2JEPA

Native family 5 xyloglucanase from paenibacillus pabuli
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
363
structure length
363
Chain Sequence
ADASQIVSEMGAGWNLGNQLEAAVNGTPNETAWGNPTVTPELIKKVKAAGFKSIRIPVSYLNNIGSAPNYTINAAWLNRIQQVVDYAYNEGLYVIINIHGDGYNSVQGGWLLVNGGNQTAIKEKYKKVWQQIATKFSNYNDRLIFESMNEVFDGNYGNPNSAYYTNLNAYNQIFVDTVRQTGGNNNARWLLVPGWNTNIDYTVGNYGFTLPTDNYRSSAIPSSQKRIMISAHYYSPWDFAGEENGNITQWGATSTNPAKKSTWGQEDYLESQFKSMYDKFVTQGYPVVIGEFGSIDKTSYDSSNNVYRAAYAKAVTAKAKKYKMVPVYWDNGHNGQHGFALFNRSNNTVTQQNIINAIMQGMQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords XYLOGLUCANASE
publication title Characterization and Three-Dimensional Structures of Two Distinct Bacterial Xyloglucanases from Families Gh5 and Gh12.
pubmed doi rcsb
source organism Paenibacillus pabuli
molecule tags Hydrolase
total genus 144
structure length 363
sequence length 363
chains with identical sequence B
ec nomenclature ec 3.2.1.151: Xyloglucan-specific endo-beta-1,4-glucanase.
pdb deposition date 2007-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2jepA00
2J7DA 1QNOA 2WMFA 1XSKA 1HJSA 3BAXA 4CD5A 4GINA 1UQYA 2WC3A 4UQ9A 1NWTA 4P7LA 4U3AA 3O2LA 1UR0A 4U33A 4J3VA 3VPLA 1QI0A 2GVYA 1LG1A 5HXMA 1KCKA 5JIWA 1O6IA 2O9OA 2J8FA 2XTKA 3WDJA 3M6DA 1TCMA 3MSDA 4M81A 3ARWA 1UUQA 3DECA 2CESA 1GOQA 1HKKA 1HKIA 3CMGA 3GH5A 4P8XA 1EIBA 2WPGA 5FKYA 2VCBA 4GZEA 4AD1A 1CPUA 3CZ8A 3WD1A 5CZKA 3BC9A 1VAHA 3OG2A 1E3XA 1E71M 2YDSA 4AXNA 1JAEA 2XFFA 4WSKA 1NWRA 3PZTA 3WSUA 1ITXA 2VURA 4HU8A 2CHOA 3MS8A 2JEQA 5LYRA 4PMXA 1E6QM 3AS3A 1PEZA 3AI0A 4AZIA 1KB3A 2OYKA 1FH7A 1CBGA 5GNZA 5I77A 4KWUA 3BXWA 5D9MA 2YA0A 3KL0A 3PTMA 3VD9A 1MWOA 4CCDA 1VEMA 4LPCA 5CJ5A 2A3HA 1QNQA 4E2OA 2OYMA 4DUWA 1OIMA 3CZEA 1UG6A 4AISA 1QHPA 1Q4NX 2WMGA 3LPOA 7CGTA 4TUFA 4LYPA 5KZ6A 1TFVA 1FA2A 3FAXA 5CPQA 2A3BA 3BCDA 1PX3A 1KCLA 4C7FA 1JYWA 1HL9A 3N11A 2TAAA 9CGTA 4PEEA 3MV11 1E73M 1CENA 2VX5A 4JFWA 4TXEA 1JDAA 3UR8A 5C71A 3RM9A 2WLYA 2AOSA 3T2OA 1W9UA 5CLTA 4CU8A 3UEQA 3VGEA 2YJQA 5EFDA 2WKLA 2WCGA 4WKHA 3G6MA 4S3KA 4QCEA 2E8ZA 2BY0A 5JUVA 1KWGA 1Q6FA 2PWEA 5BXSA 4EANA 3AHVA 4W8AA 2CETA 1E9LA 2GSJA 4DWSB 3GH4A 3WNNA 2D0HA 1HKMA 4HZ7A 4F66A 1G0CA 3UETA 3ZQ9A 1UHVA 3EDDA 1EA9C 1KQYA 4PSRA 4UFLA 3VINA 2F61A 5AY7A 3CUGA 1KXQA 3TP4A 1VJSA 3BAYA 4C7GA 1DWIM 2F8QA 4JFTA 5I5RA 2W4XA 1GOWA 2CKRA 3KL3A 4J3WA 1W9PA 1JZ7A 3VUPA 4W88A 3WD2A 3VDAA 5LA0A 4MJ2A 1D2KA 1MW2A 3VTRA 2GJPA 3WH6A 3GXIA 3WH8A 3WDQA 4KRUA 1XD0A 3T0BA 5A6SA 2VRQA 4RE3A 2W67A 2YL8A 2WM0A 3AROA 3TTQA 1JNDA 3WNKA 1V3IA 1TVPA 2RGMA 4PMQA 1FOBA 5D8WA 1KR0A 1HP4A 4PMUA 4W7VA 4UQCA 4W5ZA 3FW6A 1J9YA 2WW5A 5EBAA 4GZJA 4GIAA 2JEPA 4AW7A 3S2CA 4Y7EA 1PIFA 1V3HA 5A6AA 1CGWA 4KRTA 2XM2A 2Y2WA 4ATWA 2QHAA 3QHNA 4W8LA 2W66A 3N17A 4AD3A 1CXKA 5DT7A 2O9TA 4H2CA 1K9EA 4BCEA 4M80A 1WDSA 2V3GA 1H11A 2X05A 1KXVA 1DWHM 3GXFA 2VVSA 3QOMA 2V5DA 3K8MA 2ESCA 3AXHA 4OBRA 1ISWA 3MMDA 4P7OA 2UY4A 5A2AA 3MO4A 2YBTA 2ZXQA 4B15A 5A6LA 2D2OA 2WNWA 4D72A 2XGIA 3CMJA 1JFHA 2J4GA 1ODZA 1OB0A 3WN6A 3TTSA 2ZOXA 4AC1X 3IAQA 1C7TA 3OZOA 3FY1A 4PMNA 1DEDA 2VCAA 3WD3A 3IAPA 2CPUA 3GM8A 4MNMA 2WSKA 4UQAA 1JI2A 1JXKA 1K9FA 2BVYA 1B3VA 1DWJM 3WH9A 4PCTA 4JFSA 2DSZA 3WDRA 1UWUA 2W62A 1GW1A 3AFBA 2CITA 2CERA 1BYAA 1NH6A 2JIEA 2V5CA 1PZ2A 1W1PA 1UKOA 1FH9A 4ZFMA 2BNJA 5M03A 1V6VA 1PBGA 2GK1A 2XVPA 4PMVA 2XYLA 2XVNA 2V3EA 2Q8XA 3K46A 1QPKA 2VJXA 4AEEA 2MANA 3QHOA 2ZX5A 5E0CA 3MUAA 4LQ1A 1JF5A 2BXZA 2VQTA 1B90A 1V6YA 1E4NA 1KGUA 3TTYA 4BS0A 1XV8A 2YLLA 4MADA 4OZOA 4CN4A 3OB8A 2CKSA 1WZAA 4XV0A 3APGA 4QP0A 1C93A 2PF0A 2VNCA 1UWRA 1QI2A 3PZIA 3QHMA 1X6NA 1E5JA 2WLZA 1MVYA 1UR9A 2OSXA 4TX6A 3FXYA 4D71A 2E40A 3AHTA 4MB3A 3GDBA 1W1VA 4YPJA 2EPMX 1F4HA 4TTGA 3U7VA 3SCVA 1Y7VA 1HKJA 2RGLA 4H41A 3EYPA 4AD2A 2XVLA 5BWFA 1H5VA 1CIUA 2BS9A 4M29A 1V02E 3CHDA 1TA3A 2ZX6A 1UA3A 4IISA 2WC7A 1LQ0A 4KH2A 3K8LA 1C8QA 1E5NA 3SEPA 1QHZA 1E6RA 1GQJA 4BQ4A 2BHYA 4AYSA 4EE9A 3MKKA 2HISA 4Z2HA 1KBKA 1QI3A 4UTFA 3CZLA 2GJRA 4MB4A 1G5AA 1VIWA 1E0WA 3PTKA 4WF7A 2YLAA 3VD4A 1J0IA 5IDIA 1HL8A 3NSMA 1BLIA 4IM4A 2G3IA 1H41A 1US3A 3RPMA 4BQ2A 1IT0A 3AJ7A 1OGBA 5EMYA 5HOSA 1TG7A 2YL9A 3A4AA 1E1FA 2WWCA 1ZBKA 3AS0A 4E8DA 3ZM8A 2Z1SA 4UFMA 1Q6EA 3IJ7A 4ATDA 3FHAA 3QGVA 4B9YA 1XH1A 3L4TA 2GFTA 1W1YA 1FP8A 4EAMA 1U33A 5A8PA 5BXPA 2DSKA 4XX6A 1GHSA 2VRKA 4CD8A 1E40A 4XZBA 1JYVA 2DDXA 5A94A 4BQ3A 4EK7A 2CXGA 1OT1A 3ZT7A 3WIJA 1JAKA 2Y4SA 5D9OA 2NW0A 3WUBA 1BYDA 3W38A 2FGZA 3L2LA 2ZICA 1YQ2A 4HTYA 2WMJA 3N04A 4U5KA 1GNXA 1QBAA 5M17A 1J0KA 4WKAA 4FMVA 1BGAA 1BQCA 1VEPA 4J3SA 3AMDA 2J78A 3K4DA 4BA0A 5A6JA 4A3YA 3ARRA 1MXGA 1N82A 3T0DA 5A6BA 1GQIA 1GOIA 3KL5A 4FLRA 4YHGA 2O92A 1BYCA 3AS2A 3WF0A 5GNYA 2VT0A 4IPNB 1RPKA 3DHUA 3AYRA 1V03A 1CXEA 1M04A 3BLKA 2ZUSA 1WPCA 2BV9A 3CTTA 3LPPA 3OGVA 3VX0A 4JKLA 5HPCA 1CXIA 2WHLA 5ABEA 2XIIA 1OM0A 4DUVA 3CGTA 4F79A 5HNNA 4PMDA 1LF1A 2G4FA 1B3ZA 1H09A 3ZJ6A 1HJXA 1NWSA 1IZJA 5A8MA 4UNIA 2PC8A 5A2BA 1NOWA 2FGLA 2WWDA 1V02A 4M24A 1UZ4A 4W84A 5IHRA 4P8UA 3OZPA 3EDFA 4MB1A 2FHBA 4L4OA 1GVIA 1BAGA 1E6PA 1DHKA 2YL5A 3UG5A 1ITCA 4PN2A 1E70M 4BF7A 3L4ZA 