2JF1A

Crystal structure of the filamin a repeat 21 complexed with the integrin beta2 cytoplasmic tail peptide
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
92
structure length
87
Chain Sequence
GAHKVRAGGPGLERAEAGVPAEFSIWTREAGAGGLAIAVEGPSKAEISFESCGVAYVVQEPGDYEVSVKFNEEHIPDSPFVVPVASP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FILAMIN-A
publication title Beta2 Integrin Phosphorylation on Thr758 Acts as a Molecular Switch to Regulate 14-3-3 and Filamin Binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 15
structure length 87
sequence length 92
ec nomenclature
pdb deposition date 2007-01-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2jf1A00
3CDGA 4X6FB 2W0LA 4OAWB 4JM4L 2RJMA 4RFOL 1A1MA 2XRAL 3C6LA 3V5KA 3BGFC 1YC7A 2HRPL 1P4LA 1AD0A 4PJHB 3BP7A 3AM8C 1E0OB 4H1LB 4OCXH 5IQ9B 1H3PH 1RZJL 2JJTC 5FYKH 3VFMB 2XIDA 3UYRL 4XBGA 1I1FB 5HY9A 2ZOLA 1T1ZA 2JIXA 1Y0LA 2VDOL 4RZCA 2MHAA 3HNTL 4I0CC 4WGWB 3WHE0 2X4SB 4JPKL 1XGYH 2IF7A 3C5ZD 3S4SB 3UJIL 1JYNA 4RGMB 5F93C 2BMKB 3EHBC 4NC1C 4P23C 4XCFH 1CICB 4J1UB 5FHBH 3X3GH 4P5TB 1WLHA 2B20A 5C1MB 1MOEA 1FVCA 4JJHA 4LPXA 1NLBH 4LRNH 1JWMA 3PQYB 4M9OA 1LO2L 4WV1B 3RWIB 4OD1H 4P57A 3BJ91 3JV4A 4JJ5B 4YDVB 3OR7B 5ACMA 5E94A 1SHMA 1IAIL 1FAKT 3DX8B 2N7AA 2OR9H 1CBVL 5H8DA 4XWOC 1NMBH 2LTQB 4XNZB 1DUZA 1FNHA 4FQIL 4LCYA 1EJOL 3SDCC 3L3KB 4QTHB 4K7PX 2A9ML 4NRXB 3QUZB 1LEIB 3KYKH 3BPOB 2J6EL 3I02B 3M1BA 1KJMA 1ZS8A 1UA6H 3FQTB 5TPWH 2DLEA 3SN6N 2DICA 4M5YL 4X8XA 1DBBH 1VFMA 4TYUA 1WIOA 3FB8B 3QDGE 2X44D 3EDDA 3HPJB 2HT2D 1NBQA 3BZ4A 5TE6H 1HINL 3QI9D 3O2WL 4L9LA 5DD5L 3TC9A 5EZIH 5EC2B 4RAHA 3ZO0A 3AS0A 2VDPL 2I27N 2ZUUA 3TJHC 2WINA 4WI3A 5EZOH 4LVOB 2OI9C 4WY7H 3CSYA 4UQ2B 5FO7A 1E28A 1NFDB 4H1LH 4V1DD 5ESAB 2AJXH 4G8GA 1HDMA 5D7SH 1MCQA 1DN0A 5F1KC 1CD8A 2DLFH 1FGVL 2NQCA 1R3IL 1P7KA 4NGHH 3RP1A 1CIDA 3H3PL 3DYPA 4NN5B 2OXHA 3CSGA 5JW3L 3B5TA 1ZA3B 4C83B 3C6LD 1DDHA 2OK0L 3C5ZB 5DRXA 4Z9KB 2W0FB 4PRAA 4CMMB 3DVGB 1AC0A 2YKLL 3AROA 2XKNA 5HHNA 3WD5L 2IGFL 1BQHG 5GRXG 4FG6D 4PGBA 4HGWB 3N1PC 3DI2B 5MEOA 4I18C 2JIXD 3H9HA 3LKSA 3OHXB 2HFEB 2R2EB 4X4ME 3RGVC 5EOQL 3C2AL 2C26A 5CSZB 1H0DB 4G42B 5KSBE 3DUSA 3GSNL 3B2UD 1EERB 4NQDA 5IW1B 5DC9B 4Q9RL 2V17L 2ZNXA 4Z6AT 1A7NL 3CJJA 2X1PA 4FFYL 1DR9A 1VGKB 3E8UL 2DDQH 3QHFL 1XCTA 2C7UB 3IRPX 4PJHE 2B1HL 5GGVH 5J3HD 5LAXA 4NZTH 4PB0H 1CD9B 4PRBA 4XP4H 5JW4M 3B5HA 4MSWB 1KV3A 2XY2A 4DUVA 4JHWL 3L3OB 4RIRB 5ID1A 1N59A 1I1YA 1U91B 3QI9B 1OT2A 4H26A 2EYRA 2YUVA 3D9AH 5CBEB 3DURB 2NY7L 2VN4A 2HTKC 4ODTH 