47A 5LNVA 1E56A 2E25A 3CBWA 2CBUA 5F4XA 2PS2A 1KTCA 4ONVA 3GDTA 3QHMA 1RPXA 1FHLA 4GKTA 1T41A 4PYSA 3TW9A 3R94A 1JJKA 3VNJA 4J1OA 2EBNA 1XC4A 1OD8A 3LS9A 3M6DA 3CGTA 4ZSTA 1QK2A 1H41A 2PLJA 4DBUA 3EOSA 3VIPA 1WZMA 1L0PA 2ATMA 1QW8A 5IRPA 2B31A 4A4AA 5D33A 3KVJA 4AY1A 4JIEA 2NV2A 4UTWA 1FOBA 2CKRA 3WQ5A 4DN1A 4B5XA 1V08A 2JK2A 3SY5A 3W23A 3LYEA 4E4UA 7REQB 4Z17A 1K9EA 4XSMA 3T1GA 1O68A 2X1TA 3MW7A 2E28A 4PGLA 4QE1A 1PCKA 4Z2JA 4Q8TA 1F4AA 3H2NA 4L4MA 3LK6A 2WJZA 2NLIA 1OYCA 2VFEA 3E3HA 2ZWZA 3E0IA 3GHUA 1XG3A 3UJFA 1B31A 3ZFHA 4DM2A 1UB3A 1OFOA 3RG6A 3BSMA 1S2WA 3WG6A 3W6MA 1JFXA 1W37A 4GI4A 3CQKA 2QCHA 3LHWA 5HQEA 3FXGA 3MCNA 4TX9A 2V63A 3FXYA 4PMJA 1OINA 3W7GA 3KE0A 1KWKA 1UWUA 1LRQA 1H61A 1WCGA 1XDMA 4DWSD 3LB0A 4RV8A 1GVYA 3PB0A 5EMJA 4WRHA 1BKHA 2NUYA 1B90A 4XTIA 2YL9A 3ZR5A 5A6BD 1EDTA 3CV6A 3F4CA 3KP1A 4L9YA 1J0IA 1S2CA 4NX5A 4MY8A 6REQA 4Y6GA 2DJXA 2RJHA 1M5WA 1UR4A 2AOSA 1X6LA 1KFLA 1ZJHA 3BO9A 1JUEA 3BV7A 1J18A 1A5UA 2FDSA 1OX4A 3LZ3A 1O5KA 3GC4A 4IMAA 2OXNA 2QCGA 4AZIA 4JIIX 3HG5A 1FKWA 1BXCA 3W24A 4U3CA 2WJFA 1ZJBA 2WWDA 1XLCA 3NJ3A 1S2TA 1S3TC 4DF1A 1A3XA 4XTDA 1BRLB 1EUNA 4PMYA 4GGBA 5BROA 1AMKA 4CCDA 1XLEA 2YA0A 2QAPA 3OA5A 5HULA 3L5MA 2BBFA 3RU8X 5I78A 4X9YA 1TWZA 4MFDA 1JFHA 3G24A 3E49A 4Z2HA 2DIJA 4H4IA 4HMEA 1V6XA 4TX6A 1CXKA 3N17A 4I8DA 1B3OA 5I03A 1BF2A 1FWHC 1XIHA 4H00A 4NJIA 4QQUA 1K4HA 2DZSA 4MVAA 3UYIA 2WPBA 3PB2A 3GYCA 3I7SA 4E2BA 4ZL1A 5A6MA 2W79A 4JR5A 4PUDA 1L6FA 4ZO6A 1ZGDA 5BYWA 3PZQA 5EBAA 1E15A 4WZHA 3S5NA 3KOFA 4NX0A 3QY7A 1WX0A 3LHZA 1DHKA 3V16A 3UY8A 5ECVA 4ZCWA 4LU0A 4QSHA 3NTYA 2QULA 2BMBA 5K4ZA 3ARQA 3PBYA 5CXPA 2GVYA 1W5MA 3RNDA 2RAGA 3U2EA 1YRRA 1ZB5A 1SGJA 1ZBCA 