4NRSA 5KEZA 1B3WA 2UY3A 5D8ZA 2ZX7A 2EPLX 3OGSA 4AZCA 3AIUA 1UA7A 3DHPA 2GJXB 2J47A 3AIWA 1W9DM 1XYFA 1W91A 4D6FA 2PWFA 2J7EA 3AOFA 1XRVA 5DFAA 3WDIA 4GO9A 1UR4A 3WFZA 4HOZA 5I78A 2OWXA 3VDCA 1MW3A 3B9DA 3NSXA 1B30A 2DT2A 3VM7A 4MAZA 4GO8A 3L4XA 3WNPA 5E09A 2Y8KA 2ZUNA 1QI5A 1KBBA 3ZO9A 1UD3A 1TR1A 5JBFA 4M8UA 1CDGA 1HVQA 3PHAA 3WF3A 3NSNA 1BYBA 4Q7NA 2ZUVA 3VGDA 3W81A 5IFTA 2E9MA 3WQVA 1KR1A 4K68A 4LYRA 4Z2KA 5BXRA 3ARPA 2DIEA 1PPIA 1RH9A 1I1WA 1VBRA 2XFRA 2BY1A 4PBGA 7A3HA 3AISA 1WZLA 4LYQA 5DO8A 4ZE5A 2YIHA 4PRWA 1VJZA 2WVTA 1H2JA 2ZUMA 3W82A 1WNOA 3WDHA 3SCNA 8CGTA 1QW8A 3VX1A 3L4UA 4W85A 4AMCA 4QFUA 2D20A 2WXDM 3VIOA 5BROA 1Z32X 4GXPA 2ZIDA 1LL7A 3LPGA 4Z2JA 2J8GA 5BYWA 3NYDA 2WMHA 1H3GA 5CPTA 2DEPA 2OLHA 2Z1KA 3CZKA 3PZ9A 3GXMA 4NSBA 4P7RA 1FH8A 3OIHA 3AZTA 2VO5A 2GDVA 4FLSA 5DMYA 4YHEA 1EHNA 3GNRA 3I3DA 5BCAA 1B0IA 3N13A 1JDCA 5IXEA 1KXTA 1W2VA 3THDA 5FOOA 3CLWA 2PBGA 3CZGA 4GI6A 2XM1A 2YA1A 2CYGA 2CNCA 3PTQA 2GUYA 1QNSA 5TD4A 5A3HA 1TE1A 5E6YA 2DSUA 2WYSA 1XYZA 3VMPA 1OCQA 1CXFA 1MYRA 1CXLA 4AZCB 2G3MA 2J7BA 3SCQA 3ZSTA 4QCFA 2JF7A 4XUYA 1LG2A 2WKGA 2IXUA 3OBAA 1C91A 3SCTA 1DTUA 5I79A 1KXHA 3WELA 1AQ0A 3S6TA 1VEOA 2DSWA 2D24A 4ZXLA 4P7NA 1CGTA 1P6WA 2WHJA 3O6AA 1XCWA 2DT3A 1JZ4A 5I23A 3WQ8A 5F7UA 3ZIZA 1Q6CA 2FHCA 3NJ3A 4D6GA 3BSGA 3RCNA 4PSPA 5A8QA 1JG9A 1HJQA 1GZJA 1X6LA 2QPUA 4OKDA 7TAAA 3VNYA 3CPUA 5M3WA 2BXYA 2DPEA 4MJ4A 4FF5A 1XSIA 3U7BA 5JIPA 4JAWA 3WNOA 5AC5A 3EDKA 1ZS2A 3SUVA 1LWJA 1ZBCA 5CSYA 2JFEX 1GORA 3F4VA 3VGGA 3ARUA 5E6ZA 1W3KA 2J79A 3QOKA 4W7UA 2WCSA 1JZ3A 1E56A 1DWGM 2C0HA 1UD4A 1H49A 3VIJA 3GTNA 3NDZA 4UZSA 4HOXA 2VMFA 2BHUA 2VOTA 3GXDA 3RJXA 3M46A 4GZIA 4C7DA 3ARXA 3PN8A 1JF6A 1BG4A 1HNYA 4TVCA 5AC4A 3NDYA 3WUFA 1L0PA 1ZB5A 5CSUA 3VMOA 4UFHA 1W9BM 3PBGA 3T2QA 4J3XA 3L4WA 2CBUA 3W27A 1X1NA 1IZKA 3D3AA 4U2YA 1E6ZA 4DWSC 4MB5A 3FNDA 1TVNA 1JZ8A 4CD7A 3POCA 4DUXA 1UWQA 3CHCA 5ECUA 5GNXA 1R87A 1QW9A 4D6EA 4AIEA 3MMUA 4CN6A 4N0RA 1EO7A 4U3CA 1ISVA 3MANA 4ATLA 4PTVA 3POHA 4UZUA 1E1EA 5DT5A 4OUEA 2ZWZA 1OGGA 2XGBA 3VDHA 2IUZA 4CVWA 2W63A 1HJWA 2BFGA 4RE2A 1ZJBA 2E9LA 1K9DA 1JI1A 3CUHA 1XC6A 1I1XA 1HJVA 4AZ5A 1V3MA 3VVGA 4JFUA 1CEOA 1OIFA 3ARQA 2ZXAA 1M53A 2D0FA 3WKZA 1NP2A 3AXIA 4QDMA 1J01A 4WKFA 3SUTA 2NT1A 1E6SM 1UH4A 2NT0A 4ZE4A 3GNOA 2VL4A 3T2PA 2XWEA 3WF4A 4JCLA 1HP5A 3KE0A 4EKJA 2WBGA 3MUY1 5BXTA 5D9PA 3L4YA 4UFJA 3AIEA 4TVUA 3CHEA 1OSEA 1VB9A 3J7HA 3RILA 2WB5A 1JD9A 1JYNA 2VZTA 3SIMA 3OA5A 2DT0A 1HN1A 3ZJ7A 1CLVA 3ARTA 1E6XM 1WZKA 3MU7A 4U2ZA 4AD4A 2DSVA 1CGXA 3VIMA 1CZ1A 3WEMA 1B3YA 4JIEA 1RD6A 3ECQA 1U30A 2G8ZA 1XSJA 1ZBVA 3N15A 2WVVA 2QPSA 3VIIA 3WUEA 1NOFA 5FL1A 4HPGA 5CQ1A 3EDJA 2IXVA 4PTMA 2JE8A 3VU2A 1HXJA 4DWSD 1UQZA 3G6LA 3VM5A 3AMKA 1R86A 4PMZA 1MW0A 1VF8A 4PMYA 1ISZA 3JUGA 1JYXA 3MSGA 3WBEA 3ARZA 1W9VA 4CGTA 2E8YA 4NI3A 4TTUA 1UYQA 1TMQA 1DWAM 4ACZB 2XHYA 5FIPA 4A3HA 4DM1A 1UR1A 1MFUA 4ZENA 3MUZ1 1SFSA 1HIZA 2WBKA 2WMKA 1C8YA 1JXJA 4W5UA 4CN1A 2AMGA 2GJXA 3W28A 3GYCA 1US2A 3VIPA 2O9RA 1V0NA 1VFUA 1V6WA 2EEXA 1MXDA 3HU7A 4RL3A 2CEQA 3TA9A 2EJ1A 2J74A 1UD2A 3WL1A 5CG0A 3M7SA 3VOCA 3FN9A 2X0YA 2X8RA 2WMIA 3WF2A 4ACYA 1UOKA 4FLOA 4B16A 1CLXA 2YKKA 2OSYA 5FD0A 1F4AA 2EO7A 1C8XA 3VGBA 1V3KA 5GPRA 1EXPA 6CGTA 1J11A 1BF2A 5ABFB 1J18A 3AXXA 4BZYA 3W0KA 1GUVA 2V3DA 3PZVA 1JDDA 3BCFA 4HMCA 2CIPA 3WNMA 3ARYA 3LMYA 4XB3A 3UG4A 3MV01 3BAIA 3ZR5A 2QMJA 5I0DA 3VILA 3GBDA 5D4YA 4M1RA 4CU7A 2V38A 3VMNA 4FLQA 1G1YA 5EB8A 3BSHA 1R85A 3KWXA 4W7WA 4J3UA 4CKQA 4OBSA 1XCXA 4M56A 1HX0A 3ZT6A 3WQ6A 2PWGA 3CHFA 4HMEA 2ZX8A 2A3AA 4PUDA 2FH6A 4P8WA 3W53A 1W2PA 4QLJA 2VRJA 1JL8A 3ARVA 3UESA 3PZMA 4Z2LA 1ZL1A 4JKMA 4CU6A 3SCOA 2BVDA 3WY1A 3CUIA 4F8XA 3TOPA 1A3HA 5A69A 1CYGA 3PZUA 3CBWA 3U5UA 2WVVB 1MQRA 5HBFA 1ZJAA 5IHSA 1R7OA 3UCQA 2WANA 4CCCA 2BVTA 1JD7A 1LL4A 1AMYA 3FHQA 4QLKA 5E9AA 4H7VA 4KMQA 2W5FA 2WCAA 2J62A 3ZOAA 1V6XA 2X1IA 3B8SA 1GJWA 1W3JA 2XVGA 1QNRA 6TAAA 2HVMA 2E4TA 2QF8A 2J7HA 1UKTA 4X0VA 1H4PA 1FFRA 1XH0A 4AIOA 3O9NA 1H0IA 2J7CA 4BQ5A 1E4MM 1NP0A 2DGAA 1GOOA 1DP0A 3GBEA 4UOQA 4GKLA 2X0HA 1BFNA 1QVBA 1XGZA 3M07A 3VNZA 2D22A 1GHRA 4UOJA 4JZ5A 1J0HA 4ML4A 4DM2A 3ZR6A 3VKKA 3A4XA 3WF1A 3AIRA 3PZOA 5I2UA 4J3TA 4X9YA 4FK9A 1WZMA 4D6IA 4OOUA 2WMIB 2D3LA 3VD3A 3LPFA 4AEFA 1UWIA 3GZAA 3W24A 3BAJA 3SUWA 1UWSA 4PCSA 1RP8A 1C3FA 4CVUA 3CUFA 2X09A 2C7FA 4V2XA 4B3LA 1UH3A 1BGGA 4OIFA 2E9BA 4JHOA 4D6JA 4B9ZA 3ZJKA 2YOCA 4AD5A 4HMDA 1UD5A 4HA3A 2OYLA 3W6LA 4Q22A 1EDQA 4CCEA 2EQDA 2VX4A 1R8LA 3DC0A 1NOUA 3N9KA 4MNJA 1QNPA 1W32A 3WQ5A 4AZBA 1J0JA 3F5KA 3A3HA 4XZWA 3CIVA 1E4IA 4LGXA 1H1NA 2BY3A 3SCUA 3VIKA 2FDMA 1J0ZA 4AD0A 3VO0A 4PYSA 1D3CA 2YDQA 1EQCA 1SMAA 2WZIA 4JHZA 3WMCA 1SR0A 2EPKX 5I3DA 1E15A 2DT1A 4UR9A 1V0MA 2VZVA 1B3XA 1BTCA 1FHDA 3IJ8A 3RMEA 1OD0A 4W93A 4NF7A 1WDRA 2NSXA 5HPOA 3A6OA 3K8KA 3N1AA 3PZNA 3I3BA 2WHMA 3AMGA 2EBNA 3WD0A 3SCRA 3WQ4A 1OGSA 1JGIA 4HU0A 3UG3A 1ODUA 3EMZA 4X0NA 2YDRA 4HA1A 4CD4A 4U5IA 3RIKA 4W8BA 3D5HA 1OINA 3BLPX 2ZXBA 1HT6A 1RP9A 4V28A 5FCZA 3VGHA 1UH2A 1ZBWA 1XH2A 2VQUA 1M01A 1PJ9A 1W3HA 5JBDA 1WAWA 4LXFA 1G94A 4H8HA 4UQDA 4PUEA 3SCPA 1V3JA 4WLCA 