2JEPA

Native family 5 xyloglucanase from paenibacillus pabuli
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
363
structure length
363
Chain Sequence
b'ADASQIVSEMGAGWNLGNQLEAAVNGTPNETAWGNPTVTPELIKKVKAAGFKSIRIPVSYLNNIGSAPNYTINAAWLNRIQQVVDYAYNEGLYVIINIHGDGYNSVQGGWLLVNGGNQTAIKEKYKKVWQQIATKFSNYNDRLIFESMNEVFDGNYGNPNSAYYTNLNAYNQIFVDTVRQTGGNNNARWLLVPGWNTNIDYTVGNYGFTLPTDNYRSSAIPSSQKRIMISAHYYSPWDFAGEENGNITQWGATSTNPAKKSTWGQEDYLESQFKSMYDKFVTQGYPVVIGEFGSIDKTSYDSSNNVYRAAYAKAVTAKAKKYKMVPVYWDNGHNGQHGFALFNRSNNTVTQQNIINAIMQGMQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords XYLOGLUCANASE
molecule tags Hydrolase
source organism Paenibacillus pabuli
publication title Characterization and Three-Dimensional Structures of Two Distinct Bacterial Xyloglucanases from Families Gh5 and Gh12.
pubmed doi rcsb
total genus 144
structure length 363
sequence length 363
chains with identical sequence B
ec nomenclature ec 3.2.1.151: Xyloglucan-specific endo-beta-1,4-glucanase.
pdb deposition date 2007-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2jepA00
1VFMA 1H1NA 1GHSA 1WNOA 1V0MA 3AISA 3AI0A 5CPQA 4OBRA 1GQLA 4ZE5A 3RJYA 3RPMA 3N9KA 2VMFA 3FW6A 2GVYA 3FXYA 3NSXA 3VTRA 1JAEA 3GYCA 4MDPA 5CSYA 4WF7A 1KXQA 3CZKA 4CCCA 2XGBA 3AS0A 4TTGA 1ECEA 2GK1B 3EDDA 2FGZA 1G1YA 5EB8A 3N11A 3TONA 3L2LA 3VIIA 3AROA 1MWOA 1J0ZA 1V6UA 1PPIA 1EDQA 1E0XA 1GOKA 5E0FA 1W3HA 4HMEA 3AICA 4TUFA 2BV9A 3WMCA 4BQ5A 2BVDA 1LL6A 2QHAA 4NRRA 3L4TA 3CUIA 1BYBA 4XUYA 4NF7A 4P7QA 2JIWA 3IAQA 1UHVA 4UQEA 3OGVA 1OGSA 4PTWA 3G6LA 3OLDA 2GJXB 3ZIZA 4W84A 4U3AA 4AZCB 2PWEA 1JF5A 1V08A 1DTUA 4WKHA 5LYRA 1EQPA 1KCLA 1NP2A 2NT0A 4M24A 2WMJA 2YA2A 2VC9A 3PZUA 4JFSA 1W2PA 2QPSA 2VZVA 1TE1A 5BYWA 3MMUA 1QHPA 3MUZ1 3VMOA 3AS2A 2PWGA 3EMQA 4LX4A 2VVNA 5A8OA 3VNYA 2QLYA 5TD4A 1C91A 2QV4A 2YA1A 5D9NA 4HZ7A 4D6IA 2WHJA 4N42A 3MANA 3SIMA 4Q7NA 4FLOA 2D22A 1E4LA 3GDBA 3MV01 5BXTA 4LYRA 3EDJA 4BZYA 5E9AA 5HXMA 1GQKA 1MVYA 2ESCA 4D6CA 4AC1X 1E0VA 2WWCA 3VDBA 1BF2A 1LG2A 2WMFA 4MADA 5I23A 5BRPA 2XVKA 1CXLA 3RILA 2C0HA 2UY3A 1JFXA 1WDRA 1M04A 2Y8KA 3BC9A 3WY1A 4P7NA 1XD1A 1QOXA 1XYFA 1JYVA 4MJ4A 4XZWA 3II1A 4D6HA 3ARYA 5EFDA 2Y8VA 3W24A 2J62A 2VZOA 2D0HA 1PBGA 1BHGA 3PBGA 4P8XA 2YKKA 4LQ1A 3EMZA 2DEPA 3WNLA 4OBSA 1UH2A 3TP4A 3OLGA 4ATWA 4HA3A 1JDAA 3L4ZA 5BCAA 2V38A 4ZXLA 5M3WA 1JDCA 3W0KA 1W9UA 4YHEA 3QHMA 4GQRA 2WANA 2FH6A 1MQQA 4KMQA 3BAKA 4MB3A 3OLIA 5FL1A 3VNZA 1BSIA 2G3JA 1HX0A 3AIUA 3CPUA 3VIKA 1K9EA 1PZ2A 3CMJA 3G6MA 1BYCA 3RM9A 1V02A 4M29A 4PSPA 3GXFA 1W1TA 2XM1A 1OWQA 2OYKA 4H8VA 3T2PA 1WE5A 3EDFA 1CPUA 2VCCA 4P8VA 4UTFA 4NRSA 1I1XA 1E71M 3WD2A 5A6AA 5BXRA 5E0CA 2VQUA 4ZENA 1S46A 1GOOA 4FMVA 3VVGA 1E73M 2TAAA 2JE8A 1V3JA 2W92A 4HMDA 4CKQA 4AD1A 4A3HA 4UFKA 2VCBA 1WO2A 1KXVA 3AZRA 2ZICA 4PMZA 1HJXA 2IXVA 5A3HA 1GHRA 3WF1A 4DUVA 2YA0A 2UY2A 2FHBA 1KCKA 4M82A 2XFFA 1AQHA 3AXHA 3IANA 3FHAA 5A6LA 3OA5A 4TX8A 3L4YA 2RGLA 3CZ8A 1OD0A 1CGVA 3WNMA 4EKJA 1NOFA 1BQCA 1E15A 5A8NA 4YHGA 1KR0A 4WKFA 3WIJA 3WF2A 4XZBA 2QPUA 1ISWA 1VEPA 3ZSSA 1JI2A 3WBEA 1B3XA 1H5VA 1ZL1A 2MANA 2G41A 1GJUA 3WD1A 1H09A 1W32A 1YHTA 3WF4A 4B15A 4UFJA 3MKKA 4TXEA 1OT2A 1EQCA 1V6YA 2YBUA 1OIFA 4AMCA 2YIHA 1JG9A 4UOJA 4D72A 1C3FA 1E40A 3WEMA 1FA2A 1VENA 4IUGA 3VIFA 4PSRA 3VX1A 3KL5A 3N1AA 3QHNA 3NJ3A 4E8CA 2YDQA 1J0KA 4WLCA 1UWUA 1OD8A 1Q6EA 3WDQA 3BH4A 2DPEA 2ZUWA 4QDMA 2OSYA 1EA9C 2ZX5A 1C8XA 5DO8A 3VIPA 1ZJAA 1BYDA 1TFVA 4OOZA 2V5DA 4MNMA 1VB9A 1JXKA 4JZ5A 4JHZA 1CXEA 3AMGA 3OZOA 2VX4A 2BHYA 5A6MA 4QLJA 1UQZA 1ZBVA 4RE3A 4W5UA 1D2KA 3EMCA 4M8UA 3ZR5A 3LPPA 2WB5A 2WBGA 3I3EA 2IUZA 2D24A 3THCA 5ABHA 1D3CA 3B9EA 4AD3A 1JAKA 1OGGA 2V3FA 2WLZA 3HJEA 2W91A 2CBVA 1OCQA 2JF6A 2EJ1A 1VFUA 4KWUA 2V3GA 3AIRA 1KWKA 3ARRA 1FH9A 1Q6CA 3B9AA 5FIPA 2ZUMA 3UESA 3SCOA 2DGAA 3CMGA 2J8FA 2D2OA 4WSKA 3IAPA 1PIFA 3WDIA 1UKOA 3RDKA 4FF5A 1Q6GA 4HU0A 3SCQA 3WFZA 2J75A 5I78A 1V3IA 2BVTA 2WLYA 1NWUA 3QOKA 3VGEA 1HP4A 3CO4A 1XSIA 3AQUA 2X8RA 4DWSD 1WZAA 4D6EA 4R5EA 2G3IA 1DWFM 3T0DA 2FHCA 3NUKA 4F66A 2BVYA 4RE4A 1KWGA 2ZX7A 3PHAA 2J79A 3CUGA 3W6LA 3WH9A 3BGAA 1CXHA 1GQIA 5IHRA 1KGUA 4AZ5A 4FK9A 2A3HA 2YL5A 3PN8A 5A94A 2CEQA 2JF7A 2WYSA 1JD9A 1PJ9A 2J7FA 2DIJA 3POCA 4C7FA 4BA0A 4TVCA 3MUAA 4BF7A 1EHAA 1US3A 3VMPA 4N0RA 2WVTA 3AMCA 5AC5A 4PMUA 2J7CA 3VD9A 4S3KA 4W85A 2XUCA 1UH4A 3WQWA 4J3WA 4AZBA 3F5KA 1TVNA 3AHYA 4DM1A 3QR3A 3WMBA 1UD3A 1HJVA 1HNYA 1V3KA 2PI6A 1G94A 3KE0A 2CETA 3AIQA 3PTMA 4L4PA 3K8KA 1BFNA 5DFAA 2Y5EA 4HZ8A 3WBAA 5M17A 1XD0A 2FDMA 2CERA 1UQYA 2VZTA 4CN6A 2EPMX 2J7GA 1QHOA 5CPSA 4JHOA 1A3HA 3MMDA 1CXIA 1EDGA 4J27A 1B0IA 4HA4A 4PUEA 3FAWA 1SR0A 1UG6A 1HVQA 4IISA 1H41A 1VBRA 2EQDA 2G8ZA 1AMYA 5CG0A 2AAAA 2VT0A 3K4DA 1PIGA 1HF6A 4RE2A 3D5HA 1KQYA 1ISYA 1WDPA 2OLHA 1DEDA 1QNPA 2WHLA 1EXPA 4UZUA 3AYRA 5HPOA 1QVBA 1KXTA 3ZOAA 3SCUA 2JALA 3RM4A 1E3XA 1PAMA 1UWTA 4WK9A 4QCFA 4EANA 5A6JA 1V3LA 4GXPA 2G3MA 2GJRA 1FFRA 1V0LA 5ECUA 4PTXA 1KR1A 1QI0A 1BGAA 1UD4A 2D3LA 2GUYA 1JYWA 1LF1A 4D6DA 1GZJA 4JFTA 2DSZA 1M7XA 4MAZA 3IJ9A 3IJ8A 5BRQA 1WAWA 3MUY1 3WH6A 4PMXA 1BAGA 1B30A 4HOXA 1JL8A 2DSUA 1JYNA 2EPOA 