3O3BB 4EUPA 4JFFA 4KKCC 1DZBA 2MFNA 4P2YA 5L9DH 2OL3H 5F7KC 4I2XA 2Y07L 4YDIH 1GCFA 3CFJA 2PXYA 3TYFA 4PR5B 5H2BB 2ESVA 3PQYE 3ZDXE 5T3XD 3BMWA 3U7YH 3C8KA 5C2BH 3CDGB 4YXHH 5JW5A 3FMGL 4A6YA 3ZHLA 1XGPA 4GXVH 4XH2B 4LQFL 3V5KB 2FBJL 5EU6B 3BP7B 2FO4A 4G8GD 4H5SA 1F00I 4HWZA 3U6RA 4HPYL 1UGNA 4OCYL 1T83C 3V7AG 4R0LB 1HQ4A 2OTWA 2JIXB 3E2HC 2R39A 4RZCB 4H88L 4JM2C 1G7HB 1F90L 1KELH 3FO1B 4TRPH 2AJ3A 3KHQA 5E00B 4PGEB 4J3SA 5EORL 1I8MA 4PG2C 4HF5L 1KN4L 3GBML 4HJJH 5DK2A 1OLZA 5EA0H 4PGCB 5IMMB 3KS0J 2J8UA 3RHWK 4KVNL 2R4SL 3C08H 4P57B 3CAFA 4LVNC 1PG7H 1NFDE 1MCFA 5DJYA 4GKZA 1CXEA 4NQDD 1DUZB 3KPRB 4LCYB 5F1OB 1MRDH 3P4LA 4D0BA 2HT3D 3M1BB 3MLRH 1KJMB 4OM0H 1ZS8B 3RNQB 5KW9L 4LP4A 5LCVH 5TDPB 3TBYA 2FATL 3VFGL 4ZMAT 4F7MB 1YY9C 4M03A 1NAMH 4Y5YC 1G7IB 2UWEF 2VABA 1HNFA 1MIML 3BZ4B 4IBLT 2X1WL 2CUMA 2B4CH 1QFWL 4L4TA 4OZHA 1TNNA 1BAFH 4NUGH 1JHLL 4CDGC 4WEMB 1TVHB 4PBXA 5B3JE 1PQZB 4JFFD 5D2LB 4ZDHA 5JXAL 1E28B 4HBCH 4X6DF 1AFVL 1HDMB 3MXWH 4P9HH 3CVHL 2PXYD 1F2XK 3QAZC 2ESVD 5F9JA 1DN0B 1RZ8A 5D5MA 1UB5A 1XH3A 1PEWA 4HG4J 1R6VA 1S7XB 1CLCA 4XNYL 1A5FL 1FH5L 1H5BA 5B22A 1T5WA 2C4FT 2VQ1A 3MNWA 4LVHC 3I50H 1KJVB 2FX8L 5DRXB 1UZ8A 4FQHA 1CI5A 1OAKH 2VTFA 2WQRA 2EO1A 3KDMA 1RAMA 2XKNB 1OW0C 4OTXL 1CT8A 2HH0H 2YMXL 3GBNH 1U8OA 4BUGA 5AWNH 2V2TA 4UTBH 1VPOL 4LU5L 3B9EA 2EZ0D 5IEKA 4OCRL 1RMFH 2XA8H 5DJ8A 2EICA 1YDPA 3WDIA 3DUSB 4KDTA 2DN7A 2EC8A 4M43L 3WYRA 5FO8B 3K4ZA 1FNEB 4WDIA 1EGJA 1NSNH 3CH1A 2D7TL 1YEDA 4XPGL 1CLOH 1KPRB 1S7VA 1G7QA 1KN2H 3BFOA 3O6LH 1ZGLA 4PBWD 5EU6E 4LSSH 3HMWH 1OAZH 5IMOB 4AEEA 1MREL 1HYSC 3O6KL 1OM3H 3UEZA 1E4WL 2ARJA 4FP8H 2CKBL 1IL1B 3AAZA 3O11A 4RBPH 1AI1L 5D70L 3RL2B 3TP4A 1FP5A 1IGIL 3FQUA 5ID1B 2M8XA 5ALCL 1N59B 3VI4F 3RVTC 1ORSA 5F7UA 4L3CB 2HKFL 4KK6C 4NBZB 4L8DA 3TO2A 3Q3GA 2EYRB 2A9NH 5JDSA 5LQBH 2D7PA 4YR6A 3PG2A 4JFFB 5I2IA 1A4JB 5I1AB 4JFYB 3WJLC 3OQ3B 4XMKL 5E99L 3PHOA 4I2XB 4I8DA 5C0CA 3UBXI 3QH3B 1MCBA 4ZUUA 3GJFH 1M71A 4YZFE 3TYFB 3BKYH 3UO1L 4GAFB 4P99A 2FGWH 3VXTA 3CFCL 4L4TD 2LU3A 4KDWA 4LASL 4A6YB 3MLYH 5EC1B 1XGPB 2NR6D 3U48A 1QFHA 3HRZA 5ID0A 2OTUA 5JXEC 5D93B 1A47A 3L7EA 2FO4B 4H5SB 3QUXD 4IIQB 4HWZB 3BPNB 1KOAA 3KPRE 2UUDH 2BC4A 1CFNB 5FF6A 5IEHA 2OTWB 3HZYA 3NABH 4U6YB 5L8JB 5IBTL 4AG4H 4LDOB 3IDJB 3QFDA 4XNUH 1JPSL 1UVQA 4I3SL 4L8BA 4OZIF 3C8DA 1KSRA 4GUPB 2Z93B 2BOBA 2EDHA 3IFOA 1I3UA 1CDHA 3FO2A 1IAIM 5ILTH 5I1IL 3A6CL 4H8WL 5T3XE 4BSVA 1U9KA 4IMKC 1IM9A 1LP9B 1J0JA 5HHQA 4FQPA 3N1QC 1IFHL 3QQ9D 5D2LE 3M07A 4MD5A 4R4NC 4XHJD 4XNXH 1J1PH 3OAYH 5DJYB 