1XHGA 2WZEA 3CO4A 4HOWA 5A6MA 1QHOA 1NARA 1QBBA 2ZE0A 4MAVA 1CTNA 3N12A 4P7QA 3BGAA 5LA1A 2VZUA 4F9JA 2AAAA 2VI0A 2ZUTA 5HDRA 1G9HA 3GNPA 3ALGA 3WMBA 4ZEPA 1UKSA 1EOMA 1GQKA 1FP9A 2DH3A 2XSBA 4OJYA 3WBAA 1GJUA 1KQZA 2D3NA 4Z2GA 2E0PA 1WP6A 3L2MA 2EPNA 4MTVA 3T0AA 1AQMA 1LLOA 1PZ3A 3AIBA 4PMOA 1BVNP 4H8VA 4D1JA 1FFQA 3MMWA 1B1YA 3HJEA 1QOXA 4IUGA 1V6UA 1WCGA 3GH7A 3WH7A 5JBEA 4GI8A 4MDOA 4KGJA 3MUIA 3B9AA 1UKPA 3WL0A 3ZMRA 5BRQA 2J25A 1UWTA 3WH5A 3AQUA 5A95A 2ZUUA 1AQHA 3SCSA 1JZ5A 6A3HA 1WE5A 4TX8A 4WK9A 1BSIA 1CECA 3KEHA 1CNVA 4UQBA 4B3KA 1OWQA 2WAGA 3U5YA 1KGWA 1WDPA 4MNLA 4PTXA 1SMDA 3AS1A 3AMLA 2ZUWA 2CBIA 1UKQA 4JL2A 1OT2A 1B2YA 4S3JA 3AHZA 3RO8A 1FHLA 4MPKA 1J0YA 2VR4A 1GCYA 1E43A 2CBJA 3W26A 5I6SA 1TUXA 1MFVA 1L8NA 4IPLA 4UOZA 3NCOA 5AYBA 1PX8A 4ACZA 3AHXA 2UY2A 3HMCA 1EH9A 4PTWA 3N18A 4J27A 2WZHA 4RE4A 1MW1A 2Y8VA 4A4AA 3K1DA 5A8NA 2XIBA 5AYIA 1GOMA 1AVAA 1C90A 2VX6A 2BHZA 4GQRA 1WKYA 2BY2A 8A3HA 2PWDA 3DYPA 3QR3A 4HP5A 1U2YA 4JCMA 3BH4A 3A47A 4WIWA 1Q6GA 3W25A 1KWKA 2GDUA 1PX4A 2WVUA 3W29A 1V0KA 3SUUA 3WEZA 5CLWA 1W9XA 4J7RA 3VGFA 4NRRA 4D6DA 3BMVA 4YN5A 2VTFA 2YL6A 4Z2IA 1E55A 3B9EA 1QI4A 3ZT5A 5LA2A 5ABFA 4J28A 5D9NA 1HJUA 1V08A 1LWHA 2QV4A 2ZX9A 1K6AA 5A6BD 4MDPA 1W1TA 4NZCA 5CPSA 1S46A 5CXPA 3WUGA 1ECEA 4R5EA 3KZSA 1E72M 1BVZA 2A3CA 1V0LA 1EHAA 2XFYA 1I75A 3WENA 1JIBA 2QMKA 2EPOA 3VD5A 1BG9A 1E4LA 3II1A 5A1AA 1EO5A 3TONA 4U31A 4AIUA 3ZSSA 1MQQA 3CUJA 3OGRA 3BMWA 1JNEA 2J77A 3EDEA 4P8VA 1PAMA 2WK2A 2VZOA 5A8OA 5M5DA 1CWYA 1EQPA 4AWEA 3WDPP 2XWDA 3W4RA 2G41A 3E1F1 2VZSA 3AZRA 4E8CA 2YBUA 3BAWA 2WSPA 1VENA 2D23A 2JIWA 2CCRA 3SURA 1YHTA 3VD7A 2JF6A 3W37A 5CGTA 2FH8A 3U57A 2B31A 4AZ7A 3OLDA 2ZWYA 3WFLA 5FL0A 4CUCA 1B31A 5GQBA 2UWFA 2VVNA 3VIHA 2A3EA 1JZ2A 1H0GA 2PB1A 1O7AA 2C8NA 3ARSA 3RJYA 4QAWA 5ABHA 5E70A 2Y5EA 2EXOA 3CH9A 3K4AA 3NIYA 1VFOA 3A4WA 1OBAA 4TVDA 3CZJA 1TZ7A 3NUKA 3OLEA 4HZ8A 3SCWA 1DWFM 1C92A 4D6CA 2OWWA 2CHNA 3F5JA 3DYOA 2D0GA 4JFVA 4W87A 3TTOA 1VFFA 4GPNA 1G01A 3L4VA 3OLGA 4M82A 1ISYA 3THCA 2J75A 2W92A 4N42A 3VIGA 1J10A 1UR2A 1E0XA 1PIGA 2O9PA 3HN3A 1ZU8A 3PZGA 5A6KA 1UD6A 1JFXA 1K9TA 2UY5A 2PBOA 1V3LA 3VIFA 5ABGA 1GOKA 1J12A 4PMRA 4AZ6A 5A2CA 1VRXA 1EOKA 2DH2A 2Y24A 4TOQA 2XPKA 1NWUA 3VDBA 2VCCA 4AZGA 1KFWA 4D1IA 3RM8A 4D6HA 2DQXA 3I3EA 2VC9A 2DIJA 1M7XA 2XVKA 1A47A 3AMCA 2PI6A 2G3NA 1ESWA 3WEOA 4WJXA 2W91A 1JZ6A 3AIVA 3EMQA 4L4PA 4AZHA 3AYSA 3EMCA 3AIQA 1LJYA 1E6NA 4H04A 1WO2A 1GPFA 1LL6A 2FHFA 2X2YA 4HPHA 2WVSA 3UERA 4UFKA 5I24A 5DF0A 3ZJ8A 4AY1A 1D7FA 2J7GA 3IANA 1EGZA 2GK1B 5EFFA 4JL1A 2XUCA 3ALFA 1EDTA 3DYMA 3W6MA 1C7SA 1WDQA 2WHKA 4R27A 1M03A 3AICA 3EBVA 1Q6DA 3PZQA 3WQWA 4OOZA 5CGMA 1CGUA 1VFMA 5E0FA 4UCFA 4KGLA 4W89A 1EDGA 4GI9A 1KGXA 2WC4A 1NQ6A 4E4PA 1CGYA 3F5LA 3RM4A 1UD8A 1XD1A 1E3ZA 2OSWA 3T08A 4H8UA 2V3FA 1MQPA 3BAKA 2VX7A 5IFPA 1IV8A 2CBVA 4MNKA 2ZXDA 1GONA 1R7AA 2XSAA 2OWCA 2J7FA 2YA2A 1BHGA 3RDKA 2F2HA 2PWHA 1GQLA 2E3ZA 4QLLA 5BRPA 4GQQA 1CXHA 1WB0A 3T09A 3IK2A 2G3JA 1TA3B 4CD6A 4F9DA 4JKKA 1NM9A 3AHYA 4UQEA 1SYTA 1HVXA 1CGVA 3IJ9A 2XJ7A 4UFIA 5DEZA 4W86A 2JALA 4V27A 5C8BB 2QLYA 1VBUA 4WSJA 1ISXA 3SUSA 4HA4A 4ZXOA 1UZ1A 3AZSA 1BPLB 3FAWA 1W3LA 2VR5A 4URIA 4HZ6A 1HF6A 3UR7A 1GVYA 2VUYA 3WMSA 2W61A 3WNLA 4LX4A 3WD4A 2XG9A 5C70A 1UR8A 2D1ZA 3OLIA 1OD8A 1E0VA 4DWSA 1B9ZA
chains in the Genus database with same CATH superfamily
3GG1A 2J7DA 3IIZA 3PANA 2DQWA 2WMFA 4XVDA 1HJSA 4MGGA 3C0JA 3U48A 3PS7A 1ZJIA 4KFNA 5C7VA 1D3HA 4R85A 4P7LA 2NV1A 3PNUA 5A5WA 1YPIA 4U33A 4J3VA 3GVQA 2GVYA 3T9PA 3MO7A 1ICQA 2O9OA 1U5VA 2XTKA 3V75A 2CZ5A 1TCMA 3MSDA 4JNZA 3DECA 4Z0SA 3AU2A 1HKKA 1HKIA 3M0JA 3K1GA 3TW9A 1Z8AA 2OLAA 2XIMA 3BE7A 2OEJA 3OG2A 3OU8A 1X39A 2RDXA 1ENUA 4MYXA 3W2JA 4IIHA 1Q6RA 1XIIA 1JVNA 3E49A 1XRFA 3MS8A 3AS3A 1PEZA 4J4KA 2OYKA 4KEUA 2NLIA 4M0XA 2H8XA 4AIBA 3BXWA 5D9MA 2Q02A 3KBVA 4EPEC 4O1EA 1DIOA 1TV3A 2TRSA 4Q8QA 4CCDA 2PSNA 4LPCA 1MNZA 3F1QA 1B4EA 2OYMA 4DUWA 2C19A 4M51A 4QIUA 3IGHX 1RZMA 4ZL1A 4QNEA 1TFVA 4HYRA 3COTA 3GWQA 4JFWA 5BU9A 1JDAA 4PZVA 5C71A 3RM9A 3U2CA 4MWAE 3PR2A 4LOCA 1QCWA 1TV8A 3THAA 1HL2A 5EFDA 1O60A 1Z3NA 3W7IA 2WKLA 1UC4A 8XIMA 4JXCA 2E8ZA 3S9YA 3NQBA 5BXSA 4EANA 2YX0A 1UPMB 3TQVA 4QITA 4AHOA 1SGJA 2BGQA 4JTSA 1FCUA 4HZ7A 1YXCA 3QKEA 3ZQ9A 3EDDA 1EA9C 2V69A 1H50A 2YSWA 4ZVJA 1AA1B 1XYCA 2BOGX 1F07A 3FKKA 5AY7A 3CUGA 4C7GA 1TB3A 1I9CB 1YXDA 4OBTA 4W88A 4WGXA 3ES8A 4RDWA 4K39A 3S5OA 3VTRA 3PK7A 4IFKB 4H6KA 4MOZA 4ZQMA 3W73A 3WDQA 3N2CA 3E2SA 1OVDA 1LYXA 2VRQA 3LGGA 4IQLA 4RE3A 2W67A 2WM0A 3TTQA 3W1AA 4F0RA 1K02A 4KKXA 4P5UA 4B5NA 2J6XA 4W5ZA 1P7TA 2PLJA 5EBAA 2Z1BA 3NQAA 4HBKA 1KTNA 3SM0A 1R6WA 6PTDA 4BEQA 1RA0A 3PJUA 4ATWA 1H1YA 3QY8A 1V6TA 2W66A 4LY8A 4NAFA 4WR3A 4AD3A 4H2CA 1YBQA 3GB6A 2X05A 1H11A 1PKMA 2G4JA 1DXFA 1I4NA 4AY8A 4DJED 3EWBX 1DWHM 4D8AA 3LMZA 2CLPA 4HN4A 1EP1A 4JTDA 2ZDRA 3G1DA 4QRNA 3H22A 4P7OA 1ISWA 2RFGA 2UY4A 3ZWSA 4I5UA 2YBTA 2WNWA 3CMJA 2G96A 4REQA 4Q8NA 4MUZA 4L80A 2R1PA 2ZOXA 2H90A 4K1GA 4NNAA 5D32A 4GY0A 3OZOA 1XLLA 1FHVA 3FY1A 3QF0A 2XISA 4PMNA 1QPOA 2CPUA 1OEPA 1SZFA 4K8EA 3PF3A 1M7OA 1DWJM 3DHDA 4FI4A 