3VD7A 4AISA 3AS1A 1C90A 1HJQA 4AYSA 2YL8A 3U5UA 2C7FA 1ODZA 4JL2A 4P8UA 1U30A 4FLQA 1E6XM 4PTMA 1UH3A 2NW0A 3DECA 4BQ4A 3OG2A 3BLPX 1QBBA 3UEQA 5E09A 1LJYA 2WCSA 3ZT5A 2BY0A 4AZHA 3WQ8A 2VQTA 3AIWA 3BCDA 9CGTA 5CPTA 5LA0A 3AXXA 1GOMA 3PZNA 4UOZA 4J3SA 3D3AA 5IDIA 5E6YA 1XV8A 2X0HA 2YL9A 1QNOA 3GH4A 3A47A 4R27A 5CQ1A 4DWSC 4LXFA 1MW1A 2WNWA 5M03A 1W9PA 2DH2A 5JUVA 2X0YA 1B3ZA 5AY7A 3W38A 4JIEA 3FY1A 1JI1A 2PWFA 3AHVA 1K9DA 2W63A 2WMIA 2O9OA 1GOQA 3DC0A 4Z2IA 1CLXA 2A3EA 1PEZA 1CIUA 2WMIB 3GXMA 3LPGA 3CGTA 3WD4A 2XVNA 2VCAA 2X2YA 5GNXA 4W8AA 1WCGA 2J74A 1UYQA 1I75A 4LGXA 3VILA 4TVDA 2CYGA 1C7TA 3IK2A 3BXWA 5A2CA 4CU6A 4AW7A 1FHLA 1ODUA 1TMQA 1UKQA 5A6BA 2X1IA 3WD0A 1E6RA 3T0BA 2XVPA 4KGJA 3THDA 3VMNA 3N17A 3GBDA 1NP0A 1R85A 4QP0A 2X09A 1GW1A 4PMYA 4B16A 3F5LA 5D8WA 1KBKA 4IPNB 4EK7A 2WAGA 3UG5A 1PZ3A 1MW3A 1XH2A 4GZIA 1H49A 2D20A 4Y7EA 2ZUUA 2BHUA 2OWXA 1MXDA 2CESA 4AD4A 3A4WA 5BXSA 4C7DA 4UQDA 2ZXBA 2J7DA 3PTKA 1DWJM 4W88A 1OIMA 1VAHA 2D23A 5D9PA 1CGUA 3AMKA 4AZ6A 4P7OA 5CSUA 1UWIA 2XFYA 4A3YA 3OGRA 1XCXA 2BY2A 3VD3A 1E6PA 4KGLA 2NT1A 3NDYA 1GNXA 4AEFA 2W61A 3AYSA 5C70A 1W9XA 2J7HA 3QOMA 3CHCA 1DWAM 3RO8A 5AC4A 3E1F1 4JKKA 4CD4A 3ZMRA 4GPNA 1V3HA 4NZCA 2Y2WA 3AS3A 1GCYA 1MQRA 4J3VA 2OSXA 3ALGA 2WZEA 3WQ6A 3BAYA 3TTOA 3RJXA 4P7RA 3NCOA 2XVGA 4RL3A 4BCEA 3SCTA 1KGWA 3K46A 4E4PA 3VGFA 4DUXA 1XH0A 1UKSA 5I0DA 1HJUA 3GNPA 1UR4A 3CZLA 1C93A 4K68A 4MB4A 1G9HA 1QI4A 1TZ7A 5HDRA 1NH6A 3SCPA 1GONA 1DWIM 4FLRA 1UZ4A 2G3NA 7CGTA 1GQJA 5CJ5A 4MNLA 1BG9A 2XFRA 2BNJA 4GI8A 2W62A 1CGYA 3WNNA 1CXFA 2CCRA 2WM0A 5IHSA 3BAWA 6TAAA 2Q8XA 2WVSA 2VRKA 2WW5A 3VU2A 5D9OA 5A8MA 2XWDA 1X6NA 4J3UA 3PZQA 2E3ZA 4D6JA 5AYIA 2GDVA 5AYBA 3AHXA 3BAIA 3CZEA 5KEZA 4B9ZA 4F8XA 1J0JA 1TVPA 4QCEA 3MMWA 3QGVA 2V3EA 4TTUA 1W2VA 1HKJA 4OZOA 2CHNA 4CCEA 2XVLA 3A3HA 3WENA 1K6AA 1W91A 1E43A 2GDUA 3WDRA 4HPHA 1J0IA 5C71A 3ARXA 3ZT6A 3CTTA 4D71A 2UWFA 3L4VA 1GOWA 4Q22A 3W4RA 4HTYA 4J3TA 1RPKA 1W9BM 3AMDA 1B2YA 3SCVA 3PZOA 2D1ZA 1JZ2A 2ZX8A 4M81A 2VRQA 4ACZA 1E6SM 4UQAA 1CGXA 1QNRA 4AXNA 3M07A 2GJPA 4JAWA 1R87A 2DT2A 4UOQA 3T2OA 1B3VA 5A69A 5D9MA 3TTYA 5JIWA 3BLKA 2VURA 1OINA 2JIEA 2O9PA 4IPLA 4DM2A 2CNCA 2WZIA 3WFLA 3VPLA 2E9LA 3ZR6A 1F4HA 3FHQA 2GJXA 2XYLA 3LPOA 3OIHA 3ZJ8A 1BG4A 4JKMA 7A3HA 4Z2KA 1Y7VA 3GH5A 3PZIA 3K8LA 2YJQA 3WQVA 1EOKA 3DYOA 3OLEA 8CGTA 1CWYA 3KL3A 1OM0A 4Z2JA 3WH8A 3AJ7A 1XCWA 3F4VA 4U33A 2DSVA 2VL4A 3U57A 5I2UA 3ARTA 3HMCA 1NWSA 1OBAA 4CD6A 1JIBA 4UZSA 5GPRA 2QMJA 3UR8A 2RGMA 2OSWA 2D3NA 3GXDA 4D6FA 3WF3A 5C8BB 3W27A 3LPFA 4AD0A 3T0AA 3O2LA 4V28A 1OB0A 4OKDA 1UA3A 2A3CA 4B9YA 3EDEA 1W1YA 1YQ2A 1TUXA 3AMLA 5DT7A 1UD6A 2X05A 2ZE0A 1UR0A 1W3KA 3ARSA 1JZ3A 1H3GA 2ZXAA 3VDAA 3SUTA 5A1AA 3BCFA 3AZSA 1W1PA 3AHTA 4H7VA 3WN6A 4IM4A 4UCFA 4GO8A 3NYDA 3ZJ7A 4KRTA 1XRVA 1UR9A 1A47A 2BXYA 3W28A 1ZBWA 2CBJA 4CGTA 4EE9A 1E6ZA 4W7WA 3AIEA 3POHA 1E1FA 4H2CA 3NSNA 5EFFA 1Q6DA 4ATDA 3BAXA 3PZMA 2PWDA 1VJSA 3T2QA 2GFTA 1E72M 1UOKA 3FN9A 3GNOA 3KWXA 2OYLA 1BVZA 4JL1A 4KRUA 3CH9A 1XHGA 2ZUVA 3SEPA 3WELA 1H4PA 1OT1A 3OGSA 4HP5A 4XB3A 2XTKA 3WSUA 3SURA 2FH8A 2WZHA 4W7UA 1HKKA 5LA2A 4W8BA 1NOUA 1QNSA 1U2YA 2WKGA 1BLIA 1W1VA 1M53A 3SCRA 1FFQA 2J78A 3VX0A 2VTFA 5CGMA 2C8NA 2O9TA 3HN3A 5A6BD 3VD4A 3WUFA 1JZ4A 1E70M 3ZQ9A 2Y4SA 4HA1A 1FP8A 1MFUA 2G4FA 2VR5A 3WH5A 4AIEA 3KEHA 4YPJA 1EIBA 4W86A 2DSKA 2NSXA 2XPKA 4XV0A 4ACZB 4JCMA 4OIFA 2XHYA 1QI2A 4W5ZA 3VO0A 1JZ5A 4MDOA 2D0FA 1LL4A 3K1DA 2OWWA 3FAXA 4MJ2A 3MU7A 5ABFA 4S3JA 2WBKA 1L0PA 5ABFB 4BS0A 1E5NA 1FH8A 2FHFA 4UFMA 5BROA 1UZ1A 3UCQA 6A3HA 2YLAA 4XX6A 4AZIA 3TA9A 1QBAA 1C7SA 4U3CA 1ITCA 2VR4A 3WF0A 1KBBA 2UY5A 1UD8A 4F9DA 1NWRA 3N13A 5I24A 1EH9A 1X6LA 1ZU8A 1HIZA 4HOZA 5FOOA 3CZJA 4ZFMA 1UD5A 5A2AA 1IV8A 1EGZA 3N04A 4HU8A 5I3DA 5A6KA 1VEMA 5HNNA 4PN2A 4H41A 2E40A 4U2ZA 3VD5A 3L2MA 4PMVA 1H2JA 2PF0A 2WCAA 2XWEA 2VVSA 2J77A 1AQ0A 2EXOA 4M56A 4UQBA 5DEZA 2EPKX 2ZIDA 4PMOA 1JZ8A 1E4NA 1WZMA 5A8PA 1EOMA 3RM8A 5BWFA 4P8WA 7TAAA 4LYPA 3BMVA 2ZUTA 1J0YA 4CD8A 1LLOA 1HJSA 2VZUA 1E4IA 3UR7A 3CHDA 3N12A 2WSPA 3UG4A 3WKZA 2CBIA 3S2CA 1GVYA 3CUHA 1XSKA 1MFVA 1KFWA 2PB1A 4AZCA 3MUIA 4URIA 3KL0A 1CECA 4B3LA 4J3XA 3APGA 3BSGA 1VRXA 1P6WA 4MB1A 5JIPA 1UR1A 4GIAA 1N82A 4CU8A 2ZWYA 5IFTA 3K8MA 1E0WA 1DWHM 3VIMA 5CGTA 4GINA 1VJZA 5HPCA 4P7LA 2VZSA 3NSMA 2W66A 3A6OA 1R7AA 1WDQA 2QF8A 1KQZA 4X9YA 2E8YA 1XC6A 2XG9A 4UFHA 2YDRA 2GSJA 3OZPA 1KGXA 5JBEA 3AOFA 2WVVB 2W4XA 1DHKA 4PCSA 4ML4A 2DQXA 1JDDA 1B1YA 2WHKA 5IFPA 2WC7A 1CGWA 4E2OA 4D6GA 5DT5A 1F4AA 4W93A 3WH7A 2AOSA 2CPUA 1LQ0A 5I77A 4EAMA 1GUVA 1PX8A 1BGGA 4A4AA 1NOWA 4MTVA 1CEOA 1V6WA 3WEOA 2BY3A 2EO7A 3MSGA 3DHPA 3WNPA 4UR9A 1H11A 3U5YA 5IXEA 4GZJA 2CIPA 2DT3A 3GXIA 1HP5A 2VX5A 1H0GA 4HZ6A 3M46A 3ARUA 4W8LA 4ZEPA 2DT0A 1D7FA 3SUUA 3ARWA 1H0IA 1WB0A 4GO9A 1FH7A 4DWSB 2EEXA 3VUPA 3VIHA 1TA3A 3TOPA 1PX4A 2J8GA 3BSHA 2V3DA 1VIWA 4HPGA 1QW8A 3F5JA 5GNZA 2CHOA 3S6TA 3N18A 3RIKA 4JFUA 1E6NA 4GKLA 4NSBA 4AIUA 2WVVA 3CZGA 4TVUA 3B9DA 3DHUA 3ARQA 1JYXA 3RMEA 3GM8A 8A3HA 1CNVA 5CLWA 4U2YA 3GZAA 3MS8A 1HVXA 1JD7A 4Z2HA 3B8SA 3QHOA 3VGHA 2J7EA 1HT6A 1J0HA 1MW0A 2PWHA 