2JETB

Crystal structure of a trypsin-like mutant (s189d , a226g) chymotrypsin.
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
128
structure length
125
Chain Sequence
GEDAIPGSWPWQVSLQDKTGFHFCGGSLISEDWVVTAAHCGVKTSDVVVAGEFDQGENIQVLKIAQVFKNPKFNMFTVRNDITLLKLATPAQFSETVSAVCLPNVDDDFPPGTVCATTGWGKTKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of a Trypsin-Like Mutant Chymotrypsin: The Role of Position 226 in the Activity and Specificity of S189D Chymotrypsin.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase
molecule keywords CHYMOTRYPSINOGEN B CHAIN A
total genus 13
structure length 125
sequence length 128
ec nomenclature ec 3.4.21.1: Chymotrypsin.
pdb deposition date 2007-01-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2jetB00
2BD9A 2QXIA 1Y3YA 1C5VA 1C1SA 2GZ7A 1SFQB 4AN7A 2NU0E 1NFXA 3RXGA 2GP9B 1G32B 5GWZA 2JKHA 2SGEE 2Y80A 1DFPA 1GHXH 4IMQA 1LHEH 2KAIB 1HAIH 1KSNA 4ABBA 4NA7A 2Z9GA 1CO7E 1EJAA 4AFUA 1DOJA 1O3HA 4B76A 3A8BA 2ZP0H 4XBBA 1O2WA 4CRCA 2VWLA 1HJ9A 1EKBB 3TJUA 1ZHRA 3MNBA 1E35B 1EJNA 1MAYA 4NA9H 1HPGA 1Y3UA 2AGEX 3RXAA 4XBDA 1ANDA 1H8IH 4M7GA 5B6OA 1TNHA 2FOAA 3QWCH 2V0BA 1EX3A 4AB8A 1HBTH 4MG3A 1ARBA 1W0ZU 3RC6A 1TPPA 3GY7A 1W11U 1TPSA 1E0FD 3DT0H 2HPPH 3SU2A 1NN6A 3URDA 3KGPA 2EA3A 4KKDA 1FPCH 8GCHF 3ZZ4A 4Y7AA 1T31A 3T62A 3TK6A 4TPYA 3SI3H 3TITA 5SGAE 2C8WB 1AZZA 3SNEA 1O2YA 1O3KA 1J9CH 3K6ZA 1CGJE 4FUIA 2GV7A 3T26A 1KDQB 1C2MA 1O3NA 1TAWA 3HGNA 2D1JA 3LGYA 5A8XA 3GDSA 1GJ4H 1O2PA 1S5SA 1ZPZA 3BF6H 1BRCE 4B71A 4IN1A 4Y8ZA 1NU9A 3L3TA 4RKJB 2FOCA 4Q80A 1XMNB 5DP8A 1Y5BT 5F8TA 2EI7A 5EGMA 2Y7ZA 1VITH 4GAWA 2A1DB 2RA3A 2ZCHP 3ATKA 4X8TH 1YLDA 1OKXA 1UTPA 4ISOA 3SU0A 3UOUA 5JBAS 2XBWA 1GI4A 2HALA 1ELAA 2TPIZ 4Y79A 4ABEA 1HAGE 1QB6A 2A5KA 2GZ9A 1HNEE 1NRPH 3F68H 5A2MH 1G2LA 3K6YA 1CGIE 3TJNA 2W7UA 3GCTF 1V3XA 1BTPA 2B7DH 3ESTA 2XRCA 4INLA 1OWJA 1QFKH 1TIOA 1SGFA 4Z6AH 2ZDAH 2JETB 3LKWA 3P8GA 2PWXA 1C2EA 4YT7H 4IS5A 4WXVA 1EAIA 1RD3B 4HI3A 3H5CB 2JH6D 2P3FH 2QGRA 3TNTA 2ZTYA 4NG9H 2XYAA 4SGAE 1XXDA 1SLXB 1NFWA 8ESTE 5GDSH 1ZSLA 4DGJA 1CU1A 3PO1B 2UUFB 3KHVA 4IBLH 1K2I1 4NSYA 2F9NA 1Y3VA 3RU4E 1RTKA 3EE0B 1TRYA 2R3UA 1MTNB 1SC8U 1SR5C 5G4BA 2PLXA 3M36A 1C5RA 1Q31A 2G5NA 2OBQA 4ABJA 1K1NA 1CE5A 4YOJA 1ANBA 1O0DH 4GPGA 1QQ4A 1WBGB 3BIUH 4KELA 2FS9A 2BD8A 1GCTC 1C5XB 1JRSA 3PYHA 1AI8H 2FM2A 5E2PA 2OC1A 1ESTA 1QHRB 1V2NT 1AKSB 1Z7KA 1GGDB 1ETRH 1DM4B 1SOZA 3NWUA 1HJAB 2ZDKA 2VVCA 1FY1A 2PGQB 1ESAA 2C93B 2ZC9H 3SUFA 2BTCE 2CGAA 2HOBA 1GL0E 2BXTH 1TQ7B 4GHQA 3SUGA 4B2CA 4OS2A 2G55A 4NZQA 3SORA 2BLOA 4X6MA 4MPWA 5A0AE 1GMHG 1ZJKA 3LGIA 3UUZA 4CRFA 1THSH 3GY2A 3NKKA 4JK6A 5FCKA 4A1VA 4X1RU 1TA2A 2Q6FA 3A84A 1QL7A 4I31A 2ULLA 5E2OA 5IDKA 2A5IA 2GCTB 3EAJA 1OWHA 3TPIZ 3A7XA 3URCA 3LONA 4Q7ZA 5GXPA 3U8OH 1OOKB 1HUTH 1TGSZ 5H4IB 4D8NA 1HIAB 2FLRH 1ZYOA 1DS2E 1EZSC 3ZV9A 2VWOA 1EPTA 2D8WA 2ZHDA 2A4QA 2BDGA 3SNBA 1P2MA 1F7ZA 3SU5A 4KTSA 1LPGB 4K3JA 3RXPA 3VGCB 1BTXA 2H1UA 1GJ7B 4I8LA 3TH4H 3MH7A 1PPCE 2XBVA 2QC2A 3MO3A 4RKOB 2BQWB 3SJIA 2C8YB 2G4TA 2ZPRA 1ZZZA 2V3HH 1Y3XA 1RIWC 3SN8A 4UFEH 5DGJA 1GI7B 1HJ8A 3O8RA 2BD4A 1KXCA 1SHYA 1Y3WA 3QZQA 2NU4E 2Z3EA 3RXIA 3MU5A 1O2VA 1NS3A 1QTFA 4ZXYH 1LO6A 3RXJA 1ZR0A 2ASUB 1WOFA 1MZDA 3EYDA 3UTUH 2GGVB 1S81A 1GVLA 3NZIA 1H4WA 1YC0A 2G4UA 3MHWU 1C2HA 1ZJDA 3A87A 1N8OB 1K1MA 1BUIA 4MQAA 2EI6A 1B7XB 3ATIA 5LPRA 1LVBA 1Z71A 4AYYB 4BNRA 3BV9B 5TCCA 3K65B 1P03A 1GDQA 3B9FH 1OWIA 1T8MA 1BJUA 4K1TA 5L2ZH 3UREA 4Y8XA 1D3DB 2ZFPH 2PTCE 6CHAB 1FDPA 4BXWA 3V7TA 4CBOA 4Y7BA 4ZHLU 3F9EA 2A4OA 3FANA 1TGCA 1P3EA 2FODA 1DSTA 1O5AB 3B8JA 5DP9A 1AY6H 2GVFA 1C1VH 2IPHA 1O2GH 1WTGH 2QXHA 3QLPH 2THFB 3LGUA 1J16A 2NU2E 1UK4A 2QXGA 4WMEA 1TPOA 1BZXE 2BDYA 4B1TA 1QJ7B 5FPSA 2VB0A 1RJXB 1RTFB 4IC5A 1UVOA 1VITG 2IOTA 1EB1H 1MTNC 1V2WT 5HYOA 1IAUA 2A7JA 5AFZH 4E7RG 1VGCB 2VVUA 4MPVA 2ZQ1A 3GY8A 1P09A 2F9OA 1HCGA 2BVSH 4FUFA 3RXEA 4GUXA 4AFQA 1ZPCA 4UONA 2GT7A 3STJA 3G01A 3QTOH 2ILNA 1Y5AT 1LPKB 3KQEA 1AN1E 1HAVA 1HYLA 4WVPE 3MYWA 3RC4A 5C5NA 3U8TH 2O8UA 2P16A 1CQQA 4X8VH 1CHOG 4MDSA 3QTVH 5EPNA 5JYIA 2NU1E 1T7CA 4MNYA 3RXFA 2SNWA 4WMFA 4VGCC 1MKWH 5K0HA 2PTNA 1T4VH 5EQSA 1FAKH 1FQ3A 1SHHB 1THPB 4BAHB 2HRVA 1IQHA 3SBKA 4X2YA 3RXUA 1GI3A 1GI2A 1Z8GA 2GMTC 1SGEE 1AVXA 2LNCA 1K1PA 2FLBH 1HV7A 1TRNA 3GCHC 1H8DH 3HKIB 1W12U 3FP7E 4X1NU 1HAVB 4Y10E 1AE8H 4Q2KA 1W13U 1OX1A 1MU8B 3JZ2B 1P2KA 3K9XB 4Y76A 1QRXA 1FN8A 1AUJA 2A7HA 4DOQA 1P01A 4YOGA 1N6YA 4R0IA 1GJAB 1L1JA 2ZG0H 3GY4A 1C5WB 1A61H 3GDVA 4H6TA 4LOYH 4KTCA 1ESBA 1O3CA 2ZZUH 4J2YB 1UHBA 5JB9S 3SUDA 3L6PA 1GJ8B 2G51A 3SHCH 4E05H 2F9UA 5DK1A 2VWNA 1O2QA 5DJ7A 1YPMH 1J14A 3B23B 1MD8A 3Q00A 1LVOA 1S0QA 1V6DA 1AE5A 2G00A 2BDHA 1RIWB 3MFJA 2ZHWH 3UNSA 3SV9A 4H4FA 3SJ8A 1O3LA 1Z6EA 2P8OB 3SU3A 4TYDA 1RXPA 1LDTT 2Z7FE 5JBTA 1BBRE 3CS0A 2I6QA 2PKAA 2J34A 1F0SA 3ZZ3A 4DCDA 1O35A 2OCVB 1EAUA 4BTIB 2QF3A 2F91A 1GBBA 1UHBB 5GPIB 4YLQH 4O3UA 2Y5FA 3ZZ5A 5FBEA 4OS7A 1UVUH 4MPXA 2W5EA 3MMGA 2OP9A 2ZTXA 1UTMA 7LPRA 9LPRA 1DICA 3R0FA 2BZ6H 4NGAH 2FI5E 3M3SA 1TGTA 1O2IA 1TA6A 1G3DA 1C5LH 4I8GA 1CHGA 2FEQH 