2JEPA

Native family 5 xyloglucanase from paenibacillus pabuli
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
363
structure length
363
Chain Sequence
ADASQIVSEMGAGWNLGNQLEAAVNGTPNETAWGNPTVTPELIKKVKAAGFKSIRIPVSYLNNIGSAPNYTINAAWLNRIQQVVDYAYNEGLYVIINIHGDGYNSVQGGWLLVNGGNQTAIKEKYKKVWQQIATKFSNYNDRLIFESMNEVFDGNYGNPNSAYYTNLNAYNQIFVDTVRQTGGNNNARWLLVPGWNTNIDYTVGNYGFTLPTDNYRSSAIPSSQKRIMISAHYYSPWDFAGEENGNITQWGATSTNPAKKSTWGQEDYLESQFKSMYDKFVTQGYPVVIGEFGSIDKTSYDSSNNVYRAAYAKAVTAKAKKYKMVPVYWDNGHNGQHGFALFNRSNNTVTQQNIINAIMQGMQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Characterization and Three-Dimensional Structures of Two Distinct Bacterial Xyloglucanases from Families Gh5 and Gh12.
pubmed doi rcsb
source organism Paenibacillus pabuli
molecule tags Hydrolase
molecule keywords XYLOGLUCANASE
total genus 144
structure length 363
sequence length 363
chains with identical sequence B
ec nomenclature ec 3.2.1.151: Xyloglucan-specific endo-beta-1,4-glucanase.
pdb deposition date 2007-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2jepA00
3GYCA 3MUY1 3ECQA 5BXSA 3UG4A 3CMJA 3W37A 3MS8A 3W28A 4CU8A 1KXTA 1X1NA 4Z2HA 2W4XA 3VGGA 3U5YA 1VEMA 1NARA 2BVDA 1XGZA 2CNCA 3UCQA 3WDPP 1GJUA 1W3HA 1MQQA 3ARXA 1HL9A 5A6MA 2QLYA 3II1A 5A8QA 1CGVA 2PWGA 5HDRA 4CN4A 4TTGA 4JFWA 3AIVA 2W66A 4MJ4A 3WNOA 3PZVA 3VMOA 2XSAA 3AHVA 2DIEA 1BQCA 2J8FA 1FFRA 2F8QA 2J77A 2QV4A 2NT0A 3SCVA 3AJ7A 1BF2A 3GBDA 1EH9A 1QVBA 2ZUVA 3L4ZA 1H41A 1OM0A 4TX8A 5E70A 1LL7A 3T0AA 1J9YA 4AZ6A 3SIMA 2DQXA 3WIJA 4PUDA 4W8BA 3CO4A 4CD6A 1JI2A 2DGAA 3BAKA 1US2A 3PZUA 4HOXA 4FLSA 4GQQA 4AZCB 3T2QA 1I1XA 1V6UA 1TE1A 1QNOA 3ZT6A 4D71A 2CXGA 3GDBA 4EAMA 4D6CA 4XX6A 4XZWA 1SR0A 2DT0A 2VCAA 1W2VA 1W9XA 1UWQA 2CBJA 2G3JA 3W6MA 1B3YA 1C7TA 4MADA 4ZEPA 3TTYA 1JZ6A 1LWJA 5GQBA 2VMFA 4W93A 1E56A 3AZTA 5HNNA 2DIJA 1UD2A 4GO8A 4UQAA 2D20A 4KH2A 2ZE0A 2WB5A 1ZBKA 5A69A 2V3EA 5C70A 1D3CA 3VIGA 4PEEA 4HP5A 1UWRA 4PTWA 3A4AA 3A6OA 4UFMA 3UG5A 1UQYA 5BROA 3GM8A 2YL5A 2XGBA 1E5JA 3T0DA 2PB1A 2E9LA 4JCMA 3M6DA 4MDPA 3WUGA 1HT6A 1LF1A 1UA7A 4JKKA 1WDQA 2VC9A 5A6BA 1Y7VA 2WKLA 4B3LA 3VGHA 4CU7A 3VM7A 4URIA 5E0CA 4OIFA 1KCLA 1A3HA 4IPNB 4ACYA 2WWDA 2D23A 3WEMA 3ZOAA 3RO8A 8CGTA 3VOCA 4WKAA 1V03A 2GDUA 3W29A 2EPMX 4EK7A 4WJXA 2A3HA 1Q6FA 4D6IA 4AD4A 4AZ5A 4GQRA 3FN9A 2DT3A 5A8NA 6A3HA 2DDXA 1G9HA 1UH4A 1QI2A 3MUAA 2B31A 2GJXA 2C8NA 3ARVA 3ARZA 4PSPA 4DWSB 3A3HA 1KB3A 3ZO9A 1IZJA 1EOMA 3DHUA 4HA3A 5I79A 4CD8A 3AHTA 4BF7A 1XC6A 1K6AA 3O2LA 4PTVA 3WD4A 3W0KA 4M81A 3BCFA 3TTOA 4MAZA 1UD4A 2J75A 3POCA 1BGAA 4X9YA 3WNMA 1CXKA 2YA2A 3THDA 4MNKA 4MJ2A 1E1FA 3PBGA 1XYZA 2IXVA 1TUXA 4PYSA 3PZGA 4AEFA 3WH9A 4AD5A 4QCFA 8A3HA 1QHPA 3ZT7A 3VILA 4UOJA 1OWQA 1X6NA 4HOWA 1XH1A 3AIRA 3AMKA 5CJ5A 1MWOA 4Z2LA 3A4XA 2YJQA 4U3AA 4ZE4A 1B30A 1DHKA 3WD3A 2Y24A 3B9EA 4CN1A 4AMCA 1R7AA 3EBVA 5DFAA 2OWCA 2OWWA 4YHGA 2CEQA 2VL4A 3W38A 3NCOA 4GKLA 2EO7A 1W9BM 3CHDA 3BSHA 4PMRA 4CCEA 3PTMA 1V3LA 2BXYA 2O9TA 4AZBA 1CXIA 1B0IA 4JZ5A 5A2AA 1XSJA 3A47A 1OSEA 1XCWA 4CGTA 2CYGA 1QOXA 1NWUA 2Y8KA 2G41A 4HZ8A 4J3XA 2YDSA 2W91A 5DF0A 3HN3A 3VIJA 1IZKA 1AMYA 3CLWA 1LL6A 3M7SA 3WF2A 2GJPA 3NJ3A 1KWGA 4U5IA 1QBAA 3W25A 3T0BA 4W88A 2F2HA 2WHJA 1U30A 3MO4A 4BS0A 2CBUA 3W53A 1Q6CA 1B90A 2CCRA 2EPLX 3AHZA 3PZQA 1UR0A 2O9PA 3WSUA 2W61A 4U31A 4CCDA 4U2ZA 3VGDA 1H0GA 2VUYA 1VEOA 1VFOA 2QPUA 3GBEA 3GNRA 2XUCA 1GHSA 1GNXA 1UZ4A 1X6LA 2GK1A 1V02E 4HTYA 1WO2A 1HF6A 4PBGA 1GHRA 2WZEA 1M7XA 1EA9C 1UD6A 4GXPA 4GZIA 3ZM8A 4CN6A 1MFUA 3W81A 5EB8A 3WNKA 5HBFA 3CZJA 2XFFA 4AZHA 3I3EA 1W1TA 2BNJA 1GOWA 1BYDA 2VX7A 1KXQA 2J25A 3N1AA 4J3VA 1D7FA 3VDBA 1W3JA 2JIEA 2CERA 1TA3A 3I3BA 4PMOA 3VDHA 4JL2A 2ZUMA 2D3LA 1XCXA 1P6WA 2IXUA 3RDKA 2F61A 1WDPA 1ZU8A 4JKMA 1ZL1A 5BYWA 3DC0A 1XSIA 3EMCA 2W67A 1W3KA 1ZJBA 1E40A 3B8SA 4X0NA 4M24A 2BV9A 1PIFA 1CPUA 3SCNA 1UG6A 1JD7A 4R27A 3CZLA 4AEEA 1CBGA 4GO9A 3RJXA 3VD7A 1HKIA 3VVGA 4J3UA 1ZBVA 3FNDA 3K4AA 1XHGA 3ZJKA 5IFTA 1GOOA 4CVUA 4GI9A 3N11A 3OGSA 1UOKA 3ARUA 1V6WA 2PF0A 4AYSA 1XV8A 4IM4A 2WVVB 3WDQA 1VBRA 2VZTA 2V5DA 4HPHA 2Y8VA 3AROA 2D0GA 3N15A 4JFTA 2JFEX 1UR8A 5GNYA 4GIAA 1WNOA 3SCOA 2XIBA 3F5LA 1CXLA 2X0HA 3D5HA 3VGBA 3WQWA 2AOSA 2W63A 1CLXA 5EFDA 1BVNP 4M29A 4PMYA 1TMQA 1XH0A 4U3CA 4ATLA 1DWIM 1EOKA 1XSKA 1CGUA 1E4LA 5HXMA 3CUGA 4NRSA 4KWUA 5DT5A 2X8RA 4D6GA 1KCKA 2WSKA 1HJSA 2DSUA 1E0VA 2O92A 2DT1A 3RMEA 1CNVA 4M56A 3AS0A 3BMWA 3DHPA 1HVXA 2GJXB 4CCCA 2V38A 1ESWA 3BXWA 4XZBA 3WKZA 1W1YA 3VINA 4BCEA 2VRKA 4PMQA 2FDMA 4WSJA 4Z2IA 5I2UA 3WDJA 9CGTA 4UQCA 1TVPA 4P8WA 5KEZA 2C0HA 2WCAA 1UWUA 1FH8A 2YL6A 4AD3A 1GJWA 3AYSA 2J8GA 3CZ8A 1HVQA 7A3HA 1PBGA 3FAWA 3BSGA 3NUKA 5FCZA 5JUVA 1GOIA 3K8MA 3WH8A 3VPLA 3ZQ9A 5A95A 1MW3A 2VR4A 3PZOA 3L2LA 3WQ4A 1BGGA 3WNNA 1H49A 1MQRA 4P8XA 2YDRA 2UY5A 3BMVA 3CPUA 3OA5A 3GXIA 3BC9A 2XM2A 1UR4A 1R87A 1W91A 3WY1A 1OD8A 3NIYA 4UFHA 1RP9A 1JL8A 1SFSA 2OYKA 1QBBA 2CKRA 3K8LA 5CLTA 4PUEA 1QHOA 5CZKA 1G94A 4YPJA 3SCTA 3IK2A 3UR8A 2CESA 1VFMA 3VD5A 5CGMA 4LXFA 3AHXA 1R7OA 4UZSA 3MMUA 2XFYA 2JIWA 2XSBA 1UKTA 2UY2A 3GNPA 4HU8A 1V6VA 1OIFA 1E6SM 3GNOA 1UR1A 