4CD7A 4UFIA 1RD6A 1E56A 1E5JA 1RH9A 2E0PA 4QLLA 2HVMA 3NDZA 4QLKA 4AY1A 1IZKA 4PUDA 4MPKA 1V6VA 1HJWA 5KZ6A 3PZVA 2EBNA 4PRWA 4PEEA 3PZGA 1MQPA 2W5FA 3K4AA 4W87A 1C8YA 1B9ZA 4DUWA 4H04A 1WP6A 3VGBA 1V0KA 2Z1KA 1US2A 2XM2A 3SUVA 2Z1SA 3CHFA 2HISA 2WHMA 2F61A 1CLVA 2WPGA 2CBUA 2CITA 1V3MA 3L4WA 2A3AA 1OSEA 2JFEX 2ZOXA 1KB3A 2YBTA 4WJXA 4HOWA 3A4AA 2WC3A 1JF6A 3BMWA 3VGGA 2YOCA 1HN1A 3DYPA 1GJWA 1B90A 1LL7A 3WNOA 5HBFA 3WQ5A 5JBDA 3MSDA 2XJ7A 2YLLA 3VDHA 5FKYA 5JBFA 1PX3A 3ARPA 5ABGA 3VM7A 2WXDM 1U33A 4AIOA 1FOBA 4D1JA 1M01A 4B3KA 2WWDA 3CBWA 1JZ7A 5M5DA 3O9NA 3IJ7A 2VNCA 2QMKA 1K9TA 4ATLA 4QFUA 1JXJA 4U31A 3WMSA 5F7UA 4U5KA 1SMAA 2XSBA 2WK2A 3EYPA 3FNDA 4OJYA 3CUJA 3U7BA 1OGBA 1EO7A 3VGDA 1W3JA 3OBAA 1CTNA 4TOQA 1J11A 3ZJ6A 2XIIA 3AHZA 2XIBA 1EHNA 1ZBCA 2F8QA 2ZUNA 1NARA 1XSJA 3WDJA 1VBUA 2XGIA 4PCTA 2ZWZA 3T08A 3PZTA 2VUYA 1QPKA 1B31A 1SYTA 5ABEA 1E4MM 4AD5A 3ALFA 2AMGA 1QW9A 4GQQA 5CXPA 3TTSA 3UERA 1CZ1A 1UD2A 2CXGA 2WMKA 1QI5A 1VF8A 1GPFA 5I79A 3WUGA 5D8ZA 2E9MA 2ZXDA 2BS9A 5D4YA 4C7GA 1R8LA 4NI3A 1W9VA 1TA3B 3WD3A 1C8QA 2J4GA 2J47A 2JEQA 1VFFA 1DP0A 1G5AA 3WL1A 4F9JA 1FHDA 5A8QA 3W81A 1J01A 4W7VA 1V02E 1M03A 4PYSA 1G01A 1MW2A 4BQ2A 1E55A 1NWTA 3ZSTA 1ZS2A 2BFGA 5E70A 3VINA 2VOTA 1KXHA 4CU7A 2OYMA 1V0NA 4QAWA 1W3LA 2DT1A 1K9FA 1LWJA 3VKKA 4H8HA 1V6XA 4GZEA 1J18A 3SUSA 2BXZA 4HMCA 1CXKA 2WSKA 3GTNA 5EMYA 3CLWA 1HXJA 3UETA 4LPCA 4WKAA 3M6DA 4M80A 1E1EA 4YN5A 3W53A 1AVAA 4W89A 3MO4A 3NIYA 3CIVA 4OOUA 1HKMA 2DH3A 1E3ZA 2W67A 3A4XA 3M7SA 5LA1A 1TCMA 4LYQA 5FCZA 1UWQA 1BPLB 5I6SA 2DDXA 4ZXOA 5A2BA 1J10A 2VX6A 1R86A 3I3BA 5GQBA 2F2HA 1ZB5A 4UQCA 1QI3A 5HOSA 3L4UA 1B3WA 2VRJA 4CVUA 5FL0A 4DWSA 1O6IA 5DMYA 3ARZA 3SCNA 3EDKA 4Z2LA 2VI0A 3DYMA 4KH2A 1JNDA 4PTVA 4V2XA 3CUFA 1NQ6A 1IT0A 3U7VA 5CLTA 2GK1A 3W82A 4JFWA 1FP9A 1SMDA 3ZJKA 3PTQA 4JCLA 3WDHA 4X0VA 3I3DA 2PBOA 3GNRA 2D0GA 4Z2GA 2CKSA 4GI6A 4MNJA 1WZLA 2IXUA 1ZJBA 3VOCA 2E4TA 1UR2A 3T09A 2BHZA 4UQ9A 1L8NA 3TTQA 1BYAA 1UWRA 4WSJA 2Y24A 6CGTA 2FGLA 2O9RA 4X0NA 5E6ZA 3MV11 3ARVA 1V03A 1VFOA 1TR1A 1ISVA 3VIJA 4GI9A 1JZ6A 1NM9A 1WDSA 3J7HA 3GH7A 5DF0A 1EO5A 4OUEA 1JFHA 3W26A 1I1WA 1J9YA 1EDTA 1Q6FA 2JEPA 3WNKA 3AIVA 1QNQA 3EBVA 2V5CA 4CCDA 4E8DA 3AXIA 2YL6A 4AWEA 4PMQA 1ISXA 3VDCA 3W6MA 1E9LA 2ZXQA 1CGTA 4PMDA 1WZKA 2DIEA 3HU7A 4JKLA 4ACYA 3WEZA 2A3BA 1UUQA 3AZTA 1JNEA 1LG1A 3WUEA 1ZBKA 3WQ4A 1C92A 3SUWA 1GVIA 4F79A 2EPNA 4PMRA 1R7OA 5A6SA 3W25A 4J7RA 3WL0A 1CENA 4WIWA 3SCSA 3RCNA 2WCGA 1W9DM 2B31A 3UG3A 3ZT7A 4AZGA 3GBEA 1RP9A 3WUBA 3VIGA 1VEOA 1Q4NX 1XYZA 1JGIA 4AEEA 4V27A 4PMNA 5FD0A 3ECQA 4MNKA 4MB5A 3LMYA 1J12A 2WVUA 2YDSA 4MAVA 4M1RA 2PC8A 1G0CA 4UFLA 1WPCA 1CDGA 2WMHA 1HL8A 2CKRA 3CHEA 3ZO9A 1LWHA 5EBAA 4CN4A 2VO5A 1AQMA 4JFVA 5A95A 4L4OA 2OWCA 3ZM8A 1UR8A 2WKLA 2XSAA 3W29A 3PZ9A 3W37A 1TG7A 2PBGA 1UKTA 2J7BA 1UKPA 3JUGA 3OB8A 2VX7A 3VM5A 1QHZA 3VIOA 4CD5A 4D1IA 1CYGA 1UA7A 1E6QM 3SCWA 1CBGA 2ZUSA 2VJXA 1BVNP 1MYRA 2E8ZA 4ZE4A 1DWGM 2DSWA 1GORA 4CVWA 3O6AA 1RP8A 5BXPA 4CUCA 2ZX9A 2WC4A 4BQ3A 1ISZA 1SFSA 2O92A 1HL9A 5GNYA 1BTCA 1X1NA 5CZKA 2EPLX 4FLSA 1UWSA 4AD2A 1ITXA 4PBGA 2J25A 2UY4A 4UNIA 1WKYA 3N15A 1GOIA 3AFBA 4U5IA 2E9BA 3BAJA 3WDPP 1HKIA 1B3YA 1O7AA 1XH1A 3KZSA 1Z32X 1XGZA 1IZJA 4CN1A 1MXGA 4J28A 3AIBA 2WMGA 2ZX6A 4H8UA 4AZ7A 4TX6A 2BY1A 3L4XA 1ESWA 5I5RA
chains in the Genus database with same CATH superfamily
1H1NA 1WNOA 1V0MA 3AISA 3AI0A 4EXQA 5CPQA 3E9AA 1GQLA 4OBRA 2ATSA 3QZ6A 2DZWA 3RPMA 1A5KC 1P6BA 3HA1A 3BG9A 3FW6A 3FXYA 2CW6A 1JAEA 4MDPA 4HA0A 4WF7A 1XLEA 3CZKA 3CAVA 4OT7A 1PHWA 5FF7A 5K9CA 4QGCA 2W27A 1S2AA 1G6CA 3TONA 3W1UA 1VYRA 2WJZA 4QJ5B 1GOKA 1WDDA 4ASTA 5E0FA 4DY1A 1W3HA 1HW6A 4DJEC 3OVPA 3WMCA 3YPIA 2OT0A 5IDZA 2QCFA 3B0UX 4DXXA 3UZJA 3GC2A 4HYWA 3EWYA 1WUFA 3NPVA 2PGWA 3EOLA 1BYBA 2F6XA 4HB7A 4P7QA 4DN1A 2JIWA 1UHVA 4UQEA 5G2IA 4F40A 3OGVA 1YPIA 3OYXA 2ZA3A 2DJLA 4WXZA 3G6LA 4O15A 4AZCB 2PWEA 4WKHA 3M44A 1EQPA 1KCLA 1UIPA 3TC3A 2WMJA 3NM1A 1TMHA 4JTDA 1KFLA 4JFSA 1W2PA 2QPSA 4WDWA 1V51A 3T9PA 4C6OA 3LCXA 1W1A1 1CX9A 2B81A 5HWMA 2QUTA 3JVAA 3TJ4A 3ITYA 3EMQA 5HJYA 1L9WA 4TIMA 4DAIA 5A8OA 3TKFA 5D9NA 1UWAA 2PDKA 4D6IA 2RDTA 3VOHA 5TQLA 3MANA 2GGIA 4FLOA 2D22A 3CAKA 2OG9A 3UNDA 4XAGA 4GBUA 2XN0A 2FZ9A 1TJRA 3L5MA 1S1PA 3CC1A 4BF9A 4AC1X 1E0VA 3TCEA 3W2NA 1BF2A 1PZ1A 2FVKA 2WMFA 5I23A 2BLEA 2VWTA 1FQ0A 1CXLA 3H2AA 3ZVIA 1ONRA 5LHEA 1RXOB 1WDRA 2ZQ0A 4EAYA 3WLKX 4GJIA 3UYIA 2GSHA 4RNFA 2Y8KA 4DWDA 4CQCA 3P7YA 3RLHA 1XYFA 4K8HA 2IPWA 1JYVA 1IXOA 1LUCB 1UJQA 4D6HA 1KRAC 4Q8OA 3ZXWA 1AZ1A 4L1WA 4CNTA 4Q32A 3PBGA 4P8XA 4XBSA 3M0YA 3MKVA 1VPYA 3OLGA 4QAIA 4ML9A 1JUKA 2V38A 1W9UA 4PFHA 1EJWC 2FH6A 1L8PA 3B9NA 4GVFA 1V79A 1Z42A 4IGHA 3OZYA 3CAWA 1NU5A 4RPQA 4I7UA 1BYCA 1V02A 4D8LA 1GYNA 3XISA 4A22A 4H8VA 2W0UA 1DPMA 1C9DA 1WDWA 2BTMA 4DHGA 2C1HA 3EDFA 1JQXA 1TR9A 1CPUA 3FA5A 4XK2A 5A6AA 4XTIA 2PDXA 4F2UA 2VQUA 4GCAA 4JXCA 1R9YA 5C6MA 3EGJA 1GOOA 4FMVA 2TAAA 1O5KA 2W92A 3W23A 4H9XA 2AGKA 1RK5A 4A3HA 2VCBA 3HOJA 3NZPA 1RSCA 1NIUA 2ZICA 4PMZA 3TJIA 2AKZA 3G1HA 3MVIA 5HULA 5A3HA 2CLHA 3EB3A 4FXRA 4M82A 1XIBA 1LBLA 4TX8A 1OD0A 2RKXA 