1GI9B 5HM9A 1EPTC 1SLUB 3ZVEA 1O2HA 7GCHG 1J15A 5I25A 3DHKH 4Y6DA 3ZV8A 1BJVA 3RLYH 1P2OA 2DUCA 4OS4A 3P95A 1ORFA 1O3DA 2ZCKP 4ABHA 1G3CA 2UUYA 5FPYA 2AIQA 2CF9H 2XWAA 3A7ZA 3HGPA 2ZPQA 1MH0A 1O36A 3L33A 2OLGA 1RRKA 1AVGH 4FUEA 1SGQE 3AASA 2WV5A 3NPSA 4NSVA 2R3YA 1ELVA 1WV7H 2BD5A 4U2WA 1SL3A 5FX5A 4NCYA 1C1MA 3JZ1B 2GDDA 5CHAC 1O2SA 1VCPA 3BTHE 2PUXB 1GG6C 1C5QA 3QUMP 1JMOH 1W7GH 1WCZA 1TYNA 2DE8A 3TK5A 2FZZA 4NFEA 3ITIA 2C4FH 1D4PB 3PLKA 5T6FA 1EAWA 4AB9A 1OWKA 1TALA 4UFFH 5EG4A 3ZVAA 1SBWA 4VGCB 4X2XA 2BQ7B 3RU4D 1A2CH 1P10A 5JPMH 1QB1A 1BITA 3WY8A 2P3TB 2BB4A 4YOIA 1BMNH 4K5ZA 3RM2H 2SGFE 5LH8A 3PLPA 1YCPH 2XXLA 3AAVA 4AGKA 3VPKA 3D62A 9ESTA 3MU0A 3UWIA 2VIPA 3QX5H 4ABGA 1UVPA 1TOCB 1FXYA 1F0RA 1ELDE 1RTLA 3A8CA 5AHGH 1EP6A 4YO9A 3RDZA 1C2LA 1KIGH 2OUAA 2ZFQH 1A5HA 3RLWH 2CHAC 3OY5U 4ZKOU 2ZU2A 2ZFSA 2ESTE 1A5IA 1FY3A 3M7QA 4ESTE 1ZPBA 4WF8A 2Z9IA 1TGNA 4JZDH 3LH1A 2ZHEH 4YZUA 1QL9A 3M3TA 2OBOA 1PYTD 2GT8A 3SI4H 3NUMA 3TIUA 2STBE 2OC7A 1QGFA 1G37A 1QNJA 1TMUH 2PKSC 4ABDA 1C4V2 5E0GA 1HXFH 3T28A 3IITA 2TGPZ 3O8DA 2ZPSA 1QB9A 2BD7A 3MTYA 4A5TS 1XUJA 1VR1H 3GY6A 4KTUA 4BOHA 5L6NH 2VU8E 1LCYA 2ZKSA 4FUJA 1SGIB 3E6PH 3U8RH 2BX3A 1NO9H 1JOUB 3SGQE 1YPHE 1GI8B 4TWYA 1PPFE 3S0NA 3RXKA 1O5DH 1YPGH 1A46H 5FX6A 3S7HB 3MO6A 1O5BB 3FP8E 1SQOA 1C1NA 1FONA 1C1WH 5I46H 2P93A 1D3TB 1GHAG 5EOKA 5EXLA 1TNKA 3OU0A 1C2GA 2AGIX 3LU9B 1W2KH 2O8TA 1IHTH 1GJ9B 1O3BA 5J4QA 4BAMB 2J4IA 1P2JA 1HAPH 4LZ1H 3PMJA 1YYY1 3QZRA 4A7IB 1QA7A 2VIQA 3P70B 1C5UA 1O2JA 3KNXA 2XC5A 2Y81A 3RXTA 2UUKB 1TBQH 4ABAA 3RXRA 1IQNA 3ATMA 1EASA 1T8NA 3I29A 1AFQC 2FXRA 4INKA 3SU6A 1TX6A 3RMLH 3GISB 2R0LA 3E90B 2A45B 1TQ0B 2BXUH 2WUCA 1FY4A 3MH4A 5LGOA 1LVMA 2ZGXH 2AFQB 4XSKU 1GL1A 1GI6A 1HB0B 2BX4A 2C8XB 4GLYA 5CE1A 2PSYA 3ZZ8A 4AGJA 1CA0B 4MVNA 5EPYA 3FAOA 1GBFA 3P8NA 1FLEE 4JZFH 2ZECA 2BHGA 2AMDA 4KGAA 1V2UT 2J92A 4CHAC 2ZDVH 3A7VA 1UMAH 1FN6A 3GYLB 1KXDA 5BPEA 1XKAC 1SI5H 4CRAA 3C27B 4BAKB 3FZDA 4MNXA 1P2QA 1T8LA 1ZMJA 1SGPE 3BEUA 3VB7A 1Z6JH 2BLQA 4PROA 3HPTB 3SJKA 1Z8IB 3GOVB 1F92A 1DE7H 1RGQA 2OQUA 1IQEA 1GBIA 2BLVA 1DWDH 4AOQA 1V2MT 1Z8JB 2ZF0H 3A89A 2VIDA 4MPUA 4X0WU 1ZSKA 1U6QA 5T6DA 1BTYA 1MZAA 2BY6X 2Q6GA 2PGBB 2M5TA 5DP3A 2J2UA 2PR3A 1SGYE 1O37A 5ESTE 1BDAA 1E34B 2PW8H 2ZU1A 1SSXA 1TB6H 1TBRH 2GCHF 1PQ5A 3HK6B 1D6WA 1VCQA 3TGJE 1D3QB 4NIYA 1GHYH 1CBWB 2XWBI 1O2NA 1S82A 5DKMA 2CHAB 3BTDE 4K1EA 3PMHB 2WPKS 2ZDNA 4ZUHA 2OD3B 3M5OA 1C4Y2 4O9VA 1IQGA 1T4UH 1QL8A 3A82A 1F5KU 1UTQA 4JYVH 4AFZA 3S7KB 1UJ1A 1GBAA 4Y71A 1XUKA 4GSOA 1BCUH 3SNDA 4X8UH 2TRMA 1INCA 2BYAX 2PKSB 4ZH8A 1IQLA 1P06A 1S85A 2QAAA 5A0BA 2G5VA 1MQ5A 1S83A 2FX4A 3V12A 2SGAA 1O3FA 3M61U 3SV6A 4JK5A 2PV9B 1FNIA 4OGYA 1EUFA 3PO1C 4ISHH 3T25A 2BZAA 2FMJA 1RS0A 3GDUA 3P17H 1C5YB 3MI4A 1BQYA 1GJ6A 1AO5A 4X6PA 1PQAA 1LVYA 4UFGH 2FOGA 3VB3A 2W7SA 3KQDA 3UQVA 4WXIA 1EZUC 5ESBA 3TJVA 7GCHF 1H9HE 1MAXA 2HNTE 1O2RA 3MOCA 2R0KA 3SOSA 2BY8X 3RP2A 4JZIA 3QDZB 1EZXC 3QK1A 2AMPA 2W3IA 1DXWA 4ZMAH 1KDQA 3W95A 2OC0A 2ZGBH 1YM0A 4GCHF 1KXFA 1ELGA 1O3GA 4XE4A 1EJMA 4A1XA 1GBLA 1T32A 3RXOA 4ZAEA 4ABFA 4Y8YA 2HGTH 1YGCH 1C1PA 3ODDA 4JZEH 1N6XA 1OSSA 2QA9E 2D2DA 5GCHG 1F0UA 5E0HA 5C1YA 4I32A 3TVJB 1EP5A 1P9SA 3ATWA 3MNXA 4R8TB 4K2YA 1KYNA 1UTJA 3BTFE 2BMGB 2HNTF 1GJBB 3DFJA 4YT6H 3I78A 1O3JA 3DFLA 3LIWA 3TU7H 2OINA 1GBTA 1GGDC 3K2UA 3EQ0H 2BOHB 1C5ZB 1W8BH 4F4OC 1GI5A 3H7TA 5LPEA 2F9BH 3SQHE 2K1QA 3BTTE 1IQMA 4TPIZ 1NTPA 1QQUA 2AIPA 1BRBE 2OC8A 3M5MA 2ALVA 2ZHFH 8GCHG 1V2OT 3GCHB 1L1NA 1MD7A 1AHTH 4CRGA 1C9PA 2H9HA 3MNCA 3RXMA 1EZQA 4LZ4B 1C1QA 5IYTA 4CHAB 4CR9A 1PPHE 3Q3XA 4IN2A 4WY3A 3M37A 2TBSA 1QBNA 1DITH 3H7OA 2W26A 4FUCA 4ZKNU 3QO6A 1IQJA 3SGAE 2H6MA 2GCTC 1VJAU 3GICB 4FU9A 1QRWA 1WTHD 2UWLA 1OP8A 1B5GH 1ZTJA 3VXFH 1J8AA 1QA0A 2PKAB 4CR5A 1L1GA 1YP9A 3KEEA 2J38A 3VEQB 1DUEA 1P02A 3BTME 5DP6A 1TMBH 3LPRA 1AB9B 1IHSH 3SUEA 8LPRA 2CJIA 5EXNA 3M3VA 2WUBA 1O2OA 1GJCB 1S6FA 1C5SA 2TIOA 5E8EH 4D9QA 3UR9A 6GCHF 5AF9H 1NRRH 1V2TT 1XUHA 2CF8H 2ZCLP 4UE7H 2AEIH 1CT4E 1TFXA 1YPJH 4KP0A 1LTOA 2F9VA 4Z0KA 3A8DA 5E0JA 1O3IA 4LK4A 1TNGA 3BN9A 1ABIH 1KXEA 1G2MA 4THNH 2BDAA 1KXBA 2FTLE 2H2ZA 4O3TA 1OYQA 3A81A 3U1JB 2ODPA 4ISIH 3LGWA 1IQIA 1JRTA 1JIMA 3SZNA 4ZXXH 1JWTA 1BTZA 1SQAA 3PROA 4NWKA 4B73A 2FIRH 3SGBE 4DG4A 2FPZA 1GI1A 2EI8A 1EATA 1F2SE 5A09A 4GCHG 3SV7A 1WQVH 4D9RA 1IQKA 3S9BA 2Q6DA 4OGXA 5CMXH 2WPIS 4K60A 1O33A 4OS1A 1BTUA 2JH5D 4XBCA 2XBYA 1DLEA 4DT7B 1C2FA 3OSYA 1A0LA 3A7WA 1GHBG 3LH3A 5A8ZA 3TGKE 1UTLM 5HM2A 1GPZA 1MKXH 3OX7U 3SJ9A 3MU4A 4J1YA 1GHBF 4NZLA 4D76A 3SHAH 2ZGJA 1S0RA 2GZ8A 3EGKH 3PM3A 2PSXA 4Y0ZE 2XBXA 1P05A 2RDLA 3E16B 3F6UH 3GY5A 1HIAA 2W3KA 1BHXB 3MU8A 6ESTA 3OYPA 3ENSB 2BOKA 1DY8A 1AD8H 2FOEA 1V2ST 1SLVB 1A1RA 2TGDA 1OWDA 1P11E 1CVWH 2Y6TA 2VGCB 1ELEE 1V2LT 3ZVBA 6LPRA 3BG4B 1WUNH 1YCPK 1O32A 1UTOA 1P57B 1GG6B 2TGAA 2ZEBA 3UNRA 3VB6A 1B0EA 2BY7X 1HXEH 2AYWA 3UWJH 1OP0A 2SNVA 2O8MA 4HZHA 3BTEE 1L2EA 3D49H 1DWCH 1MBQA 1TX8A 3U1IB 1KLTA 2ZU3A 3STIA 1DWEH 1MUEB 1M9UA 4NIVA 4U01A 4ABIA 1W7XH 4I8JA 2ODQA 5FBIA 2UWOA 3A85A 1F0TA 3P6ZB 1C1UH 4H6SB 5F8XA 