3QOMA 2QCFA 4XVEA 3ARTA 1TRIA 3FFSA 2AQVA 2ZZ2A 3L0KA 2QT3A 1XDLA 1Z48A 1A5CA 2QPUA 1I2PA 4WHBA 3UG3A 3S6TA 1VGAA 3M0LA 3KRZA 3SSJA 2JIWA 3VC6A 1WQ5A 3VUPA 3K5XA 4NYUA 1QNSA 2A0NA 4JTSA 3LSBA 4YS1A 3LGGA 2NQJA 1BG9A 4QCFA 5D37A 3W74A 1WXJA 2OGJA 3AWOA 1UA7A 2WXDM 1EUAA 3P82A 2VC7A 3BZJA 2I14A 4GUJA 3SUSA 5GPRA 3EAUA 3UW6A 1B0IA 1EGVA 1XSJA 1JPKA 3BGAA 1FDJA 3QSTA 5AZ0A 3A47A 1R30A 3A5FA 1N7KA 4B3KA 3GBDA 2DT2A 4M7TA 1DWJM 2DW6A 4AXNA 3NQAA 1P6WA 2NQ5A 1E1EA 3PG9A 3WMCA 5IHRA 5JH1A 4GE8A 5CBBA 2Z7GA 3TP4A 4ZO7A 4GIYA 3W2NA 4UBPC 3NM3A 2CZEA 2IW0A 3SCVA 3LHTA 2OLAA 3O15A 4EXBA 3PPGA 5TD4A 1BYBA 1E4LA 2E5BA 5DX7A 4NRRA 4AEEA 3LHYA 3M0JA 3BPWA 1Q2RA 4G2DA 4X61A 4AY8A 1PEZA 3IK4A 2BV9A 2D73A 5GJMA 3CO4A 4Q4PA 1ME7A 1SO6A 4IMDA 5DN1A 4QROA 3IIOA 1B30A 3CV1A 4MB4A 2J47A 3GU2A 5BU6A 4AX7A 3TCEA 1AODA 3P7YA 2GJXB 3DERA 1HKJA 3FKRA 4XAZA 1LL7A 2OCZA 3LRMA 4NL1A 5I3DA 1GOKA 3ZJ6A 2YGYA 5FJUA 5AC4A 5AHLA 4NSBA 3DHDA 1W9DM 1TPEA 3CUIA 4DWSC 3T81A 1G01A 2HQAA 1V79A 1LTDA 4I6KA 4XB3A 3B0YA 1H51A 4GX9A 1KCXA 2D2JA 4ZO8A 4F0HA 5A8PA 4HNCA 1SMDA 4B92A 2R1LA 5H2ZA 4FS9A 1KXTA 4IMFA 5L6UA 3GHRA 4GCAA 5G4WA 3ABXA 2WM1A 1F5ZA 1EJRC 3O0FA 1VKFA 3TA6A 1MUCA 1HL2A 3QM3A 3T2PA 2PMQA 1OFQA 5EYWA 5ABTA 3W1XA 3VKDA 4QG9A 3C4UA 4C6QA 4AXKA 4JTLA 4H9VA 4HHLA 3PBVA 3S6OA 3BSGA 4E8DA 3KCOA 1EO5A 4W7WA 3GH7A 2RUSA 3L5LA 3C5QA 4WKHA 5EMUA 1CWYA 2ZRUA 5A2AA 2GL5A 1EWEA 3QMSA 4AWSA 1RLCL 3LPPA 3ZLGA 4I9TA 3CIVA 3W7KA 1XFBA 5PTDA 3BW2A 1W1IE 2WO5A 1O66A 1KQZA 1EJWC 2CLEA 3MKKA 4PTWA 3AFBA 1TZ9A 1TREA 1RQEA 4AZCB 3TCSA 1HKKA 3ZVIA 3HG3A 4WCJA 3EZ4A 3TSMA 3GW3A 3WNPA 3AISA 2ZUNA 1TO3A 4UTJA 4OT7A 1OFEA 4C6MA 1SZFA 1VENA 1GVSA 3IVSA 3I6EA 5DBTA 