2Q76A 4HBQA 2DJUA 1MCPL 4OCLC 1QOKA 2R56L 1NUGA 1J9CT 1W0VA 4OIIH 3S37L 3KPLA 1LO4L 3WBDA 4TSCH 4FFZH 3WHXA 1FAIL 1NGPH 3LSOA 3SGEH 2OP4L 4WEBL 5T33L 2W9LA 2HJKA 3FZUC 4YHNB 5ITBL 4TVPD 4URTB 2CXKA 3N85H 3V8OA 1ZK9A 2CKNA 1QVOA 4N8CH 2YPKB 1FZOB 5J6HA 5FV2A 3MTRA 5DEGA 5F9AC 3V9FA 1UACH 1JGVL 1Q9OA 4BK4A 1Q9KA 2PO6A 3IB4A 4IRJB 1QP1A 2XG4A 4X8JA 3JVGA 2LFGA 1D5ZA 1Z2KA 4WUKL 3OZ9L 4N8VG 3MJ9L 3L6FA 4NRYA 3KPSA 2WNGA 5F70A 5AZEL 5C0CD 2EE3A 3QUXB 4NO2A 3BSZL 4O5LH 2AEQH 2Z91B 2H41A 5F9JB 5D5MB 2NZIA 1TTFA 4LNRA 1TJHH 3BDYL 5D7IF 2ORBH 4Y16B 3OJMB 4HKJB 4MNHA 5J13B 3GHBL 3IDIA 1H5BB 4HJ0D 2BY1A 4WVRA 5E9DB 3RY6C 3MNWB 3QJHB 4GLRH 2OJEA 5BXFB 2ERJB 2DQJH 1HIMH 5IVXF 2X2YA 2FB4H 3WKMH 2DLTA 1UZ8B 5J89A 3F7VB 4FQHB 1F4HA 2M1KA 3MV7A 3L3GA 1YNTB 1NGXB 4LSRL 4YWGL 3SDAB 5IFJA 2WANA 1U8OB 4XXCC 1YJDH 4AYFA 5TFSL 4FFWD 5JIPA 1LK2A 1NL0H 5IEKB 1PJ9A 1JGLH 1GC1C 3FT3B 3CFBA 4KROB 4JFFE 1RUMH 3GDBA 1YDPB 4I2XE 5C0ND 2PYEB 1J0IA 2NZ9C 3DSFL 2YR3A 3WUWG 3WXVL 1R5IA 4WDIB 3NIGE 4QWWD 1IM9D 1EAPA 2H9GA 3CH1B 2N7BA 3CLFH 2R1XB 1D5IL 4OLWL 4Z0BH 1R3KA 1KIUA 1MAJA 2AK1H 2NY5H 4OF8A 1G7QB 4RNRA 3UTPD 4NCC2 3VD3A 3QO1A 1VHPA 1ZMYA 3FTGA 2ICCA 5I8EA 3ZKXB 3PABB 1HSBA 2F53B 3BHBA 4OCXL 2EDBA 1TZHA 5FYKL 4Q2ZA 3GM0A 4MB4A 3ZYIA 5CSBA 1TVBB 3QQNA 4HHAB 4HWEH 4ONHA 1BBDH 1WZ1H 3PWUA 1OARH 1ORSB 5DZNA 2A83A 3JV0A 1XGYL 3Q3GB 5JDSB 1BP3B 3IU4H 3LEXB 3PGDA 5FKAA 2A73A 3HS0A 4YR6B 1WISA 5I2IB 4XCFL 4PP1D 7CGTA 5FHBL 4PJIB 5BV7L 3P4MB 4YEFA 5K9JL 5C0CB 2Q7NA 4ZUUB 4WO4A 1NLBL 2IQ9H 1RI8A 5KOVC 4WI6A 1QR1B 1LP9E 1NCCH 2XACC 1S78D 5AYUL 4U7KA 3MZGB 3KLAA 5GRYA 1DUYA 4ODWA 1INEH 2PO6D 4HIJA 3HRZB 2Y7QA 1DANT 5FUCC 1U3HA 5GHWL 2EDNA 3C60A 3ARYA 3KPSD 3VWJA 2WP3T 1B0GB 3V6OA 4JKWA 4KDVA 1HH6B 5IEHB 3KYKL 1EDQA 4HH9B 4R7DA 3N9GH 2ZCKH 2GK0B 1UA6L 5TPWL 4NJAH 3ZTNH 4A2LA 5I6XC 2CIKA 5KS9A 4BQ8A 4OF6A 4OB5H 4ODXB 1DBBL 4GSDH 1BD2B 4IDJH 5A2JH 5ERWB 4HS3A 4PJDF 3MV7D 5C2UB 5D1XA 3IFOB 3MRCA 5TE6L 1UJ3B 1MLBB 4M48H 3ZYJA 4XB8A 4NWTL 2X70B 3HC4L 2BVYA 5EZIL 4BSVB 2V5YA 4PRNB 4JB9H 1Z3GH 2VIRB 4JCMA 2WUCH 5IW3A 4OJFH 5EZOL 4GAYB 3VJ6B 1WBZA 1X4ZA 4P0DA 3GMNA 4HG4K 4X4YA 2AJXL 1LDPH 1K4DB 3ARPA 5D7SL 4H0HB 4ZOCA 3M17A 2AXGA 2DLFL 5B39G 5D5ME 4NGHL 2P44B 1N7ML 3HN3A 3KPLB 5E7FA 4BELD 1OSZA 1AD9A 1V7NH 5E9DE 2YBRA 1V3KA 4ZTOL 5D4QA 2JB5H 1WFOA 2FX7H 5EBMA 3NA4A 4OLVH 2PTTA 1JK8B 4GAGH 2G60H 1IRAY 1QHPA 3O8XC 1VKXB 2Y5EA 2E6QA 3RDTB 3DJ9A 5I71B 1TTGA 3DX6A 1QVOB 2CO6B 5J6HB 1ZV5A 3FRUA 5HJ3B 1F3JA 1T5XA 4ZS7L 4UI2A 4HX1A 2DIJA 4Y2DA 5FDYA 2OR8A 