1GOXA 1GW1A 3AFBA 1VHNA 4M6QA 2GZXA 4PEKA 3KLKA 2V5CA 3W7GA 3GW0A 4ICNA 1FXQA 5M03A 3OTRA 3RR1A 1X96A 4DLFA 1QT1A 3HGRA 3QHOA 3REQA 1W5MA 4IMGA 3C0SA 5E0CA 4Q4PA 4ERAA 3IIXA 2BB0A 4LQ1A 3S2MA 4DBEA 1E4NA 3TTYA 3W2UA 2YLLA 3EA1A 3IIVA 4XZLX 4CN4A 2HPIA 1EX5A 4DF1A 3OB8A 2GGHA 4Z1BA 1EKOA 5AHEA 4LB4A 3RUBL 3RF9A 3QHMA 4EXQA 2OSXA 4K38A 1XLIA 2PC4A 1GVEA 3WLJA 5I3GA 1GEHA 1F4HA 4HN8A 1HKJA 4AU0A 4O8RA 5CAHA 3EYPA 5BWFA 3URAA 4I5XA 1EJSC 3LENA 1VPQA 4JPGA 3UWEA 1PHQA 4DRSA 2ISSA 3L5AA 4LY4A 3CHDA 3LI0A 2PRMA 4IISA 4F48A 3N3MA 1SW7A 2CLOA 3C0QA 4C6DA 3MKKA 2I5GA 3VKCA 4QEHA 4Z2HA 5KINA 3CZLA 4MB4A 1G5AA 5HQLA 2ZQ0A 2YZ5A 2YLAA 1TJ0A 4GJ1A 1BXBA 1J0IA 1MDRA 5HUPA 3IGXA 1ECQA 1KFBA 1US3A 6XIMA 1TG7A 4JN6A 3SAZA 1ZBKA 3AS0A 2Z1SA 2YCEA 4UFMA 2BSLA 4L9YA 1TUFA 4LJ3A 3IK4A 4QGCA 2POTA 3W1LA 3GIQA 1GVSA 4FPSA 4CNUA 3P93A 2H9AA 3SRFA 4XX6A 3W7EA 1E51A 3KTXA 1E40A 1PIIA 3MHFA 1SVDA 2WNNA 3R1ZA 4EK7A 3WIJA 1JAKA 1S2UA 2Y4SA 1LDCA 3WUBA 2FGBA 4O53A 3BWWA 4ZOAA 5B80A 3T81A 4HTYA 2QVNA 3C2OA 1J0KA 3EOEA 3JZUA 2PDNA 4NHVA 5CBIA 1NVMA 4J3SA 1BQCA 1VEPA 2CZDA 1T8XA 2IW0A 2ZA1A 3M5ZA 5GNYA 4IPNB 4NT0A 3P81A 3RAOA 2C91A 4IQJA 2AKMA 2ZRYA 3NWRA 2C13A 1OHLA 2HWGA 4O57A 3IJDA 3KVMA 1M7JA 2ZUSA 3L65A 3LB0A 2E68A 2FPYA 3DGRA 4NP7A 5CPNA 2WHLA 4ICMA 4DUVA 1F6KA 2NX1A 1LF1A 2Z1WA 2G4FA 4I3GA 5A8MA 1NOWA 2FGLA 4RNJA 5FF2A 2PU0A 1V02A 1PKYA 1XI3A 2RJHA 3OZPA 3EDFA 5A8GA 1I2NA 1GVIA 1BAGA 1DHKA 2W9MA 1ITCA 4PN2A 1E70M 1QMLA 1F5ZA 1SO3A 4NRSA 2YCLA 4US6A 2UY3A 4HJWA 4Z17A 2EPLX 3OGSA 3C61A 3AIUA 1UA7A 5EMJA 3UW6A 2J47A 3B0YA 1W91A 1PUDA 1S39A 3WDIA 1H61A 2OWXA 1DIEA 3B9DA 4DUOA 4QS6A 1B30A 3VM7A 3FFSA 4LS0A 3CB3A 1X7IA 1XPGA 3LGEA 3ZO9A 1TR1A 4M8UA 1CDGA 4ORIA 4PGLA 3NSNA 1JGMA 3V5FA 3VGDA 3W81A 2V82A 5IFTA 4NJIA 4LNCA 2DZSA 3QRHA 3N6JA 4JD4A 1FWTA 1PPIA 2O55A 3LM7A 4CQDA 3N34A 3TTEA 2ADAA 1N55A 3QJAA 2NQZA 1EB3A 3AISA 3ZYZA 2BOFX 4HNVA 3M0XA 3RX2A 2DVTA 1YIXA 2YIHA 4PRWA 1R47A 1NU5A 1JUBA 2Z1XA 1OFDA 3SCNA 1P0BA 3Q58A 3NQ8A 1QW8A 3VX1A 4W85A 2NV9A 2C15A 2VC5A 2WXDM 4BHYA 1Z32X 2ZC8A 4Z2JA 5DY3A 1XP3A 3NYDA 3SJNA 4A8IA 5CPTA 3LV5A 3DENA 4F40A 3OIHA 1WDWA 4FLSA 1XIGA 3GNRA 2YGYA 1X1ZA 3I3DA 3RLVA 4HQVA 5BCAA 3I4EA 2ISDA 3CS2A 4GIRA 2NQ9A 4O0ZA 1W2VA 3UPBA 4O11A 1JDFA 3WQPA 3DH7A 1EJTC 2PBGA 4WXZA 3GD6A 2YA1A 2CYGA 3UCDA 3RG6A 4YL2A 3QW3A 2IS7A 2GUYA 5CGQA 1TE1A 3SIZA 2WYSA 1XYZA 3I7SA 5C9RA 1CXFA 3ZSTA 2JF7A 4DO7A 4XAFA 1C91A 1QK0A 1DTUA 1XR2A 4JS3A 2ZZ3A 3S6TA 2DSWA 2D24A 5I09A 3PPHA 4P7NA 4KCVA 1P6WA 1I8JA 3O6AA 2FTYA 2BZNA 2DT3A 4HNCA 1VCFA 2HS6A 3NJ3A 2J8TA 1X6LA 2QPUA 3FJNA 4JIHA 4PCFA 1IGSA 3P5ZA 1TSIA 3A12A 1KFKA 3U7BA 3URQA 4H6RA 1N7KA 2DJXA 3PBUA 2G50A 1LWJA 1ZBCA 1K6WA 3B3DA 1GORA 1LORA 3F4VA 3KCLA 4C6CA 4EP8C 2ZCGA 4W7UA 2WCSA 1E56A 4EPBC 3S6OA 1H49A 3GK0A 1SW3A 3B4YA 3NDZA 4J40A 4UZSA 4XD4A 4IF2A 3ICJA 2EPHA 3S9IA 4GOAA 1OQFA 4IQDA 3GUWA 3T8QA 1RCQA 3PAJA 3PN8A 1ZSXA 2QT3A 5CSUA 3ABRA 1DJXA 2INEA 1W9BM 4O54A 3A3WA 3WQGA 4ZQNA 3T2QA 5I02A 3M0KA 4DBUA 3MP4A 4RNFA 2Y88A 3WZ0E 4KWOA 3W27A 4CQAA 1X1NA 3GUGA 3LCGA 4EXBA 4GGBA 3VOJA 3PBMA 4ZCWA 1Q4WA 2PGEA 1TVNA 3FNDA 4CD7A 3POCA 3F4WA 1GTEA 1UWQA 1PYMA 5GNXA 4NNCA 4K36A 4PRRA 4GYJA 4AIEA 4N0RA 1XS2A 3P60A 1LOQA 3WG6A 3GC2A 4ATLA 2XGBA 4N6EA 3VDHA 2W63A 5EKYA 1GK8A 1DIDA 4RDZA 3IRDA 4Q4KA 1XC6A 1I1XA 1HJVA 4G7EB 4Q4SA 5FJJA 4OWGA 3GS6A 1M53A 3AAMA 4RE0A 3WKZA 3AXIA 4QDMA 3SGZA 3B04A 2NT1A 1UH4A 2NT0A 2P8CA 5H91A 4C1NB 2Y89A 3GNOA 3HURA 3T2PA 4S3AA 2QR6A 4H7ZA 5D04C 3QV9A 4CQ9A 5T8GA 3TC7A 3TN5A 2RKXA 4DEFA 5K4XA 4UFJA 1K8XA 3WBWA 3CHEA 3DERA 3J7HA 4YIWA 3DFOA 2V5LA 3IACA 9RUBA 1FUYA 3VXGA 1CLVA 1OX6A 4G8TA 3ARTA 2BGNE 3IJQA 3UXAA 4H19A 3GNXA 1L6FA 4XO7A 2P76A 4D2JA 3TOYA 2WZMA 1IT7A 4DO4A 1H7XA 4YS1A 1EP3A 4IHCA 1F8IA 1U30A 3N15A 2DUAA 5HMSA 4YVPA 4DQWA 3EDJA 4PTMA 4E38A 1FWAC 2VHLA 1UQZA 3I7QA 2Y6ZA 4H6EA 4AF0A 2QV5A 1R86A 1VF8A 1ISZA 2GGGA 3VNKA 3B40A 3MSGA 4YU1A 3WBEA 1E9IA 3ARZA 1SZEA 4CGTA 3RMJA 3W7CA 5FJIA 1DWAM 4A3HA 4DM1A 1W5QA 2GVJA 3W07A 5AVHA 1F3XA 1SFSA 1BRLA 3VZZA 2WBKA 3URBA 3BOXA 4WGHA 2GJXA 3W28A 3NPXA 1VFUA 4HCDA 2EEXA 3A13A 4UTTC 3G1HA 2ZRWA 3RU8X 2J74A 3S2NA 4KFPA 3STCA 4LAOA 4EVZA 1A5SA 3WL1A 3VOCA 2X0YA 2GQ8A 2YB4A 5DRIA 5I3HA 2PMQA 4FLOA 2I57A 3QKZA 4FNQA 5FD0A 2EO7A 4NI8A 5DBUA 2ATSA 1GW9A 1WOAA 4AQLA 3MCMA 5BMWA 4BZYA 2OKOA 3L66A 1TJPA 4RZ6A 1GUVA 3PZVA 4HMCA 5BOFA 1VS1A 4WCJA 4GHRA 3LCHA 3UG4A 1FWNA 3MV01 4YXGA 3A23A 3EOSA 3GBDA 4M1RA 3S42A 5IM51 5DMLA 3BSHA 1R85A 2QDEA 1XIJA 4W7WA 3OA3A 4LU0A 4FXJA 4CKQA 4OBSA 3BPWA 1ME7A 3ZT6A 3HA1A 3WQ6A 3LHUA 3CHFA 3NGJA 4KWSA 3LU2A 4PUDA 3S3GA 3W53A 4FIQA 1W2PA 3TCEA 2KAUC 3ARVA 4Z2LA 4LVBA 1ZL1A 1K4HA 2H3DA 3PJTA 4CU6A 5CBJA 1XCFA 4I8DA 2BVDA 3WY1A 3MWCA 3OBKA 3GG0A 5G2WA 3PZUA 3CBWA 2WVVB 1JRBA 2YBVA 1MQRA 4RUBA 4O4WA 1R7OA 1I2OA 4QHRA 2PDJA 4MWAC 1P4CA 1LL4A 3FHQA 4QLKA 5E9AA 2RUSA 1MMFA 3USZA 2WJFA 2J62A 2X1IA 4Q7BA 1FWHC 2OODA 2XVGA 2E4TA 4GUGA 1UKTA 2W27A 3FSUA 1FCVA 5FSDC 4RV3A 1FFRA 2RDWA 3O9NA 1Z89A 1I2PA 4MFDA 1E4MM 1NP0A 4A2RA 1NY1A 1GOOA 4CQCA 1DP0A 3V35A 3LNMA 4UTLA 4H83A 4UOQA 1BFNA 2NQJA 1F76A 