3F1SB 4UEHH 1KLIH 1O30A 3LGTA 1GBEA 1GDNA 2ZU5A 4X6NA 2Z9KA 4ISLA 2B0FA 2BDCA 3NK8A 1GHVH 4BAQB 1CHOF 3PLBA 3LOXA 3GY3A 3M5NA 3A88A 1OPHB 5F03A 2SFAA 4NWLA 8KME2 1TLDA 4B2AA 3V0XA 1FY5A 5ETXA 1X7AC 2VH0A 1YKTA 2JH0D 1P2NA 3M7UA 4X2WA 1ZGIA 1JXPA 1TMTH 3AAUA 4IMZA 5TCAA 1JBUH 5AVDA 2YOLA 1QURH 2ZWLH 3T29A 1SMFE 1ANCA 4MTBA 1GMCG 3BTQE 2R2MB 3ZYEA 1WAYB 3MH5A 2FP7B 1LPZB 1ZRBA 3DA9B 1GWAA 2H5DA 2FOMB 1YF4A 1SGDE 3VFEA 3SV2H 1V2JT 1GBJA 4XDEA 5GJ4B 1F5LA 2PFEA 3TJOA 1AQ7A 2Z3DA 1K21H 1W3CA 4ZHMU 3RM0H 1B0FA 1YPLH 1T8OA 1WQSA 3LC5A 2FESH 3F9FA 4IC6A 3GCNA 2P8OC 2A31A 2UWPA 2FI3E 1YCPM 3C1KA 1XVMA 3D65E 1PPGE 4TWWA 3UY9A 2GV6A 2LPRA 3U98H 3CENA 1E38B 4X1SU 5A8YA 1XUFA 4WJG2 4MNWA 1BIOA 1BMMH 5C5OA 1V2RT 4I8KA 1SGCA 1P12E 2WPHS 1ZTLA 2Z9LA 1BRAA 2C8ZB 1MKXK 1TNIA 1TBZH 2FDAA 2JETC 5ABWA 4I7YH 2A0QB 1C9TA 2B8OH 3BG8A 1KTSB 4Y0YE 1O2MA 1A3BH 1G9IE 4A6LA 3RXDA 2QXJA 3KIDU 2BDIA 1A0JA 1HAHH 2ZI2H 1QR3E 5JBCS 1AWFH 5C1XA 1NT1A 3R3GB 3E1XB 1VITF 1EPTB 1ZGVA 1ARCA 3ODFA 4X1PU 3NXPA 1C2KA 2WPLS 4FUDA 4NFFA 2V6NA 5FPTA 1WSSH 1Y8TA 1SGTA 4SGBE 2XC0A 1BBRH 1AU8A 2QIQA 2VIWA 1UVSH 2A4RA 3ELAH 1ABJH 1D6RA 2BQ6B 1C5OH 3VXEH 1UO6A 3TGIE 2R2WU 2A2XH 2BVRH 2Z94A 2BY5X 2DE9A 1MTWA 1BTHH 4ZROA 1KTTB 2AH4X 1ZLRA 2O8WA 1SB1H 1FUJA 2HNTC 4FVBA 3KQBA 5BRRE 1C2DA 3LDXH 4ZHAA 1HJAC 2IJOB 5DP5A 1JIRA 3DD2H 1PFXC 5A0CA 3UFAA 3KQCA 2QY0B 2B9LA 2WPJS 3O8BA 2A7CA 1DXPA 1LQEA 1WYKA 4DURA 1MCTA 4XOJA 2YNBA 2SGDE 1VZQH 4YM9A 2FX6A 2VGCC 3AW1A 1K22H 2D26C 3MH6A 3RXLA 1P0SH 1NC6A 1UTNA 2ZTZA 3LT3A 2GD4B 2RCEA 2ZO3H 5JDUB 1EB2A 3A7YA 4DJZB 3A80A 3P8OA 1C5TA 1GMCF 3VGCC 2VIOA 1A5GH 1MCVA 1HAYB 1DY9A 4AFSA 3IG6B 1PJPA 1QBOA 1OWEA 2IN2A 1MKWK 4CBNA 2P59A 1BMAA 1K1IA 3ZVFA 1FPHH 1O2UA 1CT2E 3RUOA 4K8YA 3HKJB 1SG8B 1GMDF 2XNIA 1O2XA 4ASHA 2VH6A 1BT7A 4JCNA 3UQOA 1PPZA 1FJSA 3GCOA 4JYUH 4U32A 4WH6A 1ELBA 1HLTH 1BRUP 4RSPA 4Q7XA 2GTBA 1TNLA 1ELCA 1C1TA 1L0ZA 2RA0A 3ZVGA 3CS7A 1CBWC 1O2ZA 2ZDLA 5HMAA 1V2VT 4BXSA 3MNSA 2C3SA 2FO9A 4BTTB 3RXSA 1UCYK 1N8OC 3ZZ7A 1W14U 3S69A 2Y5GA 1NROH 2A2QH 1BOQA 1TOMH 3KCGH 3FVFB 5LPFA 3PTBA 2ZU4A 3SQEE 1LMWB 2ANMH 3DUXH 3N7OA 1EQ9A 1ZTKA 3ZVDA 5DO4H 4DVAU 2GDEH 3RC5A 1GMHF 1K28D 1J17T 1MU6B 3ZZ6A 1QBVH 2ZHQH 1UK2A 1GBCA 2WINI 3FZZA 2ALPA 1TABE 1MTVA 2PUQH 2FWWA 2QF0A 1GHAF 3T27A 1SGRE 3E0NB 3V3MA 1FIZA 1YPKH 5C20A 4E06H 2FOBA 1D3PB 3I77A 1GBDA 5EW1H 1C5NH 1PQ7A 1O31A 1DDJA 1YBWA 1HFDA 3AVZA 4GHTA 4DIHH 1Y59T 2Z3CA 4O97A 3OTJE 1NRNH 2HPQH 3BEIB 5F6MA 6CHAC 1VGCC 2CN0H 3M7TA 1EAXA 2NWNA 1YPEH 2XCFA 3S9AA 4DIIH 4AX9H 3HK3B 2Y5HA 1HAZB 1XXFA 5L30H 4X6OA 1ZMLA 1H1BA 2ZA5A 4YTAA 4ZKRU 3P92A 1NESE 4INHA 4TY7A 2ANYA 1ETSH 3QN7A 1LHGH 3MO9A 3S9CA 4CH8B 1DVAH 1OXGA 1VCWA 3GYMA 1LHCH 1OP2A 2O9QA 1PYTC 4IW4E 2FS8A 4MNVA 5EODA 1Z1IA 3IWMA 1AFQB 1SLWB 1EOLA 1AWHB 1GCTB 2KAIA 1O3OA 4A1TA 3F9GA 2ANKH 2HVXA 2ZIQH 1O2TA 2QYIA 1TONA 1XM1A 3A83A 4JZ1A 3RU4T 2FOFA 2BD3A 1MTUA 1O5CB 3KF2A 3KN2A 5C67A 1O5EH 2I6SA 1ELFA 2UUJB 3SV8A 2VVVA 3SU1A 1SFIA 1DSUA 4I33A 3UNQA 4YESB 5GCHF 3TLOA 1BHXF 5C3NA 1SPJA 1P3CA 2ANWA 5JB8S 1G3EA 2H5CA 3UOPA 1XKBC 4U30A 1HAOH 5C2ZA 4CRDA 5GIBA 1TNJA 1GVKB 1XUIA 2P3UB 3QGNB 1GHWH 1C4U2 1NRSH 2A5AA 7ESTE 1NZQH 1QY6A 1SGFG 1SQTA 1KXAA 1PQ8A 1Z1JA 1UVTH 2ZGHA 3MWIU 4I8HA 1P04A 3RXBA 3ZZCA 1DT2A 4K1SA 3HATH 3E91A 4QT8C 1FZZA 1LHDH 1ZHMA 2GMTB 3PB1E 4NA8A 2Z6BD 3RMOH 4CRBA 2SGQE 2BVXH 1MTSA 4Y11E 3TH3H 2WYGA 2AMQA 1TWXB 4WH8A 5EQQA 3Q77A 3KL6A 4D7GA 5DP4A 2VWMA 3ZZDA 4RN6A 4D7FA 1Q2WA 4MLFB 1DWBH 1V2QT 4BANB 3SU4A 1CGHA 1ANEA 1CA8B 4IGDA 1THRH 1AZ8A 3PMAB 1AGJA 4B74A 2OXSA 1GBHA 3EA7A 1SGNE 2XCNA 1Z8RA 1VJ9U 1H9LB 2ZGCA 3OY6U 1H9IE 1PPEE 1XVOA 2ZFTA 2ZFFH 3LJOA 3ZVCA 1SVPA 1UCYH 1YLCA 2Q1JA 3PTNA 1GMDG 3Q3KA 2R9PA 3BTGE 5C1UA 2RG3A 1C5PA 1RFNA 2GX4A 1O5FH 1BA8B 1DANH 3T5FH 1GCDA 1MMJN 2VIVA 2J9NA 3LGVA 3ZZBA 3QGJA 1ZOMA 1TPAE 1A3EH 1ID5H 4F49A 3Q3YA 3EA9A 2V35A 2VJ1A 1ELTA 4NIWA 2HLCA 4AZ2B 4X2VA 1BBRK 2FOHA 2WPMS 3ZYDA 1EOJA 4K8BA 1HRTH 4HGCA 1NRQH 2ZFRH 2ZQ2A 1G36A 1FAXA 1O3PB 2BY9X 1GBMA 1F5RA 4K69A 1KLJH 2QV1A 3M5LA 5T6GA 1QJ6B 2FYQA 1AUTC 1UTKA 1QJ1B 5EU8A 1S6HA 1G3BA 4AYVB 4FUBA 1O3MA 2XW9A 2P94A 1MQ6A 7KMEH 1GDUA 4UD9H 3SNAA 3ZZAA 4JMYA 1UCYE 3PV4A 1LHFH 4Q7YA 3W94A 4DW2U 1ZMNA 1W0YH 3FP6E 1DUAA 1ZSJA 4FUGA 1OYTH 1TRMA 5FHTA 2F3CE 2YNAA 4DY7B 2P95A 1A7SA 1ACBE 1P2IA 1AMHA 5EQRA 3ATLA 4FU8A 5CHAB 1V2KT 1GJDB 4WMDA 1C2JA 1Q3XA 2FYRA 3BG4C 1YPHC 1FI8A 1K1OA 4FUHA 1DPOA 1WU1A 2BDBA 1FMGA 3E3TA 5K7RA 2WYJA 1LKAA 5FXLA 1AFEH 3VB5A 4A92A 1O39A 1ZRKA 3E0PB 2Y82A 3A8AA 1XUGA 3FFGA 1AIXH 1O5GH 1CT0E 1GHZA 1ZHPA 4HTCH 3CP7A 3RXHA 4AORA 1QCPA 1A4WH 3MU1A 1C5MD 3U69H 1FIWA 4B2BA 5HXFA 2SGPE 3EDXB 1O34A 2H9EH 3SW2B 1CSOE 2BD2A 1L4ZA 3A7TA 4ISNA 2GKVE 3UPEA 1AVWA 1C1OA 5DPAA 4JYTA 2FTMA 3BEFB 1O3AA 5PTPA 1K1JA 2EEKA 3A86A 3NCLA 2FI4E 2BLWA 1PPBH 4UDWH 2J95A 3VB4A 2QN5T 1Y5UT 3TK9A 1NY22 1TX7A 3BIVH 3U9AH 1AKSA 1C2IA 2A4GA 1IQFA 1D9IA 2G81E 3AW0A 2QCYA 3EA8A 4CH2B 1BB0B 1O2KA 1K1LA 2H9TH 3T2NA 5F8ZA 1MBMA 3O8CA 4GVUA 1DLKB 3RMNH 2ODYB 1AB9C 4WWYA 1K9OE 5T3HA 2VNTA 4FU7A 1V2PT 1HDTH 1C1RA 