1Q9OB 3VRJA 1RHFA 2VLJB 1Q9KB 3MRGB 3A67L 1UH4A 4PUBL 4X8JB 3SQBA 5E7BA 1ADQA 2FECL 1D5ZB 2PYEE 1LO5A 5FM5O 3L6FB 3T4AA 3KPSB 1ONQB 2Q7YB 5EUOF 1HOCA 1JTPA 1SBBA 4WO4D 5E8PA 2ADIA 2HFFB 4MAYB 1S9YA 3WFEL 3WN5A 4LNRB 3VWKB 4I77H 4R4BB 1RURH 3MYZA 4MNHB 4F3FA 4GW5A 3K81A 4XC1L 3IDIB 4PV9B 5KSAC 2AJZA 2F53E 1U3HD 4TVPE 2CJUH 4PB0L 3C60D 4M5ZL 2UWEB 3F7RA 4K8RH 1VESA 3VWJD 3WCYA 2DJ4A 1KB5A 1CE6B 2X4QA 4Y1AB 3MV7B 3L3IA 4XAKD 4TTGA 3JUZA 4ZTPH 4JAMB 3NCMA 5IFJB 4KZDL 1T0PB 5E4IA 4LPVA 2AQ3A 3KPQA 2AS5M 3QUYC 4ODTL 1QHOA 4Z5RA 4NFDA 3MGOB 3H7BA 4W6XB 3LHPH 5K9OB 3K1KC 4PJIE 3T08A 2OL3L 4OF0A 2XTJD 4YDIL 1QLRA 5D1XD 5C0CE 1RULL 5C70A 3ALXA 1R5IB 2IH1B 4KRNA 3BRFA 4S11A 1SM3H 3CDYA 2H9GB 2XN9B 3MRIB 3UYOD 3E3QE 2H32A 1KBGH 4NC2B 3BYTA 3GO1H 3MLTB 1FNGB 1N4XL 4Z7UB 1HSBB 1G0DA 1WICA 1X5GA 4P5KB 1ZSDA 2VDQH 3EO0A 3UJJH 5JOEA 4R97B 5MEQB 4XB7A 3SE9H 4ONHB 5GQBA 4MQXC 1ITBB 4RFEA 5T1DH 1JGUH 3HB3C 3F5WB 5FA3B 5KG9B 1BD2E 4F9LA 3SKUD 3ZKQD 1AE6H 3WUWA 1SEBA 3HS0B 3ROLB 2M26A 3GHEH 5E8NA 4HS6B 1KCUL 3TFKC 3TNMA 1PGRB 3WUZA 3OR6A 1U6AH 2MTPA 2FEDC 5JNYA 3C08L 1QQDA 1HHIB 4HIEB 4Y2DD 6FABH 5C0FB 1ED3A 3GEWB 3SEPA 1DUYB 1F4WL 1PG7L 3D2UA 3QULA 1NCBH 2XZAL 4W6WB 1U3HB 5D6DA 2R2HB 2R0KH 3IS0X 3B9KA 3T4YB 4KK9C 3DX7A 2DQGL 3QZWA 5FAAA 4N0UB 2VDNH 2QHLA 1MRDL 5I19H 1MCWW 3MLRL 4HUXB 3GRWL 4ZNEA 2CIKB 2P5EA 2AK4D 1HZHL 3MGTB 5I0ZA 3UTQB 2J4WH 3G04B 3SO3B 1S7TA 4NQVB 1NAML 3PE9A 4GG6F 5DD0H 5KANG 32C2B 3RVXC 5SWQA 4QXTA 3TV3H 5D1XB 1IAMA 1A7PH 4M61B 2E7MA 2PTVA 1OY3B 2ZUYA 1BAFL 3LAFA 4NUGL 4MNGA 2YD3A 1CFBA 2EYTA 2VLJE 2DYPB 2GQHA 2PNDA 3KNBB 5DRNB 1WBZB 4WHYG 4IJ3C 3GIZH 4HMCA 2A1WH 3KPSE 4P9HL 3IDGA 3F65A 4Z7QF 3M17B 4DN3H 4HMDA 2AXGB 5SX5K 5I17B 3RAJL 3OGCA 1BFTA 4RGMC 1T3FA 5L6YL 2X4UA 2JJVA 2C3WA 1CICC 4OFDA 1U8LB 1AD9B 2YBRB 2PW2A 3I50L 4P5TC 4MLSA 3GI9L 4XP9H 4OQTA 3LPWA 2UWEE 1YUHB 4HXBL 2PTTB 5FECB 4WV1C 3Q0HA 3DRTA 4JPIB 3MV7E 4Y1AE 1P7QA 4J4PA 1C5DA 3DX6B 3MV8A 1I7UA 4QRPA 4KHXL 3LQMA 1C5CH 3V0VA 4UTBL 4OFYD 4Z7WA 2IPKB 4KVCH 5D6CA 3QO0A 1QZ1A 4WI8A 4E9LA 2Y06L 2DIBA 4HX1B 3GMPA 1RMFL 1HWGB 1INQB 2LTQC 4Y2DB 3KG5A 4F7TA 2QQNL 2XA8L 5FM4A 5GGRY 5C0IB 1AGBB 4XC3H 1NJ9B 5KSVA 4GXUN 3QUZC 2CLRA 1K3IA 4PG9A 4PREA 3R8QA 3BPOC 2BHZA 4PJ5A 4U1MA 1CLYL 5A43C 4KMLB 1GHFH 5I8KH 2HFTA 5IFAH 1CLOL 2HVKA 2XN9E 1KN2L 1MJ8H 4B5EA 4F3FB 3D2UD 1PY9A 4Z7UE 3BP6B 4LSSL 4KH2A 3SGDI 2AK4B 3HMWL 2XZZA 1X7QB 2W59A 1OM3L 3WIHH 3B9KD 4EI5B 4MA3A 5DMGD 3FONA 5CHNA 1G7LA 3TCLA 4JHBA 3L3IB 1L6XA 2VB5A 4LVOC 1AGDA 3IFPA 3KPMA 3GGWA 5F6HJ 