3L67A 4UIOA 3WNMA 1XICA 5A8NA 4GCXA 4PEKA 4B5XA 4WKFA 3WIJA 4LV4A 1JI2A 3PUDA 1QO5A 1H5VA 1ZL1A 2MANA 3PB0A 1H09A 1W32A 4B15A 4TXEA 1OT2A 2YBUA 4AMCA 4UOJA 1SJAA 1B57A 4O8AA 3WEMA 3XINA 2A3LA 1EWEA 3VX1A 1YPFA 3QC0A 2WNQA 4NT0A 4E8CA 3I68A 2WOQA 4ZZ9A 1UWUA 1V93A 3ABZA 3KTSA 3VE9A 3QQ0A 4GQGA 4BKNA 2C19A 3S5ZA 1EA9C 2ZX5A 1SFJA 2J9XA 4Q4SA 3VIPA 4JTJA 1TFVA 2GUBA 4OOZA 2E6FA 4REQB 4QE5A 1CXEA 3TYAA 3OZOA 2VELA 3QW3A 2JGYA 1FWHC 3THQA 4Q4QA 1UQZA 1ZBVA 4RE3A 3EKLA 2ZZ2A 4AY7A 3LPPA 1EB3A 3I3EA 2JKAA 2D24A 1RJRA 2G5WA 4LUJA 4XD5A 1AJ2A 1AH3A 3QMRA 4LS0A 2W91A 3PG8A 4KWUA 1R46A 1Q6CA 3B9AA 5D30A 3GC5A 3LI0A 2ZUMA 6XIAA 1TIMA 2B7NA 2DGAA 5EPDA 3CK5A 3BGJA 2GVGA 5M1TA 4ZVJA 3EXSA 1W0MA 3N2TA 4Q8UA 3RDKA 2ZZ3A 4FF5A 1Q6GA 4ICNA 1UP0A 3CM4A 1FWDC 3MY9A 4LYKA 1NWUA 4S3DA 4PCPA 2R24A 1TPH1 4P2VA 4BJHA 1WZAA 1UP2A 5TF0A 1XJBA 3GC4A 2FHCA 3PB2A 5TBOA 4MUPA 4RE4A 4Y90A 3ABRA 4XWUA 5G4WA 3CQIA 3DFNA 1OK4A 3CUGA 5IHRA 1FDYA 2PLKA 3KXQA 4ROQA 2J7FA 4BA0A 4I8YA 2GWGA 3MUAA 1US3A 4N0RA 1OC5A 3VD9A 1UBSA 4J3WA 3BV4A 1JPIA 4E0CA 3QPYA 4N02A 3BZGA 4XIMA 3MI2A 1HJVA 1HNYA 1V3KA 1G94A 3W7EA 2SFPA 4FX6M 1NF7A 3WBAA 3CYVA 2REQB 3QSTA 1UQYA 2VZTA 3N6JA 2EPMX 4QSFA 1RV8A 3SFKA 3P80A 4WQ6A 4Z1DA 4O1EA 3QV6A 2E5BA 3NL3A 3MO7A 4IISA 2WSRA 1H41A 2DIKA 3HURA 4Z1AA 3CS2A 1AMYA 2AAAA 4FI4A 2IQTA 2FMNA 2DZBA 2O7SA 4LRTA 1ISYA 3STEA 3LA4A 2HCVA 1BRLB 4UZUA 3AYRA 5HPOA 4BWLC 3IIPA 2QPXA 4EANA 4FIQA 2QJIA 1V3LA 4GXPA 2G3MA 2GJRA 1O60A 2PTYA 5ECUA 1JULA 1FKXA 1KR1A 3TDFA 2QQ6A 1SPQA 3B05A 4F2BA 1AA1B 1GZJA 2MUCA 2ZKMX 2DSZA 1LDCA 3Q37A 1U5HA 2B4GA 5D03A 3UXIA 5HR7A 3MUY1 2Z2BA 4PRRA 1JL8A 2DSUA 1VCGA 1YDYA 1XLAA 1XS2A 3AS1A 1HJQA 4AYSA 4H01A 4M51A 1XLJA 1U30A 4C1NA 1UH3A 4O8RA 4BQ4A 4QR6A 5J5RA 3M47A 3ZVHB 3BLPX 1QBBA 3UEQA 5E09A 1LJYA 5AHFA 5CAHA 1UW9A 4TO8A 5DMNA 3BCDA 9CGTA 3CQ0A 4LT9A 4QEHA 4RPPA 2FIQA 3W1RA 1K8YA 1YX1A 4DXVA 2YL9A 3NNTA 3QR1A 2CLOA 4DJDD 3PUEA 4M6VA 4DWSC 4B4FA 3SRDA 1I2PA 2DZUA 2WNWA 4DYJA 2CLPA 2NVDA 2PWFA 4XZMX 2WJEA 2W63A 3MI6A 1TV8A 2Y62A 3OBKA 3GXMA 2WMIB 1XUZA 2FB3A 1WUEA 2XVNA 1Q63A 2QJJA 2WKJA 1OCJA 5GNXA 2J74A 1EC7A 4LY4A 4LGXA 5JU6A 4TVDA 3BK0A 3BXWA 2EJAA 2C15A 5A2CA 1T8QA 1FHLA 5GJNA 1VBJA 1ODUA 1TMQA 4GVGA 1QJWA 3N17A 1R85A 6PTDA 1KBKA 1S39A 5DMLA 3WJSA 3HZ3A 5LGZA 3PBWA 1Q4WA 4ALDA 4X63A 2J8TA 4AD4A 5BXSA 3NQCA 4C7DA 2HK1A 4ZB5A 3ATZA 3NQEA 1TPC1 4LC8A 3I65A 4E2BA 1DWJM 1OIMA 2Z7GA 1GZGA 1IXPA 5D9PA 4FAMA 1W3TA 3H55A 2NXHA 4P7OA 4L1XA 3QZAA 2OTDA 4A3YA 3ZYZA 1E6PA 4F0HA 2NT1A 4HNOA 1P7TB 3M43A 2ANUA 3AYSA 3W7JA 4LFYA 5CJMA 1N8FA 1DWAM 3CHCA 3P60A 1YNPA 4ZTXA 2QR6A 3RO8A 6ENLA 3REQA 2A6NA 4WJEA 1RUSA 2F84A 2A0NA 3LXBA 3NZ1A 4HHPA 4J3VA 3F4NA 2HSAA 1F3WA 3MC5A 5I3KA 3RNDA 3SSJA 1AK5A 4RL3A 1H1ZA 2FFCA 2Q8LA 2OJPA 3VGFA 1IEQA 1T7LA 1BXCA 3MYPA 4KCUA 2XH0A 4ZL1A 4K68A 4GNJA 1QI4A 2O56A 2XU2A 4NVTA 1NH6A 3P5ZA 3SCPA 5HWNA 2G3NA 1XGDA 1GQJA 4MNLA 1BG9A 3OVGA 5C9RA 2GSEA 1W8SA 2HXUA 2WVSA 4G1NA 3VU2A 1W54A 3ZZ1A 1WKDA 2NV1A 3NQ6A 2E3ZA 1CB7B 3TN4A 3AHXA 3LHYA 4A2RA 4F8XA 3FX4A 1YNQA 1J0JA 1XKJA 4N4PA 4QCEA 2NLIA 3QGVA 4KFNA 3IJLA 2V3EA 1W2VA 1DJXA 4I5RA 3USZA 3WENA 3QKZA 3R1ZA 5KETA 3RU6A 3HFYA 3BV7A 2I16A 3CTTA 1EBHA 4J3TA 3RUBL 2A79A 3AO0A 3FJ4A 1FWWA 3B0XA 3TFCA 2VRQA 1RK6A 2ZRVA 1F8IA 1E6SM 3K4WA 3WLPA 4AHQA 4EWJA 3M07A 3H4GA 4UOQA 3MTWA 3T2OA 3EPMA 5D9MA 2ZRYA 1IZCA 3TTYA 5JIWA 3BLKA 3NOEA 3UJEA 1T5AA 4NJIA 4DM2A 9XIAA 3OOQA 3ITXA 2OOFA 2WQDA 4HHLA 2CNCA 4R33A 3ZR6A 1LOQA 1F4HA 3S46A 4Z2KA 3PZIA 4H9YA 4NL1A 3K8LA 2YJQA 1EOKA 2ZVRA 2JKPA 3S5OA 3NXFA 1OM0A 3HPZA 1XCWA 3H2OA 3RCYA 4U33A 2VL4A 1T8XA 3DERA 1K7XA 1K4GA 4WOZA 3ARTA 2VC7A 4I90A 3L66A 3HMCA 4CD6A 1IYXA 5GPRA 2QMJA 3UR8A 3W7DA 4K39A 2FGBA 3WF3A 2ABAA 2PDHA 2PDMA 3CPRA 3LHVA 2QCEA 3T0AA 3W1PA 4O12A 2NQLA 3UGRA 3VOFA 4YL2A 4B9YA 4DIAA 1JRBA 5MHBA 1TUXA 5DT7A 3LY0A 1UD6A 1OC6A 1TV2A 1O1HA 4GRSA 3SUTA 5A1AA 2BGNE 4O1BA 4H7VA 3WN6A 6REQB 3GHUA 1PYFA 4UCFA 3L0KA 4NHVA 3ZJ7A 2FTWA 1XRVA 1FWFC 2FPYA 3W28A 1ZBWA 3IIXA 2E6YA 1OADA 3POHA 1H60A 3NSNA 3S1GA 3BAXA 2AL2A 1VJSA 3NO5A 2JKEA 2OYLA 1JPKA 4KRUA 1DJYA 3LRKA 4O57A 2J88A 3LLFA 5CZSA 2IKGA 3WELA 1H4PA 1W5QA 4HP5A 4RR4A 4XB3A 2FB2A 1YPXA 3WSUA 4Z0JA 4W7UA 3HIJA 2XFWA 5LA2A 3QFEA 1NOUA 4K8EA 5LZLA 3OHMB 1WQ5A 3LGDA 3UG8A 4F0RA 4MY9A 5B7ZA 2GQ9A 4YVVA 3SCRA 3HG2A 4O19A 5A6BD 3M0JA 1PKLA 3I4KA 4FOUA 3WQGA 1IE7C 1FP8A 2PRLA 1QDSA 3KEHA 4YPJA 3KHJA 1AL8A 1DYSA 2XPKA 4XV0A 3MWCA 1SGJA 1QNVA 1QI2A 5G2HA 2XDFA 4W5ZA 2OEKA 3VO0A 4MDOA 5J04A 4YTRA 3FAXA 4MJ2A 3MU7A 4N9DA 4YJ5A 2WBKA 5ABFB 1R5YA 3FFSA 2PTDA 3SAZA 1FH8A 4HHHA 1UZ1A 1MEIA 1TV3A 3W01A 1QBAA 4U3CA 1ITCA 3N73A 3DFYA 1MUWA 4A2SA 2VR4A 2F9RA 1R47A 4CQAA 4R3UA 4KIRA 3NQVA 3W75A 1TPWA 3CZJA 4ZFMA 2CZ5A 3NQ8A 5A2AA 1IV8A 3N04A 4JQ3A 3A64A 1HFBA 3GO2A 3CQJA 3W87A 2E40A 1J93A 3SQMA 5LHFA 4E5TA 3S47A 3FOKA 3WCZA 3V36A 2WCAA 3M4HA 4H9UA 2XWEA 4XZNX 1QU4A 4FNSA 1M3UA 2VVSA 4M56A 3LRMA 1SO6A 5K2ZA 4UQBA 5CEWA 2EPKX 4UC5A 2ZIDA 5EBUA 4IL2A 3W00A 4PMOA 5BWFA 1AMKA 1BXBA 2PDBA 7TAAA 3QMTA 3VCCA 1DIDA 3UR7A 3PC0A 2WSPA 3UG4A 2CBIA 2E6DA 3VAVA 3EOSA 3MZNA 