2AS9A 3LJJA 4NIXA 3V13A 1QIXB 1KY9A 3F9HA 4BAOB 1E37B 1NPMA 3SO3A 4X8SH 5EW2H 2F9PA 1OS8A 2CMYA 3BTWE 3D23A 1XX9A 2GCHG 4BTUB 1LKBA 1FY8E 1NFUA 5FAHA 1A0HB 1IOEA 1GVZA 5JBBS 2OTVA 1UK3A 2PHBA 3SNCA 3M35A 4O03A 4FVDA 5J4SA 2G52A 1G30B 1HGTH 1TGBA 4AG1A 2B5TB 5DG6A 3PWCA 2J94A 1O3EA 4YLUA 2Z9JA 2HWLB 4X1QU 5FCRA 3TH2H 3RMMH 2STAE 2XC4A 2O8LA 4H42U 5L2YH 1DX5M 1NFYA 2TGTA 1W10U 1N1LA 1EXFA 1E36B 2C90B 2CV3A 3UIRA 3PWBA 2EC9H 4XFQA 2F83A 5EXMA 1QRZA 4HFPB 2ZNKH 1NU7B 2WV4A 6GCHG 3Q76A 2ZDMA 2VINA 4LXBH 5TJXA 3P8FA 4TY6A 3TNSA 4E7NA 1GJ5H 2A32A 4ZKSU 3RXCA 1GBKA 4B75A 1P8VC 3SJOA 2Y7XA 2BM2A 3RXQA 4UFDH 1O2LA 4CREA 3UR6A 4AG2A 1HAXB 1LQDB 3LC3A 1FV9A 2AGGX 2CXVA 3GCTG 3BSQA 1S84A 1NM6A 3E8LA 1L4DA 2G8TA 1BTWA 1TE0A 3BTKE 4OS6A 1ETTH 3ZZ9A 5AFYH 2OQ5A 1SOTA 1BMLA 3PMBB 1O38A 4FXGH 4OS5A 2V3OH 5DP7A 1GI0A 1CA0C 2NU3E 3RXVA 1P9UA 2XTTB 2AERH 5HGGA
chains in the Genus database with same CATH superfamily
2BD9A 2QXIA 1Y3YA 1C5VA 1C1SA 2GZ7A 1SFQB 4AN7A 2NU0E 1NFXA 3RXGA 2GP9B 1G32B 5GWZA 2JKHA 2LP6A 2SGEE 2Y80A 1DFPA 1GHXH 4IMQA 2EY4C 1LHEH 2KAIB 1HAIH 1KSNA 1WDIA 4NA7A 4ABBA 2Z9GA 1CO7E 1EJAA 4AFUA 1DOJA 1O3HA 4B76A 3A8BA 2ZP0H 4XBBA 1O2WA 4CRCA 2VWLA 1HJ9A 1EKBB 3TJUA 1ZHRA 3MNBA 1E35B 1EJNA 1MAYA 4NA9H 1HPGA 1Y3UA 2AGEX 3RXAA 4XBDA 1ANDA 1H8IH 4M7GA 5B6OA 1TNHA 2FOAA 3QWCH 2V0BA 1EX3A 4AB8A 1HBTH 4MG3A 1ARBA 1W0ZU 3RC6A 1TPPA 3GY7A 1W11U 1TPSA 1E0FD 3DT0H 2HPPH 3SU2A 1NN6A 3URDA 3KGPA 2EA3A 4KKDA 1FPCH 8GCHF 3ZZ4A 4Y7AA 1T31A 3DSPA 3T62A 3TK6A 4TPYA 3SI3H 3TITA 5SGAE 2C8WB 1OHHD 1AZZA 3SNEA 1O2YA 1O3KA 1J9CH 3K6ZA 1CGJE 4FUIA 2GV7A 3OTPA 5EJZA 3T26A 1KDQB 1C2MA 1O3NA 1TAWA 3HGNA 2D1JA 3LGYA 5A8XA 3GDSA 1GJ4H 1O2PA 1S5SA 1ZPZA 3BF6H 1BRCE 4B71A 2WZQA 4IN1A 4Y8ZA 1NU9A 3L3TA 4RKJB 2FOCA 4Q80A 1XMNB 5DP8A 1Y5BT 5F8TA 1YWUA 2EI7A 5EGMA 2Y7ZA 1VITH 4GAWA 1E79D 2A1DB 2RA3A 2ZCHP 3ATKA 4X8TH 1YLDA 1KMHB 1OKXA 1UTPA 4ISOA 3SU0A 3UOUA 5JBAS 2XBWA 1GI4A 2HALA 1ELAA 2TPIZ 4Y79A 4ABEA 1HAGE 1QB6A 2WSSD 2A5KA 2GZ9A 1HNEE 1NRPH 3F68H 5A2MH 1G2LA 3K6YA 1CGIE 3TJNA 2W7UA 3GCTF 1V3XA 1BTPA 2B7DH 3ESTA 2XRCA 4INLA 1OWJA 1QFKH 1TIOA 1SGFA 4Z6AH 2ZDAH 2JETB 3N7EA 3LKWA 3P8GA 2PWXA 1C2EA 4YT7H 4IS5A 4WXVA 1EAIA 1RD3B 4HI3A 3H5CB 2JH6D 2P3FH 2QGRA 3TNTA 2ZTYA 4NG9H 2XYAA 4SGAE 1XXDA 2KZ4A 1SLXB 1NFWA 8ESTE 5GDSH 1ZSLA 4DGJA 1CU1A 3PO1B 2UUFB 3KHVA 4IBLH 1K2I1 4NSYA 2F9NA 1Y3VA 3RU4E 1RTKA 3EE0B 1TRYA 2R3UA 1MTNB 1SC8U 1SR5C 5G4BA 2PLXA 3M36A 1C5RA 1Q31A 2G5NA 2OBQA 4ABJA 1K1NA 1CE5A 4YOJA 1ANBA 1O0DH 4GPGA 1QQ4A 1WBGB 3BIUH 4KELA 2FS9A 2BD8A 1GCTC 1C5XB 1JRSA 3PYHA 1AI8H 2FM2A 5E2PA 2OC1A 1ESTA 3AK5A 1QHRB 1V2NT 1AKSB 1Z7KA 1GGDB 1ETRH 1DM4B 1SOZA 3NWUA 1HJAB 2ZDKA 2VVCA 1FY1A 2PGQB 1ESAA 2C93B 2ZC9H 3SUFA 2BTCE 2CGAA 2HOBA 1GL0E 2BXTH 1TQ7B 4GHQA 3SUGA 4B2CA 4OS2A 2G55A 4NZQA 3SORA 2BLOA 4X6MA 4MPWA 5A0AE 1GMHG 1ZJKA 3LGIA 3UUZA 4CRFA 1THSH 3GY2A 3NKKA 4JK6A 5FCKA 4A1VA 4X1RU 1TA2A 2Q6FA 3A84A 1QL7A 4I31A 2ULLA 5E2OA 5IDKA 2A5IA 2GCTB 3EAJA 1OWHA 3TPIZ 3A7XA 3URCA 3LONA 4Q7ZA 5GXPA 3U8OH 1OOKB 1HUTH 1TGSZ 5H4IB 4D8NA 1HIAB 2FLRH 1ZYOA 1DS2E 1EZSC 3ZV9A 2VWOA 1EPTA 2D8WA 2ZHDA 2A4QA 2BDGA 3SNBA 1P2MA 1F7ZA 4P00A 3SU5A 4KTSA 1LPGB 3CNRA 4K3JA 3RXPA 3VGCB 1BTXA 2H1UA 1GJ7B 4I8LA 3TH4H 3MH7A 3UAIC 1PPCE 5EJ1A 2XBVA 2QC2A 3MO3A 4RKOB 2BQWB 3SJIA 2C8YB 2G4TA 2ZPRA 1ZZZA 2V3HH 1Y3XA 1RIWC 3SN8A 4UFEH 5DGJA 1GI7B 1HJ8A 3O8RA 2BD4A 1KXCA 1SHYA 1Y3WA 3QZQA 2NU4E 2Z3EA 3RXIA 3MU5A 1O2VA 1NS3A 1QTFA 4ZXYH 1LO6A 3RXJA 1ZR0A 2ASUB 1WOFA 1MZDA 3EYDA 3UTUH 2GGVB 1S81A 1GVLA 3NZIA 1H4WA 1YC0A 2G4UA 3MHWU 1C2HA 1ZJDA 3A87A 1H8HD 1K1MA 1N8OB 1BUIA 4MQAA 2EI6A 1B7XB 3ATIA 5LPRA 1LVBA 1Z71A 4AYYB 4BNRA 3BV9B 5TCCA 3K65B 1P03A 1GDQA 3B9FH 1OWIA 1T8MA 1BJUA 4K1TA 5L2ZH 3UREA 4Y8XA 1D3DB 2ZFPH 2PTCE 6CHAB 1FDPA 4BXWA 3V7TA 4CBOA 4Y7BA 4ZHLU 3F9EA 2A4OA 3FANA 1TGCA 4Q4LA 1P3EA 2FODA 2L74A 1DSTA 1O5AB 3B8JA 5DP9A 1AY6H 2GVFA 1C1VH 2IPHA 1O2GH 1WTGH 2QXHA 3QLPH 2THFB 3LGUA 1J16A 2NU2E 1UK4A 2QXGA 4WMEA 1TPOA 1BZXE 2BDYA 4B1TA 5IK2D 1QJ7B 5FPSA 2VB0A 1RJXB 1RTFB 4IC5A 1UVOA 1VITG 2IOTA 1EB1H 1MTNC 1V2WT 5HYOA 1IAUA 2A7JA 5AFZH 4E7RG 1VGCB 2VVUA 4MPVA 5C0TA 2F4LA 2ZQ1A 3GY8A 1P09A 2F9OA 2W6JD 1HCGA 2BVSH 4FUFA 3RXEA 4GUXA 4AFQA 1ZPCA 4UONA 2GT7A 3STJA 3G01A 3QTOH 2ILNA 1Y5AT 1LPKB 3KQEA 1AN1E 4B6FA 1HAVA 1HYLA 4WVPE 3MYWA 3RC4A 5C5NA 3U8TH 2O8UA 2P16A 1VKYA 5FL7D 1CQQA 4X8VH 1CHOG 4MDSA 3QTVH 5EPNA 5JYIA 2NU1E 1T7CA 4MNYA 3RXFA 2SNWA 4WMFA 4VGCC 1MKWH 5K0HA 2PTNA 1T4VH 5EQSA 1FAKH 1FQ3A 1SHHB 1THPB 2IPQX 4BAHB 2HRVA 1IQHA 3SBKA 4X2YA 3RXUA 1GI3A 1GI2A 1Z8GA 2GMTC 1SGEE 1AVXA 2LNCA 1K1PA 2FLBH 1HV7A 1TRNA 3GCHC 1H8DH 3HKIB 1W12U 2PP6A 3FP7E 4DT4A 4X1NU 1HAVB 4Y10E 1AE8H 4Q2KA 1W13U 1OX1A 1MU8B 3JZ2B 1P2KA 3K9XB 4Y76A 1QRXA 1FN8A 1AUJA 2A7HA 4DOQA 1P01A 4YOGA 1N6YA 4R0IA 1GJAB 1L1JA 2ZG0H 3GY4A 1C5WB 1A61H 3GDVA 4H6TA 1BMFD 4LOYH 4KTCA 1ESBA 1O3CA 2ZZUH 4J2YB 1UHBA 5JB9S 3SUDA 3L6PA 1GJ8B 2G51A 3SHCH 4E05H 2F9UA 5DK1A 1NBMD 2VWNA 1O2QA 5DJ7A 1YPMH 1J14A 3B23B 3OFND 1MD8A 3Q00A 1LVOA 1S0QA 1V6DA 1AE5A 2G00A 2BDHA 1RIWB 3MFJA 