3WJJC 1MJJA 3T2PA 4EBQH 5FOBA 3G08A 1NGZA 2A9NL 4ZSOA 5LQBL 2P5ED 4Z5RB 3GSWA 1MCDA 5SWZB 3T3PF 1TPXB 3EKCA 2MKWA 3GKWH 4NN5C 1NUDA 2FJHB 4U6HB 4F7EA 3BKYL 1EIBA 3E6FB 1FIEA 2VZ3A 1I1AC 2FGWL 1CFSB 4BH8B 3Q6FB 1MNUH 2ATKB 1JPST 1SYVA 1QPXA 5DUPH 1ZGLP 3HMXH 3EZ8A 4OT1H 2APFA 4XMLH 1G7PA 1V3MA 2AEPH 2I9TA 1QPPA 1KNOB 3BIKB 3FQNA 1RZGB 4LLQB 1OTSD 2D9CA 4GG8A 4M1GL 5TE7L 4N0UE 3QDAA 1IZJA 3EJZD 1IE5A 3QISA 2NY0D 4J6RH 5C9KA 2QJDA 3GFUA 3VFUA 3NABL 4R96A 4KHTH 2F8VA 4Z78A 1S7WB 3CK0H 4XNUL 1CS6A 5IF0A 4KI1A 2VISA 1XZ0A 3ECBB 2CUIA 2W9EH 1SEBB 4L1DA 2VLLB 4MB5A 1KLUA 4TULH 1P7QD 4J4PD 4XTRC 3BEVA 5DRZA 5IB1B 3MV8D 4QRPD 3DIFA 3HC0B 5ILTL 4H20H 4MJIA 4LP5A 5D2NA 5IP4A 1A9BA 1U8MB 1FO0L 2O61A 1QACA 5FKPB 1I8KB 3MQIA 2DL2A 3OB0K 5DYOB 3QULB 4XNXL 3D0LB 4YH6A 5HYFA 4MHHG 4HLJA 2GUOB 2Z92A 5I1CL 1S7SB 4LAJH 4UMGA 43C9A 4PJ5D 3SDXA 3WFHA 3DX7B 3QZWB 1NBVL 4OIIL 3STBA 3BUYA 5D1QA 5T5FL 3BE1H 4TSCL 4OZHF 4FFZL 5AUMB 1BQLL 1CWVA 1N64L 4OQ1A 1PW3A 4L8SB 1MFDH 5DF0A 1X5XA 5JW4R 3QWQB 3HFMH 3RWCA 1S7TB 4LGRB 1DLFH 1FZMA 4PGDB 3IKKA 2FHBA 3WS6A 3D25A 2X10A 4N8CL 1YY8B 5EZJA 2B4CC 1MCEA 2CLVB 3CSBA 4UU9A 2LE9A 4FTVB 3GSOA 5GGSA 5FA4B 1UACL 1JPTH 3K4DA 4N9GA 2AJSL 4X9HA 4XCNA 2EYTB 2AJYH 4R0LC 4P9HC 5GISH 4NM8H 1A8JH 4XVSL 5DD6A 5IJVA 3VXPA 2X40A 3TNNA 5FYJH 2AEQL 2YRPA 4AQOA 2YK1H 2NYYC 4TUJA 15C8H 1KLGA 1QNZH 2NY0B 2ORBL 1AP2A 3ZLQC 5BCAA 1HEZA 3S35X 1O7SA 1YN6A 1P1ZB 5IB3A 5JMRA 4KJWC 1ZLUH 1JHKH 1IZKA 1F11A 2AK4E 3H8NA 5EOCH 3SKOA 4PJDB 2OZ4H 2FB4L 4NFCA 4W70A 5E95B 3WKML 3WO4C 4MX7B 5GGVY 4JZOA 5LXGH 3FKUS 3G5YB 4MA1C 5K9QG 2CDEA 4G43A 3IDXH 3VD7A 1P7QB 3MV8B 4QRPB 1I7UB 2H2SD 3K7UA 1MWAA 1Z9LA 5CZVL 4M6NH 1ZLSL 1UXWA 1NL0L 4HS8H 4XCEA 1EFXA 4O02H 2EDEA 3VD5A 5HYJA 1CU4H 4Y4HA 5SWZE 1IBGH 1RUML 3S37X 4F7TB 5JOFB 4JO1H 4PV8B 4K7FA 5KSUB 2HN7A 4Y4KA 4CADB 1F58H 3BD4A 1TZGH 3RL1B 4KGLA 2CLRB 3PF2A 3OSKA 1Z5LA 4PREB 3FRPG 3QJFA 3THMH 3VU2A 5LVEA 1AXTL 4MJID 2ZJSH 4N68A 4YDKH 5HHOB 5EBWA 1WC7A 5JHDA 5HDQH 2C3XA 3MLWH 4Q0XH 4Z0BL 4YC2B 5GS3A 2AK1L 3LN4A 3QPQC 4P2OB 1QEWA 3TYGH 4WI4A 1MAKA 3QWOA 1MJ7L 3ULUE 3BRDA 5SX4H 4P4KC 1U8NB 2H26A 4OFVA 2N4IA 4MXWL 5GS2D 1U58A 4HWEL 4G6KH 5CHNB 1G7LB 5DQJB 5FYJE 1KIRA 3VGFA 1BBDL 3BKCH 5DZLA 1WZ1L 4ONOA 3WDHA 4B7LA 4YGAB 3IFPB 4CVXB 1OARL 3GGWB 1TETH 2XZQH 3R0MA 3EYVA 3S88L 2E9JA 1LEKA 4QHUA 4HWNA 2FHFA 3SGKC 5B21A 5I1KL 5AG9A 1S7UA 1IAKA 3IU4L 4Z8FH 3GSWB 4NQEA 4BFEA 4MS8D 1ZVHA 4MGXA 3V0AC 5DJZA 1RUAH 3RVVD 3SGEI 3GBLA 4XVTH 4OZ4A 5C07A 5IVZB 5IJKC 2IQ9L 2IEPA 4KJPC 2GIYA 5I1DB 