4NZCA 1AQHA 4B15A 4ATDA 4LX4A 4N42A 4CD7A 2Z1KA 2FH8A 3ARYA 2ZXQA 1V0KA 4M8UA 5A1AA 4ZE5A 4AISA 1WZKA 3S2CA 2PWDA 2V3DA 2O9OA 2BY3A 4WKFA 3MKKA 1C7SA 2NT1A 4U5KA 3F4VA 3SCQA 3KL3A 4PRWA 3LPOA 4D6EA 4QLKA 1NOWA 2A3AA 1W2PA 4QCEA 3AMGA 2BVYA 2WNWA 4MNLA 1K9TA 1W9VA 2ZX5A 2PWFA 1VIWA 2QHAA 1NOUA 1W3LA 5M5DA 3BH4A 1JAKA 2VX6A 4XUYA 1ISYA 3T2PA 3L2MA 3KWXA 2OSXA 1PAMA 3VGFA 2E0PA 3WQ6A 1OGSA 1MQPA 1I75A 2FH6A 1WZAA 1BG4A 2J7CA 3WUFA 4J3SA 4D6HA 4K68A 4PMZA 3KZSA 1HKMA 1TFVA 2DH3A 4V27A 4BQ2A 4JKLA 1M04A 1DP0A 1ODZA 3ZSSA 2G3IA 5HPOA 1MFVA 2ZUNA 1C8XA 1JDDA 1M53A 1DWGM 1UD5A 4CVWA 1RPKA 1WAWA 2WVUA 1NP0A 1SYTA 1KFWA 4DUWA 1GQKA 3ZMRA 1FHDA 2WMIB 7CGTA 1MYRA 3JUGA 2ZUUA 1DWHM 2D0FA 3BAJA 4TVDA 1E6XM 3N18A 4BZYA 3BCDA 5I6SA 4ZENA 3SUUA 3VD3A 4F66A 2PBOA 2WLYA 5A6BD 3K8KA 3SCRA 3VIOA 4W8AA 4S3JA 3TA9A 3U7BA 5I3DA 1CXFA 2PBGA 4TTUA 1EO7A 2QMJA 1ISZA 1JYVA 4FF5A 3E1F1 1SMDA 1VFUA 1J0KA 2BVTA 3PZIA 5IHRA 3DYMA 3FHQA 1U33A 4R5EA 3AS2A 2A3CA 1KGWA 4MNJA 4DWSC 5D9PA 2XTKA 5A3HA 3NSMA 1E5NA 4PMXA 5DEZA 2D1ZA 2D3NA 2EBNA 2XHYA 3AMCA 4L4OA 1GQIA 1CGTA 3NDYA 2ZUSA 1GQLA 1UWTA 2JF6A 1L8NA 4RE3A 1TVNA 2XM1A 4ZFMA 4QLLA 1NQ6A 3WBAA 1GONA 3G6MA 2D24A 4E8DA 1JGIA 5DT7A 3WF1A 4H2CA 3ALGA 4CD4A 5LA2A 3K46A 3W82A 1KBBA 3PZMA 3ARTA 3CHEA 2V3FA 5I5RA 3LPPA 4AY1A 5A8MA 5A8PA 2WPGA 2D0HA 4TOQA 1OD0A 2X1IA 2Y4SA 1Z32X 1H1NA 5I77A 3MV11 3CUJA 1XD1A 3WL1A 4P8VA 4AWEA 4HMEA 5CSYA 4KMQA 1WE5A 1MW1A 2CHNA 1GCYA 2WAGA 4W8LA 3VTRA 1CXHA 4MB1A 3NYDA 2WVTA 1W1PA 4UFKA 4MPKA 1HIZA 3IANA 2BXZA 1XYFA 3LPGA 3QHNA 1W9DM 7TAAA 2JE8A 2XGIA 2WVVA 5FL1A 4C7FA 3CGTA 4ACZA 4TX6A 1J0JA 3QOMA 1MW2A 3UERA 5JBFA 4E2OA 1MW0A 2DH2A 3GH7A 2YDQA 3BLKA 5ABFA 4AD2A 5LYRA 4C7GA 1J0YA 3VIIA 4KGJA 5BXPA 2WHMA 3SURA 4WIWA 1UD8A 5CPSA 3U7VA 3VX1A 3WQ8A 1DEDA 1BPLB 3OB8A 3DYPA 4X0VA 2J7EA 3J7HA 1UWIA 3WMBA 3QOKA 3IJ7A 1EO5A 2PWHA 3WFLA 4XV0A 5A6AA 3EDDA 2V3GA 2E8ZA 4TVUA 5CSUA 4CD5A 4U2YA 4W89A 3UETA 3AISA 2A3BA 1UKPA 3GH4A 5E6YA 2VQTA 2D22A 1RD6A 4JFSA 4WF7A 1J11A 2EPKX 1JDCA 1CDGA 2E40A 2XVKA 1J0IA 3GZAA 1JXJA 1E4NA 4QDMA 1E9LA 4TVCA 4MDOA 3KL5A 3CHCA 2WBKA 4GI8A 2YLAA 4F79A 3THCA 3CBWA 4KGLA 2XVLA 4D1IA 5LA0A 1CWYA 2YLLA 1C3FA 3VD9A 1XRVA 2XVNA 1JYWA 1UKQA 4LYRA 3N17A 4MB5A 1B9ZA 4HA4A 4YN5A 1OCQA 4BQ3A 4UZUA 2EQDA 4W84A 1VB9A 3FY1A 4B9ZA 1ZJAA 1UYQA 4L4PA 5M3WA 5HPCA 4N0RA 2AMGA 2VTFA 5A2CA 1FP9A 4DUXA 2VR5A 2J4GA 1XH2A 2GSJA 3NSXA 3TOPA 2ZX6A 3CZKA 2C7FA 2JEPA 5ABGA 2W5FA 4P7OA 3VDAA 1JF6A 1ITCA 3SCPA 3TONA 1EQCA 1JYNA 5E09A 4A4AA 2EXOA 3WDRA 5F7UA 4OJYA 2XFRA 1JAEA 1AVAA 4H8HA 3AXXA 3VNYA 3U57A 4PMUA 3W6LA 5D9OA 2FGZA 1ZBWA 1JG9A 3MMWA 4MNMA 3WDHA 5I0DA 2XWDA 2VOTA 3L4TA 4HMDA 3CUIA 4Z2JA 2YOCA 4PTMA 3WUBA 4XB3A 1U2YA 3VDCA 1WCGA 3K4DA 4AIOA 2WCGA 3OLIA 1V3JA 3AXHA 3OLEA 5FOOA 1RH9A 3CTTA 5A2BA 3CZGA 2NSXA 3NSNA 3RM9A 2PI6A 1E3XA 1GPFA 3EDEA 3FW6A 1PIGA 1W1VA 1WZMA 2DT2A 2WCSA 3HJEA 1B3VA 2J7HA 1V3KA 3B9DA 3HU7A 2JALA 2YA1A 4KRTA 2YBUA 2X09A 3WUEA 2VI0A 4J27A 1EDQA 3TTQA 1E6PA 3SEPA 1OINA 1QW8A 4W87A 4FLOA 1ODUA 1JYXA 2BY0A 2VCCA 2WVSA 3W4RA 2J78A 3WH7A 2MANA 1KR1A 1F4HA 1Q6GA 2BHUA 1R8LA 4PCTA 1E15A 1J10A 4M1RA 4AZ7A 2QF8A 3OLDA 4BQ4A 1B31A 1G0CA 2VT0A 2WHLA 1V3MA 2GUYA 4P7QA 1WP6A 4OOZA 1JZ4A 2G3NA 2Y2WA 3FHAA 1E3ZA 5JIWA 2CKSA 1D2KA 1WKYA 2VZUA 5M17A 5GNZA 2FHCA 1PX3A 1JZ2A 1HP4A 1QNSA 3EDFA 3LPFA 1E4MM 3WFZA 1O6IA 1BFNA 1LWHA 2J7DA 1PZ2A 1CZ1A 1WB0A 3VD4A 3W24A 3BAIA 1ITXA 1GORA 3IJ9A 3AIWA 2V5CA 2VRQA 1QW9A 3RM4A 1V6YA 3UR7A 3W26A 1UD3A 5GPRA 3WH5A 5EMYA 2W62A 4GPNA 4OOUA 3PTKA 3WL0A 4E4PA 1ZB5A 4DWSD 1GUVA 4W85A 1CGXA 4BQ5A 1QI3A 2CETA 3NDZA 2X05A 4LGXA 1C92A 1NM9A 1E6ZA 4PN2A 4ATWA 5JBDA 1E72M 3MANA 4UCFA 4HOZA 2TAAA 2WW5A 1FH9A 4W7UA 3BGAA 4UOZA 1QHZA 1KQZA 3AIUA 3MV01 3W27A 3VIHA 2E9BA 5BXRA 5C71A 4D1JA 3G6LA 2CBIA 3AZSA 3RIKA 2WXDM 1K9FA 1RP8A 4B16A 4P7LA 5KZ6A 3AYRA 5E0FA 3MSGA 1JFHA 5M03A 3FXYA 2CIPA 2WMHA 2Q8XA 4A3HA 1BAGA 1WDSA 1HJWA 2GVYA 2NW0A 2EEXA 3CMGA 5JBEA 2DSKA 3ZT5A 4NSBA 5FD0A 3VMNA 2GFTA 4MB4A 3VIKA 1H5VA 3RPMA 1JNDA 1PJ9A 3MMDA 4H8UA 1AQ0A 4LQ1A 3RJYA 1CGYA 2XJ7A 3PZ9A 1JNEA 4QFUA 4PMVA 4JIEA 4H7VA 4P7RA 1L0PA 2XPKA 1QI0A 1NH6A 3VX0A 1B1YA 3O9NA 1J18A 1GVIA 1E0WA 4J7RA 2YKKA 3APGA 2G3MA 3M07A 2EJ1A 4U33A 3WBEA 2VURA 2WHKA 4FLRA 1E71M 4EKJA 3SCSA 3WMCA 5A6JA 5AY7A 3AOFA 5ABHA 5IXEA 1DTUA 5DMYA 2VZVA 1E1EA 3SUWA 2E9MA 4IPLA 3AICA 1GQJA 2Y5EA 1E6QM 2OYMA 2A3EA 1UUQA 4YHEA 2WBGA 2ESCA 3TTSA 1JF5A 4V2XA 2JF7A 5I23A 2VCBA 4AXNA 4B3KA 2J7FA 4ML4A 4E8CA 2E8YA 1OIMA 1HP5A 2J47A 2FGLA 3WQVA 5CLWA 4ZXLA 1GVYA 1ZBCA 3B9AA 3OGVA 1FA2A 4AZCA 4UQ9A 3S6TA 4H8VA 4WK9A 1JDAA 1KGUA 4WLCA 5GNXA 2X2YA 1DWJM 1EIBA 3ARPA 3QR3A 4LYPA 3WENA 3CIVA 1PPIA 4FLQA 1V0NA 2DPEA 1AQMA 3VKKA 2ZX7A 1UKSA 5D8ZA 1E70M 4F9JA 1HJUA 3EMQA 5I24A 4JFUA 2BY1A 2WMIA 1EDGA 3L4XA 1A47A 4NI3A 3AXIA 3L4YA 1C8QA 1W9UA 5AC4A 2WMFA 4HU0A 2EPOA 1XD0A 1KXVA 4P7NA 3PZNA 1CEOA 2O9RA 1TCMA 4UR9A 3I3DA 1BLIA 1H09A 1TR1A 2XWEA 1BSIA 2QMKA 3ZR5A 3N9KA 1VRXA 1Q4NX 4AD1A 5A94A 4QP0A 1E6NA 5CPQA 2XVPA 3QGVA 1B2YA 1MXDA 3ZSTA 3WF3A 3CZEA 1PEZA 1J0HA 2VVNA 3WD2A 1EGZA 1HNYA 3CUHA 3KE0A 