2ZHWH 3UNSA 3SV9A 4H4FA 3SJ8A 1O3LA 1Z6EA 2P8OB 3SU3A 4TYDA 1RXPA 1LDTT 5DN6D 2Z7FE 5JBTA 1BBRE 3CS0A 2I6QA 2PKAA 2J34A 1F0SA 3ZZ3A 4DCDA 1O35A 2OCVB 1EAUA 4BTIB 2QF3A 2F91A 1GBBA 1UHBB 5GPIB 4YLQH 4O3UA 2Y5FA 3ZZ5A 5FBEA 4OS7A 1UVUH 4MPXA 2W5EA 3MMGA 2OP9A 1QZ8A 2ZTXA 1UTMA 7LPRA 9LPRA 1DICA 3R0FA 2BZ6H 4NGAH 2FI5E 3M3SA 1TGTA 1O2IA 1TA6A 1G3DA 1C5LH 4I8GA 1CHGA 2FEQH 1GI9B 5HM9A 1EPTC 1SLUB 3ZVEA 1O2HA 7GCHG 1J15A 5I25A 3DHKH 4Y6DA 3ZV8A 1BJVA 2KR7A 3RLYH 1P2OA 2DUCA 4OS4A 3P95A 1ORFA 1O3DA 2ZCKP 4ABHA 1G3CA 2UUYA 5FPYA 2AIQA 2CF9H 2XWAA 3A7ZA 3HGPA 2ZPQA 1MH0A 5B6LA 1O36A 3L33A 2OLGA 1RRKA 1AVGH 4FUEA 1SGQE 3AASA 2WV5A 3NPSA 4NSVA 2R3YA 1ELVA 1WV7H 2BD5A 4U2WA 1SL3A 5FX5A 4NCYA 1C1MA 3JZ1B 1W0KD 2GDDA 4YXWD 5CHAC 1O2SA 1VCPA 3BTHE 2PUXB 1GG6C 1C5QA 3QUMP 1JMOH 4F48B 1W7GH 1WCZA 1TYNA 2DE8A 2KM0A 3TK5A 2FZZA 4NFEA 3ITIA 2C4FH 1D4PB 3PLKA 5T6FA 1EAWA 4AB9A 1OWKA 1TALA 4UFFH 5EG4A 3ZVAA 1SBWA 4VGCB 4X2XA 4Q63A 2BQ7B 3RU4D 1A2CH 1P10A 5JPMH 1QB1A 1BITA 3WY8A 2P3TB 2BB4A 4YOIA 1BMNH 4K5ZA 3RM2H 2SGFE 1E1RD 5LH8A 3PLPA 1YCPH 2XXLA 3AAVA 4AGKA 3VPKA 3D62A 9ESTA 3MU0A 2V7QD 3UWIA 2VIPA 3QX5H 4ABGA 1UVPA 1TOCB 1FXYA 3U28C 1F0RA 1ELDE 1RTLA 3PV2A 3A8CA 5AHGH 1EP6A 4YO9A 3RDZA 1C2LA 1KIGH 2OUAA 2ZFQH 1A5HA 3RLWH 2CHAC 3OY5U 1S6LA 4ZKOU 2JJ1D 2ZU2A 2ZFSA 4TSFD 2ESTE 2HLDD 1A5IA 5EJLA 1FY3A 3M7QA 4ESTE 1ZPBA 4WF8A 2Z9IA 2M2AA 1TGNA 4JZDH 3LH1A 2ZHEH 4YZUA 1FX0B 1QL9A 3M3TA 2OBOA 1PYTD 2GT8A 3SI4H 3NUMA 3TIUA 2STBE 2OC7A 1QGFA 1G37A 1QNJA 1TMUH 2PKSC 4ABDA 1C4V2 5E0GA 2J97A 1HXFH 3T28A 3IITA 2TGPZ 3O8DA 2ZPSA 1QB9A 2BD7A 3MTYA 4A5TS 1XUJA 1VR1H 3GY6A 4KTUA 4BOHA 4ZCNA 5L6NH 2VU8E 1LCYA 2ZKSA 4FUJA 1SGIB 3E6PH 3U8RH 2BX3A 1NO9H 1JOUB 3SGQE 1YPHE 2F43B 1GI8B 4TWYA 1PPFE 3S0NA 3RXKA 1O5DH 1YPGH 2K0QA 1A46H 5FX6A 3S7HB 3MO6A 1O5BB 3FP8E 1SQOA 1C1NA 1FONA 1C1WH 5I46H 2P93A 1D3TB 1GHAG 5EOKA 5EXLA 1TNKA 3OU0A 1C2GA 2AGIX 3LU9B 1W2KH 2O8TA 1IHTH 1GJ9B 1O3BA 5J4QA 4BAMB 2J4IA 1P2JA 1HAPH 4LZ1H 3FN8A 3PMJA 1YYY1 3QZRA 4A7IB 1QA7A 2VIQA 3P70B 1C5UA 1O2JA 3KNXA 2XC5A 2Y81A 3RXTA 2UUKB 1TBQH 4ABAA 3RXRA 1IQNA 3ATMA 1EASA 1T8NA 2J5UA 1AFQC 3I29A 2FXRA 4INKA 3SU6A 5KECA 1TX6A 3RMLH 3GISB 2R0LA 5KGOA 3E90B 2A45B 1TQ0B 2BXUH 2WUCA 1FY4A 2YMSB 3MH4A 5LGOA 1LVMA 2ZGXH 2AFQB 4XSKU 1GL1A 1GI6A 1HB0B 2BX4A 2C8XB 4GLYA 5CE1A 3GS9A 2PSYA 3ZZ8A 4AGJA 1CA0B 4MVNA 5EPYA 3FAOA 1GBFA 3P8NA 1FLEE 1YLNA 4JZFH 2ZECA 2BHGA 2JJ2D 2AMDA 4KGAA 1V2UT 2J92A 4CHAC 4RT0A 2ZDVH 3A7VA 1UMAH 1FN6A 3GYLB 1KXDA 5BPEA 1XKAC 1SI5H 4CRAA 3C27B 4BAKB 3FZDA 4MNXA 1P2QA 1T8LA 1ZMJA 1SGPE 3BEUA 3VB7A 1Z6JH 2BLQA 4PROA 3HPTB 3SJKA 1Z8IB 3GOVB 1F92A 2OQUA 1DE7H 1RGQA 1IQEA 1GBIA 2BLVA 1DWDH 4AOQA 1V2MT 1Z8JB 2ZF0H 3A89A 1E1QD 2VIDA 3H09A 4MPUA 4X0WU 1ZSKA 1U6QA 5T6DA 1BTYA 1MZAA 2RDEA 2BY6X 2Q6GA 2PGBB 2M5TA 5DP3A 2J2UA 2PR3A 1SGYE 1O37A 5ESTE 1BDAA 1E34B 2PW8H 2ZU1A 1SSXA 1TB6H 1TBRH 2GCHF 3F3BA 1PQ5A 3HK6B 1D6WA 1VCQA 3TGJE 1D3QB 4NIYA 1GHYH 1CBWB 2XWBI 1O2NA 1S82A 5DKMA 2CHAB 3BTDE 4K1EA 3PMHB 2WPKS 2ZDNA 4ZUHA 2OD3B 3M5OA 1C4Y2 4O9VA 1IQGA 1T4UH 1QL8A 3A82A 1F5KU 1UTQA 3KYFA 4JYVH 1COWD 4AFZA 3S7KB 1UJ1A 1GBAA 4Y71A 1XUKA 4GSOA 3DSGA 1BCUH 3SNDA 4X8UH 2TRMA 1INCA 2BYAX 2PKSB 4ZH8A 1IQLA 1P06A 4F55A 1S85A 2QAAA 5A0BA 2G5VA 2RFKC 1MQ5A 1S83A 2FX4A 5F53A 3V12A 2SGAA 1O3FA 3M61U 3SV6A 4JK5A 2PV9B 1FNIA 4OGYA 1EUFA 3PO1C 4ISHH 3T25A 2BZAA 2FMJA 1RS0A 3GDUA 3P17H 1C5YB 3MI4A 1BQYA 1GJ6A 1AO5A 4X6PA 1PQAA 1LVYA 4UFGH 2FOGA 3VB3A 2W7SA 3KQDA 3UQVA 4WXIA 1EZUC 5ESBA 3TJVA 7GCHF 3KQ5A 1H9HE 1MAXA 2HNTE 1O2RA 3MOCA 2R0KA 3SOSA 2BY8X 3F0OA 3RP2A 4JZIA 3QDZB 1EZXC 3QK1A 2AMPA 2W3IA 1DXWA 2CK3D 1KDQA 4ZMAH 3W95A 2OC0A 2ZGBH 1YM0A 4GCHF 1KXFA 1ELGA 1O3GA 4XE4A 1EJMA 4A1XA 1GBLA 1T32A 3RXOA 4ZAEA 4ABFA 4Y8YA 2HGTH 1YGCH 1C1PA 3ODDA 4JZEH 1N6XA 5CHBA 1OSSA 2QA9E 2D2DA 5GCHG 1F0UA 2WHXA 5E0HA 5C1YA 4I32A 3TVJB 1EP5A 2XNDD 5HKKD 1P9SA 3ATWA 3MNXA 4R8TB 4K2YA 1KYNA 1UTJA 3BTFE 2BMGB 2HNTF 1GJBB 3DFJA 4YT6H 3I78A 1O3JA 3DFLA 3LIWA 3TU7H 2OINA 1GBTA 1GGDC 3K2UA 3EQ0H 2BOHB 1C5ZB 1W8BH 4F4OC 1WXRA 1GI5A 3H7TA 5LPEA 3WWBA 2F9BH 3SQHE 2K1QA 3BTTE 1IQMA 4TPIZ 1K0HA 1NTPA 1QQUA 2AIPA 1BRBE 2KCYA 2OC8A 3M5MA 2ALVA 2ZHFH 8GCHG 1V2OT 2J98A 3GCHB 1L1NA 1MD7A 1AHTH 4CRGA 1C9PA 2H9HA 3MNCA 3RXMA 1EZQA 4LZ4B 2GJGA 1C1QA 5IYTA 4CHAB 4CR9A 3WW7A 1PPHE 3Q3XA 4IN2A 4WY3A 3M37A 2TBSA 1SQRA 1QBNA 1DITH 3H7OA 2W26A 4FUCA 4ZKNU 3QO6A 1IQJA 3SGAE 2H6MA 2GCTC 1VJAU 3GICB 4FU9A 1QRWA 1WTHD 1UW7A 2UWLA 1OP8A 1B5GH 1ZTJA 3VXFH 1J8AA 1QA0A 2PKAB 4CR5A 1L1GA 1YP9A 3KEEA 2J38A 3VEQB 1DUEA 1P02A 3BTME 5DP6A 1TMBH 3LPRA 1AB9B 1IHSH 3SUEA 8LPRA 2CJIA 5EXNA 3M3VA 2W6ID 2WUBA 1O2OA 1GJCB 1S6FA 1C5SA 2TIOA 5E8EH 4D9QA 3UR9A 6GCHF 5AF9H 1NRRH 1V2TT 1XUHA 2KCAA 2CF8H 2ZCLP 4UE7H 2AEIH 1CT4E 1TFXA 1YPJH 4KP0A 2KX4A 1LTOA 2F9VA 4Z0KA 3A8DA 5E0JA 1O3IA 1H8ED 1TNGA 4LK4A 3BN9A 1ABIH 1KXEA 1G2MA 4THNH 2BDAA 1KXBA 2FTLE 2H2ZA 4O3TA 1OYQA 3A81A 3U1JB 2ODPA 4ISIH 3LGWA 1IQIA 1JRTA 1JIMA 3SZNA 4ZXXH 1JWTA 1BTZA 1SQAA 3PROA 4NWKA 4B73A 2FIRH 3SGBE 4DG4A 2FPZA 1GI1A 2EI8A 1EATA 1F2SE 5A09A 