2HISA 4AC1X 1RJRA 2VX5A 2WCSA 3W2KA 3W2JA 4OECA 3DG6A 1GYNA 4P8XA 4QAWA 3BJTA 3B97A 1GYLA 1VIWA 3V5OA 3VABA 4J3UA 2H9AA 4R7JA 3MP3A 1KO0A 2W91A 4WSJA 3KL0A 3NUKA 5U7SA 4AD0A 1SZEA 1MYRA 1V3IA 2JF6A 4Q6XA 4KWWA 3DX5A 3GC5A 3OQ8A 3UFYA 1KM4A 5CGQA 3QPZA 2PTYA 3PWIA 4IP5A 1QOXA 3ENLA 1XQKA 1ZBKA 5CSUA 2BP1A 4DNMA 3V4BA 4WX2A 3DC8A 4OBTA 2QW5A 5BRBA 2HNEA 4F9JA 3BDKA 3WQ4A 1ZCOA 1W9XA 3GZ3A 4ZENA 4B90A 3YPIA 3AYRA 1P0BA 1UD8A 2OWWA 4Y7EA 3AHTA 1CXEA 2XDFA 3ARZA 3W01A 3JS3A 4YTTA 1YKWA 1KRCC 5LIKX 2B0MA 4O10A 3OIHA 3QKZA 3CXOA 3N9RA 2GGGA 1TWIA 2JIEA 2PB1A 2J6XA 3HURA 2A21A 1K9FA 1HKWA 1CXIA 4JTIA 3LGEA 2GGEA 1AH3A 3RRAA 1EL3A 2JEPA 4B5TA 4OBRA 2QS8A 4N6FA 9XIMA 5I24A 1L8NA 3TLLA 4IZGA 1EHNA 4M1RA 1OF6A 1T6MA 3SN1A 1AL7A 1VPXA 3MWCA 4HGXA 4DJEC 1A80A 4UZUA 1OADA 2F61A 1PB0A 4HOZA 3HTWA 3EX3A 4REQA 1JDCA 3G18A 1KGXA 1I0DA 3T4CA 2OX4A 4V28A 2A3AA 4QLKA 1ZP4A 2YA1A 3C56A 2I17A 5JBDA 1VRDA 2I5GA 3UA3A 2XH2A 1Z89A 2OOFA 1DJZA 1RBOB 2AMGA 2BHYA 4ICMA 4HPJA 1KXHA 3AI0A 1TPC1 4FF5A 8CGTA 1SJDA 4CD5A 1F74A 2D0FA 1DJXA 1NIUA 1RJQA 3T9PA 4OHQA 4J3TA 3PC0A 2YW3A 1D3GA 3AXHA 1VR6A 3TSDA 1WA3A 1NOUA 5EFFA 2Z0IA 5BXRA 3SO7A 4MHBA 1JDEA 1GJPA 3NA8A 3QC3A 1TWWA 4F9DA 2WNWA 9RUBA 5EY5A 3CT7A 1OFRA 4LH8A 4O16A 1HIZA 1IXPA 4CLMA 3L5AA 3QV7A 4A8NA 3TC3A 2ZUSA 4S3CA 3DZ1A 2E5CA 3S1UA 4BJHA 1FH9A 1TELA 1DVJA 3S4TA 4JKMA 1F6KA 3EKGA 3GTXA 2ABBA 2CCRA 3VFLA 4M6PA 4NYYA 3D3FA 1F73A 4MNJA 1ZPTA 3H2CA 3HPZA 2PFHA 3LENA 3NQ6A 1RD5A 1LL6A 2F7FA 1JEZA 1C9DA 1EA0A 2WZTA 2JFEX 1D9EA 1TPWA 4FAMA 3BVJA 4G5DA 3ANYA 3QTPA 2PWDA 1JI2A 1I1XA 3TW7A 3DKLA 4LNCA 3EBVA 1BWKA 1EJTC 4U2ZA 5A8GA 4MFEA 3CS2A 3VZXA 2BFGA 2JGYA 3GTFA 3NZ1A 1QPQA 3FS2A 1E9LA 