3PHAA 4FMVA 1BHGA 1QNQA 3AS3A 4UQDA 1ISXA 1FH7A 3GTNA 1LJYA 1JI1A 1UKOA 4GI6A 3ZJ8A 3WF4A 1TG7A 3PTQA 4J3TA 1WDRA 5BRPA 3ARSA 3D3AA 2QPSA 3LMYA 4H04A 5A6LA 2W92A 2J79A 1CYGA 3OLGA 3FAXA 4TUFA 2Z1SA 4HA1A 3QHOA 4JHZA 2GDVA 3AFBA 2WC3A 6TAAA 3OIHA 1NWRA 2FHFA 3DYOA 3SUSA 5IFPA 4EANA 1UWSA 4MB3A 3EDKA 3OZOA 1PX8A 4RL3A 3VNZA 1UZ1A 1KBKA 3AIEA 4TXEA 4IISA 4KRUA 4AIEA 2WM0A 2UWFA 1E73M 3BAYA 3IAQA 5A6SA 5ABEA 3RCNA 4PSRA 3T08A 1G01A 2WMKA 1F4AA 4C7DA 1QPKA 1UH2A 3WN6A 3MUZ1 2ZICA 1E55A 1NWTA 2DSWA 4RE2A 4HMCA 2E3ZA 2J74A 1R85A 2G8ZA 4GZJA 4WSKA 1LG1A 1VF8A 4AC1X 2WSPA 4MAVA 1N82A 1I1WA 5CPTA 3ARWA 4OBRA 3WD1A 5LA1A 3CUFA 1OB0A 4D6FA 4QAWA 3ARQA 1YQ2A 5AYBA 3OZPA 1OBAA 1E43A 2WC4A 4JHOA 3WD0A 4D6DA 3BLPX 5DO8A 1E4IA 3AIQA 3GXFA 3WF0A 3L4VA 4UQEA 1H11A 4Z2GA 1DWFM 1CLVA 1J0ZA 4W7WA 4BA0A 2CPUA 5JIPA 3AHYA 4J3WA 1W32A 1FOBA 3UEQA 1C90A 1UR2A 1LQ0A 4HZ6A 5BRQA 2BS9A 3HMCA 3GXMA 2RGLA 4D72A 5EBAA 5A8OA 1UHVA 3VU2A 2AAAA 2ZXBA 3AZRA 4W7VA 1VEPA 1YHTA 2WMGA 2WWCA 1GZJA 3UESA 2RGMA 1VENA 1H0IA 4UQBA 4UTFA 3PN8A 4H41A 3IJ8A 1BYBA 4OBSA 2J7GA 1OT2A 3WQ5A 1JZ3A 4OZOA 4EE9A 3N13A 2VX5A 3CH9A 1H3GA 3WNLA 4AZGA 1VAHA 3O6AA 2YL8A 2VVSA 4Z2KA 4UFIA 2PWEA 1JFXA 5FKYA 1O7AA 1HKJA 4QLJA 1J12A 2GK1B 3VIPA 1HL8A 1FHLA 3U5UA 2EPNA 5FIPA 1JZ5A 2UY4A 1R86A 2OLHA 1KWKA 5CGTA 2WKGA 4AD0A 2J7BA 1HJQA 2X0YA 1B3ZA 3MSDA 2VRJA 2FHBA 3PZTA 3ALFA 1V0LA 2ZXAA 4CUCA 4Q22A 1BG9A 4GZEA 1Q6EA 5CG0A 2VQUA 2VX4A 2BFGA 1KGXA 2IUZA 1HXJA 2ZOXA 2OSWA 5D9MA 1J01A 3SUVA 2VJXA 4ACZB 2DEPA 2XIIA 4JCLA 3K1DA 2WK2A 4LYQA 1VJSA 1JIBA 3N12A 3GH5A 1JZ8A 1LLOA 4UFLA 4V28A 3RM8A 5ABFB 1UA3A 3VO0A 1CTNA 3MUIA 1ISVA 2HISA 1G5AA 1HJXA 1VBUA 3AMLA 3OG2A 1JXKA 4NRRA 1V0MA 1V02A 4W86A 1V08A 3M46A 4A3YA 2UY3A 1BYAA 4F9DA 4PCSA 1HN1A 2JEQA 1WZLA 4W5ZA 1B3WA 1HX0A 3AMDA 5CQ1A 2BY2A 2VNCA 1MVYA 2XVGA 3N04A 2CBVA 1PX4A 2VZSA 4Q7NA 1JZ7A 4W5UA 5TD4A 4OUEA 2GJRA 3MU7A 4S3KA 2OYLA 1OT1A 1S46A 2OSYA 2CHOA 5AYIA 3T09A 1MXGA 3AIBA 4P8UA 3VGEA 1GOQA 1C91A 3VMPA 1E6RA 1E0XA 3F5KA 3ZJ7A 5AC5A 4CKQA 2E4TA 1UR9A 3WELA 2CITA 1IV8A 1EHAA 3A4WA 1V3HA 2PC8A 2WANA 1HJVA 3EYPA 3WEOA 4AZIA 5D9NA 3WNPA 3OGRA 4ZXOA 4CU6A 3AI0A 1NOFA 1HKKA 5ECUA 5E6ZA 3EMZA 2ZIDA 4UOQA 1WPCA 4UNIA 3SUTA 3RILA 3WDIA 4PMNA 2YBTA 4WKHA 4AW7A 3OBAA 1C93A 1KXHA 2ZWZA 1LL4A 1BYCA 4DM2A 2DSZA 3SCWA 3GXDA 1TZ7A 5C8BB 1CECA 2ZX8A 3ARRA 1K9DA 2OWXA 4IUGA 4DM1A 1UQZA 1VJZA 4PMDA 3CHFA 3VUPA 4DWSA 3IAPA 2HVMA 3L4WA 1JD9A 1QI5A 2XYLA 3ZR6A 1V3IA 4GINA 5IDIA 5D4YA 3POHA 4NF7A 2WLZA 4LPCA 4DUVA 5IHSA 1QNRA 4OKDA 1ISWA 5CXPA 1EHNA 1H2JA 4F8XA 6CGTA 4PTXA 3ZIZA 1CXEA 2DSVA 2WZHA 1EXPA 2ZUWA 4JFVA 1OGBA 1CENA 1BTCA 1DWAM 4FK9A 3T2OA 1KQYA 4Y7EA 1GOKA 1NP2A 3UG3A 2G4FA 2ZX9A 1QI4A 1OGGA 2J62A 2BHYA 3QHMA 1IT0A 1M03A 2ZUTA 1KR0A 1PZ3A 4JL1A 1H4PA 5I78A 2VZOA 1TA3B 2D2OA 1GW1A 5BXTA 4HPGA 1B3XA 4JAWA 3KEHA 3VIFA 3L4UA 3VM5A 1CGWA 1EDTA 1NWSA 2VO5A 4UFJA 2WC7A 1EQPA 3WMSA 3EDJA 4J28A 4D6JA 1GOMA 1K9EA 3AS1A 4MTVA 2ZXDA 1QNPA 5E9AA 5BCAA 1G1YA 2WMJA 2XG9A 2WYSA 3BAWA 2YA0A 3SCUA 5D8WA 4RE4A 4AIUA 1FP8A 2WZIA 5BWFA 1FFQA 1US3A 1V6XA 3DECA 3AQUA 2BHZA 4B9YA 4HZ7A 1VFFA 2YL9A 1LG2A 1C8YA 2YIHA 1ECEA 1Q6DA 2ZWYA 5A6KA 1ZS2A 3TP4A 5EFFA 1M01A 4M80A 3BAXA 3KL0A 3WEZA 5HOSA 3F5JA 4M82A 1W9PA 3WH6A 1UH3A 1SMAA 3VIMA 1CIUA 3ZJ6A 5FL0A 1BVZA
chains in the Genus database with same CATH superfamily
3FA5A 4Y90A 4KCVA 1TV8A 1FWDC 1EJ7L 2ACRA 2PDQA 3MS8A 1FCUA 4UNKA 3QV9A 1VKFA 4MG4A 3URNA 4I7WA 4TMCA 5D2TA 3NQMA 2RAGA 2PDJA 1GG0A 1VEMA 2BVDA 4GYPA 4PUWA 2ISWA 3BLOA 4DXKA 1GJUA 4O10A 3O8AA 4N9BA 1XGDA 1HL9A 2QLYA 4ERIA 2NQLA 1YDVA 1XDMA 4TTGA 4GVHA 2NLYA 5I3GA 3VMOA 1U5VA 2J77A 3SCVA 3AJ7A 4XZMX 3GBDA 4EWND 4S3GA 1QVBA 2ZUVA 2GVJA 1NTHA 2FB2A 4REQA 1DIDA 3JR2A 4ZL1A 3C2FA 1FDZA 3T0AA 1Z41A 3DFHA 3SIMA 2DQXA 4PUDA 2FZ8A 3M0HA 4U4MA 1E9ZB 1OZMA 1R3WA 1US2A 4GQQA 1DJXA 1TTPA 2DJXA 1EJVC 4D71A 1W1ZA 4OECA 3G1AA 3RN6A 4F2BA 2V68A 3TN3A 4XZWA 2P50A 4FPSA 1UWQA 3GVWA 2G3JA 3NG3A 4ZEPA 5IDZA 3QVQA 2DIJA 4IPPA 3N9SA 2D20A 4K2SA 1Y65A 5A69A 2V3EA 1ELSA 1D3CA 1UJPA 1GGOA 1UWRA 5PTDA 2QCNA 3RF9A 3TJLA 3EPNA 4UFMA 3CT2A 5KETA 5BROA 4DRSA 1GJPA 2XGBA 3S5OA 1E5JA 3T0DA 4JCMA 3R6IA 3U4FA 1LF1A 1UA7A 1J96A 2VELA 2PWUA 2VEFA 1LOLA 4XTIA 5A6BA 4GUGA 3WCZA 4URIA 5E0CA 3UPBA 3LLXA 3PPCA 1N2VA 2WWDA 4O8RA 3WEMA 3RO8A 3RU6A 3UJRA 3W29A 3OBEA 4Y8FA 2EPMX 3LXCA 4WJXA 2A3HA 1Q6FA 4H7ZA 1WUEA 3BVJA 5A8NA 6A3HA 1RZMA 2DDXA 2HDJA 1G9HA 2VGFA 2OJPA 3TJIA 3MUAA 1VCVA 3PBYA 3KDNA 1AH4A 1XIEA 2C8NA 4J1OA 4CQ8A 1EGMA 3ARZA 4QX4A 4F4RA 4DJDC 3MI2A 2VENA 4AVNA 4IMGA 3S1WA 3ONBA 1VP5A 4NYYA 4M81A 4C6PA 3BCFA 1MNZA 1FRBA 1UD4A 3WNMA 1WOBA 3P61A 1ONRA 1E1FA 4F0RA 4JTRA 3S5SA 4O0QA 1LBMA 2IXVA 1QRQA 3WLSA 4UTLA 3PG9A 3ZT7A 1OWQA 3AIRA 1WV2A 4GC3A 4FA3A 2YJQA 4LH8A 1XG3A 3W7JA 1TJRA 4U3AA 1VLIA 4S3FA 1XP3A 2BWGA 2Y24A 1JCXA 3BZJA 1K8CA 1IEIA 1H7NA 3NZQA 1TREA 3GDMA 4WXZA 4YHGA 4GVGA 2CEQA 2VL4A 4E3TA 3L5AA 1FVPA 2A85A 3BSHA 3FEMA 3WLHA 3R58A 4RXGA 4UCGA 2CW6A 5AHEA 1ZAHA 2HPIA 4JZ5A 3MBDA 3SQSA 3QPZA 1OSEA 1XF0A 3ZWSA 1H1YA 3HN3A 2BOGX 3VIJA 2P1FA 2QZRA 2YZRA 1LL6A 5DELA 