1XGZA 3M07A 3PBWA 1KM4A 3SW6A 3AJXA 4AX6A 2HPMA 2Y7GA 1KD0A 4DM2A 3TNOA 4O28A 2Q8LA 4BI6A 3R8RA 3WF1A 1Y5VA 4J3TA 2OGJA 4FAMA 2D3LA 7TIMA 3PVFA 3LPFA 1W0MA 1UWIA 2ZTKA 3BAJA 3T55A 3SUWA 1UWSA 1Q6OA 1QTWA 1C3FA 4XZMX 2YXGA 2BP1A 4B3LA 1KRBC 4D6JA 2Z6IA 4L7ZA 4MFEA 2GVLA 4JX4A 1RXOB 1NJJA 4HMDA 3U3HA 2OYLA 3FKRA 3ME3A 4JYDA 4WJ8A 4ZOBA 4CCEA 4P2VA 1MRAA 3EB4A 3ANUA 4IIFA 4AZBA 3KOXA 1KFCA 1TX2A 4XZWA 2QJHA 3ZWTA 3MPGA 3VIKA 2FDMA 1J0ZA 2IQDA 5CSRA 4OHQA 1W1B1 4WDUA 3O63A 5MKGA 2OOGA 1SMAA 4LS1A 4IMDA 2DT1A 5I3DA 4UR9A 5FAGA 4G2DA 1H63A 4POCA 5FEWA 2NSXA 3PJWA 2CWXA 2J9YA 4MWAD 3E0VA 3K8KA 3N1AA 3PZNA 3I3BA 2A5HA 2GUBA 2FTPA 2R91A 5LZLA 4HU0A 4O13A 4U5IA 3CL7A 3W1UA 1OINA 3UF9A 1HT6A 3W7QA 4DN1A 2OVLA 3VGHA 3RU6A 4DZAA 4H8HA 3LQGA 4H1ZA 4PUEA 3F2BA 1V3JA 1UB3A 1A0EA 3V4BA 4E3VA 4HOWA 5A6MA 3W22A 5LXXA 2ZE0A 3UGVA 1CTNA 3N12A 3PWIA 5HJXA 3Q94A 3BGAA 3KRBA 4IPJA 2VZUA 3ES7A 3ID7A 3H21A 1G9HA 5BWAA 3GNPA 3ALGA 3T7VA 7XIMA 3V5CA 2QIIA 1UKSA 3VZXA 2ZE3A 2IPWA 5HWMA 3IVUA 3OVGA 3BGGA 2CZVA 1SJAA 3L7RA 3NL3A 4ZO9A 3WBAA 2ZZ1A 2V30A 3STFA 1BWVA 3TWAA 4MTVA 3UA3A 2GDQA 1LLOA 1PZ3A 3AIBA 3GHRA 4MVAA 1I0DA 3M7WA 3GVRA 5REQB 4GI4A 4JTLA 2A7NA 1B1YA 3HJEA 4IUGA 3FYPA 3LRKA 4ZOEA 4A3UA 4GI8A 4GFIA 4GCAA 4N9DA 3B9AA 1UKPA 1EJXC 3H2FA 1K4GA 2J25A 4NXKA 1LZOA 4Z0JA 1SZNA 3AO0A 2HBXA 4KF1A 3RITA 3VNMA 1WE5A 1BSIA 4GVFA 3RGTA 4UQBA 1S5NA 3RLUA 1UUMA 1DHPA 4GISA 3H24A 5HMDA 1BKSA 1KM1A 1B2YA 1PKLA 2FKPA 4MPKA 5CC5A 1A5KC 1GCYA 2YYUA 5IDZA 1EYWA 3GYEA 5I6SA 4S2BA 1MFVA 1AH0A 3WK3A 4QS5A 4G5DA 3HMCA 5E5CA 4Z1YA 1MW1A 1UZHA 2Y8VA 4F3HA 5A8NA 1JQXA 5AYIA 1AVAA 3KW3A 3T4CA 3N4AA 3FX4A 3G22A 4GQRA 3QR3A 4A21A 2B7QA 1U2YA 4FZIA 3BH4A 1JCXA 3W25A 3WLKX 2PGFA 3TYAA 2WVUA 3KBNA 3WLLA 4DPQA 2YCIX 1F73A 4RK8A 1V0KA 3GTFA 2QDHA 1D3GA 3VGFA 1WV2A 4YTSA 4YN5A 4Z2IA 4NJHA 4QJ3B 3ZT5A 3PULA 1ME9A 1WBJA 2WNZA 5EGRA 4S23A 2QV4A 5A6BD 3NQMA 3V0SA 1W1TA 5CXPA 5FEXA 2X1TA 4WX2A 3G8RA 1QATA 3BW3A 2A3CA 1WOBA 4JQ4A 3ATYA 3WENA 1JIBA 5DCEA 2FQIA 2EPOA 3VNJA 2HBVA 3L0NA 4OE7A 3ZSSA 1MQQA 2P53A 3U4AA 1VZWA 1U83A 2WK2A 2ZKMX 5M5DA 1KFEA 1EQPA 3W4RA 3WO8A 3E1F1 3SFKA 3P8JA 1IEXA 4OV4A 4J2MA 2F9RA 3BAWA 1VENA 3EOUA 1O5QA 1XG3A 2CCRA 3MB9A 2OEKA 3VD7A 3W37A 5CGTA 2FH8A 3H7RA 2PDPA 4XD5A 2ZWYA 5FL0A 1AH3A 3UPMA 3OO2A 2CLHA 3DG6A 4UXDA 1DJZA 4JYFA 2UWFA 2VVNA 4LAUA 3UWUA 2R1MA 4XUGA 3GW3A 1JJKA 1O7AA 1PL9A 5ABHA 1PDYA 3BQ5A 5E70A 1M68A 3B9NA 2EXOA 4OFCA 1QOQA 2IQ0A 3EX2A 4AH7A 1OBAA 3CZJA 1KBLA 1XLHA 4HZ8A 4HK6A 2V5BA 3NOEA 4H9MA 4PFMA 3EOLA 1W6TA 5G4WA 3GKFA 1GGOA 1O1HA 4FHAA 3AC0A 1H7WA 1SR9A 3UJFA 1O68A 3F5JA 1K77A 1N8WA 4JDYA 4JFVA 2F6XA 4HHLA 2A7PA 3TTOA 2W0UA 4GPNA 1XIEA 3I4KA 1G01A 2QDDA 3W02A 3B9OA 1ISYA 2V5KA 3THCA 4N42A 5KMYA 3VIGA 2INFA 3FGCA 1E0XA 3NEVA 2O9PA 2E1WA 1UZDA 1UD6A 1G4SA 2PBOA 1NIUA 4WDTA 4YTQA 4NJKA 1LUCB 5ABGA 1I2RA 1VRXA 1EOKA 2DH2A 4TOQA 4GIYA 2XPKA 4ILSA 4AZGA 1HZYA 2VEGA 2R1KA 4D6HA 3LHZA 2DQXA 2VC9A 5CPMA 5CAKA 4ERIA 2XU2A 3WEOA 4WJXA 4YCOA 3AIVA 2QNEA 4AZHA 4I6KA 5FEZA 3EMCA 2JKPA 3UXDA 1SU5A 2GPTA 3CT7A 4HPHA 3UERA 4KT2A 1IXPA 1K1DA 3ZJ8A 4JTCA 3N2XA 4NJJA 3IANA 2POZA 1S1PA 2X40A 2RHGA 3DYMA 3KP0A 3W6MA 1E1CB 3TN6A 4Q8PA 1VKFA 3EBVA 2V2DA 2WSRA 2O0TA 3WQWA 1DBTA 5E0FA 4W89A 1H51A 2H8ZA 1KGXA 1EEPA 1HKWA 4NAEB 1CGYA 3F5LA 3RM4A 1BWKA 4NG3A 1RV8A 1IWBA 3LTSA 2PURA 4PFHA 5HK4A 4K8HA 1AZ1A 1A3XA 3S5NA 4BY3A 4H9UA 5IFPA 4MF4A 2ZXDA 3IJ6A 2QCGA 1FWJC 2J27A 4QNWA 3V18A 4N9EA 1GQLA 4GQQA 5AN7A 1CXHA 1YYAA 3FA5A 2PZ0A 3H55A 3HV8A 1JEZA 2NQHA 4CD6A 1VCGA 5AYYA 4XZNX 3AHYA 2IKIA 1CGVA 4WHBA 2XJ7A 2JALA 1RJQA 4HA4A 1BPLB 2A6NA 4RNIA 1GVYA 1TVLA 1XFCA 1OY0A 2W61A 2VEPA 3WMSA 3FEMA 2XG9A 1UR8A 3W7RA 4FNSA 4MPQA 4HPXA 4LBRA 1ZZMA 4A6GA 5TIMA 1BQGA 1XSKA 2A85A 1UQYA 2WC3A 4L61A 1SZRA 1NWTA 1CB2A 4JNYA 1HTIA 4YYFA 1LG1A 2FDSA 3U0HA 3EEZA 1ONEA 2J8FA 1VQTA 4RLIA 3TMQA 3M6DA 3ARWA 1UUQA 4GUJA 1IIHA 3C4UA 5BMXA 4FP1A 1QWGA 1EF2A 5FKYA 1TPH1 3WBYA 3BZGA 4GZEA 2AGKA 4C6MA 4AD1A 1CPUA 3OJGA 3TMLA 1IE7C 1Q13A 3BC9A 1QPRA 3TJXA 4FB7A 3DG7A 1E71M 1JAEA 2E77A 2PTDA 3GSMA 4AFYA 4WSKA 1NWRA 3PPGA 3PZTA 1G6CA 1OZMA 1YDNA 4KPLA 1ITXA 3BUVA 1SSGA 3C0LA 3PUEA 5EMUA 4KCUA 4AVNA 1UPPA 1LQ2A 2CHOA 2CLLA 2NWRA 5LYRA 3GDRA 4PMXA 5AC8A 1SSDA 4GXMA 3G24A 1FH7A 4X61A 5I77A 4XBJA 5HQEA 4HSOA 2GGEA 1AJ2A 1K7FA 2HRWA 3LPOA 7CGTA 2AQOA 4TUFA 5KZ6A 4DX3A 2WJDA 2A3BA 1EC9A 3BCDA 1PX3A 1KCLA 1QR7A 9CGTA 4L6OA 1QASA 1CENA 2WLYA 2AOSA 3T2OA 1W9UA 5CLTA 3UEQA 4Z1DA 4HB7A 3BICA 4WKHA 3G6MA 4S3KA 4QCEA 2TMDA 5JUVA 1KWGA 1P1XA 3BARA 3GHTA 1B5TA 2QYGA 1DKWA 3FJ4A 4DWSB 3OODA 3WLPA 5FSEC 2O7SA 2D0HA 2PDBA 4M6UA 3UETA 3MC5A 1Z41A 1KQYA 4PSRA 1A5NC 4UFLA 4R3UA 3T78A 3VINA 2F61A 1KXQA 3TP4A 1T40A 3BAYA 2VM8A 2F8QA 4KIEA 5I5RA 1IWPA 1NF0A 1EGVA 3STPA 3VUPA 4LCQA 3ZVIA 2VP8A 3EWXA 1IEIA 1W31A 3VDAA 3DBNA 1D2KA 4GJIA 4TQTA 1O5KA 3WH6A 1J79A 2F84A 3W7HA 1GYNA 4WEVX 3W00A 1XD0A 5F2IA 3HIJA 3CV2A 3ONBA 4WUIA 3FVMA 1V3IA 1TVPA 3CNYA 4PMQA 4JIQA 4X2PA 1KR0A 1HP4A 3NZ1A 4PMUA 4DZ5A 3E38A 4W7VA 4UQCA 3FW6A 4GIAA 2WPBA 5DY2A 3R0DA 2R24A 4Y7EA 5J8LA 3PFRA 2OGYA 4GUHA 2I9UA 3W7DA 