4GCHG 3SV7A 1WQVH 4D9RA 1IQKA 3S9BA 2Q6DA 4OGXA 5CMXH 2WPIS 4K60A 1O33A 4OS1A 1BTUA 2IJD1 5EIYA 2JH5D 4XBCA 2XBYA 1DLEA 4DT7B 1C2FA 3OSYA 1A0LA 3A7WA 1GHBG 3LH3A 5A8ZA 3TGKE 1UTLM 5HM2A 1GPZA 1MKXH 3OX7U 3SJ9A 2KCOA 3MU4A 4J1YA 1GHBF 4NZLA 3FKSD 4D76A 3SHAH 2ZGJA 1S0RA 2GZ8A 3EGKH 3PM3A 2PSXA 4Y0ZE 2XBXA 1P05A 2RDLA 3E16B 3F6UH 3GY5A 1HIAA 2W3KA 1BHXB 3MU8A 6ESTA 3OYPA 5C0UA 3ENSB 2BOKA 1DY8A 1AD8H 2FOEA 1V2ST 1SLVB 1A1RA 2TGDA 1OWDA 1P11E 4FETA 1CVWH 2Y6TA 2AHME 2VGCB 2EQNA 1ELEE 1V2LT 4RI0A 3ZVBA 6LPRA 3BG4B 1WUNH 1YCPK 1O32A 1UTOA 1P57B 1GG6B 2TGAA 2ZEBA 3UNRA 3VB6A 1B0EA 2BY7X 1HXEH 2AYWA 3UWJH 1OP0A 2SNVA 2O8MA 4HZHA 3BTEE 1L2EA 3D49H 1DWCH 1MBQA 1TX8A 3U1IB 1KLTA 2ZU3A 3STIA 1DWEH 1MUEB 1M9UA 4NIVA 4U01A 4ABIA 5CDFE 1W7XH 4I8JA 2ODQA 5FBIA 2UWOA 3A85A 1F0TA 3P6ZB 1C1UH 4H6SB 5F8XA 3F1SB 4UEHH 1KLIH 1O30A 3LGTA 1GBEA 1GDNA 2ZU5A 4X6NA 2Z9KA 4ISLA 2B0FA 2BDCA 3NK8A 1GHVH 4BAQB 1CHOF 3PLBA 3MQKC 3LOXA 3GY3A 3M5NA 3OAAD 3A88A 1OPHB 5F03A 2SFAA 4NWLA 8KME2 1TLDA 4B2AA 3V0XA 1FY5A 3VG8A 5ETXA 1X7AC 2VH0A 1YKTA 2JH0D 1P2NA 3M7UA 4X2WA 1ZGIA 1JXPA 1TMTH 3AAUA 4IMZA 5TCAA 1JBUH 5AVDA 2YOLA 1QURH 2ZWLH 4M9FA 3T29A 1SMFE 1ANCA 4MTBA 1GMCG 3BTQE 2R2MB 3ZYEA 1WAYB 3MH5A 2FP7B 1LPZB 1ZRBA 3DA9B 1GWAA 2H5DA 3F2GA 2FOMB 1YF4A 1SGDE 3VFEA 2HVYB 3SV2H 1V2JT 1GBJA 4XDEA 5GJ4B 1F5LA 2PFEA 3TJOA 1AQ7A 2Z3DA 1K21H 1W3CA 4ZHMU 3RM0H 1B0FA 1YPLH 1T8OA 1WQSA 3LC5A 2FESH 3F9FA 4IC6A 3GCNA 2P8OC 2A31A 2UWPA 2FI3E 1YCPM 3C1KA 1XVMA 3D65E 1PPGE 4TWWA 3UY9A 2GV6A 2LPRA 1W0JD 3U98H 3CENA 1E38B 4X1SU 5A8YA 1XUFA 4WJG2 4MNWA 1BIOA 1BMMH 5C5OA 1V2RT 4I8KA 4FOUC 1SGCA 1P12E 2WPHS 1ZTLA 2Z9LA 1BRAA 2C8ZB 1MKXK 1TNIA 1TBZH 2FDAA 2JETC 5ABWA 4I7YH 2A0QB 1C9TA 2B8OH 3BG8A 1KTSB 4Y0YE 3OE7D 1O2MA 1NBME 1A3BH 1G9IE 4A6LA 3RXDA 2QXJA 3KIDU 2BDIA 4HG6A 1A0JA 4Z1MD 1HAHH 2ZI2H 1QR3E 5JBCS 1AWFH 5C1XA 1NT1A 3R3GB 3E1XB 1VITF 1EPTB 1ZGVA 1ARCA 3ODFA 4X1PU 3NXPA 1C2KA 2WPLS 4FUDA 4NFFA 2V6NA 5FPTA 1WSSH 1Y8TA 1SGTA 4SGBE 2XC0A 1BBRH 1AU8A 2QIQA 2VIWA 2QF4A 1UVSH 2A4RA 3ELAH 1ABJH 1D6RA 2BQ6B 1C5OH 4B6EA 3VXEH 1UO6A 3TGIE 2R2WU 2A2XH 2BVRH 2Z94A 2BY5X 2DE9A 1MTWA 1BTHH 4ZROA 1KTTB 2AH4X 1ZLRA 2O8WA 1SB1H 1FUJA 2HNTC 5KEDA 4FVBA 3KQBA 5BRRE 1C2DA 3LDXH 4ZHAA 1HJAC 2IJOB 5DP5A 1JIRA 3DD2H 1PFXC 5A0CA 3UFAA 3KQCA 2QY0B 2B9LA 2WPJS 3O8BA 2A7CA 1DXPA 1LQEA 1WYKA 4DURA 1MCTA 4XOJA 2YNBA 2SGDE 1VZQH 4YM9A 2FX6A 2VGCC 3SZEA 3AW1A 1K22H 2D26C 3MH6A 3RXLA 1P0SH 1NC6A 1UTNA 2ZTZA 3LT3A 2GD4B 2RCEA 2ZO3H 5JDUB 1EB2A 3A7YA 4DJZB 3A80A 3P8OA 1C5TA 1GMCF 3VGCC 2VIOA 1A5GH 1MCVA 1HAYB 1DY9A 4AFSA 2QF5A 2JDID 3IG6B 1PJPA 1QBOA 1OWEA 2IN2A 1MKWK 4CBNA 3F2FA 2P59A 3DCLA 1BMAA 1K1IA 3ZVFA 1FPHH 1O2UA 1CT2E 3RUOA 4K8YA 3HKJB 1SG8B 1GMDF 2XNIA 1O2XA 4ASHA 2VH6A 1BT7A 4JCNA 3UQOA 1PPZA 1FJSA 3GCOA 4JYUH 4U32A 4WH6A 1ELBA 1HLTH 1BRUP 4RSPA 4Q7XA 2LELA 2GTBA 1TNLA 1ELCA 1C1TA 1L0ZA 2RA0A 3ZVGA 3CS7A 1CBWC 1O2ZA 2ZDLA 5HMAA 1V2VT 4BXSA 3MNSA 2C3SA 2FO9A 3EE7A 4BTTB 1MABB 3RXSA 1UCYK 1N8OC 3ZZ7A 1W14U 3S69A 1NROH 2A2QH 2Y5GA 1BOQA 1TOMH 5GNDA 3KCGH 3FVFB 5LPFA 3PTBA 2ZU4A 3SQEE 3FOAA 1LMWB 2ANMH 3DUXH 3N7OA 1EQ9A 1ZTKA 3ZVDA 5DO4H 4DVAU 2GDEH 3RC5A 3F0PA 1GMHF 1K28D 1J17T 1MU6B 3ZZ6A 1QBVH 2ZHQH 2OK5A 1UK2A 1GBCA 2WINI 3FZZA 2ALPA 1TABE 1MTVA 2PUQH 2FWWA 2QF0A 1GHAF 3T27A 1SGRE 3E0NB 3V3MA 1FIZA 1YPKH 2WPDD 5C20A 4E06H 2FOBA 1D3PB 3I77A 2L6OA 1GBDA 5EW1H 1C5NH 1PQ7A 1O31A 1DDJA 1YBWA 1HFDA 3AVZA 4GHTA 4DIHH 1Y59T 2Z3CA 4O97A 3OTJE 1NRNH 2HPQH 4RT1A 3BEIB 5F6MA 6CHAC 1VGCC 2CN0H 3M7TA 1EAXA 2NWNA 1YPEH 2J98B 2XCFA 3S9AA 4DIIH 3N99A 4AX9H 2QE7D 3HK3B 2Y5HA 1HAZB 1XXFA 5L30H 4X6OA 1ZMLA 1H1BA 2ZA5A 4YTAA 4ZKRU 3P92A 1NESE 4INHA 4TY7A 2ANYA 1ETSH 3QN7A 1LHGH 3MO9A 3S9CA 4CH8B 1DVAH 1OXGA 1VCWA 3GYMA 1LHCH 1OP2A 2O9QA 1PYTC 4IW4E 2FS8A 4MNVA 5EODA 3WWFA 1Z1IA 3IWMA 1AFQB 1SLWB 1EOLA 1AWHB 1GCTB 2KAIA 1O3OA 4A1TA 3F9GA 2ANKH 2HVXA 2ZIQH 1O2TA 2QYIA 1TONA 1XM1A 3A83A 4JZ1A 3RU4T 2FOFA 2BD3A 3UB0A 1MTUA 1O5CB 3KF2A 3KN2A 5C67A 1O5EH 2I6SA 1ELFA 2UUJB 3SV8A 2VVVA 3SU1A 1SFIA 1DSUA 4I33A 3UNQA 4YESB 5GCHF 3TLOA 1BHXF 5C3NA 1SPJA 1P3CA 2ANWA 5JB8S 1G3EA 2H5CA 3UOPA 1XKBC 4U30A 4P02A 1HAOH 5C2ZA 4CRDA 5GIBA 1TNJA 1GVKB 1XUIA 2P3UB 3QGNB 1GHWH 1C4U2 5DSFA 1NRSH 2A5AA 7ESTE 1NZQH 1QY6A 3W1EA 1SGFG 1SQTA 1KXAA 1PQ8A 1Z1JA 1UVTH 2ZGHA 3MWIU 4I8HA 1P04A 3RXBA 3ZZCA 1DT2A 4K1SA 3HATH 3OEED 3E91A 4QT8C 1FZZA 1LHDH 1ZHMA 2GMTB 3PB1E 5T1VA 4NA8A 5HIZA 2Z6BD 3RMOH 4CRBA 2SGQE 2BVXH 1MTSA 4Y11E 3TH3H 2WYGA 2AMQA 1TWXB 4WH8A 5EQQA 3Q77A 3KL6A 4D7GA 4ASUD 5DP4A 2VWMA 3F2HA 1SKYE 3ZZDA 4RN6A 4D7FA 1Q2WA 4MLFB 1DWBH 4OM9A 1V2QT 4BANB 3SU4A 1CGHA 1ANEA 1CA8B 4IGDA 3DSOA 1THRH 1AZ8A 3PMAB 1AGJA 2YMSD 4B74A 2OXSA 3SYJA 1GBHA 3EA7A 1SGNE 2XCNA 1Z8RA 1VJ9U 1H9LB 2ZGCA 3OY6U 1H9IE 1PPEE 1XVOA 2ZFTA 2ZFFH 3LJOA 3ZVCA 1SVPA 1UCYH 1YLCA 2Q1JA 3PTNA 1GMDG 3Q3KA 2R9PA 3BTGE 5C1UA 2RG3A 1C5PA 1RFNA 2GX4A 1O5FH 1BA8B 1DANH 3T5FH 1GCDA 1MMJN 2VIVA 2J9NA 3LGVA 3ZZBA 3QGJA 1ZOMA 1TPAE 1A3EH 1ID5H 4F49A 3Q3YA 2KCPA 3EA9A 3PV5A 2XOKD 2V35A 2VJ1A 2KFWA 1ELTA 4NIWA 2WV9A 3N7DA 