3M7SA 3GNNA 1ICSA 3QSTA 1LP6A 4U5IA 3W76A 3W25A 2F2HA 1UCWA 4BS0A 4HNNA 3QR1A 3U2ZA 3MZNA 3QRHA 3M9YA 1JCNA 3ABXA 1BSLA 3AO0A 4QQ3A 1P0KA 4DWDA 4XUGA 3VGDA 4GX9A 1VD6A 3L0GA 2ISSA 3CL7A 2QPUA 3GBEA 5IM51 1XCFA 4AVFA 3CIWA 3R12A 1CB7B 1V8EA 4M7SA 2GK1A 3AAMA 1RR2A 1V02E 3I4EA 1WO2A 1HF6A 3UNDA 1UD6A 4LAKA 2VDIA 1MFUA 2I5QA 3HOJA 1E0UA 3CZJA 3IRSA 1QASA 3W3OA 2BNJA 3IV8A 4O57A 2VX7A 1KXQA 3L5LA 1XKYA 4J3VA 4DIAA 1W3JA 2JIEA 4PUJA 1G69A 4PMOA 4JL2A 1Z69A 3TQ0A 2CZVA 5XINA 4H2HA 3LBCA 2IXUA 2QCMA 1E1CA 1ZU8A 4CQCA 3ABSA 1XSIA 3EMCA 2W67A 1W3KA 5EL1A 3AUJA 4K1WA 4M24A 3N4AA 2BV9A 1PIFA 3P3BA 3H4WA 1JD7A 3CZLA 4AEEA 4HTBA 4YWSA 2G50A 3I65A 1LZOA 3K4AA 4GYFA 1A49A 4GI9A 4JNZA 4L65A 3GIQA 4XD3A 3WDQA 3H53A 4PB5A 3TH6A 1Q2SA 5GNYA 3NA8A 1OCNA 1WNOA 5T8GA 1VYPX 2P76A 2YYTA 3F5LA 2X0HA 3TSDA 3P93A 4UTTC 3ANVA 5F2LA 4AMAA 2Z24A 3UCDA 4M29A 4PMYA 1RCOB 1TMQA 1XH0A 4IT1A 4KEVA 4GRSA 2ZTJA 1BXBA 1ME7A 5FF0A 2GQ9A 3C86A 5C0QA 1PZ1A 1RCXB 4QDWA 4JD4A 2J9XA 2DSUA 1FCVA 3P74A 1ADOA 4ZOEA 1R2TA 4XZNX 4IF2A 3NYZA 1FWFC 3W07A 2V38A 4DY1A 1ESWA 4XZBA 2OLSA 3VINA 4BCEA 4XAYA 2CLFA 2XGZA 4UQCA 5KEZA 3TMQA 2WCAA 1F8MA 1P6BA 4GIEA 3LK6A 4Z0SA 2A1YA 3NPXA 4ZQOA 3RYSA 1H50A 5TBOA 2QCFA 3N19B 7A3HA 3MZ2A 3NQAA 5TIMA 4H6EA 1GOIA 3T81A 4GE8A 1HL2A 3VPLA 1TPVA 3TXVA 2WJFA 3GU1A 4GABA 2L5HA 3N6JA 5KMYA 1T96A 2VGGA 2B7NA 3QFWA 2UY5A 1HQTA 4YTUA 3CPGA 3O6CA 3LCHA 3GXIA 3C2RA 2F7FA 3HGJA 4Z0JA 3G1VA 5LNSA 3DGBA 3QF0A 1ADDA 2YZ5A 4JTEA 1SFSA 4ILSA 2PRMA 4ZB2A 2INZA 5CZKA 5CPMA 4RPPA 3W7KA 4YPJA 3SCTA 2HK0A 1HKVA 2CESA 4EXAA 3S83A 4LXFA 3W01A 3Q94A 3M0IA 4UZSA 4DJDA 2ZE3A 2VFGA 3GNPA 1YNYA 4WD0A 2F6UA 1TKKA 3NGJA 4CD7A 4LX4A 2O4QA 2FH8A 2ATMA 4P5UA 3GLCA 6ALDA 5A1AA 3IIPA 1XS2A 1XKJA 3SI9A 5D2YA 3DG6A 3FGCA 1YXDA 1S5MA 3R13A 2NQ5A 1XLEA 1FKXA 4PCNA 1NOWA 1TJ2A 3PFRA 2P5NA 2PGEA 5BW6A 2QGHA 1Q65A 1W1A1 1EB3A 3RXZA 1SJDA 4UTHA 3TYDA 3TQVA 1EC9A 1GVRA 4DQWA 1W3LA 5M5DA 2VEMA 3WJSA 4J2PA 1DTNA 2OPJA 3JS3A 3PWAA 5BNKA 2VC7A 1I75A 1AODA 4W4QA 1Z9AA 3BW3A 3V18A 4WR3A 1ONEA 1W0MA 1W17A 3UWWA 2GUBA 1HKMA 2GWGA 4V27A 4HCLA 2R8WA 1DP0A 1ODZA 2R14A 4DJEC 5LIXX 5HPOA 1UMLA 1SW7A 5K9DA 3S46A 9XIAA 2HZGA 1SUXA 3BLDA 1M53A 3C0LA 4PB3A 5EY5A 1DWGM 3LNMA 3BCJA 5BU6A 1XLBA 1SYTA 2QDGA 3S9IA 4X22A 3GC5A 4WUIA 1DL3A 1FHDA 2IMRA 7CGTA 3URBA 3B9NA 7XIMA 1Y0EA 1DWHM 4IUOA 3ITTA 4BZYA 1MEIA 1EYEA 3VZZA 5I6SA 3SUUA 2R91A 3VD3A 2NXIA 3GR7A 5A6BD 1VJIA 3SCRA 4Q8QA 3DFNA 3U7BA 1CXFA 2PBGA 2P0OA 2ZZ5A 1ISZA 3S1UA 3B8VA 2PDGA 2BVTA 5FSEC 3NL5A 4WDUA 3AS2A 3MT1A 3UWZA 4LNCA 3S2JA 3H2CA 1W56A 5D9PA 4JICA 2DZPA 4FX6M 4LF2A 4WDWA 1JJKA 1F3XA 1P0EA 5C54A 5DEZA 2NV2A 4KCWA 2XHYA 4L4OA 2Y6ZA 1XBYA 3THUA 1YEYA 5AOUA 1OF6A 4JQ1A 2IPFA 1UWTA 3G3DA 4RE3A 1V79A 2OCZA 4ZCWA 2POTA 1VCGA 3UQNA 2Y63A 5HANA 3JW7A 1GONA 4QHRA 4K8GA 3I7SA 3WF1A 3CS2A 4H9ZA 2INFA 5C2GA 4Y8EA 4Z1YA 1M6JA 4CD4A 5G4WA 3NO1A 4Y2WA 4NX5A 2H90A 5I5RA 5LKYA 2PP0A 5A8MA 5L6UA 3HV8A 2D0HA 1UMYA 1OD0A 4IIBA 4PUKA 1RBOB 4HPJA 1V93A 5LIKX 4NJJA 4JTGA 1GCYA 4W8LA 1PZ0A 3FXGA 4GMEA 1JCLA 3EB2A 3MUCA 1CXHA 7PTDA 5LSMA 2WVTA 1VFSA 4UFKA 4MPKA 4M0XA 1HIZA 1QOQA 2J6XA 2QKFA 1Y8BA 1JULA 3UA3A 3QHNA 1K7XA 4EOUA 1XIIA 2JE8A 3MI6A 3W1QA 2UV8G 1GW9A 1J6PA 3R4IA 1P48A 3CT7A 1OY0A 1I2OA 5HUPA 3UERA 5JBFA 4C1LA 1MW0A 1UP3A 1OYCA 5AHFA 4OGZA 5LYRA 4C7GA 4ZSTA 3LD5A 5BXPA 4WIWA 1UD8A 5FEWA 2ATSA 1DEDA 1DJZA 3J7HA 4JQAA 4RV3A 1VC4A 4JTAA 3WMBA 3G24A 3CV1A 3WFLA 4Q7IA 5A6AA 2R1NA 2HVOA 1US0A 2YXOA 1SVDA 4LUTA 3WK0A 4U2YA 4QG6A 4W89A 1V7YA 5E6YA 3LG3A 4N9DA 3LENA 1UC5A 2EPKX 2JKAA 2XVKA 3ITGA 1A0DA 4PBEA 1E9LA 4QGCA 3URQA 2HPMA 3CHCA 4O1AA 3FJ4A 1S2CA 2BDQA 3THCA 4PRTA 3S1XA 4FI4A 3TU9A 3CL8A 4AXKA 2W3ZA 1RXOB 4LYRA 3QEZA 4LY4A 3VDGA 1TTQA 5I7GA 1OFOA 1W31A 6TIMA 4Q4PA 1MRQA 3BOFA 1VB9A 4H6QA 2F84A 2B0MA 5HULA 9RUBA 4BHYA 2HCVA 2VR5A 2J4GA 2DUXA 4RV8A 1EP3A 2GSJA 3TOPA 1GKPA 2ZX6A 3CZKA 1N7KA 1TRDA 2FZBA 4JQ2A 2W5FA 4P7OA 2Z7GA 4QEHA 3F2DA 4EPBC 1Q7QA 3WJZA 1EQCA 4QBXA 2QGYA 3BZGA 3WDRA 5F7UA 3DBPA 2XFRA 1JAEA 1AVAA 3AXXA 3VNYA 3G5EA 5D9OA 3FKKA 1FWRA 5H6HA 1M7OA 1VBJA 3UWUA 1W3NA 3BJFA 2EKCA 4O1DA 2XWDA 4IQJA 4NG3A 1XIDA 3PUOA 1OC7A 3N3MA 4XB3A 3VDCA 3Q2DA 4EX4A 3K4DA 4XKYB 3K30A 2QCCA 4MVAA 4L56A 1QDSA 3CYJA 1Y5XA 3CTTA 3STEA 2DZTA 2NSXA 4A22A 3NSNA 3E38A 1F74A 4CNNA 3UZYA 1WZMA 1XLKA 1VPXA 2WCSA 4M6VA 1LQ2A 3HJEA 3E0LA 1S2AA 1B3VA 1V3KA 1X38A 3QGAC 2YA1A 3CHVA 1CCWB 1ZENA 3EXTA 2J9ZA 3WUEA 3SADA 1EDQA 5CZTA 3TTQA 1E6PA 3QY8A 1OINA 3FK4A 1JYXA 2BY0A 1TPH1 3W4RA 2J78A 5CC5A 3C61A 2CZ5A 4PCTA 3W1MA 1E15A 1J10A 4ZOAA 3G1YA 1NDZA 2ZZ6A 5AYXA 4UTWA 4BQ4A 2FPYA 3H2NA 2VT0A 3DOPA 3KFTA 2C1GA 2WHLA 1V3MA 2VUNA 1QFEA 4HMNA 5AHNA 2I56A 4O4VA 1E3ZA 2CKSA 2WSQA 3HG3A 1IXOA 1D2KA 2PZNA 5M17A 5GNZA 2VFDA 1JZ2A 4QRNA 1O6IA 4J35A 3QXBA 3CTLA 4O0KA 1LWHA 2ZKMX 5D2XA 4S2BA 3EKLA 1CZ1A 1DJYA 3WQCA 4I9MA 2V5CA 3FJ6A 2I17A 2VRQA 3NQ8A 2PDNA 3WH5A 5AC8A 1Z42A 2OU4A 2BASA 2QPXA 3F4WA 2AQVA 4BQ5A 4YMZA 1SSGA 4K39A 3REQA 3SQMA 3G1FA 1UPPA 1E72M 1FHUA 3W7PA 1X97A 2F9RA 1ZCCA 3BGAA 4C6OA 3A13A 4UOZA 1QHZA 3MV01 1AK5A 2E9BA 2H9AA 5C71A 4D1JA 2Q3RA 