4XAZA 3K30A 5A6AA 4O8AA 2I14A 4LNYA 2YW3A 2CZEA 1FWBC 4W8LA 4ZSUA 1CXKA 5DT7A 4F0HA 5F2GA 2E5DA 4KWVA 3WBXA 1KXVA 4B91A 1RQBA 2FB3A 3GXFA 3PP7A 4ERGA 5AHIA 2TPSA 3WLSA 3MMDA 3M0YA 2VDGA 2PD5A 3QPZA 1OCJA 1JPMA 2ZXQA 3T0CA 5EMKA 3ANVA 4V15A 1ODZA 3GZ3A 4PC8A 5FA5A 3C86A 2Q3OA 4HIBA 4HSHA 4GC4A 1C7TA 1FDJA 5D38A 4D9PA 1OFQA 1DEDA 3VZYA 3QLDA 3WD3A 1RLCL 2V8ZA 3IAPA 3GM8A 1A4LA 2YDAA 1JXKA 2BVYA 1B3VA 3G18A 4JFSA 2B7NA 3WDRA 1UWUA 2W62A 2CITA 3R8GA 5D09A 1BYAA 2Y1HA 3FV9A 4LUSB 5M2FX 4PE8A 4KEZA 2FZ8A 4A29A 5C0QA 1UKOA 1FH9A 3GO2A 3QLLA 2BWGA 4JYEA 2BNJA 2XGZA 3FCPA 1PBGA 2XVPA 4DAIA 1XGDA 3B8DA 3ERPA 2MANA 1XIFA 5GVJA 2VWTA 2W79A 3TAOA 3MUAA 1U5HA 1LT8A 1V6YA 2IPGA 2ZA3A 1XLGA 1KGUA 1YTKA 1JUEA 1LBMA 4MADA 4XAYA 3G1AA 2C71A 2ZZ6A 4QP0A 3MHGA 1C93A 4UR7A 3MW7A 2PF0A 2VNCA 3H12A 1A5LC 1QI2A 2VEMA 3PZIA 2WLZA 1MVYA 1UR9A 1TELA 3FXYA 4NZ1A 3GFZA 3GDBA 2EPMX 4IL2A 3KRSA 4DZIA 3QGKC 5RUBA 2Q3RA 2RGLA 1HFBA 1W54A 2Z7KA 3EZ4A 4G9PA 5K2ZA 3TK7A 1R3SA 4ZODA 1W1ZA 4M29A 3N14A 1WXJA 5DN1A 4O15A 4LUYA 3S5ZA 4MZ1A 1TA3A 2ZX6A 4G7FA 1UA3A 3B0VC 1GVRA 5FJUA 3F2DA 1LQ0A 1YBQB 1T6MA 3SEPA 3EWDA 1VCVA 3R4IA 1GQJA 1FWGC 1NDZA 5KTLA 1G4PA 2GJRA 3EWWA 3PTKA 1R3VA 3VD4A 2PCEA 5G2HA 5IDIA 5JMUA 1BLIA 4IM4A 2G3IA 4HSNA 3RYSA 4U10A 4REQB 4BQ2A 4K1WA 4Q4MA 5EMYA 3OVPA 2YL9A 2WWCA 4E8DA 3NR0A 2GJNA 2PTXA 4L56A 5AFDA 1Q6EA 5KZEA 4QE1A 3S46A 1I60A 3IJ7A 3P0WA 3QGVA 4B9YA 1XH1A 3DX5A 3S2JA 1FP8A 1U33A 3EPOA 1QRQA 2VFDA 2DSKA 4ROQA 1L8PA 1GHSA 2Z29A 2DORA 2VXNA 4E2VA 1YX1A 3LCWA 4O1CA 3SN4A 1IGWA 3LN3A 4BQ3A 2QPXA 2A4AA 5F1UA 3ZT7A 2HJPA 3TYCA 7ODCA 2AAMA 4O10A 2JGQA 4N6FA 1EFZA 5DANA 4U5KA 5DQPA 4JHMA 4UTUA 1Q45A 3R7MA 4WKAA 3REQB 1KLZA 3ORWA 1BGAA 5I06A 2C14A 4LUTA 4ADSA 2J78A 3BTNA 3K4DA 3R13A 4BA0A 1HG3A 5A6TC 5A6JA 5BRBA 4A3YA 4QQ3A 2QQ6A 1PTGA 1MXGA 2FB2A 1J96A 4I9TA 5AHFA 1GQIA 3RCMA 2G97A 3VCRA 4YHGA 4PCNA 1BEUA 3IV3A 3C2EA 3H7VA 3AYRA 1CXEA 1XG4A 1V77A 5LGZA 1RSCA 1S3TC 2YB1A 3BLKA 1J5TA 1G7VA 4H01A 1WPCA 3TC6A 3P67A 5D2YA 1KBIA 2MUCA 1CXIA 5ABEA 2XIIA 1OM0A 2BOEX 3CGTA 2DFAA 4PMDA 3RK8A 4ES4A 3FEQA 1SJCA 2YCJA 1EBGA 1ITQA 1HJXA 1IZJA 2VUNA 2PA6A 4M24A 1YXYA 3LRLA 1NTHA 3A64A 4DXXA 3E02A 4NYYA 1POJA 3WQDA 4BF7A 3VKDA 5KEZA 1T8QA 2WJEA 1TQXA 2XN1A 1OFRA 2ZX7A 4AZCA 3KBSA 1DIKA 3CUZA 4IJCA 1W9DM 1BD0A 3O0FA 3ONCA 1XRVA 4LCRA 4RKAA 5DFAA 4GNVA 2ZZ4A 4HOZA 5I78A 5IBXC 2OG9A 1Y5XA 3PWAA 1MW3A 3DFNA 4PODA 1GQNA 4RX0A 4FR6A 3SZ8A 3M0VA 3WNPA 5E09A 1IEVA 2DUZA 3N3TA 1QI5A 1KBBA 4RDYA 1VRDA 3FYOA 2H9AB 5JBFA 4Y9OA 3B8WA 2BVWA 3DDMA 1HVQA 4LB3A 3WF3A 1BYBA 3M5XA 4IIDA 4Q7NA 1LT7A 2C79A 2Y62A 3A5VA 3GIPA 1VFHA 1DXIA 3SN1A 4K68A 4A3RA 2JKEA 1G4EA 4Z2KA 3ARPA 3JR2A 2DIEA 4R9XA 4R7OA 1RH9A 1XQLA 3O6YX 1GPWA 4IT1A 2QCDB 2Y7DA 5B7ZA 4GH1A 3L5LA 5DO8A 3SO7A 2C3ZA 3JZEA 1VJZA 2WVTA 4FXRA 2ZUMA 3W82A 4EPDC 1UW9A 1KV5A 3WDHA 3E3HA 1LRTA 3GRIA 4QFUA 2OO0A 4LS2A 2D20A 1KM6A 2VFEA 4GXPA 3CYJA 3SECA 2A2IA 1LL7A 4S3FA 5D2WA 3UPWA 2DEPA 1EC7A 2A3LA 2Z1KA 4P7RA 3WLRA 3BQ6A 2VO5A 1OC7A 2GDVA 4TV6A 4YHEA 3BG3A 4LVGA 2I5QA 3PY2A 3TDFA 1B0IA 3EWCA 3BURA 4QQUA 3W1XA 2VD9A 3IWPA 3THDA 4NL1A 1AZ2A 3VFLA 2GLKA 4NYUA 2DZWA 5G1TA 3UBPC 3M5YA 4LEFA 1X38A 4IH3A 1VJIA 2CNCA 4LWWA 1A49A 1QNSA 3DAQA 5E6YA 1GTHA 2DSUA 3VMPA 1MYRA 4ZQOA 4JN8A 4QCFA 3KUMA 4ZQCA 4XUYA 3MSYA 3SCTA 3TYUA 1QPNA 4RV8A 1VBGA 1Q3NA 3TH6A 2VKZG 3WELA 4JY9A 1AQ0A 3SB0A 1TMLA 3CM4A 4ZXLA 5C9WA 2ZRVA 4M6PA 2NUXA 2WHJA 1AD4A 4PTDA 1QJWA 3LBOA 4A3QA 1XCWA 3FOKA 1JZ4A 5I23A 3ZIZA 4K2SA 1AD1A 3BSGA 3P2VA 4YWIA 3E5BA 1JG9A 4ZBCA 1GZJA 3NM3A 3CQKA 3EX1A 3I6TA 5M3WA 4LF2A 5FEPA 4FF5A 4XSLA 4JAWA 3E2QA 2OTDA 3EDKA 5AKQA 4RPPA 3SUVA 3MDWA 1TMHA 2JFEX 4YMZA 3KOYA 2VD8A 2R9RA 3VGGA 1PTDA 1NDWA 1W3KA 5E6ZA 1YPFA 1JZ3A 1XYAA 3O1NA 4HOXA 2VOTA 3RJXA 1P6BA 3DC8A 4GZIA 3A9BA 2ZBTA 3CAQA 3CXOA 2Z4GA 1JF6A 4BK9A 1HNYA 2BBFA 5AC4A 3S5SA 2HTMA 1ZB5A 1VFSA 3TWBA 2J66A 3VMOA 4TU1A 4UFHA 1XBZA 1TTQA 4J3XA 3L4WA 1KRMA 4L65A 2CBUA 4UTWA 3D3AA 4U2YA 3VDGA 2R1NA 1E6ZA 4MB5A 5D05A 3GLCA 4N02A 1GVQA 3CHCA 2AQVA 5ECUA 4MZ8A 3W3OA 1R87A 2I17A 4D6EA 2OQYA 2V0TA 2EF9A 3MMUA 4LBUA 4U3CA 3TJIA 1GVOA 1ISVA 1ZCOA 4PTVA 4B2DD 5DT5A 4OUEA 2ZWZA 1OGGA 2GSEA 4DNMA 3DI0A 1JI1A 1F3EA 3THUA 5KITA 4AZ5A 3VVGA 1C9WA 1CEOA 4ZFCA 4LSBA 4GCXA 2VOMA 4LRTA 2P88A 5FJRA 1J01A 1PSCA 3SUTA 1E6SM 2J24A 2G0WA 4IL0A 4IMAA 4HU4A 3WF4A 4JCLA 1HP5A 3KE0A 3VAVA 4B90A 2X16A 1P0KA 4DO5A 5BXTA 5D9PA 4GNKB 1MUWA 1Z69A 1FXPA 2HNHA 4TVUA 2XDFA 1OSEA 1VB9A 1VBHA 3RILA 2WB5A 1JD9A 2P8BA 2FFCA 3NQDA 4BJHA 3SIMA 4BFAA 2DT0A 3PG8A 3ZJ7A 1KV8A 4J9JA 3MU7A 2DSVA 5LNRA 1CGXA 1CZ1A 1B3YA 1GYMA 1LQAA 1FWDC 1RD6A 3ECQA 1ZBVA 1KTCA 3OEXA 4G56A 3N9SA 4E3TA 4JBRA 3W84A 1W1A1 1NOFA 1RUSA 2GWGA 3NM1A 4RXFA 1B4KA 4NVTA 1Q2RA 2IXVA 3VU2A 4IGSA 3S8HA 3S6DA 3CB8A 3U2EA 3DOPA 1G69A 1MW0A 2X41A 1EPXA 2E8YA 3JU2A 1TMQA 1ZY9A 3VUSA 2XHYA 2XIQA 5FIPA 1UR1A 3LM3A 2OKTA 1MFUA 4ZENA 3TSDA 4IG2B 3V36A 3PUGA 1JXJA 3DGBA 1R30A 3GYCA 1RBOB 4I6VA 4O52A 1TPDA 3VIPA 2O9RA 3VA8A 1MXDA 3HU7A 1Q8JA 1UD2A 5CG0A 3M7SA 3E2VA 1TTPA 2WMIA 2C16A 3CAWA 1NEYA 1DE5A 3MQTA 2YKKA 1C8XA 2YZRA 1J11A 