1AH1A 2VJXA 3MLZL 3QPXH 3GB7B 3I75A 3V7MA 3UDWC 2P5WB 4KQ4L 5IW6A 3AGVA 4ESKA 4ENEC 2GT9A 1INEL 3MFFA 3RI5K 1DSFH 1HXMB 4MAUL 1G7PB 3DBXB 2I9TB 1T89A 1YNLH 2AGJH 3FQNB 3RJDA 2I60H 2E3VA 5HI3C 1TFHA 4G80A 2XQYK 4JDVA 5D7KD 1ZTXH 5HI4D 1NKRA 2ZCKL 4NJAL 4R96B 4ZUSA 4ZNEE 3QNYA 4RWYH 1U2HA 4N5UA 1RZKH 4FZEL 4MNQB 3MCG1 5CKAA 2AXFA 1NAKH 1B3JA 1AKJA 1HH9B 1CLZL 3O3DB 4TUKH 1KLUB 2QKIA 3BEVB 4HAFA 1IKNC 4YUEH 3HI6H 1I3RA 2HT3C 4MJIB 4RGOH 4FTVE 3QIWD 1MHEA 2BRQA 1U95A 3VDCA 1A9BB 1D9KB 2Q20A 3N50A 3IJYA 3HE7A 2HJFB 5JR1H 2O61B 1JV5B 1RIUL 3HE6B 1EFXD 4ELMA 4OJFL 4Y4HD 4ZAKA 1XGQB 1M7IB 1LDPL 3PXHA 2NPLX 4Y4KD 4HUVA 3QHTC 2X4TA 1J18A 3E1F1 3SDXB 3WFHB 4WRLA 4F2MA 4OFKA 5JHDD 4YHPB 4MJ6A 1EA9C 3S96B 5IKCA 1V7NL 4KUZL 2C9AA 4QOKB 3BN9C 2JB5L 2FX7L 4U1IB 4HZAA 4PJDE 5BVPH 4S1RL 4HK3J 1DE4A 4OLVL 4GAGL 2G60L 3OAZK 1QR4A 3DTXB 4ERSH 2VLRA 4LRIA 3D25B 3QXDA 4MJ2A 1K4CA 3MV8E 3MGAA 4QRPE 5IR1A 2W92A 1FYHB 3PP4H 5DWUH 5D93C 4ZFFB 1VACB 4WU7A 1ORQB 2OQJB 3V5DA 5T3ZD 2FEEL 1VGEH 3GSOB 4U3HA 3QUMB 4N0RA 4Y7MA 4XHQA 3RWEA 1UWEL 4IIQC 5F7HA 1U42A 1VEMA 3BPNC 4AENA 1H3VA 25C8H 5INCA 3DVNA 1BBJA 4MCZA 4X7SH 5C07D 3VW3H 1TQCC 5C0EA 2AJUH 5HHOE 5DFTA 4WFFD 1A64A 1T20A 4Q74A 2YSSB 4TUJB 1DVFC 4I77L 3ULVD 3G9AB 5CEXA 1AP2B 3O3AA 1CD1B 1HEZB 3O2DA 5ICZA 5C0RH 4I3RH 2R23B 1S8DA 3RWHA 2UY6A 4GG6B 3CX5K 3MBEA 4WNQB 1J0ZA 2VZUA 1CFQB 3FAXA 3F12A 3VFOA 5J6GA 2X89A 4OZFB 4O00A 4G43B 1YJDC 1T0MA 4LGPB 3B9DA 5GRVL 1LE9A 2B8OT 4HKXB 8CGTA 4F58L 5DJ6A 3QIWB 3L3JA 2A0LD 3MCLH 1UXWB 4XCEB 2LVEA 1NDGA 3LHPL 4JGMA 2VUYA 4ONGH 4RX4A 2ENYA 1HHJA 1AKJD 2DD8H 5CIPH 5SWSA 2HN7B 3IDMB 5FYLL 3U9UB 2P7TB 2LVCA 3GIVB 3QJFB 2XFXB 1U8JB 1SM3L 2NY5C 1WC7B 4AZ8A 2P5WE 5JHDB 1UG9A 3HE7D 3QEUA 4YFDB 3O6MH 4ZAKD 4CDHA 1KBGL 2DKMA 3QWOB 4OGAD 2NY6D 4U0RB 1BLNB 3RIAK 3FQXA 2H26B 2VMFA 3M8OH 3SE9L 4IRJC 3QUMH 1C7TA 3SE4C 5JHLH 4Q7DA 5T1DL 1JGUL 2ZPKH 2BY3A 4KU1A 5C6PB 3QUXC 1S9WB 1S7UB 1AE6L 4MNQE 3ARFA 2DQTL 1GXEA 1IILE 2VLRD 4Y16C 5C07B 3WEXA 5J13C 1VB9A 1H5BC 4MJIE 5I75B 4PTUA 5TQ0H 3Q6GH 2R9HD 4BZ1H 5TF1H 4PJGF 4M1CD 6FABL 5IW6B 1BM3H 1FLRL 4FMFA 4RMTA 2D9QB 4AIZA 3P4OA 3D0VB 1NCBL 4EQ2A 2GJ6A 4QTIL 5K93A 3SDAC 2BNUB 5CUSH 3MUZ1 4OZFH 3OXRA 3SDXE 1BOGA 12E8H 2PYFB 3JV6A 1K85A 2QSQA 1EZVY 5A3ID 3QQ9C 4KROC 1EEZA 5I19L 5F8QC 3RX7A 1CYGA 3AY4A 3OXSA 1CK0H 4XHJC 1ND0A 4QOKE 3BO8A 4NNXA 1KIQA 3JTSA 1L9MA 4X6CA 2OS7A 2J4WL 4JG0L 1FJ1A 3ARVA 4YO0A 2VKXA 1MAMH 3MBED 3PGCA 1NCAH 1J0HA 2X89D 3OKMB 5DD0L 5IB2B 1WTLA 1T7XA 4GBXA 1KIPB 1HI6A 1NMCB 3ZKXC 1A7PL 