4JTDA 5F4SA 1QOPA 4HGXA 1MEWA 5E0FA 3MSGA 3KLKA 1JFHA 2YR1A 5M03A 4RZ5A 4LRSA 4BEUA 2Y62A 1ZQ5A 1VLWA 4DBEA 1XLLA 1BAGA 4ZO9A 2EEXA 1AH3A 2DSKA 3ZT5A 4JTTA 3VMNA 4OWGA 1J93A 1N55A 4MB4A 4X2PA 4FSAA 2Z1XA 5F1UA 3RPMA 1YNPA 3RFAA 1AMKA 4IGNA 2C71A 1NQKA 4GNVA 2W0UA 1JNEA 4QE5A 4JIEA 4UB9A 3MVIA 2XPKA 1I8JA 2HTMA 4IIEA 3PPGA 1B1YA 4DZ5A 3HPAA 3FYOA 3H2EA 3EPMA 2X40A 1A50A 1XPGA 2EJ1A 4FLRA 4MOZA 3WMCA 1FTXA 4LY8A 5ABHA 2XIMA 5IXEA 5DMYA 4HJWA 1WKEA 1GQJA 4E2DA 3QFEA 2FTWA 3W7GA 1GYLA 4ZODA 3TFXA 2W9MA 1TV4A 1EYWA 5A8GA 3CQJA 2JF7A 4K37A 1JR1A 1W1IE 3LBMA 4AXNA 4NAEB 4AUBA 4ML4A 4E8CA 2E8YA 3N2TA 1TV3A 3PJUA 3WQVA 1TMLA 1ADSA 3KHDA 3LXAA 4H8VA 4WK9A 1JDAA 4WLCA 3H23A 1XGEA 3QR3A 3MWAA 2FIQA 1XPYA 3TWAA 3CIVA 5EMMA 4ZTYA 1V0NA 2XU2A 3LB0A 2ZX7A 1UKSA 5D8ZA 3TN6A 2F6XA 3RK8A 4WSHA 3H55A 3NZRA 2BY1A 3P82A 3L4XA 4CNUA 4YXGA 1ONWA 1A47A 2REQB 4EAYA 2PDYA 2GWNA 3L4YA 3Q45A 5AC4A 2WMFA 5ABTA 2AGTA 4DO6A 4P7NA 3PZNA 5G4EA 4I7VA 3H70A 4CNOA 3I6EA 3GSMA 1Q4NX 2Y88A 4PRRA 2XVPA 3U4AA 3WLPA 1YDNA 4DJFA 1B2YA 4AWUA 2EPHA 4AHPA 3ZSTA 5L9FA 3URAA 1OFEA 2DW6A 1PEZA 1ICQA 3WD2A 3C8FA 5HNTA 4NXSA 3G8EA 3KE0A 4C6BA 4E6MA 1ISXA 4UNLA 3UW6A 3D46A 2PF8A 1UKOA 4R85A 3LU2A 4J3TA 2A2IA 3B06A 3D3AA 3B4YA 4H04A 1R46A 2W92A 1CYGA 3TV8A 2Z1SA 4LSBA 1WX0A 4LCRA 3H12A 3TW9A 2Y89A 4ROPA 2GDVA 2WC3A 1NWRA 2GJLA 2PUZA 2PWVA 3DYOA 2QEZA 3WQFA 1LT8A 4RL3A 3TC3A 1UJQA 3AIEA 1SFJA 2WM0A 2UWFA 3IAQA 5A6SA 3BGGA 1J2WA 4RNIA 4O11A 4PSRA 3W85A 1G01A 2QJHA 3PG8A 1LWIA 3DFTA 1XIMA 3LX9A 1QPKA 4NAFB 3IVTA 1RAKA 3MUZ1 2ZICA 2G37A 3LY0A 5E5CA 3OOQA 4LS1A 4ZQNA 2DSWA 5I3IA 4RE2A 2VR2A 2E3ZA 4N02A 2VGIA 3A3XA 3R5EA 2WSPA 5FEPA 3BMXA 3L12A 1I1WA 4JN7A 5CPTA 3USBA 5LA1A 1WOAA 5KZDA 3KOZA 4NAEA 4QAWA 3WJXA 4FIRA 1E43A 1KKOA 4JHOA 4HCHA 1XBXA 4O1FA 4ZGYA 4R88A 2AGKA 2QIIA 1OYAA 2J27A 3TROA 1XFCA 4UQEA 1I45A 3TYBA 4Z2GA 4LV4A 5A5WA 1FOBA 4C91A 1UR2A 1LQ0A 4HK5A 5E1QA 1PWLA 3HJZA 3B03A 5I00A 1UHVA 3VU2A 2AAAA 3AZRA 2C1IA 2NVAA 3R1ZA 1YHTA 3LHWA 4HPXA 4ADTA 1H0IA 4DO4A 4LCQA 1AJ0A 1BYBA 4X3ZA 3LHZA 5EYWA 4DPQA 5IBXA 3EZ4A 4GH1A 4K6AA 4IIGA 5C9UA 4TO8A 2Q6ZA 3N13A 3OU8A 4POCA 4A8IA 1M9HA 4D8AA 3QLLA 4JTFA 4UXDA 6XIAA 1O7AA 3LSCA 3P67A 3DHFA 1XIJA 4JEJA 4OU1A 3S0CA 1FHLA 3U5UA 3DH7A 3M44A 5FIPA 1XUUA 2OLHA 4GY0A 2WKGA 1I2QA 1W5PA 2X0YA 3PZTA 1XDJA 4I9TA 4GD0A 2E25A 2ZXAA 1BG9A 4GZEA 1Q6EA 3TW7A 5CG0A 3CH0A 1KGXA 1IWAA 1DJNA 1HXJA 5D9MA 2OOFA 5H8UA 2RKXA 1J5SA 2DEPA 1UASA 3QBUA 4JCLA 1TPEA 1VJSA 3N12A 1FX6A 2I9EA 1FKWA 5D09A 4UFLA 5LZLA 3LRKA 1GG1A 5T9BG 2CLPA 1ISVA 2HISA 2DVXA 1W6TA 3OG2A 1HJXA 1WXZA 3C52A 3W7RA 4K7YA 4INFA 1V02A 3E2SA 2E6DA 4W86A 1V08A 4A3YA 5B7ZA 2ZFAA 1QR7A 4F9DA 1QTWA 3UJSA 4F0KA 3N6QA 4XO7A 3ZLGA 1S2TA 1MVYA 4H9XA 4XVEA 3BOXA 3V4BA 2HEJA 4WQ6A 4W5UA 4Q7BA 2HRWA 4IH3A 3O1NA 2OYLA 4H1ZA 4US6A 4H9TA 1MXGA 3PSWA 3T09A 1FWIC 2PDWA 3PWIA 2C6QA 3MA8A 4CKQA 1IEXA 2PE4A 1UR9A 4HN4A 1KM4A 3HFYA 1OABA 3A4WA 1V3HA 4JTKA 5D9NA 3WNPA 4IJBA 4CU6A 3R0KA 1PE1A 8RUCA 1HKKA 1HFBA 2ASHA 1KM6A 3VCNA 4MJZA 3ATYA 2YBTA 3WLQA 4AW7A 3F4CA 3OBAA 4A3UA 2ZWZA 4HYVA 3V1HA 2DSZA 3GXDA 3N4FA 3GC4A 1OQFA 1DJQA 2OWXA 4DM1A 4DWSA 3VUPA 3HZ3A 5F2GA 3WLOA 3TE9A 3POHA 1AQFA 4NF7A 1ISWA 1IHIA 3W72A 1KM1A 3SGZA 1O4UA 4PTXA 1ECQA 5AVNA 2BLEA 4GY7A 3KRSA 1CENA 5I3JA 2ALDA 4NKCA 1M1BA 2PODA 4Y7EA 1A5AA 2ACQA 2G4FA 2ZX9A 4UMBA 1A3XA 2HSAA 3QHMA 3W1AA 1IT0A 1XINA 4EXBA 3ITXA 2ZUTA 4JL1A 1I9CB 5C6MA 1S5WA 5BOEA 2D2OA 3MCMA 4LVGA 5BXTA 2MNRA 1V4YA 4Z42C 4HPGA 1WXYA 3KEHA 3VIFA 2IQDA 3L4UA 1NWSA 2VFHA 3L7RA 1H5YA 3CAKA 3EDJA 4J28A 2FJKA 1LOSA 2PLCA 4XZLX 4DZHA 4D6JA 5C7HA 3D0CA 1OF8A 4X63A 1MUWA 3CAQA 3BLIA 3QJAA 5U7SA 1IYXA 4U10A 4UMCA 5CEWA 1UR3M 3GTFA 5DMMA 3BAWA 4NJGA 1O94A 1EJWC 3BWWA 3A12A 4RE4A 2C19A 2WZIA 1PKYA 5GJNA 2JQXA 1V6XA 3FFSA 3TAOA 2PP3A 4NVTA 4B9YA 2G5WA 2YL9A 2OTDA 2YIHA 1DVJA 1Q6DA 3QZ6A 1DJIA 1ZS2A 1IEVA 1F6KA 3KL0A 5HOSA 1Q85A 3MUY1 1EZ2A 5FF2A 3ECQA 5BXSA 4H9MA 4CU8A 1KXTA 1X1NA 5DRCA 3R11A 3VGGA 4DI8A 4H7CA 3Q67A 2NQZA 3UCQA 4Q33A 3XIMA 1BQGA 1FWWA 2G96A 5HK4A 5A6MA 3II1A 5A8QA 6ENLA 2IKHA 3QQ1A 5HDRA 3SR7A 4A3QA 4CN4A 3TCEA 2W66A 3PZVA 2DU2A 3IUDA 2QV4A 4YNGA 1BF2A 1EH9A 4RW3A 3L4ZA 3T55A 1OM0A 5FEXA 3U6WA 4TIMA 2I57A 3WIJA 3BGJA 4W8BA 2DUZA 2NX9A 2DGAA 3CIXA 4DEFA 1FWCC 1ZALA 3GU2A 3UYIA 3QR0A 3ZT6A 4F0LA 3T8QA 1W2VA 1NFBA 2CBJA 4NJHA 1OCJA 1OFDA 3DEQA 1C7TA 4FALA 3TTYA 1NF0A 1ZPTA 5JU6A 1E56A 5HNNA 1UD2A 1H7RA 2D69A 4KH2A 4HNVA 2WB5A 5K4ZA 3WG6A 2V5KA 3VIGA 1QPNA 4PEEA 5HAOA 4HP5A 3A22A 2E6YA 3PJTA 1UQYA 1PTDA 4FOKA 1HUVA 3PJWA 3F2BA 3M6DA 3W1LA 3CB3A 1EEPA 2E28A 4O1CA 4YVVA 1MUMA 1Y7VA 2WKLA 3KOXA 2OELA 4B3LA 1E0TA 4JXCA 2CZFA 2BG5A 4WRHA 1A3HA 4IPNB 3RLHA 2R1KA 2QVNA 4DBSA 4UTUA 3NQDA 2WQDA 3QY6A 4WKAA 5H8PA 1GVEA 2WJEA 1XM3A 4AD4A 4GQRA 5BOOA 1TWIA 3FN9A 3GVVA 1KBIA 3R2GA 5FJTA 1QI2A 3PPHA 1K8ZA 1J4EA 3DFOA 1AH0A 2WJZA 4JIIX 4MZYA 3ZO9A 2ZYFA 4DJEA 1XQLA 3DHUA 1K6AA 4PTVA 3OG3A 3WD4A 1NY1A 3S2NA 3W0KA 4ZO7A 1XBVA 4U28A 4MAZA 4X9YA 1K8YA 2P8CA 3POCA 4ICCX 3LI0A 3A23A 3M6YA 4AEFA 1KC7A 5F4XA 4L9ZA 2GQ3A 3MP3A 2FZ9A 1VIZA 3SECA 3QQ0A 4HOWA 3VAVA 