2FHBA 2CNCA 3MZNA 3MV01 2FZ8A 5BOEA 2AGTA 3CUJA 3LUTA 4AZ7A 2UZ9A 4H1ZA 3SAZA 1A5MC 1V02E 5HMFA 4BF5A 4A3YA 2GDQA 1OEPA 4UZSA 5H6HA 2VRQA 1OX4B 1UQZA 2W27A 1TJ2A 1JCLA 2BG5A 1HKMA 1WZAA 1K3UA 3B9NA 5REQB 4OU1A 4DPPA 1BGGA 3UG5A 4XIAA 3I4EA 3VD4A 3HFYA 2HXTA 4OBSA 3G8EA 4MDPA 1G6CA 4NY2A 1R7OA 1H1YA 4HSOA 2P1FA 3I10A 4D71A 1SVDA 1LLZA 3SCUA 3GNOA 2DDXA 3C3UA 3TJLA 1AQHA 1SYTA 1KBJA 2WLYA 2WQDA 1UKTA 3VD5A 1LRNA 1KB3A 1YXYA 1UUMA 4PMXA 2G3IA 3R4IA 1NH6A 1N8IA 2QJNA 2CHNA 4GYPA 3NPVA 4PEKA 2D0GA 3N2MA 4I8YA 3THDA 3LV6A 2WHKA 2X1SA 4BQ2A 3UXAA 2VX6A 3HFTA 2Y1HA 4ASTA 3E6EA 2ALRA 2XIMA 1C29A 3SI9A 4J2PA 3RX4A 4HK7A 3N4EA 1OBAA 4B91A 1YXCA 2X1RA 4E8GA 1GOQA 2ABAA 4ZQCA 3OLGA 4A3HA 3VDAA 4WSKA 4GPNA 2DVTA 3VFCA 3GXDA 3LPOA 3TOPA 2HBXA 3B8UA 4GJJA 1X98A 1BPLB 4FX7A 3MV11 3LRKA 1SR0A 3DHFA 1XR2A 4H8VA 3EB2A 4TU1A 5BW6A 4W5ZA 4LUSA 4IIHA 1XKJA 1XLIA 3NEVA 3G0UA 5HMSA 4DZ5A 2P88A 2E1WA 2PDMA 4QQ3A 4KGLA 3PAOA 1LQAA 1WYIA 3T8LA 4WDXA 4R9XA 4O4VA 2G41A 3MO7A 1R3WA 3GB6A 1ZRQA 5C9RA 5ECUA 4UMCA 1V77A 4PUNA 2CLIA 4ERIA 1A5NC 3QPEA 4MWAA 3W29A 3F03K 5A6KA 4QEHA 3WJZA 2BSLA 1W5PA 1POJA 3GUWA 2DZBA 1K9DA 3CJPA 3RU6A 1E5JA 4R34A 4RDZA 2DSKA 4MNKA 1ISVA 1FDZA 1WE5A 1U1HA 2EPNA 1ZNNA 2VC6A 1A0DA 2QJJA 3ITCA 2YLLA 2VZUA 3NSNA 3RIKA 2QQ6A 2E8ZA 2PWUA 3A5VA 4LY8A 2QCDA 1G4SA 2BASA 1YPFA 4GH3A 2J8TA 1A0EA 3WFAA 5I2UA 3DENA 3W88A 2C19A 4NZ3A 3STPA 4LRSA 3TE9A 2IPJA 3GU1A 1H0GA 3H4XA 2G96A 2BOFX 5DMYA 1H5YA 3A6OA 4WDWA 3OBAA 1MMFA 3VZZA 1V6TA 2G0WA 5LIXX 4W8AA 2ZXBA 3CL6A 1E0XA 3SCNA 1J96A 1F07A 2E0PA 2V5JA 1F6PA 1UBPC 2YW4A 1M6JA 2XG9A 4L9ZA 2E1DA 4ICCX 3GR7A 3WUEA 1XS2A 4XD5A 3VIIA 1H5VA 2OLSA 3VPLA 4U2YA 5G2IA 2ZZ1A 3O6AA 3ZOAA 