1I3RB 1EEUA 3A6OA 4Z77B 2VITA 1OP9A 4KRMB 1NCWH 3TT1H 1VFUA 2VQUA 4WHTA 4ZAKB 2JCCA 2MCG1 2D2OA 4RX4D 3V4VL 4GT7A 3GIZL 2A1WL 4CN6A 2ZCLH 5SWSD 4OFPA 2AERT 4U2YA 1IGYA 2XPGB 4POYA 2UVEA 4F9PA 4DN3L 2QSCH 4ZS6D 5T1LB 3ZT6A 1MY5A 3ZE0E 5DS8A 3TJEH 3ZMRA 1LGVA 4MJ6B 2WWKO 2QR0B 3LPFA 5I18H 3Q2CA 4ZUTA 4YHIB 3KR3L 3GSXA 2Y36H 4XP9L 3NCBB 1YEKH 1WIPA 1DJSA 5GSRA 4RRPG 4GG6E 3TN0A 3FFDA 3B8SA 3SKJL 1NCNA 3EO1A 2UY7A 1BHGA 1B4JH 1KCSH 2EDLA 5CBAA 1VFBA 2WW8A 3AM8A 1BX2A 2H45A 1PG7X 2VLRB 5ITFB 1C5CL 3EJYD 3EFFA 3VMPA 1KPVB 5I73B 1X5ZA 1WZLA 4KVCL 4E5XB 4BQBA 1RK0B 3KS0H 2C5DC 3QCUH 3RWEB 1DLHB 3EDEA 2Z31B 3NBNA 2ITCA 5HYEA 4M3KB 3PXJA 3ARFD 1MRCH 4J3XA 4P23A 3MC0A 4RISL 2VLME 4YQXH 1AXSB 2GW5A 3HZKB 1DQDH 5JHDE 2AXHA 2R2CA 3CGTA 4B50A 3U0PB 4U1GB 5F71A 3T8XA 1MJ8L 1JF5A 4S1DC 2GJJA 2D4DA 5C0NC 1BZ9A 1UJ3C 4K8RC 3DOSA 2GJ6D 1EO7A 1E4KC 1VADA 2BNQA 3FO9A 4W6YB 3WIHL 5EPMA 3MBEB 2NNAA 5J9PA 4OCNC 4CU8A 1GAFH 2L4OA 4F7PA 4YK4B 4D8PA 5HYQA 4YNYB 3PV6A 1TQBB 3SDCA 5CP3H 5HPOA 4EBQL 1FNSH 3IAQA 3ESUF 4M6MH 4P3CH 4YGVA 4RAUA 5T3ZE 5EN2A 3BD5A 3JV5A 3TGXA 1UKQA 4GMSL 4APQA 2YN3A 4FXGA 4XX1E 2P43B 5EBGA 3GKWL 1HHJB 1V3JA 4ORGA 5C07E 3MLUH 1U8QB 4GBXD 3EYUH 3RPIA 1BREA 4X6BA 3T2QA 5D8JH 4MVBD 2EXWD 4JN1H 4R2GD 3U4EA 3QEUB 5DUPL 1JNJA 3HMXL 3EIFA 4XMLL 3RDTC 5DJXB 2DQEL 2AEPL 5I71C 3CFIC 2YPVH 1KEMH 3KPOB 4FQLH 3RY5A 3B43A 2YC1A 4HT1H 5CWSA 4Y8DC 4JFXB 3QDMA 2FIRT 2FDBP 2X7LA 1FORL 2DM4A 1ACYH 2H6PA 2XNAA 2J2ZA 4KHTL 1UADC 1YQVL 3D6GA 3NTCL 3T3PE 5DR5H 2JTDA 4M8VA 1ZLWH 2R0WH 3CK0L 1U93B 1Q94A 2ED7A 5I1EH 1EHLL 3TN0D 1I9IL 3EOAA 4MAYC 5DI8B 4G5ZH 3VWKC 1MFBH 4H20L 4PJEF 1PEZA 1MCNA 2A6IA 4G9DB 4JG1H 3IXTA 3RWGB 4CVZA 5DDHA 1H15A 4QHLA 4I18A 1T7YA 1UEMA 1XF5A 1OP3K 5HGAB 4R7NA 3RGVA 2PN5A 3ILPA 4NO0A 5GGTH 4AIZB 3P4OB 1FL3A 5F3BB 2N1KA 4XVUC 1H3UA 3EHBD 4P23D 3OL2A 3T1FA 3LQAC 3DV6B 4DKEH 3EOYG 3L5WB 3QXWA 3EDJA 4PY8I 1JZ5A 4RMUA 5L0QB 3C6SB 5AD0A 4JKLA 3CFDA 1ND0B 3EFDH 4LPTA 4I13B 1JUFA 1KIQB 1NFKA 4X6CB 3QHZH 5F88B 3SJVB 1T2QH 2HLAA 2WIMA 4KV5F 1DLFL 5AYQA 3PGCB 1JFQL 3JXAA 4XWOD 2VLRE 4JRYA 2CIIA 1RUKH 5CJQH 2ARJQ 4LHUA 1M7DB 1MVUA 3SDCD 3PUCA 3ET9F 1DBJH 2HYMA 1ZLVK 4GRMA 1JIBA 1G9MH 3G6AA 5FGRA 1NH6A 1JPTL 1VFAB 2B1AH 4X6EA 4JHAH 4R2GB 1JF1A 1KENH 3FOMA 4PGZA 4JLRB 3MJGX 4APQD 2JCCB 1HXYB 1MFAL 2E9WA 1QLEL 3QEQB 4GKOA 5GISL 1S7RA 2FBOJ 4NM8L 1JYWA 1F4AA 1I3GH 1FFRA 4JPVL 2YK1L 4P5MA 15C8L 1KGCE 1BQUA 1TIUA 1QNZL 3QEGH 3K8LA 3L1OH 2KQMA 1CDUA 4ZQKA 2OZ4L 3TJHD 1FYTA 2VKWA 3DO3A 5GSRB 3TN0B 1TVDA 3EO1B 4HUMB 3TZVB 