2HLCA 4AZ2B 4X2VA 1BBRK 2FOHA 2WPMS 3ZYDA 5C94A 1EOJA 4K8BA 1HRTH 4HGCA 1NRQH 2ZFRH 2ZQ2A 1G36A 3PRDA 4TT3D 1FAXA 1O3PB 2BY9X 1GBMA 1F5RA 4K69A 1KLJH 2QV1A 3M5LA 5T6GA 1QJ6B 2FYQA 1AUTC 1UTKA 1QJ1B 5EU8A 1S6HA 1G3BA 4AYVB 4FUBA 1O3MA 2K8IA 2XW9A 2P94A 1MQ6A 7KMEH 1GDUA 4I86A 4UD9H 3SNAA 3KYGA 3ZZAA 4JMYA 1UCYE 3PV4A 1LHFH 4Q7YA 3W94A 4DW2U 4ACAA 1ZMNA 1W0YH 3FP6E 1DUAA 1ZSJA 4FUGA 1OYTH 1TRMA 5FHTA 2F3CE 2YNAA 4DY7B 2P95A 1A7SA 1ACBE 1P2IA 1AMHA 5EQRA 3ATLA 4FU8A 5CHAB 1V2KT 1GJDB 4WMDA 1C2JA 4XRNA 5C17A 1Q3XA 2FYRA 3BG4C 1YPHC 1FI8A 1K1OA 4FUHA 1DPOA 1WU1A 2BDBA 1FMGA 3E3TA 5K7RA 2WYJA 1LKAA 5FXLA 1AFEH 3VB5A 4A92A 1O39A 1ZRKA 3E0PB 2Y82A 3A8AA 1XUGA 3FFGA 1AIXH 1O5GH 1CT0E 1GHZA 1ZHPA 4HTCH 3CP7A 3RXHA 4AORA 1QCPA 1A4WH 3MU1A 1C5MD 3U69H 1FIWA 4B2BA 5HXFA 2SGPE 3EDXB 1O34A 2H9EH 3SW2B 1CSOE 2BD2A 1YY3A 1L4ZA 3A7TA 4ISNA 2GKVE 3UPEA 1AVWA 1C1OA 5DPAA 4JYTA 2FTMA 3BEFB 1O3AA 5PTPA 1K1JA 2EEKA 3A86A 3NCLA 4AC9A 2FI4E 3PRBA 2BLWA 1PPBH 4UDWH 2J95A 3VB4A 2QN5T 1Y5UT 5HIYA 3TK9A 1EFRD 1NY22 1TX7A 3BIVH 3U9AH 1AKSA 1C2IA 2A4GA 1IQFA 1D9IA 2G81E 3AW0A 2QCYA 3EA8A 4CH2B 1BB0B 1O2KA 1K1LA 2H9TH 2VBCA 3T2NA 5F8ZA 1MBMA 3O8CA 4GVUA 1DLKB 3RMNH 2ODYB 1AB9C 4WWYA 1K9OE 5T3HA 2VNTA 4FU7A 1V2PT 4ACBA 1HDTH 1C1RA 2AS9A 3FO8D 3LJJA 4NIXA 3V13A 1QIXB 1KY9A 3F9HA 4BAOB 1E37B 1NPMA 3SO3A 3ZIAD 4X8SH 5EW2H 2F9PA 1OS8A 2CMYA 3BTWE 3D23A 1XX9A 2GCHG 4BTUB 1LKBA 1FY8E 1NFUA 5FAHA 1A0HB 1IOEA 1GVZA 5JBBS 2OTVA 1UK3A 2PHBA 3SNCA 3M35A 4O03A 4FVDA 5J4SA 2G52A 1G30B 1HGTH 1TGBA 4AG1A 2B5TB 5DG6A 3PWCA 2J94A 1O3EA 4YLUA 2Z9JA 2HWLB 4X1QU 3NRLA 5FCRA 3TH2H 3RMMH 2STAE 2XC4A 2O8LA 4H42U 5L2YH 1DX5M 1NFYA 2TGTA 1W10U 1N1LA 1EXFA 1E36B 2C90B 2CV3A 3UIRA 3PWBA 2EC9H 3OEHD 2F83A 4XFQA 5EXMA 1QRZA 4HFPB 2ZNKH 1NU7B 2WV4A 6GCHG 3Q76A 2ZDMA 2VINA 4LXBH 5TJXA 3P8FA 4TY6A 3TNSA 4E7NA 1GJ5H 2A32A 4ZKSU 3RXCA 1GBKA 4B75A 1P8VC 3SJOA 2Y7XA 2BM2A 3RXQA 4UFDH 1O2LA 4CREA 3UR6A 4AG2A 1HAXB 1LQDB 3LC3A 1FV9A 2AGGX 2CXVA 3GCTG 3BSQA 1S84A 2V3MA 1NM6A 2JIZD 3E8LA 1L4DA 2G8TA 1BTWA 1TE0A 3BTKE 2YMSC 4OS6A 1ETTH 3ZZ9A 5AFYH 2OQ5A 1SOTA 1BMLA 3PMBB 1O38A 4FXGH 4OS5A 2V3OH 5DP7A 4XD7D 1GI0A 1CA0C 2NU3E 3RXVA 1P9UA 2XTTB 2AERH 5HGGA
chains in the Genus database with same CATH topology
2BD9A 2QXIA 1Y3YA 1C5VA 1C1SA 2GZ7A 1SFQB 4AN7A 2NU0E 1NFXA 3RXGA 2GP9B 1G32B 5GWZA 2JKHA 2SGEE 2Y80A 1DFPA 1GHXH 4IMQA 1LHEH 2KAIB 1HAIH 1KSNA 4ABBA 4NA7A 2Z9GA 1CO7E 1EJAA 4AFUA 1DOJA 1O3HA 4B76A 3A8BA 2ZP0H 4XBBA 1O2WA 4CRCA 2VWLA 1HJ9A 1EKBB 3TJUA 1ZHRA 3MNBA 1E35B 1EJNA 1MAYA 4NA9H 1HPGA 1Y3UA 2AGEX 3RXAA 4XBDA 1ANDA 1H8IH 4M7GA 5B6OA 1TNHA 2FOAA 3QWCH 2V0BA 1EX3A 4AB8A 1HBTH 4MG3A 1ARBA 1W0ZU 3RC6A 1TPPA 3GY7A 1W11U 1TPSA 1E0FD 3DT0H 2HPPH 3SU2A 1NN6A 3URDA 3KGPA 2EA3A 4KKDA 1FPCH 8GCHF 3ZZ4A 4Y7AA 1T31A 3T62A 3TK6A 4TPYA 3SI3H 3TITA 5SGAE 2C8WB 1AZZA 3SNEA 1O2YA 1O3KA 1J9CH 3K6ZA 1CGJE 4FUIA 2GV7A 3T26A 1KDQB 1C2MA 1O3NA 1TAWA 3HGNA 2D1JA 3LGYA 5A8XA 3GDSA 1GJ4H 1O2PA 1S5SA 1ZPZA 3BF6H 1BRCE 4B71A 4IN1A 4Y8ZA 1NU9A 3L3TA 4RKJB 2FOCA 4Q80A 1XMNB 5DP8A 1Y5BT 5F8TA 2EI7A 5EGMA 2Y7ZA 1VITH 4GAWA 2A1DB 2RA3A 2ZCHP 3ATKA 4X8TH 1YLDA 1OKXA 1UTPA 4ISOA 3SU0A 3UOUA 5JBAS 2XBWA 1GI4A 2HALA 1ELAA 2TPIZ 4Y79A 4ABEA 1HAGE 1QB6A 2A5KA 2GZ9A 1HNEE 1NRPH 3F68H 5A2MH 1G2LA 3K6YA 1CGIE 3TJNA 2W7UA 3GCTF 1V3XA 1BTPA 2B7DH 3ESTA 2XRCA 4INLA 1OWJA 1QFKH 1TIOA 1SGFA 4Z6AH 2ZDAH 2JETB 3LKWA 3P8GA 2PWXA 1C2EA 4YT7H 4IS5A 4WXVA 1EAIA 1RD3B 4HI3A 3H5CB 2JH6D 2P3FH 2QGRA 3TNTA 2ZTYA 4NG9H 2XYAA 4SGAE 1XXDA 1SLXB 1NFWA 8ESTE 5GDSH 1ZSLA 4DGJA 1CU1A 3PO1B 2UUFB 3KHVA 4IBLH 1K2I1 4NSYA 2F9NA 1Y3VA 3RU4E 1RTKA 3EE0B 1TRYA 2R3UA 1MTNB 1SC8U 1SR5C 5G4BA 2PLXA 3M36A 1C5RA 1Q31A 2G5NA 2OBQA 4ABJA 1K1NA 1CE5A 4YOJA 1ANBA 1O0DH 4GPGA 1QQ4A 1WBGB 3BIUH 4KELA 2FS9A 2BD8A 1GCTC 1C5XB 1JRSA 3PYHA 1AI8H 2FM2A 5E2PA 2OC1A 1ESTA 1QHRB 1V2NT 1AKSB 1Z7KA 1GGDB 1ETRH 1DM4B 1SOZA 3NWUA 1HJAB 2ZDKA 2VVCA 1FY1A 2PGQB 1ESAA 2C93B 2ZC9H 3SUFA 2BTCE 2CGAA 2HOBA 1GL0E 2BXTH 1TQ7B 4GHQA 3SUGA 4B2CA 4OS2A 2G55A 4NZQA 3SORA 2BLOA 4X6MA 4MPWA 5A0AE 1GMHG 1ZJKA 3LGIA 3UUZA 4CRFA 1THSH 3GY2A 3NKKA 4JK6A 5FCKA 4A1VA 4X1RU 1TA2A 2Q6FA 3A84A 1QL7A 4I31A 2ULLA 5E2OA 5IDKA 2A5IA 2GCTB 3EAJA 1OWHA 3TPIZ 3A7XA 3URCA 3LONA 4Q7ZA 5GXPA 3U8OH 1OOKB 1HUTH 1TGSZ 5H4IB 4D8NA 1HIAB 2FLRH 1ZYOA 1DS2E 1EZSC 3ZV9A 2VWOA 1EPTA 2D8WA 2ZHDA 2A4QA 2BDGA 3SNBA 1P2MA 1F7ZA 3SU5A 4KTSA 1LPGB 4K3JA 3RXPA 3VGCB 1BTXA 2H1UA 1GJ7B 4I8LA 3TH4H 3MH7A 1PPCE 2XBVA 2QC2A 3MO3A 4RKOB 2BQWB 3SJIA 2C8YB 2G4TA 2ZPRA 1ZZZA 2V3HH 1Y3XA 1RIWC 3SN8A 4UFEH 5DGJA 1GI7B 1HJ8A 3O8RA 2BD4A 1KXCA 1SHYA 1Y3WA 3QZQA 2NU4E 2Z3EA 3RXIA 3MU5A 1O2VA 1NS3A 1QTFA 4ZXYH 1LO6A 3RXJA 1ZR0A 2ASUB 1WOFA 1MZDA 3EYDA 3UTUH 2GGVB 1S81A 1GVLA 3NZIA 1H4WA 1YC0A 2G4UA 3MHWU 1C2HA 1ZJDA 3A87A 1N8OB 1K1MA 1BUIA 4MQAA 2EI6A 1B7XB 3ATIA 5LPRA 1LVBA 1Z71A 4AYYB 4BNRA 3BV9B 5TCCA 3K65B 1P03A 1GDQA 3B9FH 1OWIA 1T8MA 1BJUA 4K1TA 5L2ZH 3UREA 4Y8XA 1D3DB 2ZFPH 2PTCE 6CHAB 1FDPA 4BXWA 3V7TA 4CBOA 4Y7BA 4ZHLU 3F9EA 2A4OA 3FANA 1TGCA 1P3EA 2FODA 1DSTA 1O5AB 3B8JA 5DP9A 