3LEPA 1XLJA 3ME3A 3VD7A 4DJFD 2YR1A 3PUGA 4UTTC 1YNYA 4BWLA 3AU2A 1U83A 2AKZA 3WLNA 1NP2A 4GG9A 1G9HA 5A8MA 3HPSA 2GOUA 3RX2A 3URQA 3KLLA 1W3NA 2V0TA 4Z2IA 1L8PA 5HANA 2NVCA 4J28A 1QO2A 4BFAA 3NL6A 2IPWA 1DXFA 4B9YA 1JZ4A 5EMLA 3CWNA 3LXAA 1EXBA 3ES8A 4QNWA 3AMGA 4WUIA 1QVBA 3LTYA 3JZUA 1E6ZA 3K8MA 1T0OA 4BEQA 4N9CA 2P3EA 2E6YA 4HPHA 4L1GA 1OIMA 2ZZ5A 3HJEA 1UQYA 4HNNA 1ITXA 4KGJA 2ACRA 2JE8A 3R58A 1UOZA 4H6QA 4IFKB 1GKQA 2AAMA 4IMEA 4MZ8A 1QHOA 5G5IA 1EZWA 2W67A 3C0SA 4ENLA 4WGHA 4GUIA 4KIRA 3RM8A 3HGJA 3CWOX 1HGYA 2E9BA 4QDMA 3OLIA 1SM9A 3KBNA 4NASA 2WSPA 1JYWA 2PTXA 2VEIA 6XIMA 3RM4A 4HNUA 2PA6A 2NWSA 3IIXA 1LP6A 3H7RA 3ABZA 5D03A 5D38A 3N2TA 1QASA 2PTDA 3GG0A 2GDVA 3S46A 1JYVA 3TW6A 3AMCA 3LLFA 1MZHA 4D8AA 4YVPA 1FHUA 4NZFA 3W7HA 3GNRA 2YB1A 3UETA 1W1TA 2AKMA 3V18A 1OB0A 3T4WA 4OV4A 2OELA 3SM0A 2RGLA 3MDUA 3GH4A 4PSPA 4W4QA 4M6UA 1RPKA 5A3HA 2Q8XA 1SJAA 4O8AA 1BXNA 4RPPA 1GEQA 3C2RA 1L2UA 1E6RA 3AIEA 2OU4A 3MYOA 4FLSA 4IUGA 3BLLA 2W5FA 1R47A 1CLXA 1K7XA 1RH9A 2CBVA 5E0KA 3C3NA 1VYRA 1EX1A 2YOCA 2WBGA 4GQRA 1MQRA 4YHGA 4CGTA 2IUZA 3AUOA 5K2ZA 3CLMA 4KWUA 1BGAA 3QSRA 4U10A 4ZBCA 5C2GA 1FQ0A 4W88A 3GXNA 3TTEA 4O1DA 3TTOA 2C14A 4ZQMA 3VYLA 3FOKA 3PS7A 3RF9A 1JNEA 4YHEA 4PTXA 4WXZA 1IEWA 1V0KA 4UNKA 1U1UA 2VYOA 5H8MA 3MSRA 1Q7QA 1XPYA 2PDFA 3UGRA 2PWFA 4XISA 1OT1A 1RR2A 2OSXA 3NG3A 3BAWA 4DEFA 1VPYA 3TJIA 3VU2A 2GVGA 1KWGA 3CAVA 3KHJA 4GD0A 1CB2A 4B15A 3W7DA 2O9PA 3CAKA 1JF6A 5HXMA 1ONEA 2X05A 4DYJA 4HHHA 4EXAA 3MCOA 1B4EA 3T44A 5FJPA 4JL1A 2ZWYA 3SRDA 5CC7A 1QRQA 2GZXA 4JN8A 4LC8A 3WIJA 5AZ1A 3U2OA 3TR9A 2QDHA 3QPYA 1JCXA 1T99A 2FZ9A 2G8ZA 4GVIA 3AYVA 3WD0A 4G1KA 3RX3A 1IV8A 1CGTA 3LCLA 4PCPA 3WCZA 