3L68A 4AZCA 2A21A 2PB1A 2GZXA 2EG8A 2PPGA 4J3XA 1DVJA 1EJVC 3E6EA 1IIGA 4CU8A 2CFFA 2ZWYA 1FX6A 4XAYA 3HGOA 3ZLFA 5CC7A 1EYWA 5CGTA 3NL6A 2G95A 4TU1A 1TJPA 4KS0A 2W66A 1R7AA 3URNA 4X9YA 3DEQA 4GYPC 2E8YA 2ABBA 1KGXA 4XD6A 4HK6A 4PCSA 4BWLA 2Z2UA 1B1YA 4ENLA 1RCQA 4CNSA 4QXIA 4D6GA 2E77A 3U2EA 5DT5A 5CSSA 3LHWA 3A4JA 2GL5A 2AOSA 2ZRUA 1TV4A 4NZ1A 1VD6A 1LLZA 1BGGA 3LENA 4A4AA 4NZ4A 1NOWA 4H9MA 3WEOA 1H63A 1NY1A 1W1B1 3MSGA 2VWSA 5FSEC 2YR1A 4KWVA 3CEUA 2CIPA 4IUOA 1HP5A 1H0GA 4HZ6A 4NUWA 3M46A 4ZEPA 2DT0A 3PJXA 4DZAA 3SUUA 1EL3A 2EEXA 1KNWA 3E2QA 3VIHA 1MZRA 4LEQA 4WD0A 1XL9A 3RX3A 2DV0A 3W7GA 3GE7A 3EAUA 4EP8C 1VIWA 2YCKX 2BB0A 4QE1A 3EWWA 3F5JA 4O14A 2QVHA 4JFUA 2WVVA 3DHUA 3OPSA 3VOIA 1R9XA 3ARQA 5FJUA 5CLWA 4F0SA 4U2YA 3MS8A 4I6VA 1JD7A 4AXKA 4JTHA 4HNUA 3B8SA 1TJ2A 3IRSA 2PWHA 2JK2A 3LZ5A 1A5NC 1E56A 4POCA 2JQXA 2ZBTA 4QLLA 2HVMA 3NDZA 5M2FX 4QLKA 3L0NA 4DJEA 3EX4A 1IZKA 4ADUA 1V6VA 4L6HA 3EB2A 3DGBA 3PZVA 4JY8A 2EBNA 3PZGA 1MQPA 3K4AA 4ZGYA 2OFJA 4DUWA 5HMDA 3LERA 3VGBA 1A5BA 1NFGA 2XM2A 4IMFA 1Q6OA 3RPDA 2F61A 4Q8MA 1CLVA 3CXOA 3BW3A 4JN6A 4DZIA 4MWAA 3TXVA 2CITA 4Q6XA 3L4WA 1OSEA 2ZOXA 1XUUA 4AWSA 4C6IA 2Q8ZA 1EP3A 3MQTA 1PCWA 3VGGA 2YOCA 1H61A 2QUUA 2GOUA 5I3GA 1ZNNA 1X97A 3QH2A 3V0TA 1AFSA 3BQ5A 3MSDA 1UBPC 5JBFA 2ZA1A 1PX3A 8TIMA 4FX7A 5ABGA 1YBQB 2WXDM 2FVLA 4CQDA 1U83A 1M01A 3GHSA 2DUZA 4FHAA 1SFTA 4C5YA 3QGKC 3A21A 4X9SA 1TVLA 1JZ7A 5GJMA 4NX0A 5HMEA 1Q7MA 1WKEA 1XM3A 2XIOA 3FA4A 1PWMA 3KX6A 1BRLA 1PZ0A 2WK2A 3I6RA 2ICSA 1UMYA 3CB3A 3U7BA 4AVOA 4IGSA 1CLKA 1W3JA 2A1YA 4RDWA 1D3GA 2G0WA 2HEJA 1E9YB 1TWSA 2XIIA 3EWUA 3AHZA 4O10A 2F8QA 1Q45A 1XLKA 3T08A 2VUYA 4LCRA 3GUGA 3N25A 3S3GA 5C55A 1HKVA 1E4MM 5D37A 4WX2A 3ALFA 4TMCA 4KFOA 1XIDA 5G5IA 5LNWA 4GQQA 5CXPA 3TTSA 1CZ1A 4FXSA 5G1TA 2CXGA 2DVUA 4JTAA 2AAMA 3ONCA 1X7IA 1A3XA 4JEQA 4I5UA 2PUZA 1C8QA 2GJLA 3GTHA 5A8QA 2HVOA 3PF3A 4XTDA 4PYSA 2NQJA 4US6A 3IGSA 2HMCA 1MW2A 1NWTA 5XIMA 1QMLA 3M5XA 4Q8PA 1TV7A 1XLBA 2VOTA 1TPDA 3MHGA 5D05A 4TQTA 3STGA 3UXAA 2P88A 2OYMA 1V0NA 4MHBA 3TW7A 4HSHA 3VKKA 4H8HA 2QDHA 1CW2A 4N6FA 3ITCA 1ELSA 3TN5A 1QASA 2BOEX 2A7NA 2PEVA 1C29A 2PDCA 2WSKA 3W1NA 3DFOA 3UETA 3V1PA 4WKAA 2YCLA 4IIGA 1E1EA 4BI5A 2INFA 4W89A 4YCOA 3MO4A 4TV5A 4UTTC 2X2GA 4E3VA 1HKMA 3VNIA 1E3ZA 1I45A 2W67A 3A4XA 5LA1A 5FCZA 5FF4A 1UWQA 4YIWA 2DZTA 2NX1A 4IG2B 1SJDA 4RE0A 2A4AA 2QEZA 3I3BA 1QXLA 2F2HA 4AQLA 3KAOA 1QI3A 1AD4A 1RQBA 3PM6A 3L4UA 1B3WA 5FA5A 2PCEA 4CVUA 1SO3A 1BVWA 3TE9A 5DMYA 3ARZA 3M0MA 3B0PA 1HUVA 4RDYA 2HS8A 4V2XA 4DJFC 4IP7A 4WOQA 2X30A 2ZZ4A 4S23A 3W84A 1DQXA 4WDUA 2GK1A 2EG7A 3HPSA 3W82A 1MXSA 3WDHA 3PJWA 4X0VA 2NUYA 3I3DA 2PBOA 5LKYA 3ITOA 3L9CA 4Z2GA 4GI6A 1WZLA 3PANA 3VOCA 2VC5A 1UR2A 3T09A 2EKCA 4IQLA 3Q45A 3GTIA 2X40A 1UWRA 3DC8A 3PP7A 2PTZA 4GJJA 2FGLA 4X0NA 4MPQA 5E6ZA 5FJIA 2BSLA 2ZZ1A 3VIJA 3GDMA 4C6NA 3AYVA 5DRCA 3W7KA 2Q09A 4OUEA 3NFUA 3VYLA 3PPHA 1I1WA 1EDTA 1UMLA 1Q6FA 2JEPA 3M0KA 4K8GA 1PUDA 2YCEA 3PULA 3AXIA 2YL6A 1RAKA 3QYQA 4AWEA 4PMQA 3VDCA 5AOUA 1I9CB 4GHRA 4I6KA 3DFSA 4L61A 4IPJA 1F6PA 2A3BA 3CAQA 2ZZ5A 4M5PA 1RR2A 5DCEA 1EJUC 2OELA 4LC6A 4CNOA 4XKMA 1KM5A 1G67A 5AYXA 3M0XA 1CCWB 4PMRA 5A6SA 1LORA 3W25A 4J7RA 3SECA 4S2BA 5FSDC 3WLRA 4Y8EA 1MI3A 4G9PA 3RCNA 3W7RA 1W9DM 1FTXA 3RR4A 3UG3A 3ZT7A 3MA8A 3GBEA 1BF6A 5AYYA 1D8WA 1VEOA 2HTMA 2XZ7A 5CZJA 4R53A 1J12A 1R38A 3STCA 3B40A 1G0CA 1P1MA 1HL8A 2CKRA 3GK0A 3LHUA 3ZO9A 1EFZA 3HJZA 5JH1A 4JIRA 2OWCA 1OZMA 2P76A 1UR8A 3OQ8A 4GYKA 4A05A 2AQOA 4G8TA 3JUGA 4NAFA 1SM9A 4C6EA 1IEVA 2OR2A 3VM5A 4EXBA 3VIOA 1GKRA 2CHRA 4DBSA 1IEWA 1LRTA 2OZTA 3R94A 1E6QM 4IIHA 1YTEA 1CBGA 3FYOA 1EC8A 2VJXA 4WJ8A 3HG5A 4Q8VA 4IMCA 4XD3A 1XISA 2QZRA 4ADSA 5LNUA 3O6AA 3W7LA 4NNCA 4R7OA 4V1YA 3H12A 1SFSA 3JR2A 2DORA 4FXJA 1X1NA 2VDGA 1H7PA 2CLFA 4IPPA 1WKYA 2ZTKA 1FY6A 1PWLA 2EG6A 3B97A 3V5CA 3WZ0E 3U8GA 1F6YA 3PSVA 1XH1A 2HDJA 4CNUA 4MYXA 4CN1A 2WMGA 2ZZ7A 3IWPA 3TWBA 4N2YA 3GXPA 1UJPA 2BY1A 1QPNA 1KC7A 1GHSA 4DYEA 2FDSA 3RJYA 1P0DA 1R2TA 3SQSA 4PB5A 3N9KA 2GVYA 5HK4A 3WLJA 3IVUA 2TODA 4R7JA 3TJLA 1KXQA 1YTKA 2NVCA 3PFRA 4IJBA 2XGBA 3UWVA 3AS0A 4TTGA 4HVXA 2QT3A 3WBXA 1ECEA 5EB8A 4X22A 3Q94A 2OO0A 2I56A 2QAPA 3P0WA 2Y7FA 3L2LA 4P5UA 3W2MA 5I07A 3AROA 4Z0SA 1J0ZA 2E09A 3WQDA 1E0XA 3KDNA 3S83A 4HMEA 4TUFA 3EA2A 4XZ9A 3AXMA 4KQNA 4PUUA 1LL6A 4K2SA 3CUIA 3U0HA 4NF7A 4LJ3A 2ATMA 2P1FA 1OGSA 1ME8A 4LANA 2CLEA 6ALDA 3E0LA 4W84A 2E1DA 2HE5A 1JF5A 1V08A 5LYRA 4AY8A 4M24A 2YA2A 3DAQA 4UTKA 3UT0A 3C8NA 4O50A 3G1SA 3PZUA 4DLFA 4HIBA 4QX4A 2QDGA 4PUMA 4Q4OA 5BYWA 1V77A 3BLLA 4FNTA 2P53A 2VDHA 9XIMA 1QHPA 3TYBA 1Z69A 3MUZ1 3VMOA 1KFBA 2AQWA 4LX4A 2VVNA 2ISFA 4QNEA 3GYEA 1SO4A 3UXKA 1C91A 4H3DA 4HZ7A 4DI9A 3RFAA 3N4EA 2VFGA 2BODX 1E4LA 2BBFA 5ECVA 5EU9A 3W1TA 1OYBA 3M0HA 3MWAA 2WJFA 5BXTA 1V6TA 2HV5A 3UCDA 2WNZA 4M0XA 1WV2A 2WWCA 1MZHA 4MFEA 4MADA 2Z4GA 4RZ5A 5BRPA 1OHLA 1L6YA 1X98A 3O6CA 4UTMA 2I5GA 1QOXA 4UR8A 3W76A 4XZWA 3O15A 4LB4A 3II1A 3EWBX 3CWOX 1RD5A 5DMMA 3W24A 2J62A 5LNSA 3DI0A 3T05A 3E2VA 4RX0A 2FLIA 1RHCA 1X96A 4LQ1A 3OU8A 4ATWA 4KEZA 4ZXLA 1QUMA 4IGNA 2YW3A 1JDCA 3W0KA 3FLUA 3DDMA 