1AY6H 2GVFA 1C1VH 2IPHA 1O2GH 1WTGH 2QXHA 3QLPH 2THFB 3LGUA 1J16A 2NU2E 1UK4A 2QXGA 4WMEA 1TPOA 1BZXE 2BDYA 4B1TA 1QJ7B 5FPSA 2VB0A 1RJXB 1RTFB 4IC5A 1UVOA 1VITG 2IOTA 1EB1H 1MTNC 1V2WT 5HYOA 1IAUA 2A7JA 5AFZH 4E7RG 1VGCB 2VVUA 4MPVA 2ZQ1A 3GY8A 1P09A 2F9OA 1HCGA 2BVSH 4FUFA 3RXEA 4GUXA 4AFQA 1ZPCA 4UONA 2GT7A 3STJA 3G01A 3QTOH 2ILNA 1Y5AT 1LPKB 3KQEA 1AN1E 1HAVA 1HYLA 4WVPE 3MYWA 3RC4A 5C5NA 3U8TH 2O8UA 2P16A 1CQQA 4X8VH 1CHOG 4MDSA 3QTVH 5EPNA 5JYIA 2NU1E 1T7CA 4MNYA 3RXFA 2SNWA 4WMFA 4VGCC 1MKWH 5K0HA 2PTNA 1T4VH 5EQSA 1FAKH 1FQ3A 1SHHB 1THPB 4BAHB 2HRVA 1IQHA 3SBKA 4X2YA 3RXUA 1GI3A 1GI2A 1Z8GA 2GMTC 1SGEE 1AVXA 2LNCA 1K1PA 2FLBH 1HV7A 1TRNA 3GCHC 1H8DH 3HKIB 1W12U 3FP7E 4X1NU 1HAVB 4Y10E 1AE8H 4Q2KA 1W13U 1OX1A 1MU8B 3JZ2B 1P2KA 3K9XB 4Y76A 1QRXA 1FN8A 1AUJA 2A7HA 4DOQA 1P01A 4YOGA 1N6YA 4R0IA 1GJAB 1L1JA 2ZG0H 3GY4A 1C5WB 1A61H 3GDVA 4H6TA 4LOYH 4KTCA 1ESBA 1O3CA 2ZZUH 4J2YB 1UHBA 5JB9S 3SUDA 3L6PA 1GJ8B 2G51A 3SHCH 4E05H 2F9UA 5DK1A 2VWNA 1O2QA 5DJ7A 1YPMH 1J14A 3B23B 1MD8A 3Q00A 1LVOA 1S0QA 1V6DA 1AE5A 2G00A 2BDHA 1RIWB 3MFJA 2ZHWH 3UNSA 3SV9A 4H4FA 3SJ8A 1O3LA 1Z6EA 2P8OB 3SU3A 4TYDA 1RXPA 1LDTT 2Z7FE 5JBTA 1BBRE 3CS0A 2I6QA 2PKAA 2J34A 1F0SA 3ZZ3A 4DCDA 1O35A 2OCVB 1EAUA 4BTIB 2QF3A 2F91A 1GBBA 1UHBB 5GPIB 4YLQH 4O3UA 2Y5FA 3ZZ5A 5FBEA 4OS7A 1UVUH 4MPXA 2W5EA 3MMGA 2OP9A 2ZTXA 1UTMA 7LPRA 9LPRA 1DICA 3R0FA 2BZ6H 4NGAH 2FI5E 3M3SA 1TGTA 1O2IA 1TA6A 1G3DA 1C5LH 4I8GA 1CHGA 2FEQH 1GI9B 5HM9A 1EPTC 1SLUB 3ZVEA 1O2HA 7GCHG 1J15A 5I25A 3DHKH 4Y6DA 3ZV8A 1BJVA 3RLYH 1P2OA 2DUCA 4OS4A 3P95A 1ORFA 1O3DA 2ZCKP 4ABHA 1G3CA 2UUYA 5FPYA 2AIQA 2CF9H 2XWAA 3A7ZA 3HGPA 2ZPQA 1MH0A 1O36A 3L33A 2OLGA 1RRKA 1AVGH 4FUEA 1SGQE 3AASA 2WV5A 3NPSA 4NSVA 2R3YA 1ELVA 1WV7H 2BD5A 4U2WA 1SL3A 5FX5A 4NCYA 1C1MA 3JZ1B 2GDDA 5CHAC 1O2SA 1VCPA 3BTHE 2PUXB 1GG6C 1C5QA 3QUMP 1JMOH 1W7GH 1WCZA 1TYNA 2DE8A 3TK5A 2FZZA 4NFEA 3ITIA 2C4FH 1D4PB 3PLKA 5T6FA 1EAWA 4AB9A 1OWKA 1TALA 4UFFH 5EG4A 3ZVAA 1SBWA 4VGCB 4X2XA 2BQ7B 3RU4D 1A2CH 1P10A 5JPMH 1QB1A 1BITA 3WY8A 2P3TB 2BB4A 4YOIA 1BMNH 4K5ZA 3RM2H 2SGFE 5LH8A 3PLPA 1YCPH 2XXLA 3AAVA 4AGKA 3VPKA 3D62A 9ESTA 3MU0A 3UWIA 2VIPA 3QX5H 4ABGA 1UVPA 1TOCB 1FXYA 1F0RA 1ELDE 1RTLA 3A8CA 5AHGH 1EP6A 4YO9A 3RDZA 1C2LA 1KIGH 2OUAA 2ZFQH 1A5HA 3RLWH 2CHAC 3OY5U 4ZKOU 2ZU2A 2ZFSA 2ESTE 1A5IA 1FY3A 3M7QA 4ESTE 1ZPBA 4WF8A 2Z9IA 1TGNA 4JZDH 3LH1A 2ZHEH 4YZUA 1QL9A 3M3TA 2OBOA 1PYTD 2GT8A 3SI4H 3NUMA 3TIUA 2STBE 2OC7A 1QGFA 1G37A 1QNJA 1TMUH 2PKSC 4ABDA 1C4V2 5E0GA 1HXFH 3T28A 3IITA 2TGPZ 3O8DA 2ZPSA 1QB9A 2BD7A 3MTYA 4A5TS 1XUJA 1VR1H 3GY6A 4KTUA 4BOHA 5L6NH 2VU8E 1LCYA 2ZKSA 4FUJA 1SGIB 3E6PH 3U8RH 2BX3A 1NO9H 1JOUB 3SGQE 1YPHE 1GI8B 4TWYA 1PPFE 3S0NA 3RXKA 1O5DH 1YPGH 1A46H 5FX6A 3S7HB 3MO6A 1O5BB 3FP8E 1SQOA 1C1NA 1FONA 1C1WH 5I46H 2P93A 1D3TB 1GHAG 5EOKA 5EXLA 1TNKA 3OU0A 1C2GA 2AGIX 3LU9B 1W2KH 2O8TA 1IHTH 1GJ9B 1O3BA 5J4QA 4BAMB 2J4IA 1P2JA 1HAPH 4LZ1H 3PMJA 1YYY1 3QZRA 4A7IB 1QA7A 2VIQA 3P70B 1C5UA 1O2JA 3KNXA 2XC5A 2Y81A 3RXTA 2UUKB 1TBQH 4ABAA 3RXRA 1IQNA 3ATMA 1EASA 1T8NA 3I29A 1AFQC 2FXRA 4INKA 3SU6A 1TX6A 3RMLH 3GISB 2R0LA 3E90B 2A45B 1TQ0B 2BXUH 2WUCA 1FY4A 3MH4A 5LGOA 1LVMA 2ZGXH 2AFQB 4XSKU 1GL1A 1GI6A 1HB0B 2BX4A 2C8XB 4GLYA 5CE1A 2PSYA 3ZZ8A 4AGJA 1CA0B 4MVNA 5EPYA 3FAOA 1GBFA 3P8NA 1FLEE 4JZFH 2ZECA 2BHGA 2AMDA 4KGAA 1V2UT 2J92A 4CHAC 2ZDVH 3A7VA 1UMAH 1FN6A 3GYLB 1KXDA 5BPEA 1XKAC 1SI5H 4CRAA 3C27B 4BAKB 3FZDA 4MNXA 1P2QA 1T8LA 1ZMJA 1SGPE 3BEUA 3VB7A 1Z6JH 2BLQA 4PROA 3HPTB 3SJKA 1Z8IB 3GOVB 1F92A 1DE7H 1RGQA 2OQUA 1IQEA 1GBIA 2BLVA 1DWDH 4AOQA 1V2MT 1Z8JB 2ZF0H 3A89A 2VIDA 4MPUA 4X0WU 1ZSKA 1U6QA 5T6DA 1BTYA 1MZAA 2BY6X 2Q6GA 2PGBB 2M5TA 5DP3A 2J2UA 2PR3A 1SGYE 1O37A 5ESTE 1BDAA 1E34B 2PW8H 2ZU1A 1SSXA 1TB6H 1TBRH 2GCHF 1PQ5A 3HK6B 1D6WA 1VCQA 3TGJE 1D3QB 4NIYA 1GHYH 1CBWB 2XWBI 1O2NA 1S82A 5DKMA 2CHAB 3BTDE 4K1EA 3PMHB 2WPKS 2ZDNA 4ZUHA 2OD3B 3M5OA 1C4Y2 4O9VA 1IQGA 1T4UH 1QL8A 3A82A 1F5KU 1UTQA 4JYVH 4AFZA 3S7KB 1UJ1A 1GBAA 4Y71A 1XUKA 4GSOA 1BCUH 3SNDA 4X8UH 2TRMA 1INCA 2BYAX 2PKSB 4ZH8A 1IQLA 1P06A 1S85A 2QAAA 5A0BA 2G5VA 1MQ5A 1S83A 2FX4A 3V12A 2SGAA 1O3FA 3M61U 3SV6A 4JK5A 2PV9B 1FNIA 4OGYA 1EUFA 3PO1C 4ISHH 3T25A 2BZAA 2FMJA 1RS0A 3GDUA 3P17H 1C5YB 3MI4A 1BQYA 1GJ6A 1AO5A 4X6PA 1PQAA 1LVYA 4UFGH 2FOGA 3VB3A 2W7SA 3KQDA 3UQVA 4WXIA 1EZUC 5ESBA 3TJVA 7GCHF 1H9HE 1MAXA 2HNTE 1O2RA 3MOCA 2R0KA 3SOSA 2BY8X 3RP2A 4JZIA 3QDZB 1EZXC 3QK1A 2AMPA 2W3IA 1DXWA 4ZMAH 1KDQA 3W95A 2OC0A 2ZGBH 1YM0A 4GCHF 1KXFA 1ELGA 1O3GA 4XE4A 1EJMA 4A1XA 1GBLA 1T32A 3RXOA 4ZAEA 4ABFA 4Y8YA 2HGTH 1YGCH 1C1PA 3ODDA 4JZEH 1N6XA 1OSSA 2QA9E 2D2DA 5GCHG 1F0UA 5E0HA 5C1YA 4I32A 3TVJB 1EP5A 1P9SA 3ATWA 3MNXA 4R8TB 4K2YA 1KYNA 1UTJA 3BTFE 2BMGB 2HNTF 1GJBB 3DFJA 4YT6H 3I78A 1O3JA 3DFLA 3LIWA 3TU7H 2OINA 1GBTA 1GGDC 3K2UA 3EQ0H 2BOHB 1C5ZB 1W8BH 4F4OC 1GI5A 3H7TA 5LPEA 2F9BH 3SQHE 2K1QA 3BTTE 1IQMA 4TPIZ 1NTPA 1QQUA 2AIPA 1BRBE 2OC8A 3M5MA 2ALVA 2ZHFH 8GCHG 1V2OT 3GCHB 1L1NA 1MD7A 1AHTH 4CRGA 1C9PA 2H9HA 3MNCA 3RXMA 1EZQA 4LZ4B 1C1QA 5IYTA 4CHAB 4CR9A 1PPHE 3Q3XA 4IN2A