1B54A 1MWOA 4Z2LA 3N2XA 5H8MA 3A4XA 4S3EA 4YVXA 3GG0A 4GYJA 5DBUA 3M43A 1JPHA 3NQBA 3M0JA 5DFAA 2FVMA 3EAUA 4RPQA 2YFNA 1A53A 4JYFA 3NCOA 2X7WA 3HQ1A 4GKLA 4EF8A 3LRMA 1W9BM 1L2UA 3KRBA 4PMRA 2BXYA 1SU5A 5EBUA 4AZBA 1B0IA 3HFTA 3DKLA 5A2AA 2OEKA 3FVMA 1RJPA 1F6PA 4RK8A 2YDSA 3A24A 2W91A 3SY8A 2YW4A 2OQYA 3EOLA 3VE9A 3IIXA 1K77A 2GJPA 3FEQA 4W88A 4AWSA 1JQVA 1A5MC 1U30A 2GVEA 3V7PA 3CXOA 2CBUA 1Q6CA 2INEA 1KM0A 2QF7A 2EPLX 2CCRA 4ZB0A 1YDOA 1UR0A 3WSUA 3UGRA 4PUMA 4U2ZA 1H0GA 3GNXA 4IIDA 1QJWA 3AXKA 2ZQ0A 1VFOA 4OV9A 3GNRA 4MY8A 1UZ4A 1MZHA 1X6LA 5K9XA 4FS9A 3NZGA 2PDLA 4Z08A 5LHEA 1YPIA 4A35A 5AYYA 4UR7A 4GXPA 4FB7A 4GZIA 3ZM8A 4CN6A 2BZNA 4C60A 5EB8A 4QTGA 2DVTA 3DI0A 2HVNA 5F1VA 4X61A 3MHFA 4Q3MA 2Q8ZA 4HNLA 3TWBA 4OQVA 2VWSA 1RQBA 1VH7A 1F76A 4RDZA 2Y7FA 3K5XA 5E93A 4Z1BA 4C1KA 2BP1A 1ITUA 3RX3A 3VDHA 4DAIA 2C18A 4B90A 2AL2A 1YIXA 4FEZA 2D3LA 1BRLB 3TW6A 1XCXA 1P6WA 1A5OC 3RDKA 2F61A 2PGWA 4O19A 1E40A 2EG7A 3O0FA 4YTTA 4R27A 5T9CE 1CBGA 4GO9A 2I5GA 4S38A 3VD7A 2OKTA 3LEPA 3IV3A 1ZBVA 4L9YA 1RJQA 2E5DA 2W6RA 3R8GA 5IFTA 1GOOA 3ARUA 4WJ8A 1XISA 4AYSA 1XV8A 3MSYA 1MI3A 1RUSA 1VBRA 2VZTA 3O3RA 1L6GA 4HPHA 3NNTA 2D0GA 4JFTA 1DJHA 3T1GA 1UR8A 4GIAA 2ABAA 4JTJA 3VNDA 3FJLA 2XIBA 2EGZA 3EWZA 3D5HA 3IEBA 2AOSA 1CLXA 5EFDA 2PC4A 4XTDA 3AYVA 4ATLA 1DWIM 1CGUA 1F6YA 1E4LA 3GXNA 1CIUA 2FPTA 3C3UA 5DT5A 2X8RA 1EWEA 1Z48A 2WSKA 4XG1A 2OO0A 3H7UA 1CNVA 3BMWA 3DHPA 3WKZA 3BO9A 4JTSA 1OC5A 3RLVA 2VRKA 4QDPA 4WSJA 4Z2IA 5I2UA 1XLIA 4FX7A 3WQDA 4AD3A 3FSTA 2J8GA 1HVQA 4PFHA 3IUIA 1PSCA 3ITCA 3BSGA 2EHHA 3B8UA 5FCZA 3OA3A 1PIIA 3O06A 4M3PA 3TSMA 3N34A 5A95A 1MW3A 1EJUC 3G77A 4Q8UA 2RFGA 1DHPA 4HZMA 1FXQA 3BICA 1MQRA 3KVKA 2YDRA 4ZQMA 3RCYA 2Q71A 3BMVA 2GGEA 2X1UA 4B2DA 1R87A 1REQA 3L65A 1YNQA 1RP9A 1JL8A 1WA3A 4LEFA 4TX9A 2CKRA 3K8LA 5CLTA 5EMJA 4IMCA 2JGQA 4BWLC 1U22A 3IK2A 1PHWA 1VFMA 3RX2A 1V5XA 3S6DA 4MFDA 1R7OA 3FX4A 4P61A 3MMUA 2XFYA 3FLUA 2JBMA 2XSBA 3IJLA 1UKTA 4EVZA 1DIKA 1E6SM 1OIFA 3GNOA 4NZCA 3I68A 3ARYA 3KRUA 4M8UA 4ZE5A 1X6UA 3S2CA 3W2UA 4V1XA 4NILA 3IJDA 4WKFA 3VYLA 3S2MA 2R24A 4YWIA 3SCQA 4GUFA 4Y9OA 4NIRA 2GLKA 3V5CA 4B91A 1QXLA 4OBTA 3UPWA 3UXKA 1PTGA 3AMGA 3UP8A 4O16A 4A2RA 2ZX5A 1MNSA 3PFMA 2QHAA 2FKPA 4GVFA 2PTYA 4FAMA 4IGMA 4O54A 4RDWA 3BH4A 1JAKA 3T2PA 1UZHA 1MO0A 2Y85A 3N2BA 2OSXA 3VGFA 3BG9A 1UUMA 1BF6A 1L6WA 1MQPA 3BSMA 3RG6A 1BG4A 3MPGA 3FV9A 3N4EA 4XBSA 3WUFA 1TO3A 4PMZA 2DH3A 4BQ2A 5CZJA 1M04A 5REQB 1BD0A 2G3IA 4FR6A 1YTEA 5C9XA 1MFVA 2ZUNA 3B04A 1JDDA 2QR6A 4CVWA 2WVUA 1NP0A 3EKGA 1HKWA 4EPKA 3MHGA 4IP7A 4A29A 2QDHA 4NHVA 4A2SA 5CJMA 1TWZA 1NEYA 3BCDA 3UG8A 4GH3A 4F66A 4HN8A 1F7BA 2WLYA 3E2VA 3K8KA 4W8AA 4Q4KA 3NOEA 2PLKA 4O17A 2Y0FA 2OB3A 2ZADA 3ONCA 4FF5A 2IW0A 3F4DA 3CQHA 4K7VA 4DWSC 4JIPA 2FFIA 1A5LC 2PDXA 3OJGA 5A3HA 3NSMA 1PV8A 2EBNA 4HYWA 3AMCA 3PSVA 1GQIA 1CGTA 1IT8A 3KHJA 1LUCA 2JF6A 1L8NA 3EA2A 1JPKA 3P81A 3P84A 2XM1A 2G3FA 2QQ6A 4M6PA 4ZFMA 4J2MA 4M1BA 4N9CA 3LCFA 3EPOA 5CAHA 1YTKA 1PDZA 3CNYA 3G6MA 1B9BA 3LBOA 4E8DA 3M1ZA 3GKFA 3BL3A 4JN6A 3W75A 3GHTA 4KWVA 3UZ5A 1OHLA 3ALGA 2YSWA 2XH0A 1KBBA 1XRFA 2AQOA 3C0SA 4LUSA 4GJ1A 4FNRA 1SZEA 3CWHA 4PGLA 4E3VA 1H1NA 5I77A 4F40A 3VZYA 3MV11 5FJJA 1TV7A 4QNWA 4Q8NA 1XD1A 3WL1A 4P8VA 4M6UA 3B0YA 2IPGA 1TMHA 4RR4A 3A5VA 2CHNA 3VOHA 3DG7A 2PU1A 1IIGA 1R9XA 5DXXA 3RPTA 3NYDA 8TIMA 2BXZA 4I8YA 2IPWA 3LPGA 4HSOA 2HXUA 3R25A 7TAAA 1GVQA 3E0FA 1ENUA 4PL2A 2WVVA 4AC7C 5FL1A 3LM7A 4MWAC 1OG0A 3NQ6A 5DY2A 3QOMA 3W2JA 1MW2A 1JGMA 2VWTA 4KEUA 3NL2A 2DH2A 5J5DA 1RLDA 3BLKA 4PUUA 1IQ8A 4GNKB 3CUXA 3RRXA 3VK5A 1P1MA 2FYMA 3VIIA 4KGJA 1UOZA 2PDMA 4JYEA 3SURA 4GLEA 5CPSA 3VX1A 3WQ8A 3OB8A 3DYPA 4KWSA 4XSLA 2PWHA 2BX7A 4XV0A 1XC4A 3EDDA 3T7VA 4HYRA 4E4UA 4JQ4A 4A8NA 2E8ZA 3U48A 1AW1A 1NU5A 2Y8UA 4CD5A 4YL2A 1KM2A 3AISA 2A3BA 1UKPA 2V5BA 4ECLA 2ZC1A 2D22A 1RD6A 4JFSA 1J11A 2R1LA 3HA1A 1JDCA 3GZAA 1JXJA 4DYEA 3OVPA 3VCCA 2RJHA 5KINA 4Q4QA 2QJJA 3KL5A 4C5YA 2YX0A 1P4CA 1ME8A 4F79A 2C1HA 1CWYA 1TJPA 1C3FA 1IWPA 3EX2A 3BOLA 3CYVA 8XIMA 3N17A 1B9ZA 4HA4A 4YN5A 3IACA 4UZUA 1VFTA 1ZJAA 5HPCA 3TQKA 4QNEA 1XH2A 3NSXA 3TUUA 1WDWA 2JEPA 3RPDA 1GOXA 4WHBA 1Q8AA 3W7CA 2IKJA 5D32A 4Z1CA 3VDAA 5CBJA 3UR2A 4ZMGA 3GW0A 3TONA 5E09A 4FNUA 3U8GA 4OJYA 3RR1A 1SZNA 4QJ1A 5AC6A 2J9YA 1ZY9A 4PMUA 2OQLA 3QY7A 4ZBCA 2J88A 1ZBWA 1JG9A 3A5FA 4LALA 3WDHA 3L4TA 1KFKA 1BXCA 3VABA 2OMAA 4IMAA 3W86A 1U2YA 2BSLA 3LI1A 4IGHA 1SFTA 5HQLA 4NNAA 4AIOA 4MM1A 3NOYA 1JCTA 1XFBA 4O15A 1JPDX 1IT7A 1CLKA 1LYXA 5CBBA 1EKOA 3CZGA 3QTGA 3S3GA 3A3WA 3RM9A 1XYAA 3HG2A 4NAFA 2AAMA 3ZR4A 1PIGA 3MUXA 3I7RA 1D3GA 1ZP3A 3L21A 3HU7A 3A4JA 5HJYA 4KCTA 4ERGA 5AFDA 5C55A 2X09A 4FNPA 5HMSA 2VI0A 3CPRA 3C2EA 1VCFA 3LCGA 1QW8A 4JDYA 1FWSA 1M41A 1DE5A 3CAWA 4C6KA 4HHMA 4QR6A 2ZDRA 2BHUA 3PPFA 1R8LA 2A7PA 3ES8A 3UXLA 4HA0A 5I09A 3UXAA 4QIUA 1BKHA 4M1RA 4AZ7A 1OJXA 4KFPA 3OLDA 2YBVA 3M5ZA 1QT1A 1CX9A 1XR2A 3OP2A 3TQPA 2NQHA 3NQ7A 5DRIA 2GUYA 1WP6A 1FY6A 4OOZA 1Q66A 2Y2WA 2P8BA 4OV4A 2V81A 5F2MA 1OADA 2V69A 2WSRA 3W1NA 2D2GA 1R3YA 4AF0A 5HR7A 3HMJG 3EEZA 3OTRA 1OFQA 2P88A 4C6MA 4GCAA 4L5ZA 4PEKA 1SJBA 2PDFA 