4EXAA 4GQRA 2WANA 1Z8AA 3BAKA 3OLIA 4H2HA 4RCXA 3VNZA 1BSIA 2G3JA 1HX0A 3CPUA 3MHUA 1K9EA 1PZ2A 3CMJA 3G6MA 3HO8A 3ONBA 3RM9A 3O6YX 2G50A 4M29A 3QVQA 5CJNA 4PSPA 1E0TA 2XM1A 2OYKA 3LG3A 1YBQA 1WE5A 2VCCA 4P8VA 4UTFA 2C6QA 4D9PA 2TSYA 3MZ2A 2EF9A 1E71M 4J2PA 3WD2A 3BVJA 1XLMA 4ZENA 2REQA 1S46A 4B5NA 3VVGA 1E73M 1V3JA 1L6SA 4UFKA 3HV8A 3USBA 3VA8A 1TQXA 2F6UA 5BNKA 2IXVA 2YA0A 1J5TA 1LTDA 5HANA 4DLMA 2Z29A 1R0MA 3PBMA 1A80A 4LS2A 1LZOA 1F3TA 1NDVA 1O5RA 3UF9A 3IANA 3L4YA 2RGLA 5D2WA 5FJJA 4UTLA 1NOFA 4CEXC 4WDTA 1E15A 5B7YA 2I9EA 4YHGA 3NQFA 5HNTA 1VEPA 2UBPC 4UXDA 5H1WA 2OEJA 2PD9A 1VLWA 5IBXC 1B3XA 1ALDA 2G41A 3WD1A 5C2XA 2KZHA 3WF4A 1A49A 5LXEA 1OIFA 2ACUA 2HE8A 1XFBA 1C3FA 3W2LA 1XDJA 3VIFA 4PSRA 4L9ZA 3ZR4A 2RDWA 3C5QA 4ERAA 1FDZA 1XQKA 2NXGA 2GVEA 4OECA 2DZVA 1J0KA 4WLCA 2G97A 3V16A 4FNRA 3M64A 1WKFA 2BXVA 2PU1A 1XG4A 1Z48A 1ZJAA 1OG0A 2VFEA 2V5DA 1UIOA 3ORWA 1XIIA 2Y7GA 1PCKA 1FWNA 2VUNA 4L4LA 1H5YA 4FR6A 2BHYA 2CZEA 4OHQA 5A6MA 3LMZA 4QLJA 4PBFA 1Q5MA 4W5UA 5AFDA 1D2KA 4LB3A 3WJYA 1D3CA 4WRHA 1GYMA 3B9EA 3PSWA 4V15A 1XYCA 2E1WA 4IMDA 4MWAE 3P93A 3HJEA 5LIKX 1R3TA 2EJ1A 1VFUA 2C0AA 1UR3M 3TYDA 2D69A 1TRDA 4O18A 1OF6A 4NI8A 2J8FA 2D2OA 4WSKA 4RNHA 1PIFA 3SCQA 4GA8A 3WQCA 3H24A 3BJTA 2J75A 1XBXA 1NSJA 5FEPA 5I78A 1V3IA 2BVTA 2ONEA 5K9XA 4GUHA 3VKAA 2BX7A 1W5NA 5KZDA 2ZTJA 4R5EA 3HBLA 4HNTA 2VFIA 4HCLA 2OVLA 3UZXA 4ZOEA 1XLDA 1KFKA 2J79A 3W9ZA 1VHNA 4FK9A 2YL5A 5CGQA 4HKPA 3NL5A 2WYSA 4I7VA 4MZYA 1JD9A 3CL6A 3T8QA 4C7FA 4TVCA 1YDVA 3FSUA 3FCPA 3UWUA 4PA8A 2TYSA 4PMUA 2VGFA 4W85A 2XUCA 3WQWA 1I6NA 3LYEA 4AZBA 1TVNA 1QTWA 3WBWA 4LF1A 3QR3A 1GYLA 3LLDA 3VOJA 1FWAC 1DOSA 2PI6A 3KE0A 8XIMA 2QCLA 3AIQA 2YXOA 3PTMA 4XO6A 2X41A 5DFAA 4HZ8A 1Q65A 1XD0A 3TFXA 1R2SA 1KM2A 2J7GA 2GQAA 1EJ7L 3KS6A 1VBGA 4JQ4A 1CXIA 1EDGA 4HA4A 4PUEA 1HVQA 1PKYA 3IIZA 1JCXA 3K4DA 3GVRA 3D5HA 1KQYA 2OLHA 1QNPA 4KEUA 1ZPTA 3URBA 4ZO6A 4JTUA 3OQEA 2HPMA 1QVBA 2GJNA 1KXTA 3ZOAA 2JALA 3RM4A 1UWTA 3N2MA 3T81A 5A6JA 1A5SA 1FWEC 1ZLPA 3W7PA 1M6JA 4YVPA 2FZDA 3A5VA 4PTXA 2GUYA 2OT1A 2FJKA 3KVMA 4Y96A 1JYWA 1LF1A 4JX6A 4OQVA 4Q33A 1EGMA 3IJ9A 3JS3A 1WAWA 5BMWA 4E38A 1W37A 5T9BG 1B30A 2C1GA 3PJTA 1JYNA 2YL8A 3U5UA 2C7FA 3VC5A 1OX4B 1TPUA 1OFDA 2V68A 4KCWA 3SY8A 3OG2A 3GRIA 4JEJA 4B90A 1VC4A 1Q6LA 3UA3A 1DIOA 5AHEA 2BY0A 1KRMA 1S5TA 2XH2A 3TSBA 4JTTA 2VQTA 3AIWA 3LK6A 5CPTA 4C6DA 1GOMA 4UOZA 4JN8A 2XIQA 3W3OA 4JNYA 5E6YA 3B8DA 4QIUA 3ANUA 3MKCA 4N9BA 4YTSA 2X0HA 4R27A 2A5HA 3FYPA 1KKOA 3DZ1A 3BG3A 4LXFA 1W9PA 5JUVA 2X0YA 3W22A 1AW1A 3FY1A 1JI1A 1ME9A 4WY0B 3W1AA 2DUAA 4J9JA 3H22A 1CLXA 4I9JA 2A3EA 1GVOA 3LPGA 3BCJA 2X2YA 4LUTB 1C7TA 2P3EA 4O0ZA 4IF2A 1OFOA 3NQBA 5A6BA 5HNRA 1E6RA 2XVPA 4QNWA 3BICA 1NP0A 3RLUA 1GW1A 4B16A 2FTPA 5D8WA 4EK7A 2WAGA 5KINA 1XH2A 4GZIA 2D20A 2ZUUA 3WQFA 1DJIA 1MXDA 3QSRA 4V1XA 4H83A 3SJ3A 4RDZA 5D32A 4UQDA 3UWWA 3TQVA 2F6KA 3UCCA 5I3IA 2XIJA 1SSDA 5ENLA 2ZC1A 1UWIA 2C71A 4GVIA 2YSWA 3M0LA 1GNXA 1EJRC 4K3ZA 4H8NA 1GW9A 2J7HA 1ZGDA 4QJ3B 5I3HA 4S3CA 3TMLA 3MP3A 5AC4A 3W1LA 1EPXA 4NXSA 4JKKA 2BVWA 2J9YA 1EC9A 2ALDA 2VXNA 4XVEA 4NZCA 4GYFA 3AS3A 4O4VA 2BDQA 1I0DA 1UUOA 2WZEA 3WQ6A 4BEQA 5I3FA 2F38A 4P7RA 4RW3A 5D33A 2V30A 6TIMA 2FZMA 2GQ8A 4HQVA 5I02A 3K46A 2E7FA 3THAA 1B4EA 4DUXA 1UKSA 4O1CA 5I0DA 1OJXA 4LF2A 3M5VA 1O95A 3ATYA 2YXXA 3GNPA 2LLEA 3N2OA 1C93A 4KBXA 1G9HA 5IRPA 3NWRA 2ON3A 4MSSA 1DWIM 4GISA 2PWUA 4LAKA 2QUNA 1V7AA 4Y9NA 3AALA 4J3ZA 1KM3A 1RQHA 3CUZA 4R9XA 1OCNA 2BNJA 2QYGA 4CQ8A 2PDYA 3WNNA 1CXFA 1U1HA 2WW5A 1VYPX 1TIWA 3C0SA 4DJDC 2D2HA 1ZCOA 3KBSA 4D6JA 4GABA 5AYIA 2GDVA 3U9IA 5AYBA 1EJTC 5FF2A 3QZEA 1JCTA 2FQIA 1GVFA 4B92A 4OZOA 3TWAA 2CHNA 4J5NA 2EKGA 1WBJA 1T6MA 1TCDA 4L4MA 3QTGA 2GPTA 4MUZA 3TZNA 5F4WA 1RPKA 4UBPC 3GIYA 1RCOB 4M7SA 4O53A 1KBLA 1GPWA 3GD6A 4FP1A 4US5A 5I00A 1GWJA 2ZX8A 1FHUA 4L56A 4ZQPA 2ZVIA 1IWAA 3H70A 3DHFA 3CEPA 1J2WA 1JPMA 2V2HA 3ZWTA 3HV9A 2ODOA 2DT2A 4C6CA 1FCUA 1KO0A 4FNUA 1SZGA 3HF3A 4YTQA 1VH7A 2VURA 1OINA 4YYFA 2INEA 3T40A 1HZYA 5K9DA 2BOGX 3SADA 2E9LA 1DJGA 3FHQA 2XYLA 3DN5A 3LPOA 4O0QA 4JKMA 3L23A 1XWYA 1UROA 1XIJA 3GH5A 3H53A 2HXTA 8CGTA 4Y8FA 1CWYA 2IKHA 1W5OA 4Z2JA 3NVDA 3WH8A 1EEXA 1KRBC 1OX5A 3S2NA 3KBWA 4LTSA 2GGGA 3A9IA 5I2UA 2Z6JA 2VGBA 1NWSA 2VEPA 3W71A 3DKLA 3VNMA 1JIBA 4NJHA 2RGMA 2VEIA 3LPFA 4A3QA 4PTNA 2CWNA 4IIBA 4OKDA 5T91A 3EDEA 1W1YA 3Q58A 1YLVA 4LNYA 3M0VA 1YQ2A 2X1TA 4WGXA 3P61A 4LY8A 2X05A 2ZE0A 4JYEA 1BWKA 1UR0A 1OFBA 4O4WA 1AQFA 1W3KA 2C14A 1H3GA 2GVJA 2ZXAA 3UZYA 5CZTA 3AZSA 3AHTA 2Z24A 3PTDA 2OKTA 2DU2A 4LOCA 4R88A 1A47A 3PWIA 4BR1A 5AZ0A 1E6ZA 1S5NA 1E9IA 1E1FA 3GR4A 5D38A 4H2CA 2I14A 3KDOA 3EPOA 3UJSA 4KWOA 3VUSA 1DTNA 1E72M 2Z0IA 3GWQA 2DQWA 1R2RA 2OOGA 1BVZA 3CH9A 4GMEA 1XHGA 2ZUVA 2Z6IA 3SEPA 2PMQA 1OT1A 1B9BA 3UZZA 2FZBA 4JIQA 3ITGA 3U4AA 1F3EA 2VP8A 2FH8A 3BANA 1QNSA 2X1RA 2WJDA 2WKGA 3BG5A 1BLIA 1W1VA 4GI4A 2J78A 3TC6A 3VX0A 3W02A 1ZP4A 2O9TA 2OXNA 2NVAA 4LUSA 3BOLA 1M7PA 1CB2A 1OX4A 3DH7A 2VR5A 4QDWA 4RZ4A 2VOMA 1EIBA 1A5LC 3OVQA 4OIFA 3U48A 3KVJA 2Q01A 3HQNA 2A7PA 3RRAA 6XIMA 4NY2A 2D0FA 3MCOA 4DO7A 3Q4DA 1LCOA 2OB3A 2OWWA 