3BCJA 4DJEA 4BF5A 2FPVA 1JDDA 4A05A 4HHPA 4XB3A 2OPJA 3UVIA 3V0UA 1IHIA 2OEMA 2QMJA 3DFPA 3LZ5A 4WD0A 4FLQA 3KVJA 2FYMA 3E0WA 5AYZA 3KWXA 8RUCA 4N4PA 1OFEA 1XCXA 1FQ0A 2QCFA 1XBVA 4HMEA 3FSTA 4R53A 4B5UA 2A3AA 2Z7GA 1LWIA 4QLJA 1JL8A 3PM6A 2VYOA 3GXPA 3UESA 3PZMA 4QM1A 2ZZ2A 1RJPA 4F8XA 1IXNA 3TOPA 1YPXA 3T05A 1X1OA 3WLHA 1EL3A 5CCZA 1MZRA 1GJPA 3UCQA 4IMEA 4R7JA 1ZP4A 2QULA 2FZDA 3GQYA 4KMQA 1MDLA 2NWSA 2W5FA 2WCAA 2YCKX 2EG7A 1XRTA 3CK5A 1CT5A 5T26A 3O6DA 2QF8A 3DUGA 4X0VA 2PGWA 2F6UA 4G1KA 3BSMA 4AIOA 1TIWA 4DYJA 4UMBA 4BQ5A 2DGAA 1GKQA 4O16A 4O18A 1BRLB 1QVBA 1K8ZA 3VNZA 1JPHA 2D22A 4L9ZA 2Z1VA 4JZ5A 1LBFA 3S1WA 1VC4A 3KTSA 4FS9A 4LUJA 4IXHA 5CZ0A 3HPFA 3ZR6A 3VKKA 3RXZA 1ICSA 4O17A 1KBJA 5FJOA 3G8EA 4FK9A 4EPKA 1YNPA 3DESA 3GZAA 4B5WA 1RP8A 5KETA 3CUFA 3T4WA 1R5YA 1BGGA 4JHOA 1ZQ5A 3B06A 4TR9A 1SQ7A 4AD5A 2GYIA 3TQ0A 1T5AA 2PWUA 3SQSA 2EQDA 1RPXA 3NXFA 3WQ5A 1G4TA 2AGTA 4DBWA 3A3HA 2PZNA 2OZ0A 3CIVA 4LGXA 2BY3A 3SCUA 5K9CA 1LRNA 3AWNA 3VO0A 4GBDA 2WZIA 4JHZA 3W1QA 1SR0A 1MRQA 3QFEA 3GVGA 2Z6JA 2VZVA 4XWUA 1B3XA 2QCHA 3T0TA 1OD0A 3G3DA 3IIOA 1WDRA 1OFOA 2J13A 3WK2A 4BKNA 4YCPA 4P61A 5DCDA 4FALA 2WHMA 3AMGA 3Q65A 2EBNA 2FLIA 4IMFA 3KOWA 4OQVA 4R9OA 3OQ8A 3HO8A 3PG9A 3OZYA 3VE9A 1V4YA 3QPYA 3GIYA 2YDRA 3HG2A 4HA1A 4CD4A 3RIKA 1OFAA 2PE4A 3EPNA 3T8LA 2DVXA 2ZXBA 5G1MA 5FCZA 4GC3A 4QJ1A 1XH2A 2VQUA 1KCXA 4NX5A 6TIMA 1TPFA 1RQEA 4UQDA 3W7LA 1ZNNA 2HNEA 1XHGA 5EYWA 4DJEC 4QISA 3QXBA 1TPUA 1S2CA 2VI0A 2PDYA 2ZUTA 1DJYA 2F2KA 2Q09A 4C1NA 5LKYA 4PUWA 1EOMA 4R88A 1GQKA 2DH3A 2QCMA 4ADUA 3JW7A 2XSBA 2QCLA 4Z2GA 2PLKA 1RD5A 3FA3A 1ZRQA 5LGXA 3P0XA 3O0KA 3UNDA 3L2MA 3T0AA 4HTBA 4PMOA 4M7TA 1FFQA 3G0SA 3MMWA 3RR4A 1WCGA 4XTDA 1LOSA 1BVWA 3GH7A 4KEMA 3WH7A 5JBEA 2DW7A 5ABTA 1IR1A 2H6RA 3WL0A 1AMKA 3WH5A 3AQUA 5A95A 4LCSA 3M0MA 4MY9A 4TX8A 1CECA 3E0FA 5MKGB 4ZO8A 3CQJA 4UC5A 4RZ4A 3U5YA 1DJQA 4UTIA 1WDPA 2QJMA 2B7OA 3H2EA 2WOQA 3KLLA 1SMDA 1IWAA 3QFWA 3RNDA 1WQ5A 3NQ7A 2GOUA 4JIIX 3LG3A 4KETA 4JL2A 1OT2A 3OQEA 2JK2A 3HG4A 6REQB 4UTJA 2VR4A 3G0UA 1E43A 3W26A 4LT9A 5F1VA 1XIMA 3EAUA 4IPLA 2VGGA 3UT0A 1WBHA 1P6CA 2X0SA 5LHEA 3CYVA 3TAKA 1V7YA 1LCOA 2WZHA 4A4AA 4FXSA 3WQFA 4FF7A 1GOMA 2PEVA 2BY2A 2PWDA 5I07A 1RBLA 5C9UA 4CEUC 3NQ2A 1IEWA 1Q6GA 2CLKA 2GDUA 1PX4A 5J04A 2PP3A 3UZWA 3TE9A 1Z42A 5CLWA 1W9XA 2P5NA 1EJRC 4K7YA 3T6CA 4JX5A 1E55A 2OJPA 3FXGA 1F3WA 4MHBA 4HHHA 5D9NA 3NQVA 3M4HA 1LWHA 2WQPA 1K6AA 3L9CA 4NZCA 1S46A 4ASTA 3KZSA 3STEA 1BVZA 1I75A 3SI9A 4QAIA 3TXVA 2QMKA 3UY7A 3VD5A 1XYLA 1E4LA 1GKRA 1YKWA 1EO5A 4AIUA 4U31A 4UTKA 2CW6A 2J77A 3M6YA 4WQ6A 4YVXA 1NDYA 3EXTA 5A8OA 3F4DA 3MP5A 4AWEA 1P0NA 1SO6A 3DKLA 2ISVA 2QZRA 2YBUA 3RLGA 3R11A 4JQ3A 1K7XA 4GXWA 1UMYA 1YHTA 2PP0A 2X1UA 1OF8A 3C52A 3MI2A 1PE1A 3OLDA 1JUKA 3LBCA 1UJPA 4CUCA 1B31A 1WXYA 3VIHA 7REQA 4IZGA 1JZ2A 2OZ3A 1H0GA 2PB1A 3GX9A 1DJWA 4MYAA 5CEWA 1TYGA 3RJYA 5JH1A 2P50A 4AWUA 3DFSA 1X98A 3BOFA 3QV8A 1YADA 3H4GA 3A9IA 1LOLA 1T96A 4E4UA 3E12A 3A4WA 3N2BA 3RLHA 1TZ7A 2Y85A 8XIAA 1N8IA 4WY0B 4D6CA 2CHNA 3DYOA 2D0GA 1BKHA 4IX2A 3DG3A 3GC5A 2YFNA 3L4VA 3OLGA 4LEQA 4M82A 4RNHA 1UR2A 4J35A 3EGJA 3KOFA 3PZGA 3WJZA 1K9TA 6XIAA 4DJDC 4PB3A 3C56A 5A2CA 3BO9A 3R6IA 1AG1O 3GDTA 1NWUA 2OCZA 1GG1A 2VCCA 1KFWA 3V3WA 5JU6A 3I3EA 2DIJA 2BDQA 1M7XA 2XVKA 4DHGA 1XDMA 1ZAIA 1A47A 2EJAA 1WUFA 2W91A 2E25A 3ITGA 3EMQA 4L4PA 4BWLC 3P62A 3AIQA 5DELA 7ENLA 4LALA 1IR2A 4H04A 4FA3A 5HA7A 4CLMA 1OK4A 5FESA 4XBKA 5EA9A 1XIHA 2X2YA 3P8IA 5DF0A 3BLFA 4JGDA 4GZ7A 1EGZA 1SJBA 2GK1B 4FO4A 2QGHA 4JL1A 2XUCA 1NFGA 2CLIA 3TCSA 4G6CA 4PULA 2WHKA 4YLWA 2XFWA 1KLYA 4H8NA 4R27A 5D2TA 2VENA 1AW5A 3AICA 1Q6DA 2Y63A 5CGMA 2FPTA 1VFMA 2FFIA 4GX9A 4KGLA 1TWIA 4GI9A 2QAFA 3ZLHA 4F4RA 1NQ6A 4LW7A 1EIXA 2OX1A 3E6EA 4ZGYA 3RRXA 1UWAA 3UGRA 1L6YA 2ABAA 1R3RA 2IQTA 1MQPA 4H4IA 4C6BA 1F6PA 2VX7A 2I9EA 2P3EA 5HR7A 1ME8A 1KFJA 2YW4A 2XSAA 2J7FA 2I16A 1BHGA 3PWGA 3CL8A 4UMAA 4QLLA 5BRPA 2PODA 2VGBA 1WB0A 2RJGA 4FNPA 5C2XA 4WDWA 3HGSA 3B8IA 2G3JA 4JKKA 1CI1A 2DZUA 3SQMA 5C55A 3UJ2A 3QM3A 5DEZA 4V27A 4D8ZA 2QLYA 4DJDD 1ISXA 3SUSA 3VKJA 4I9MA 1UZ1A 3N6HA 2NXGA 2VR5A 1HF6A 4C6IA 3WNLA 3FGCB 3WD4A 4R34A 2D1ZA 1OD8A 3CEPA 1A0CA 3WLTA 2WSQA 1QNOA 3W86A 2ZFAA 1XWYA 2HVNA 4GINA 2G3FA 4UQ9A 1MNSA 3NL2A 4K8GA 4U3AA 3O2LA 1UR0A 2D2HA 3VPLA 1QI0A 4XKYA 3CLMA 4E0CA 1ZAJA 1KCKA 3ITXA 4AC7C 2FMNA 1H7NA 1O6IA 4HPNA 3WDJA 3G1VA 4S39A 2DU2A 3CEUA 3KX6A 1W8GA 4IP7A 3UYCA 3CO8A 1UOZA 3GH5A 1SFJA 4P8XA 1J93A 2XH7A 3HPZA 3SQLA 2WPGA 1YDVA 4CNOA 3EX3A 3CAVA 4QSHA 4O50A 1CX9A 3WD1A 3W6YA 4Q6JA 4X22A 3HQPA 4JTTA 3GHSA 2CLFA 1E3XA 4QXIA 1G67A 1VLWA 1X97A 2XFFA 3N19B 1E0UA 2C6QA 4H00A 3WSUA 3GTHA 1OCNA 3WK0A 1IQ8A 2VURA 1SW0A 4HU8A 2JEQA 3R94A 3L67A 4IGMA 1FWEC 3QPEA 5GNZA 1FRBA 2QUTA 3Q4DA 4AWSA 4NZ4A 4XIAA 4I7UA 1TIMA 1I6NA 2PTYA 2YA0A 2XH0A 1MWOA 5JXQA 5TNVA 2QUNA 1TV4A 2A3HA 1QNQA 4E2OA 1OIMA 2QAPA 1FCBA 1VH7A 1QHPA 1Q4NX 2PDMA 2WMGA 3B4UA 4WSHA 2VWSA 1W5PA 2R8WA 1OYCA 5F4WA 4C7FA 1HL9A 2TAAA 4E8GA 1E73M 4TXEA 3UR8A 1W3NA 4ZQPA 2XN2A 3D0CA 3VGEA 4A35A 3NL5A 1W3TA 5HATA 3NPUA 4ZSTA 4OUIA 4S3GA 4PR4A 2PWEA 4W8AA 4F2UA 3LYEA 