2XSXA 1J12A 1AL8A 1R3QA 4JY9A 2WWCA 3SFKA 3WBYA 2OTDA 4Q8OA 1TR9A 1BSLA 3V0UA 3C2EA 2VEGA 4KS0A 1UCWA 2W0UA 5EMKA 3VA8A 1C3FA 4O12A 4HCHA 5CLWA 4LFYA 4HKPA 2WOQA 3CIXA 3H7UA 3ZYZA 1FCQA 4Q8VA 1DEDA 1QOQA 4PBFA 5I79A 2Y85A 3R25A 4B5UA 5A8OA 5MHBA 3W7JA 3IV8A 4J7RA 3CHCA 2VX4A 2AL1A 1UWSA 3BLEA 5I23A 3STCA 2PCQA 3B4UA 4NNBA 2VCBA 2DORA 4NZ1A 1W3JA 2QUNA 3BOXA 3K30A 5ABHA 1KFJA 5HUOA 3F5LA 1TVNA 4RCXA 5DT5A 3ZSSA 3G22A 4N2YA 1XLFA 1GQKA 3BSHA 2BVYA 1PIFA 3W85A 3GRIA 1ENUA 2XPKA 3O8AA 4XVDA 3CAWA 3QV6A 3UZYA 1OCJA 3ATYA 1AH0A 3B0PA 1ALDA 5C8BB 4H6EA 1NDZA 4N0RA 2HEJA 3PF3A 1UIPA 1E0TA 4Z42C 1HGWA 3GTHA 5LA2A 3GXPA 4GJIA 1CLKA 1GW9A 4JZ5A 4MJ2A 3UZ5A 4PR4A 3TWAA 1Y0EA 2GQ8A 3HPXA 4UFIA 1LRTA 3PG8A 1B9ZA 4C6NA 1EBGA 2EG8A 6XIAA 5IBXC 5XINA 4FXJA 1VBJA 5E70A 4IL2A 3KCLA 5K4XA 3HU7A 1QUMA 3AUJA 4EIVA 1ZJAA 2Z1BA 4B5SA 3EWWA 5EBUA 5CJMA 4LCRA 2XIOA 3KVLA 2G3JA 3LTSA 2CESA 4WKFA 4C5YA 4OWGA 2VD9A 2WNQA 5AYYA 1C90A 3C6CA 4D6GA 1ZLPA 4P5UA 2X7VA 3KLKA 1M04A 3S1WA 2PDWA 2J75A 3WQCA 3UCDA 1TPFA 1OVDA 3T07A 3KTCA 1OCBA 2X7WA 1EO7A 1VRXA 3RFAA 1XG4A 1TKKA 2WJEA 2XISA 3VE9A 5LSMA 2OQYA 1SZGA 5A8NA 4UQ9A 4MM1A 1V7YA 5A6JA 5AC7A 1QR7A 3WL0A 5I7GA 2PWHA 4JTUA 4EXQA 4NZ5A 3IJ9A 2FFCA 2CPUA 3BLKA 3R0UA 4XZNX 1UP2A 4H9TA 2ZZ7A 1XC6A 2W4XA 4DLMA 2ON3A 3G3MA 5HPCA 2GSEA 1LBMA 1H3GA 1TQXA 3NGFA 2MANA 2QPXA 3G1RA 4HCDA 2PU0A 3I7RA 3OP2A 4GXPA 2Y24A 5E5CA 4GYKA 2PLCA 4PUMA 2CLKA 2Z26A 2UWFA 1SPQA 3A12A 3W71A 4ZB0A 2V2CA 1OK4A 1H49A 1HN1A 3T55A 1Q6LA 3KL3A 3UF9A 3H70A 1UR2A 1XYFA 3WK1A 1ISWA 4JTHA 1E1FA 2L5HA 3P93A 2BS9A 2WQPA 3TJXA 4LRTA 3G1FA 1GQJA 3EKZA 2XFWA 1YEYA 3O9NA 3GG1A 4OZOA 1ML1A 4S3DA 4UTTA 1EJUC 3RR1A 4ZA0A 4LAMA 4D6IA 