4B5SA 1WB0A 1SZFA 3BAIA 4OUIA 3IJ9A 1C9WA 1QW9A 3UR7A 5GPRA 3FDKA 4UWMA 5EMYA 2W62A 3I6RA 4GPNA 1ZB5A 3KM8A 4HHHA 1GUVA 1T5AA 2ANUA 3O63A 2X05A 4EP8C 3VFLA 3T9PA 1VBGA 1NM9A 2NWRA 3G1DA 3DESA 4RDVA 4UCFA 3MB9A 2BMBA 3T05A 3N2CA 5IOBA 4W7UA 4XD5A 2FFCA 3F2CA 1DBTA 3AIUA 3TX9A 3LTYA 3S4TA 3VIHA 3WBWA 4ASTA 1DXFA 3H2AA 3H6OA 2CBIA 3AZSA 9XIMA 1F61A 1TJ0A 1PYMA 3ORWA 4P7LA 1AA1B 2I9UA 5MHBA 2CIPA 4DF2A 1O1HA 4X2RA 4FOJA 2OX1A 3A21A 2Y7GA 2H3DA 2GVYA 4GJJA 4ADSA 4IFKB 4S3CA 3EX1A 2QCDA 3WQEA 5HQMA 2GFTA 2C79A 2OGYA 5HMEA 4HNOA 3RU8X 5LHFA 3MMDA 4H8UA 2Z2BA 5D2VA 1CGYA 2PGFA 2OR2A 1EPXA 4HK6A 4PMVA 3B0VC 3G0UA 1SGJA 1A0EA 5DCEA 1QI0A 1NH6A 3O9NA 1J18A 4GZ7A 3NM1A 1TJ1A 2I14A 3L0NA 1E71M 3SCSA 4O14A 5A6JA 5AY7A 3AOFA 4NQ1A 1DTUA 4HK7A 2A5HA 1E1EA 2E9MA 2C3ZA 3MQTA 1IXQA 4OHQA 5BU9A 2BXVA 2OYMA 4TR9A 4NNBA 4CQBA 2ESCA 3TTSA 1JF5A 5I23A 2VCBA 4N7QA 1EJRC 1OIMA 1HP5A 3TDFA 2FGLA 4GKTA 2E5BA 4ZXLA 3LTPA 3B9AA 3ZS4A 3TA6A 3E2QA 1S5TA 4EXQA 4O1BA 3V0SA 4HSNA 2X2YA 4CLMA 4UTMA 3GG1A 3ARPA 1TWSA 1AZ2A 4KEZA 1PPIA 2HK1A 4FLQA 3RX4A 1AQMA 1E70M 3RNDA 1HJUA 2XINA 3T44A 1Z8AA 1EDGA 3HF3A 3NDOA 4NI3A 3TIMA 3BTNA 3KVLA 3RITA 4IL0A 5IBXC 4HU0A 2P53A 3UCCA 1CEOA 2JKEA 1ZP4A 1TCMA 4ZQPA 5DMNA 1TR1A 2FZNA 1SO5A 1BSIA 2HE5A 2QMKA 4AD1A 4DVOA 5A94A 4MPQA 1KD0A 5CPQA 1PS9A 3GWQA 3QGVA 3UU0A 4B5UA 4HNUA 4Q4RA 3E6EA 2BB0A 4ZQRA 2VVNA 1ZJHA 1A5CA 1EGZA 1HNYA 3CUHA 1M65A 1BHGA 5LXEA 4JS3A 4ADUA 3WBYA 3WQOA 4CNTA 3KRZA 1JCMP 4LTSA 1LDCA 3UR5A 3FJNA 1TG7A 4IJRA 5TF0A 3ARSA 1TPWA 3E0VA 1TUFA 3O07A 2NV1A 5EMKA 4HA1A 5AC7A 3QHOA 4ZO8A 4G56A 3AFBA 4FXFA 3GK0A 2POZA 4EANA 1UWSA 1UP0A 2FGBA 2KX9A 3H2MA 1N8WA 2DUAA 1GYMA 3UF9A 3LN3A 5HMFA 3RCNA 3OYZA 3T08A 4E8GA 1YXCA 1YE4A 5KITA 2GUUA 5I02A 2HS6A 1JCJA 1O1ZA 1XRTA 1S1RA 2J74A 1VZWA 1R85A 4I9JA 1ZAIA 4GZJA 4KQNA 3L5MA 4WSKA 2OXNA 2CWNA 2C16A 1VF8A 2QW5A 5G5IA 3GO2A 2PRHA 3DZ1A 2X7VA 3CUFA 4G2DA 2A7NA 4D6FA 1Z7AA 3ARQA 4J9JA 3OZPA 1OBAA 3W23A 4D6DA 1JUKA 3PB0A 5DO8A 4F2UA 3WF0A 2PS2A 1H11A 1J0ZA 4W7WA 2VM8A 4FX8A 2CPUA 1QO2A 5FJIA 1W54A 4J3WA 1W32A 4JTLA 1C90A 4HZ6A 1LLWA 3EB4A 1RLCL 4A8LA 4LUJA 2BS9A 3HMCA 2RGLA 3DUGA 4D72A 4F0MA 5A8OA 1UIPA 3FA4A 2QCEA 6REQA 2HNEA 2V8ZA 1VEPA 1J5TA 3ES7A 2CLIA 3UESA 3NPWA 2RGMA 1FHVA 1VENA 3VUSA 4UTFA 4H41A 3IJ8A 3BG5A 2QYGA 1RSCA 2NQ9A 2GSEA 5GJMA 4LUYA 2GL5A 3LCXA 2NVDA 1H3GA 3V1PA 2H3BA 1S38A 4PTNA 1S3HA 2GVGA 2VVSA 4LJ3A 2ALRA 1JFXA 4QLJA 2OGJA 4MZ1A 2TPSA 4KT2A 1HL8A 4PBFA 1Q4WA 3FGCB 3G3MA 4DX3A 1JZ5A 5AYZA 1R86A 2GYIA 1UROA 5CGTA 1FWTA 4AYGA 4JOMA 2J7BA 1HJQA 5HNUA 2XZ9A 2FHBA 4HHPA 1V0LA 4Q22A 2VQUA 3VOGA 4MWAD 2BFGA 3MY9A 2OSWA 1J01A 3SUVA 2HWGA 5JMUA 4ACZB 2XH7A 2XIIA 4AWTA 4DF0A 4ML9A 5FEZA 4MGGA 4GI4A 3LCIA 3EOSA 3GH5A 2X1TA 4ZSUA 1LLOA 1EA0A 3RM8A 1CTNA 3MUIA 1VBUA 3GR4A 3AMLA 1JXKA 4NRRA 1V0MA 4DYJA 3M46A 1MRAA 2UY3A 1BYAA 1NVMA 1HN1A 4JBRA 2WM1A 1B3WA 1I2RA 3AMDA 4KIRA 1A3WA 4JIHA 4Q4OA 1MEHA 1ZSXA 4RUBA 5CQ1A 2VNCA 3N73A 2NQJA 1AG1O 5TD4A 2GJRA 2DZWA 3MU7A 4S3KA 2OSYA 5AYIA 1U1UA 2ZZ7A 4P8UA 2CZDA 5ENLA 2PLJA 1RA0A 3OHIA 1X96A 1IR1A 4N6EA 3A9BA 3ZJ7A 1PDYA 1AJ2A 5AC5A 1IV8A 2PC8A 1RA5A 4CEXC 1HJVA 5DMLA 4AZIA 3OGRA 4Q32A 2DY3A 5E6ZA 5HINA 2GGHA 4LOCA 3W7NA 1K6WA 3UA4A 4UNIA 1O5XA 2BOEX 3RILA 3WDIA 1KKRA 3TZNA 2ZRUA 1GTEA 1OX6A 3VOJA 3A9IA 3UZZA 1LL4A 1BYCA 1CB2A 4US5A 3SCWA 3EWUA 3VC6A 3QC0A 3ARRA 1YRRA 4PULA 4PMDA 3CHFA 1KFLA 3IAPA 1D8CA 1NFPA 4UTIA 3R0DA 4G9PA 3IPWA 4GOAA 1R9YA 2CLMA 3OZYA 3ZR6A 4I8DA 4GINA 5IDIA 5D4YA 5MF5A 4I90A 4Q8TA 4Z17A 2E1WA 5CXPA 1OK6A 3UJ2A 1H2JA 2IQTA 2J24A 4F8XA 2DSVA 2WQPA 2ZUWA 3IIOA 4JFVA 4A3RA 4IL2A 4YYCA 1DWAM 3T2OA 3GTHA 4C5ZA 3WYZA 4ERAA 1YE6A 1GVOA 1ZGDA 2FJUB 3UG3A 1S2WA 1F3WA 3RCMA 1OGGA 4C1NA 4JNYA 6PTDA 5BOFA 4QM1A 1QUMA 3BJTA 4ZVJA 5I06A 4ZOBA 1TA3B 1Q13A 3QW3A 1B3XA 2VOMA 3L67A 2GGJA 4UFJA 3Q37A 4EIVA 3S5NA 4FP1A 3T4CA 2ZTKA 3AS1A 3WLMA 1K8XA 3EWBX 5BCAA 3N2OA 2XG9A 3F4NA 3W70A 2YDAA 3F1QA 2CHRA 4AIUA 1FP8A 5G2WA 4C6CA 3TNBA 3MYOA 3M5XA 4C6QA 3AQUA 2BHZA 3EWXA 3QLDA 3NFUA 2OLAA 3TCSA 5D02A 1LCOA 1LG2A 4O12A 1C8YA 3FOKA 1U83A 5HJXA 4ZA0A 3CJPA 1TPUA 1XLMA 3TP4A 5EFFA 3GU9A 1M01A 1X7IA 4M80A 4RZ6A 4REQB 5C9ZA 3TOYA 1W9PA 1UH3A 1SMAA 3VIMA 4LAZA 3THQA 3AWOA 3USZA 3UG4A 2BGNE 2WKJA 2W4XA 4I6VA 3U5YA 4G7EB 1NARA 5E0KA 1MQQA 4PE8A 1YADA 1CGVA 4RLIA 2PWGA 4GFIA 2EJAA 1T7LA 3E5PA 1D8WA 4JFWA 1KV8A 3WNOA 3AHVA 2DIEA 1GKQA 2V82A 3GFXA 1XJBA 4QE4A 2PDHA 1UB3A 2I5IA 1DE6A 1H41A 2BGQA 4TQTA 4TX8A 4C6JA 1R3RA 4LUIA 1FWEC 2YCLB 1LL7A 1J9YA 4AZ6A 2AL2B 4AFYA 1GVFA 2D2JA 4CD6A 3HG5A 2PFHA 3BAKA 4UTKA 3MO7A 3PZUA 3LUTA 3UPMA 3KOFA 1I1XA 1V6UA 1TE1A 3STPA 1QNOA 3SY1A 3TKFA 4JY9A 2CXGA 3GDBA 1ME9A 3D6NA 4D6CA 1XLHA 4DLMA 4XX6A 3VE7A 1SR0A 1FBAA 2DT0A 4EACA 3S1GA 1KW1A 2VCAA 3DAQA 1B3YA 2PAJA 4MADA 1KFJA 1JZ6A 2VC5A 4Q8WA 1LWJA 2VMFA 4YLWA 1B3OA 1IXNA 4LB3A 3AZTA 4GO8A 3P6LA 2ZE0A 1ZBKA 1RALA 3SN4A 3N25A 5C70A 4XQ6A 1B57A 4JN8A 3LMZA 3A4AA 3UG5A 3MYPA 4YTSA 4JX6A 4C6NA 3NPUA 2YL5A 3JZEA 3HGSA 4DAFA 4Y9MA 2B81A 1HT6A 4S2CA 1WDQA 4XAGA 5KZMA 3VGHA 2H8XA 4CU7A 3VM7A 2QT3A 4GQBA 2J6VA 1FCQA 1N8IA 2W79A 3ITOA 3QW4B 