3W85A 5ABFA 3QN3A 1IXNA 2ZYFA 3AC0A 3ENLA 4BS0A 1E5NA 1DV7A 4JQAA 4UFMA 1MNSA 4QG9A 2ZFAA 3W70A 3VKCA 2OU4A 2FPTA 3TA9A 2QCMA 1BKHA 1B3OA 3DFQA 4NJKA 3RPTA 2UY5A 1UD8A 2ACQA 3NR0A 4F9DA 1TTJA 4HTBA 5I24A 1KM6A 4AHOA 1F73A 1ZU8A 1Z89A 2D73A 3WK0A 5AHNA 3NYZA 2PS2A 3H4WA 1E0UA 1FCBA 4BY3A 3DBPA 4NZJA 4JIPA 4U2ZA 1M65A 4GNKB 3EA3A 5C5YA 4PMVA 3SIZA 3S6DA 1B54A 3GDRA 2EXOA 1H51A 3G8RA 2O0TA 1F05A 2IPFA 5C54A 4EPKA 5EKYA 3ABXA 4JHMA 3V0UA 1PV8A 4LYPA 1J0YA 3O6DA 1E4IA 3CHDA 1GT8A 3K30A 3N12A 1MRQA 3WKZA 2XN1A 3S2CA 3CUHA 2OLSA 3HM7A 4QQ3A 5CPNA 1YXDA 2G4JA 5H91A 3UJFA 3R4IA 3KL0A 1CECA 4B3LA 5PTDA 5EYWA 5CPOA 4L64A 2P0IA 5IFTA 2X1UA 3VIMA 4BEUA 4KKXA 1Q2SA 4P7LA 2VZSA 4AHPA 2RUSA 1OYAA 4ZOCA 2O4QA 2YDRA 3MP5A 2GSJA 5JBEA 1FBAA 1P4CA 3EEZA 5H2ZA 3AUJA 3JU2A 2DQXA 1JDDA 2WHKA 5IFPA 1W17A 4HN8A 4UMAA 1O4UA 3C2EA 4E2OA 3KBJA 3M0IA 4W93A 1ITUA 2VGGA 3K13A 2UV8G 3CL7A 4W9TA 3FYYA 2CPUA 1GUVA 1YRRA 5H8PA 1PX8A 1XR2A 5CC3A 2FMOA 5E9XA 4XBKA 3A24A 1CEOA 4PGLA 2BY3A 2EO7A 1XX1A 4XAPA 1H11A 3U5YA 1JEZA 3SSZA 2PGRA 3U2CA 4GZJA 2DT3A 3GXIA 3I6TA 4Q7BA 1JCJA 3AWNA 4LW7A 1UCWA 4GO9A 1FH7A 3VUPA 3R10A 1DHPA 1W8GA 2V63A 5FAGA 2FJUB 2J8GA 4ZO7A 1BQGA 4HPGA 1UUMA 3NL2A 2E67A 3VC6A 4O1FA 1QW8A 4TV6A 2Y0FA 1WYIA 1PTDA 4JOMA 3EA1A 3N18A 3RIKA 4AIUA 3W6YA 3B9DA 4XZLX 4GOAA 1MUMA 4P61A 3GZAA 3P74A 1FHVA 3V35A 2J7EA 2AL2B 2PDUA 3C52A 3ICJA 3PR2A 4XSLA 4GY1A 2PF8A 4AY1A 4MPKA 4PRWA 1TX2A 4PEEA 3QF0A 4W87A 2OPJA 1B9ZA 3TAKA 4H04A 1OYCA 1ZALA 2PZ0A 3QPZA 1US2A 1OFRA 2I9UA 3C3UA 2WHMA 3MBFA 3VNLA 3KRUA 3IPWA 3GR7A 2JFEX 4RNIA 5FACA 2WC3A 3IVSA 4X3ZA 3IV3A 1HN1A 3LB0A 1LL7A 2DZPA 5FJRA 4S1FA 5HBFA 3D0CA 3WQ5A 1OFQA 3LD5A 3R0UA 4MVAA 2YZRA 1J5SA 1G7VA 1ML1A 3QW4B 1NJJA 1FOBA 3CYJA 1W56A 5KTLA 2V9DA 3QEZA 3CUXA 3IJ7A 2VNCA 1EIXA 3APTA 1TQJA 1JXJA 3G18A 4ZCWA 4DZHA 4U31A 4CLMA 1SMAA 2XSBA 3U3HA 1OFPA 3FNDA 4ZTYA 1EO7A 1P7TA 5DBUA 1CTNA 2XH7A 4TOQA 4GUGA 2FVMA 3RAOA 3ZJ6A 3TC7A 1EHNA 1ZBCA 3GQYA 3WLIA 1IWPA 1NARA 2P8BA 2A7RA 4QITA 4QG8A 1BEUA 1QT1A 1G4TA 3LGGA 2XGIA 1RLCL 1I4NA 5TNVA 1B31A 5ABEA 5A8GA 5IOBA 2VENA 1M41A 4EIVA 2AMGA 2QDEA 1E1CA 1HO1A 4U28A 3CMFA 1EGVA 4H7CA 4C6QA 1QI5A 1VF8A 4FNQA 5I79A 2XN2A 1KTNA 3LNMA 1Z9AA 2ZXDA 2BS9A 5D4YA 5FJTA 4C7GA 4K7VA 4S3BA 4YYCA 3CTLA 4NI3A 3QQ1A 1TA3B 3WD3A 3AWOA 4MWAB 5LIWX 1VFFA 4F9JA 1J01A 3FDKA 1V02E 1M03A 1G01A 1TO3A 3IARA 4EPEC 1FVPA 4BQ2A 5CAKA 1K3UA 4DF0A 5DANA 1XIMA 3IUDA 3VINA 5JXQA 1LROA 1DBTA 3M16A 3PY2A 1JRCA 1MNZA 2AKMA 4X2RA 4Q8NA 4XKYB 5IM51 1VYSX 3ITTA 1EF2A 1K9FA 4IL0A 1Q85A 1V6XA 5K4XA 4A35A 4KWWA 1QOQA 1J18A 4NP7A 4TR9A 4REQA 3M9YA 3CLWA 1HXJA 3FDGA 3PAOA 4LPCA 3WLHA 5C2CA 3M6DA 4M80A 4YN5A 3NIYA 3KVKA 3CIVA 1RALA 2DH3A 4NJGA 3W74A 3M7SA 4J40A 4JTLA 4AWUA 1BPLB 2R1KA 4C6KA 5A2BA 3GNXA 5LIXX 4JTSA 3UVAA 3EOEA 1T41A 3LS9A 4AVFA 4U4MA 3PUOA 1JNDA 2PRHA 3VK5A 3TR9A 3CUFA 3MUXA 4GIEA 1FP9A 4DBUA 3WFAA 2V69A 4KW2A 3KBNA 3KOWA 1MUCA 3LCIA 3UY8A 4MNJA 2E4TA 4L6OA 3E38A 4MG4A 1BYAA 1NVMA 2Y24A 4NZ5A 2O9RA 4YU1A 3IUIA 3ARVA 1V03A 3GG0A 1TR1A 1WXJA 2QCHA 1NM9A 3ABOA 3TN3A 3GH7A 3W26A 3AIVA 2V5CA 5CC6A 4CCDA 4E8DA 5F1VA 4MOZA 1CGTA 1ZQ5A 1GVQA 5FJPA 4IJRA 1TX0A 4YVXA 3OVRA 1LG1A 2H8XA 3WO8A 3I10A 3IIOA 3NGJA 1ZBKA 3WQ4A 1T96A 2TMDA 5F2MA 4LEFA 3AU2A 5F4SA 3QV9A 3C2FA 2FKPA 2P8CA 2B31A 5KZEA 3W1XA 1UB3A 3WUBA 3LHZA 4LAUA 5RUBA 1EZ2A 1JGIA 3O05A 2H9AA 3TYCA 4AG0A 4MNKA 3LMYA 2QVNA 4MAVA 4GZ7A 2PC8A 4UFLA 3TSMA 1CDGA 4CN4A 3KW3A 2VO5A 1AQMA 4A3RA 4C1KA 2WKLA 3W29A 1XW8A 5C2GA 2C16A 1UKPA 5C0QA 3OB8A 4HK7A 1GG0A 1EX1A 1QHZA 1A4LA 4H9VA 4D1IA 1CYGA 1UA7A 3CV1A 3CPGA 2Z2AA 1S3TC 3SCWA 1AW2A 3G24A 1BVNP 1Z7AA 2E8ZA 1XF0A 4ZE4A 1DWGM 3GSMA 1IR2A 2DSWA 1EYEA 2NX9A 1C8VA 2QNEA 2QJGA 4CUCA 2WC4A 2PZNA 2O92A 5HUOA 1LT8A 3R0DA 2PRMA 3EKGA 2VGIA 3WLNA 1BXNA 3RGTA 3I4EA 3UVIA 1PS9A 2J25A 2UY4A 2FPVA 5CG7A 3W07A 3N15A 3GIPA 2H9AB 4JTGA 4XQ6A 3WDPP 3KZSA 3A9BA 3FEQA 1XGZA 2WSQA 4QDPA 3GTFA 3SO7A 3AIBA 4H8UA 4JTEA 4TX6A 3L4XA 1ESWA 3UXDA 2G96A 3TYZA 3S1VA 1H7RA 5DQPA 4ZE5A 4IT1A 4PCFA 2V5KA 4C1NB 3NSXA 4GJ1A 2NLYA 3GYCA 4WDXA 4KWSA 1W6TA 3C2OA 3W73A 5BOOA 5I09A 4HD5A 4CCCA 1JPDX 4PCNA 2GK1B 3EDDA 3HB9A 5D04C 4PUJA 1Z6KA 4LCQA 3VIIA 1VFSA 2NUXA 1FWGC 4MLRA 3SRHA 3OEXA 1V6UA 3ZLHA 3BOFA 3GFZA 3O07A 4IFRA 4BQ5A 1SUXA 2YYUA 3HGSA 4IWWA 1H7WA 1B4KA 2BVDA 3LTYA 1EKOA 1N8WA 2QHAA 4NRRA 1A5CA 4MFDA 4XUYA 3GKAA 1U22A 4JBRA 2BWGA 1TWIA 3TYUA 2B7PA 3OLDA 2GJXB 3FGCA 3ZIZA 2H6RA 3I7RA 1DTUA 4L6DA 2Y7DA 4MZ8A 4RJEA 1SJCA 1NP2A 2NT0A 4JQ1A 2VC9A 3SJNA 2IS7A 2JBMA 2QGYA 2VZVA 1TE1A 3MMUA 3S2JA 5EA9A 5LSMA 3WK1A 4WXYA 3AS2A 2NXIA 2PWGA 2CZVA 2RDXA 5TIMA 4B2DA 1S5VA 4F0LA 1GG1A 1XLGA 2CLMA 2YA1A 4LVBA 4C6JA 4N42A 3W72A 4GYJA 1S5MA 5E93A 2CZDA 3SIMA 4Q7NA 3KFTA 2Y88A 5G1YA 3GDBA 4NYYA 1FWJC 3EDJA 3A22A 4BZYA 2IW0A 2Z27A 5E9AA 3PPFA 5HXMA 1GQKA 1MVYA 3U2OA 1R3WA 1EP2A 1DIKA 1LG2A 3NO1A 3PNUA 4AH7A 4GNVA 1YKWA 1VLIA 4MKVA 1PL9A 4MIMA 4DPPA 3NEVA 4MZ1A 3B8TA 5FF3A 3BC9A 1FXPA 2OX1A 1XD1A 2NWSA 3N3MA 3K2GA 1DJQA 3ARYA 3L2IA 2YCLB 2Y8VA 5G4HC 2VZOA 1OABA 1BHGA 4S2CA 1VKFA 3EMZA 3KOZA 5CSRA 4OBSA 1UH2A 3TP4A 4HA3A 