1PBGA 1H0IA 1IXNA 4LUTB 5DXXA 1X1OA 1E1CB 3BW4A 1SFSA 2BVDA 1A5LC 2X0SA 1R9XA 2IMRA 2XIIA 3ARXA 4IPJA 2I1OA 4AZ5A 1PZ1A 1O60A 4FLRA 5A6LA 4CCEA 3OODA 2C3ZA 4LSBA 4YCPA 3EXTA 2WMIA 1QBAA 2O92A 4HU8A 5FEXA 4LUIA 4CD7A 3T6CA 2E6DA 4UWMA 4C65A 1IGSA 5LYRA 4N7QA 1PZ0A 2BY0A 1XCFA 4PRRA 3FAWA 2G4JA 3CM4A 1YBQA 4GLEA 2HRWA 4H8NA 4NJKA 5CPNA 3GHSA 2W62A 1N2VA 2VHLA 3P0WA 4NJHA 4DBEA 3VNIA 2P10A 3CPGA 4LUYA 2BGQA 5TIMA 1TV2A 2FTWA 1ZHAA 3MS8A 1TE6A 2A3CA 1QWKA 2ALDA 5C2XA 3SCQA 4GXMA 1W2PA 1XRFA 3LBCA 4WJ8A 4MNMA 5HAOA 3BXWA 1R46A 2F8QA 2FDMA 4X9SA 1MUMA 3DYOA 1X38A 2EPLX 2YFNA 5G1TA 4XAGA 1RALA 1MNZA 4FIQA 3SFWA 1HL8A 1ICPA 2QUTA 2V2DA 4BI5A 4A2SA 4UQCA 5B7ZA 3SGGA 3UYCA 3MY9A 3QLLA 3WNKA 3C2OA 3DH7A 1H2JA 3S2CA 1HKVA 4L56A 4O0ZA 2VFFA 4XV0A 2WVTA 4CN4A 1BD0A 3R1ZA 5LHFA 3U9IA 3VGBA 2BY1A 4IFOA 4V2XA 2Z2BA 2QJMA 4YCOA 3LX9A 2AL2A 3M5XA 4D9PA 1QI5A 3Q94A 1Q6OA 4LYRA 4FO4A 4Z1YA 3NPWA 2OKOA 3M43A 1GJWA 2GGHA 1ZY9A 3ARWA 4F2UA 5DY3A 3WUGA 3VKBA 5JU6A 3I6TA 3FNDA 5KEZA 1K02A 1EJXC 3LHUA 3DUGA 2Q8LA 1RK6A 5CPOA 4AW7A 2C1IA 2J78A 5CPSA 4C7FA 5CZJA 4LVGA 1KRBC 1U5JA 3W75A 2X8RA 2YXGA 3NQMA 1WNOA 3WYZA 1QPKA 1PE1A 1H1NA 1XHGA 3BLPX 1IWBA 4C6CA 3VGEA 3NQ2A 3L2IA 4DBDA 4PMVA 3B9DA 3L0GA 3GD6A 1ADOA 1QJWA 4R27A 3QY6A 1D3CA 1KR1A 3HQOA 2J9ZA 1HNYA 5HBFA 4JTKA 6REQB 2DZTA 1KA9F 1UMLA 1W1B1 3NYDA 1P4CA 1GVIA 3M5YA 2XGZA 2C13A 1A5SA 2VEPA 1J0HA 5I3FA 3H54A 4XD6A 4YTRA 4P2VA 4DJDC 1A4MA 1QPNA 3NPXA 3DHPA 1JCMP 3MP4A 4AD1A 4R5EA 1E6SM 2I7GA 4FOUA 3MHUA 3F2DA 3BG9A 1UZ1A 3PUEA 4J3XA 6CGTA 1GNXA 4K6AA 4YL2A 2EKCA 2EPOA 2CIPA 2CBIA 4GIRA 3RHGA 3IVUA 2OLHA 5CBIA 4JBRA 1RBLA 2VDGA 4FR1A 3RR4A 4KCTA 2ZADA 1KCZA 3UG8A 4OVXA 4B2DA 3AJ7A 