3VNJA 8CGTA 1DJWA 3VOCA 2GDUA 2NXHA 3QYSA 1XICA 3MTWA 4AZ5A 3BLLA 2DT3A 3NQ2A 2Z1VA 2Z4GA 2B31A 5FJOA 3EB3A 3UY7A 1V77A 4GWEA 1ZCOA 3L9CA 4PSPA 3A3HA 1KO0A 1IZJA 1EOMA 4XO6A 1X8CA 3O0KA 3AHTA 4BF7A 4CD8A 1XC6A 3TTEA 4LNYA 1XLDA 3IJ6A 3WLTA 1RY0A 2NUXA 2J75A 1BGAA 3REQB 3V5OA 5JH2A 3THDA 1MZRA 4MNKA 1RD5A 4XK2A 1F05A 1B4KA 4GXMA 2GQ8A 1XYZA 2PEVA 3P62A 3PZGA 4HCDA 2PU0A 2PCQA 3H4GA 4IXHA 3OHMB 5EPDA 3WH9A 1G7UA 2RUSA 1QHPA 3WJYA 4LUTB 4UOJA 1X6NA 3H26A 3PBVA 1XH1A 2RDUA 3GDLA 1O5KA 4MYXA 4NZ5A 3FCPA 1NDVA 5CJ5A 2W27A 3MJYA 6XIMA 3HG4A 3A64A 4G6CA 4ZE4A 1BWKA 1B30A 2HBXA 3LHYA 3WD3A 1TV2A 5KTLA 4O4WA 4CN1A 4AMCA 3MKCA 2X0SA 3TYCA 5G1MA 2OWCA 3MBFA 1WAUA 3Q58A 3W38A 3S5YA 3TYZA 4IMDA 1K7FA 3C3NA 4ORIA 4DXVA 2EO7A 4CNSA 3NZPA 1V3LA 2O9TA 2J13A 4V33A 5HATA 2HE8A 1CXIA 2Z26A 2C91A 1T41A 1XSJA 3A47A 1T8XA 3W22A 3AJXA 4CGTA 3S9ZA 1NWUA 2C13A 4J3XA 1OC6A 4HZ8A 2OEJA 5CPOA 2FB3A 3CLWA 3GY1A 4A05A 3TMLA 3AUOA 3W6YA 1KWGA 1QBAA 4I7UA 3T0BA 1TV5A 2WHJA 1A5UA 3EX6A 3W53A 3AHZA 3G1RA 1K3UA 3CQKA 4ENLA 1ICPA 2F6KA 3LCLA 3ID7A 4J40A 1W3IA 5FAJA 1GKRA 3H7RA 4JX5A 1VEOA 1GNXA 4LYKA 1ZLPA 4HTYA 1GHRA 2WZEA 1M7XA 4KERA 1VRDA 4AY8A 2CFFA 1GT8A 2ABBA 2WSYA 2R6OA 3OQ8A 1QK0A 2XFFA 1TTJA 3I3EA 1W1TA 3C8NA 1GOWA 4GK8A 2V2HA 3U9IA 3KBWA 3KTCA 4M7TA 3UZWA 3GE7A 1XUZA 4NU7A 2CLEA 4NP7A 1J8VA 1AD4A 3H22A 3C2OA 3B9OA 1TA3A 1UP2A 2QAPA 5HR6A 1A5KC 2ZUMA 4W9TA 3W73A 4CEUC 1EJTC 1X39A 3NL3A 5BMWA 1WDPA 2IKIA 1ZL1A 3DC0A 5KSWA 1W1B1 4CNPA 2QS8A 4DHGA 1BWLA 4X0NA 3MC5A 1CPUA 3SCNA 3COTA 3SO7A 1P7TB 1JEZA 1HKIA 4XSMA 1R9ZA 3FNDA 3ZJKA 4CVUA 3N11A 3OGSA 1S1PA 1EJSC 2GJNA 2PF0A 4RZBA 1THFD 3UY8A 3BK0A 4Q6JA 4NL1A 1B5TA 4WX2A 2OZ3A 4UMAA 2ISDA 1CXLA 3IRDA 3WQWA 1SW0A 4LCSA 3HIJA 3SSJA 3E0WA 4QJ5B 5HXMA 3TLLA 3W74A 3CUGA 3VA8A 4KWUA 2VD9A 2QDDA 1KCKA 3IVUA 2O92A 4KF1A 2DT1A 3P5YA 2QV5A 3IWPA 4M56A 3AS0A 3QKZA 3C2YA 1JUEA 1HVXA 4CCCA 1A4LA 1R30A 3L2IA 6REQB 1TVPA 4P8WA 2C0HA 1UWUA 5D30A 1FH8A 2YL6A 1R5YA 1GJWA 3AYSA 3SJNA 2NZLA 3CZ8A 1PBGA 3FAWA 5AECA 4DI9A 1SR9A 3K8MA 1U1JA 3PZOA 4MLRA 3W7OA 3WNNA 5CGQA 3FYPA 4Q6XA 4P8XA 3CPUA 2V2DA 3OA5A 4PMJA 2HV5A 3HPXA 1UR4A 3TJXA 3WY1A 3RAOA 1OD8A 3NIYA 3ABRA 4UFHA 4IOTA 5DCBA 4S23A 3K4WA 2OYKA 1QBBA 4RKAA 3LRLA 1QHOA 3ZYZA 3AHXA 2TSYA 2DFAA 2JIWA 3IGHX 4Z1AA 4HU8A 1V6VA 2P3EA 1UR1A 1AQHA 4ATDA 4KRZA 3M0LA 4H4IA 1SW3A 1GYNA 3R7MA 3ZZ1A 2YCIX 4AHQA 1WZKA 2X41A 3B8DA 4O18A 3SRFA 3OEXA 2PWDA 2V3DA 1C7SA 2OFJA 2Z7KA 4U5KA 5FF3A 3F4VA 4XD4A 1DORA 3KL3A 4PRWA 4D6EA 4QLKA 4MWAB 3T78A 4LANA 1W2PA 3VKCA 1D7KA 4QCEA 1QWKA 4F48A 2WNWA 3IJQA 1K9TA 1W9VA 3WJWA 3ANYA 2PWFA 3H2OA 1VIWA 3ZVIA 4I5RA 4V1YA 4XUYA 2VX6A 1YBQA 3W84A 1AFSA 1SQ7A 5DANA 1POKA 2E0PA 4HNCA 3TN5A 1Z6KA 3P5ZA 1WZAA 3LLDA 2J7CA 2PDKA 4MFEA 2O7SA 3GAKA 1P43A 1FCBA 3CWNA 2Y5SA 4RNFA 1F3TA 4D6HA 1KBLA 3KZSA 1TFVA 4JKLA 3GR8A 3GXPA 3PTDA 3SGGA 3ZSSA 2PPGA 4FHAA 2O4MA 3SIZA 1C9DA 1IR2A 1C8XA 4YU1A 3LGGA 4YTRA 1UD5A 3UWQA 1P0NA 3RGTA 1H60A 1RPKA 3BW4A 3IJIA 4WZHA 1KFWA 4RX0A 2XIQA 4DUWA 4MYAA 1GQKA 1JDFA 3AU2A 2E6AA 2DP3A 3ZMRA 1MYRA 2VEPA 4WOQA 4M6QA 2ZUUA 4F2TA 2D0FA 3BAJA 4TVDA 1E6XM 5D05A 1PVNA 1K1DA 1CW2A 4IG2B 3N29A 4M5PA 5CAKA 5J5RA 1IWBA 4UR8A 2PBOA 2ZZ3A 2A6LA 5I3DA 4TTUA 4J5NA 1JYVA 3KS5A 3ITLA 3E1F1 1KLZA 3H24A 1SMDA 3W87A 1VFUA 1J0KA 3PZIA 5IHRA 5F2IA 3FHQA 1U33A 4DPPA 2A3CA 1YYAA 2OT1A 2XIJA 4JQ3A 1KGWA 1Q45A 4KETA 2PTWA 3GVQA 3TK7A 5T91A 3SQLA 1E5NA 4IIHA 3EX3A 2D1ZA 1TTIA 2Z1BA 3LXBA 2YYUA 1LBLA 3CMFA 3GDRA 1NDWA 1GQLA 1Q7MA 4XWUA 5LNWA 2V5LA 4QLLA 3DN5A 4S1FA 2X30A 2D24A 2OOGA 3SY5A 1JGIA 5DT7A 3L68A 4C6FA 4UIOA 4NT0A 4H2CA 3DXIA 4IPJA 2RH9A 3W82A 3CHEA 3OIXA 3EOEA 2GZXA 1RCQA 3NO5A 5A8PA 1KLYA 4HPNA 2VD8A 2A7RA 1FWAC 1Z32X 3BQ6A 3DGRA 3ZWTA 4LRTA 3DBNA 4AWEA 2PZ0A 4HMEA 5CSYA 3T07A 4KMQA 1WE5A 1MW1A 1SZRA 3QH2A 4Y9PA 2WAGA 3QPYA 2OX4A 3VTRA 3LM3A 4GUJA 4MB1A 3HPSA 4WDTA 3CU2A 3ITYA 3IANA 4C6IA 3M0ZA 5LXXA 1XYFA 2VGBA 2Y70A 2WPBA 1W9DM 4B5WA 1XLAA 3PY2A 4E2VA 1F9CA 1J0JA 4MUPA 3TAKA 4IXXA 3GQYA 4OFCA 4E2OA 2ZCGA 2BGSA 3V0TA 1M68A 2G97A 3KBJA 1J0YA 2Z1WA 4ZOCA 4QROA 2AKZA 1SSDA 3B0PA 3U7VA 3ZXWA 1BPLB 1ONXA 4X0VA 1LT7A 2J7EA 3IJ7A 1EO5A 3RMJA 1XIHA 2V3GA 4FNSA 1Q63A 3SJ3A 5CSUA 3GAYA 3ME3A 1TCDA 3UJEA 4KPLA 1O66A 3GB6A 2V67A 3GH4A 4HSHA 3DFSA 4EWJA 2VQTA 4AF0B 1OZQA 1SFLA 4XZIA 3VCRA 3OVRA 4QDMA 2NLIA 3ABOA 4TVCA 3C5QA 4RJEA 4GACA 3QQWA 4GQGA 2AMXA 3B97A 3CBWA 5CSRA 2XVLA 5CC7A 5LA0A 5TNVA 5I3KA 3P14A 1JYWA 2OQHA 1F8IA 4MB5A 4XBKA 4BQ3A 3R8RA 4ONVA 4ZB5A 1QCWA 3FY1A 5LIUX 3LGEA 3LHVA 3CM4A 1UYQA 4L4PA 4L1XA 5M3WA 2A21A 4N0RA 5A2CA 2VTFA 4HU3A 5U4NA 4H83A 2V63A 2EG6A 1EC8A 1NFGA 2C7FA 2ZDSA 4O1EA 4DZAA 5AHMA 2REQA 3EA1A 3PWGA 1REQB 4JGDA 3MVTA 1JF6A 1ITCA 3SCPA 1TPFA 2DZVA 4AG0A 4A4AA 3CO8A 3W7HA 1ITQA 4H8HA 4NUWA 3U57A 1QPRA 3W6LA 3WK1A 4HHLA 1DV7A 3PAOA 3MMWA 2PURA 3WQPA 1Y5VA 3WBXA 3CUIA 4Q8MA 3W1RA 5IRPA 1QPQA 3M0VA 1V6TA 3OODA 1P5BA 4JIQA 2NVCA 3M5YA 1EF3A 3ANUA 4LC8A 3F03K 1OYBA 5HWNA 1KCZA 3W2KA 5D2WA 3B3DA 3OLEA 5FOOA 1YDYA 1RH9A 4K8HA 3UWEA 1PCKA 2XN2A 1E3XA 2VC6A 3FW6A 1W1VA 2DT2A 4LVBA 4I3GA 1F5ZA 3KXQA 2J7HA 2I1OA