1Q85A 3W7KA 1HKMA 1G0CA 3QZ6A 1UHVA 5F2MA 4JR5A 1VYPX 2A79A 1DWIM 5SWUA 4UTTA 3IV8A 5C5YA 4QJ4B 5HINA 3KL3A 1W9PA 1TJRA 1JZ7A 3TC3A 2EKGA 5TBOA 3NVDA 4Q8UA 1SPQA 5LA0A 5AB3A 2GJPA 2GQAA 3NPWA 5BNKA 3H23A 2ZA2A 3T0BA 3LUTA 1US0A 4IXXA 5FAJA 1JNDA 3WNKA 2HMCA 3U2OA 1ONWA 2GWNA 1VHCA 1W8SA 3TLQA 1FOBA 2ALRA 3DN5A 1J9YA 4ICCX 2JEPA 4EXAA 2GOKA 2XINA 1JCNA 4IP5A 4MLJA 4L64A 1PIFA 4DJFC 1F05A 2RDUA 1VP5A 1CGWA 3K13A 1AFSA 2XM2A 2Y2WA 3R0UA 2WSYA 3ZXWA 1EX1A 1XX1A 4S1FA 3BW4A 1UP3A 4BCEA 1WDSA 2V3GA 3S9ZA 1OC5A 4DY1A 1MUMA 2DZAA 4K7VA 2P10A 5E93A 4GUFA 3GAYA 3BLLA 2ESCA 3AXHA 4AVOA 3GU2A 4OBRA 5A2AA 3LDVA 3CC1A 1YLVA 2PPGA 2BX7A 4B15A 1QW7A 5A6LA 2D2OA 3W7JA 1UBPC 2J9ZA 3UZXA 4D72A 2XGIA 1KM2A 1JFHA 2J4GA 3MI6A 3WJYA 2QEZA 3S1VA 1R38A 3TTSA 4MWAA 4Y9MA 3O07A 4GQGA 4AC1X 3IAQA 3UQNA 5CC7A 3LQLA 4N2YA 1H7OA 4GQ0A 3W85A 3W9ZA 4MNMA 4NILA 3UZZA 4O12A 4KRZA 4QJ5B 2O56A 4UQAA 3A22A 3V7PA 1JI2A 1K9FA 1YNQA 4PCTA 4AHQA 3M0IA 4UUIA 4HKPA 3GU9A 3W1PA 1U5JA 2FVKA 2JIEA 4X3ZA 3MI3A 4ZZ9A 4ZFMA 3MDUA 1ZLPA 2A21A 3WQEA 2J88A 4C90A 5FJPA 2FJKA 5KZDA 2XYLA 3AUOA 2XVNA 2V3EA 3K46A 1AODA 3UR2A 2J9XA 1Z7AA 1QAPA 2QJNA 2ZX5A 4XKMA 4GY7A 4YVVA 4GKTA 2F6KA 1JF5A 2BXZA 2VQTA 1B90A 4HYWA 4O0KA 3UYIA 4KQNA 4OZOA 3QTGA 2MNRA 3MJMA 4XV0A 5D02A 5DMNA 4JQ1A 3JVAA 5C7HA 4U4MA 2ACRA 2RDTA 4DJFD 4TX6A 2Y5SA 4D71A 2E40A 2QJIA 3LY0A 1W1VA 3IGUA 4YPJA 3M0LA 4TTGA 2GJLA 3U7VA 3SCVA 1Y7VA 3B03A 4N9BA 4C60A 3PUOA 1S1RA 3W2KA 3NQFA 2PDIA 1CIUA 3H54A 1TPWA 2R1LA 3LHTA 2BASA 4C5ZA 1V02E 1ADSA 2OLSA 2QJGA 2WC7A 4S38A 4KH2A 3K8LA 3LXCA 1RCXB 1E5NA 1KC7A 4CQ8A 3L21A 4AYSA 3FLUA 3GXNA 3IUDA 3NQEA 2HISA 1QI3A 1MO0A 1ELSA 1UIPA 1XLFA 5TF0A 4WF7A 3A5FA 3N2TA 4XIMA 3WK1A 1HL8A 1XFBA 2TYSA 4A2SA 1K70A 1M3UA 1T41A 3AJ7A 2W6RA 3AYVA 3O05A 1FWCC 1E1FA 3A4AA 3RN6A 4UR8A 1Y8BA 4L5ZA 3T1GA 1PYFA 3FDGA 1IYXA 3I65A 3SSJA 3QZAA 3FHAA 3OZMA 2X42A 3L4TA 1AUSL 1W1YA 1A5UA 4EAMA 5A8PA 3IGSA 2VRKA 1FVPA 3MWAA 1IIGA 1O66A 2GVEA 4XZBA 3GTXA 1JYVA 2AQWA 2OX4A 4XD6A 1RA5A 3EX4A 2CLMA 2DDXA 2CXGA 2DZTA 3DEQA 4EIVA 1LP6A 4JEJA 4DO6A 1BYDA 4F0LA 3W38A 3L2LA 1YQ2A 3N04A 1RCOB 1QBAA 5M17A 3R12A 2UZ9A 4FMVA 2VELA 1BSLA 3ANYA 3AMDA 3B05A 4KCWA 4GY1A 3ZR4A 5DXYA 1N82A 3T0DA 4MY8A 5A6BA 3VOIA 1GOIA 2HK0A 3KL5A 4FLRA 3THQA 2O92A 1BYCA 3WF0A 2VT0A 1PWLA 5BZAA 3DHUA 1XC4A 3XIMA 1V03A 2D2GA 3R43A 4IX0A 3BLDA 3CWOX 2XH4A 3DU0A 3CTTA 4HGXA 3LPPA 1DQWA 2G5WA 3VX0A 3KCJA 5HPCA 4BEUA 3EA2A 3TR2A 5HNNA 1XICA 3GHUA 2PAJA 1NWSA 5A2BA 5JQ9A 3A4JA 5IHRA 4Y8FA 4P8UA 1ZALA 1T99A 3W2NA 2FHBA 4L4OA 1E6PA 1UBSA 1UP0A 3R2GA 1LLZA 3UG5A 3PJXA 3EB2A 3FS2A 2REQA 3L4ZA 4OV9A 1B3WA 2FVLA 4FOKA 5D8ZA 4F0SA 2EKCA 3EXRA 5DLCA 1XYFA 3IEBA 3B8VA 4D6FA 1AW2A 2J7EA 4GO9A 5D37A 2E67A 3LGDA 4RW5A 1Z6KA 3ZS4A 5JH2A 1V51A 3NSXA 4ZOCA 3L4XA 4XAPA 3NZQA 5LNWA 2ZUNA 5U7SA 1TJ1A 3A21A 2JGYA 5CBBA 3PHAA 2VFGA 1XUZA 2PUZA 4JEQA 2ZUVA 2ISFA 4XQ6A 3VE7A 4B3ZA 1TZZA 1F8MA 1NAL1 1TPEA 1BTMA 2PLMA 2XFRA 1VBRA 2VDIA 2BY1A 4PBGA 3NA8A 4ZB2A 3HFTA 1DJGA 1PTAA 1GG0A 4UNLA 4ZE5A 1R2TA 4LUTB 2ACQA 1SM9A 1XXXA 1H2JA 3OPSA 4M19A 2ICSA 3BZJA 3GVWA 3G3MA 3TFXA 8CGTA 3I68A 3HBLA 4XO6A 4AMCA 5EL1A 3N2OA 2NSOA 3BG5A 4AHPA 2X1RA 1F74A 3NL6A 1FKWA 2ZIDA 3S47A 3LPGA 3UZYA 3RHGA 2J8GA 5BYWA 3DXIA 1XDJA 2OLHA 3DFHA 1OADA 1KFLA 3PZ9A 3GXMA 4UNKA 1FH8A 2OR2A 5HR6A 5DMYA 1EHNA 3UP8A 2OB3A 3MUCA 1XM3A 2Q6ZA 5IXEA 2HK1A 4ONVA 3V1PA 3W7OA 1XPYA 4C6LA 2PU1A 1BWLA 3A3XA 3CZGA 2YYTA 1JULA 4C6NA 3O06A 4OVXA 4ZO7A 4PCPA 4GGHA 3UCCA 4B5SA 1G7UA 4IPIA 3BVJA 5CPLA 1MEHA 3UVAA 1OCQA 1HGYA 1D9EA 1CXLA 4AZCB 3SCQA 1LG2A 4HA0A 2WKGA 2IXUA 3PSWA 3OBAA 1UUOA 4S3DA 5I79A 4CNPA 1KXHA 3UXLA 3KDNA 3V5OA 4LUSA 4GFSA 1VEOA 2BLEA 3UFYA 4XSMA 1CGTA 4HNLA 4GMEA 2YXOA 1O5XA 3L0GA 2Q8ZA 1V8EA 1JQVA 5F7UA 2FHCA 1DYSA 3RCNA 1HO4A 4TO8A 5A8QA 2PDGA 5CZSA 3VNYA 2CZFA 4XTIA 1OFBA 2BXYA 2DPEA 3ITCA 4RCXA 4MJ4A 5C9ZA 1TTIA 1H60A 5JIPA 3WNOA 1OG6A 3EWZA 1TZ9A 1ZS2A 1L6SA 3HQ1A 3QOKA 5LNSA 3OYXA 4Q8WA 1LBLA 1UD4A 3MHUA 2VMFA 3JS3A 3WJSA 3GXDA 1YDOA 1KNWA 3SY8A 3KBJA 3ITTA 3ARXA 2XZ7A 1M1BA 4TVCA 2HEJA 3B0XA 3NDYA 3LXBA 1L0PA 3WUFA 3B8TA 2AKZA 2HXUA 3PBGA 3B0UX 1DXEA 2WNQA 1OFPA 3N2MA 4N7QA 3MBDA 4DWSC 3OW1A 4DUXA 3CV1A 3W23A 1PDZA 1QW9A 3CWHA 1EO7A 1ADOA 3W7NA 1YTDA 1RVGA 4NY2A 1E1EA 4L4LA 3GR4A 2IUZA 4CVWA 1HJWA 2BFGA 1RHCA 4RE2A 1N8FA 1LM1A 3GR8A 1FHUA 3CPRA 1ZJBA 3EOOA 3VKAA 3DBPA 1K9DA 3APYA 2O4MA 3TXZA 3H2MA 3W76A 4JFUA 2IMRA 4B4FA 3KBMA 5LSMA 3W01A 1IEQA 1SO4A 4WKFA 3MJYA 3PB0A 2Z24A 3M44A 4MIMA 4S2CA 2VDHA 3GG8A 4I9JA 2VL4A 3O7UA 4C6QA 1XIDA 1ZFJA 4JTAA 4ZA0A 3QH2A 1EXBA 4LC6A 3NQCA 4EKJA 2WBGA 3MUY1 3WCZA 3L4YA 4ROPA 1GEQA 4AAJA 4US5D 3QSRA 3OA5A 1WUEA 1UP2A 1HN1A 2V9DA 5LIWX 3W2MA 4KCTA 4OGZA 4PUNA 1WZKA 1P1MA 2QJJA 2QDGA 3SRDA 1OC6A 1KW1A 4Q8TA 2ONEA 3K4WA 4Q32A 2G8ZA 4UBPC 2HXTA 4AXKA 2QPSA 5AZ1A 3VIIA 3HQNA 1W1IE 3WUEA 5FL1A 3GVVA 2ZVIA 3MUXA 2JE8A 1TE6A 2XIOA 4DWSD 3G6LA 4DLMA 1REQB 3TQKA 4PMZA 1ZGDA 4PMYA 3JUGA 3KBWA 1JYXA 1W9VA 4HMNA 4NI3A 4TTUA 3HOJA 1UYQA 1CCWB 1JPIA 4ACZB 5C6MA 2DUXA 1H62A 1RVKA 3O15A 3AUJA 2WMKA 5H8MA 2OQLA 3MP3A 3IARA 4XAGA 3LK6A 2ZRXA