3LOTA 3THQA 1ISXA 1MI3A 4Y2WA 1L9WA 2PDBA 3NZGA 2WANA 3S0CA 1GHRA 4RNIA 4PH6A 2WSQA 2EGZA 5LNSA 3ZJ7A 5CJNA 2VQTA 2YL8A 1ITCA 4JS3A 5AVNA 4NUWA 1V02A 2R1KA 4C1KA 5D9NA 2BZNA 3VOGA 4AB4A 1C91A 3P61A 1SO4A 3WMSA 4DXKA 1PHQA 4EF8A 4ZOEA 1Q66A 3TUUA 4RKAA 1XKYA 4YWSA 3GAKA 4GY0A 1TRDA 2QJIA 1MRAA 4DIAA 4TMCA 1DIKA 5LNUA 3E0VA 4QLLA 1B5TA 3LD5A 3IUDA 4JIHA 3GWQA 3MDWA 3KL5A 5CPTA 1TA3B 2JKPA 1MXDA 1XJBA 1UKOA 5GNXA 3GC2A 2TSYA 2F6UA 5C7VA 3BCDA 3GDKA 4L6OA 1V0NA 1MFUA 4XUYA 2A6NA 3BGJA 1Q65A 2EJ1A 2PDJA 4MAZA 1A50A 1PSCA 2ZUVA 4PFMA 3TYZA 2P8CA 4L9XA 1UA3A 3KS6A 4BS0A 4LCQA 4M29A 2OWCA 2J9YA 4DWDA 2CEQA 4RW3A 1CXLA 3LI1A 1NQ6A 4HK5A 2P0IA 5AHIA 2TYSA 2BHZA 1O7AA 3VTRA 3LV5A 3ITGA 1XBVA 4KEMA 1R9YA 2PGRA 1FWNA 3WO8A 5A1AA 3THUA 1XLMA 1YPXA 1Y5XA 3F7JA 3EWYA 1UZDA 2VWSA 2YXXA 3FYYA 3AZSA 2Y6ZA 3KWXA 2QCDB 3UCQA 3ID7A 4MNLA 3WLQA 3GUGA 1QI2A 1HT6A 3UVAA 4XZHA 2Z00A 1HL9A 4GQGA 4AVOA 2D23A 3UWVA 4Q4RA 2ZRYA 1KGWA 3TYUA 1DWHM 2F38A 4I7UA 2WKGA 3NQVA 4PEEA 1CDGA 3G1SA 3AXIA 2UY3A 3MI3A 4KWSA 1EC7A 2A3BA 4BA0A 2DV0A 3A3XA 4HJWA 4E8CA 4WEVX 4TV5A 1SUXA 3VD3A 2J27A 2DJLA 3WQVA 3GR8A 4LEQA 4DI9A 4OJYA 1YNPA 1YW1A 4JFUA 4GVHA 1MVYA 1NF0A 3ZMRA 5C9WA 1LWHA 2XZ9A 4LS1A 2OT0A 4LF2A 1MSSA 1BQCA 3PJTA 2VRKA 2A5HA 3N9KA 3RLGA 3MT1A 3MUXA 4TTUA 3SBFA 2VVSA 3CQHA 3EMQA 4YMZA 2FQIA 4ZQRA 1NJJA 3NYZA 3M7SA 4KF1A 3NDYA 9XIAA 1CGUA 2PC8A 1J5TA 1A0CA 2OZ8A 3GY1A 3BLIA 3VVGA 1H62A 3L4VA 3BAJA 1S5TA 1K1DA 5CG7A 2A4AA 4HHPA 1NFPA 2ZA1A 4L4OA 3APYA 3USBA 3TAOA 4DWSA 3N2CA 3VOJA 4GRSA 3DYPA 3ES7A 4IH3A 2Y70A 1O6IA 1U5VA 2GJRA 4HVXA 1UR9A 2YCIX 3NQFA 4Z2KA 4PRWA 4UQEA 4UTUA 4PUEA 2AQOA 3GVRA 5FL1A 3RPMA 4AVFA 2NX9A 4AEFA 4X60A 1SSGA 1RUSA