1POJA 1JDAA 3DX5A 5BCAA 1ONXA 1MSSA 4PUWA 5M3WA 4ORMA 3QHMA 3BLDA 1MQQA 4KMQA 4MLJA 4S3AA 5FL1A 4JNMA 1F3XA 4ZMGA 5F2GA 3AIUA 1AODA 1GEQA 2PE4A 3REQB 2X7VA 3G1VA 4YCPA 3KTCA 1W5PA 2H8ZA 3JW7A 1OWQA 3AXKA 3F2BA 5FEXA 2TPSA 1I1XA 3EWCA 4ZODA 1Q6QA 4HMNA 8RUCA 5E0CA 2GGEA 1K1DA 1D7KA 1Y5VA 2ZCGA 4IMGA 3G77A 3AZRA 3MW7A 4HJWA 4GYPA 4JTCA 3DESA 1S2TA 3TAOA 2IQDA 4Y9PA 2UY2A 3R12A 3T7VA 3C0QA 1KCKA 1J96A 3BOXA 4LV9A 1VPQA 1AQHA 2V81A 3OBEA 3AXHA 3FHAA 2V5LA 3OA5A 3CZ8A 1VR6A 2R91A 1CGVA 1BQCA 4ZFCA 1QPQA 3KUMA 3PWGA 3WF2A 4XZBA 4XAFA 3S5YA 3JZUA 3WBEA 4K6AA 7XIMA 1ZJIA 5F2LA 1EQCA 1V6YA 1YE4A 2YIHA 1JG9A 4GACA 4D72A 4O17A 3O7UA 3LGEA 1FA2A 3KL5A 2E6AA 3N1AA 3QHNA 1W5MA 3R89A 3S6OA 4FSAA 2YDQA 2YZ5A 1H62A 1Q6EA 3BH4A 1X1ZA 2DPEA 4E6MA 3FV9A 1JDFA 2OSYA 3LM7A 1HKWA 4H6KA 1C8XA 1O94A 1OF8A 4KERA 2GQ3A 4MNMA 4XZHA 4JZ5A 3C2RA 4RZ6A 1JGMA 4C65A 3EMCA 4M8UA 3LBMA 1F07A 1IT7A 4TMBA 2ZDRA 2Y70A 2WBGA 1AG1O 2IUZA 3HTWA 1JAKA 2V3FA 4R34A 2WLZA 1SO5A 5K7JA 2V3GA 1TREA 3AIRA 1NTHA 1QWKA 3ARRA 4B5SA 2IKIA 5FIPA 3H21A 4WY0A 2R6OA 3SR7A 3IIVA 3WDIA 4RV3A 4YMZA 4EVZA 4GBDA 3VZXA 2I17A 4HU0A 1X8FA 4EWND 1AUSL 1JCYA 2WZTA 3F03K 1T99A 3VGEA 1HP4A 3CO4A 2X8RA 1ICPA 2OEMA 5KSWA 4D6EA 3HFTA 3NDOA 1YDOA 3NUKA 4F66A 2BVYA 1KWGA 3PHAA 2VKZG 3MYOA 1YDNA 3NG3A 3W6LA 3WH9A 3BGAA 1GQIA 5HAOA 1KGUA 3PN8A 2CEQA 2ALRA 4FPSA 2DIJA 4CCZA 2I1OA 1EHAA 3WJZA 3VMPA 1VP5A 2WVTA 1Y5XA 5AVHA 3E5PA 5AC5A 1B5TA 2J7CA 4JTQA 4PBEA 3F5KA 5J5DA 4Z1BA 5AYZA 4IXHA 4DM1A 1UD3A 3O8AA 3NZQA 2CETA 1NDWA 4L4PA 1AJ0A 1BFNA 3LCGA 2Y5EA 4PUNA 2QUMA 2CERA 3WLSA 4WGHA 4CN6A 5REQB 3N2BA 3E3HA 3FIGA 2CZFA 5JMUA 3E2SA 1B0IA 2R1NA 3SZ8A 5U4NA 3FAWA 1P1XA 1SR0A 1IT8A 1UG6A 4KT2A 2NQ5A 2AQVA 4GFIA 2OX4A 4OFCA 2EHHA 4H00A 3CIWA 2G8ZA 5CG0A 2QDDA 2NWRA 3N9RA 8XIAA 1XIHA 4UNKA 2BZNA 1WDPA 2WHLA 1F8MA 1L6WA 3CL8A 5JVLA 1EP1A 3SCUA 1PAMA 1DQWA 1HO4A 3BUVA 4QCFA 1ONWA 1FFRA 1V0LA 3VXGA 3QGAC 2D3LA 4NJJA 2FTYA 3INPA 1OC7A 4D6DA 4G1KA 4MAZA 3IJ8A 1BAGA 4HZMA 4HOXA 2QJNA 3S2LA 4XIAA 4HNNA 2G3FA 5DY2A 1RZMA 4JL2A 4P8UA 3TR2A 1PB0A 1QR7A 2ZA2A 3PPCA 4M19A 3IACA 5HMSA 3NQMA 2PURA 3IK4A 3ZT5A 1BSLA 2R1LA 3DGRA 5HINA 4H1ZA 3MCNA 5LA0A 3AXXA 1K02A 3PZNA 1TE6A 2INZA 1A0EA 3R8GA 3EWZA 4O11A 2J27A 3LV6A 3M5ZA 1RCXB 2ISDA 2V6AA 4LAZA 3GH4A 3ABQA 2Q3OA 3A47A 3UJRA 3QV8A 5EMMA 4PTDA 3KVLA 3T42A 2YB1A 1KTBA 4C6PA 4ZR8A 1JCLA 1EUAA 1MW1A 4PZVA 5M03A 3URAA 3W83A 4EOUA 3ZFHA 3PBYA 5AY7A 3W38A 5BU9A 4MWAD 5H6HA 3B8WA 3AHVA 4INFA 4CQBA 3G1XA 1GOQA 3R58A 4HN4A 4Z2IA 4MY8A 3UNTA 2EPHA 3WJXA 3WD4A 1AW5A 3CGTA 1XPYA 4W8AA 1WCGA 4HNVA 1UYQA 4Y9MA 4PL1A 3IK2A 2ZC8A 4EPBC 4CU6A 1K6WA 4AW7A 2Z7KA 1EUNA 3MHFA 4UB9A 2X1IA 1FWTA 3WD0A 2PDPA 1UOZA 1A53A 3THDA 4QEEA 1OZQA 1IEXA 2YX0A 2X09A 2RJGA 1SZRA 3XIMA 4IPNB 3AAMA 3DFPA 3UG5A 5AVNA 4G6CA 1PZ3A 3CQHA 1H49A 4K38A 2OWXA 2CESA 4GH3A 3A4WA 5AKQA 2I5QA 3MMTA 1RJPA 4US5D 3PTKA 1XFCA 3GW0A 4W88A 1GJPA 1R30A 3CWHA 1VAHA 2D23A 3L12A 3OW1A 1POKA 1CGUA 1LM1A 3ABSA 4OBTA 3AMKA 4IOTA 4AZ6A 4HSOA 3WLMA 2VR2A 5CSUA 2POZA 1VZWA 3OGRA 1XCXA 1ICSA 3VD3A 4KGLA 4WUIA 4ICCX 4AEFA 2Y8UA 1W9XA 3QOMA 3GY1A 2OQYA 2PFHA 4C1LA 3KRSA 4Q4KA 2C79A 3E1F1 3D6NA 1TPEA 4IFKB 2RDUA 3T44A 3ZMRA 5ABTA 3WK2A 2FZNA 4GPNA 1MMFA 4PE8A 1PTAA 3WLQA 1TZZA 3FK4A 3W2UA 1W1IE 3PVFA 3RJXA 3L0GA 4BHYA 2XVGA 1Q7QA 1MEWA 3SCTA 4E4PA 2PDLA 1XH0A 5DY3A 2YCIX 2PDGA 4HYVA 4MM1A 3LTSA 1R3QA 3CZLA 4MB4A 1Q6RA 1JUEA 1TZ7A 1GONA 3WQPA 1J6PA 4E3TA 2CXEA 3GVGA 5CJ5A 4JTIA 2XFRA 4GIYA 1J8VA 2Q6ZA 5D2XA 1CGYA 3GZ3A 2CCRA 5IHSA 3BAWA 2Z25A 1Q66A 2VRKA 3TSDA 4B91A 5AZ1A 3G1RA 3QYSA 3RU8X 3S1XA 1X6NA 3RCMA 3PZQA 4RV8A 4B5TA 3BAIA 3CZEA 4B9ZA 3C56A 1ADDA 1W31A 2PDNA 1HKJA 1XIFA 4CCEA 2XVLA 3A3HA 3G8EA 1K6AA 4G7FA 3A5FA 1E43A 2GDUA 4HPHA 4NU7A 5C71A 3ARXA 1SZNA 1GOWA 2V67A 2VC6A 4HTYA 1DXIA 1EEPA 1R3RA 3R25A 4NNAA 4EF9A 1W9BM 1B2YA 1LUCA 1O66A 4A8LA 1M7OA 3S5NA 3N6HA 1JZ2A 1TWZA 1YYAA 4JX4A 4RW5A 3W7CA 2QULA 3EEGA 1BTMA 4ACZA 4HU4A 1H7NA 1SVDA 1VFHA 3T4CA 1QO2A 3I6EA 1CGXA 1QNRA 3GTXA 1YW1A 4M6QA 4AWTA 1PVNA 4UTIA 2NSOA 2GJPA 1R87A 3SDOA 1JVNA 4IPIA 1B3VA 3IJ6A 2QV5A 4EX4A 4GXWA 2O9PA 4IPLA 3WLOA 1XBVA 3G0SA 3R6IA 3A3WA 1QK0A 2WZIA 3WFLA 3VPLA 3K5XA 2PLMA 3ZJ8A 1BG4A 1HGWA 4CNPA 3ERPA 3CU2A 3UPWA 3KLKA 3KL3A 3B4YA 3M5YA 3AJ7A 2DSVA 3LV5A 4NG3A 3T78A 2Z1XA 2A2IA 3UYCA 3U57A 3S4TA 1DE6A 2YFOA 1NAL1 3KCOA 1XXXA 1ICQA 4LWWA 1GK8A 4WEVX 4FZIA 3RR1A 2VD8A 4UZSA 1VPXA 3GXDA 3TH6A 7ODCA 5C8BB 3H26A 3W27A 3P81A 1A5OC 5EGRA 1UA3A 2A3CA 3G3DA 3IS4A 3ME3A 2HROA 3H8AA 3WYZA 2PSNA 5HWJA 4HPJA 3AMLA 3PJUA 4K7YA 1F2JA 3ARSA 4ZBCA 2BG5A 1JZ3A 3NZRA 1Q8JA 3BW2A 1ZFJA 1TWWA 2YB4A 4GO8A 3NGFA 3NYDA 4GY0A 1XYBA 4KRTA 4I9TA 2R8WA 3SI9A 3M7WA 1QPOA 1FRBA 3KLLA 5LIUX 1AH4A 2VEMA 2CBJA 5C9UA 3AIEA 5I06A 3LCWA 2VYOA 4LS1A 4UMCA 3PK7A 4ATDA 2PWDA 4RDVA 3T2QA 1UASA 1UOKA 3GNOA 4IH3A 4UTHA 4JL1A 3RK8A 1M7JA 4UUIA 4I9AA 3CV6A 1D9EA 1TTPA 4NQ1A 3OGSA 3GU9A 3CLMA 3SURA 4KRZA 2PA6A 3A13A 4ZQCA 1M53A 2VTFA 4DVOA 3HN3A 4QTGA 3H2MA 1NFBA 1DE5A 2FFIA 2NQZA 4Q8TA 5MKGA 3SN0A 5DBTA 4XISA 4K37A 1RBOB 4HA1A 4ZSUA 3T0TA 3W1MA 1DIEA 1LP6A 3LEPA 2G4FA 3FA3A