3MA9H 3MCKB 1YPZA 4ZO9A 3IDXL 1XR8A 4AH2A 3QDMD 4OCSH 2IAMB 1FRGH 1Q9LA 1T83A 2VE6A 4ZPVA 3EFFB 4M6NL 1EZVX 3BAEH 3EJJX 4O02L 1CU4L 1IBGL 4JM2A 1L7TH 4EDWL 5FFLA 1PLGL 1AIFA 5K59F 3GSRA 3UBXG 1F58L 4OKVA 1TZGL 1BVKB 3LCYA 4Y19B 1SY6H 2ZJSL 4YDKL 2D7OA 3PL6B 4PG2A 1AJ7H 1CXKA 1B0WA 3MLWL 5CEYA 1E6OL 1ITCA 3T8XB 4RRPA 3RGVD 1I7TA 4NO0D 1QLFB 3JWOH 3V52H 4XPBH 2R2BB 4EKXA 3FO9B 4U1HA 5E2UH 5EPMB 4N9OB 2NNAB 1ZE3C 5J9PB 4U33A 4ODSH 4G6KL 3BH8A 3BKCL 3TBSB 3P0VH 1OVZA 4WTXA 1Z6JT 3CU7A 3PV6B 1TETL 2J6EA 4IRZH 4KY1H 4TNVK 2VNCA 5EN2B 1YYMH 5FM8A 4UINH 4Q9QL 4WEUD 4QRTB 3IF1B 3VXSB 2DS4A 3H6JA 2K3TA 1WCBA 4APQB 1RUAL 4FXGB 4XVTL 1A1OB 4PRIA 4JRYD 1G6RL 5J1AA 3I6KB 4LHUD 4WFHD 2A6KA 4JY4A 4U1LA 1NC2A 4Y5YA 3OJDA 3RWFB 4ZFOL 4PJAA 3RPIB 4C59B 2R0LH 4D9RE 3VE0A 4LAQH 3HZMA 5LBSL 4CJ0A 5C3LD 3U4EB 3KYOA 3MNVB 3FFCB 4JPWH 5IHZB 1FV1A 1NGQH 3GSVA 1UKSA 1DSFL 2HTKD 5C92A 2ICEA 4KKCD 1FIGH 2OI9B 4MMZC 2I60L 2YC1B 2ZCHL 3NACL 1MFCH 1S9VA 4QHKI 1E4JA 5GSVB 3L3HA 4Y2DC 4O9HL 1F3RB 4PJBB 1ZTXL 4QT5A 4B0MM 1T2XA 1PZ5A 3MUGB 4BFGA 2PCPB 4JZNA 4RWYL 1WEJH 1WT5C 3RUGA 1GPOH 4O58H 4X6CE 1FYTD 1S5IH 3SJVE 3AVEA 2P24B 2ATPA 5K9KA 2OX5A 3HAEB 4TUKL 4ZFGH 5C9JA 4JY6B 4YUEL 5FO9A 2OJZH 3HI6L 1OW0A 2A6IB 3QEHB 4NQTA 4RGOL 2OLDA 4L4VA 4YIQA 3MODH 3DX9A 3IAPA 4LK4A 4QHLB 4I18B 5JR1L 2HLFC 4ODUA 4HUWA 1LILA 3TLRA 1EV2E 4JM2D 4EI5C 4R7NB 5J1TC 3VRIB 4DUWA 2JCCE 3JSSA 1Z9MA 3QEQE 2CR3A 1S5HA 4NO0B 1EO8H 3QXAA 2ZG3A 4JKKA 1FL3B 1HILA 3KHOA 4OD3H 3UJTL 5DUBA 5D7LD 3QA3A 4LNVA 3U46A 1FVEA 2XKUA 1EUTA 3PNWA 2WIIB 1OWRM 1TPXC 5L8KB 1SVZA 5AD0B 5DD3H 3CFDB 3IKCA 1A3QA 5BVPL 4PGJA 3AXLA 4GRWB 5E6YA 2IQAA 4NDMA 4PJ9C 2HKHH 4Y88A 1WAAF 1IC4H 2BXZA 3SY0B 4UNTA 2CIIB 3IU3A 5DWUL 4LHUB 4PJGB 4DN4L 4LF3B 1VGEL 4GRMB 3Q5OA 3ULUC 3AMLA 4OLYH 4KJYA 4M7ZB 3PWJA 3L5XH 4PRDA 1G7MA 1S7RB 1KJ2B 3O3EB 4R90L 2ZKHL 4PRID 4Y19E 3LEYH 2AJUL 2DWDA 3WJLA 1YY9D 2YD2A 1A0QH 3ULSB 1NC2D 1E27A 1UB6A 4ZUVB 3QCVL 2AKRB 4F9LC 3LRGA 2R0ZH 1MH5A 4XI5D 5C09A 4E41A 3DRQB 4I3RL 4YDLB 5MENA 1B9ZA 2V2XA 1J1XH 4TNWF 3R0NA 4ZQKB 3OB8A 3HAEH 5JXEA 5ANMA 3OKOA 4HZLA 4ZNCD 3LB6C 1GVIA 2B5IB 4HLZG 2KBGA 1YPZB 4XCYB 3LKOA 3E6HA 1Q9LB 4ZPVB 3D85A 1R5WA 3ZSTA 3A0OA 1HK6A 4HJGA 1OQOA 4LKXA 5FXCH 2VXQH 3KYMA 3VXSE 4JM2B 1JGEA 5EU3B 4KUCF 2DD8L 2EO9A 4V2CB 1CD0A 3TBTA 3GSRB 1BJ8A 2LU7A 2X4OA 4OKVB 2EH8L 4C54A 2Q86B 3WL9B 5D7LB 4K71B 3QRGH 4L8SC 4L4VD 3BW9B 1RD6A 1FHGA 1X5KA 3KPPB 4IMKA 3FFCE 1IGFH 1I7TB 1A3RL 5H35B 1WWWX 4P4RB 4GW4B 1CG9A 4LVNB 4WTWA 4X9IA 1FPTH 4U1HB 4JN2B 3M8OL 1AO7A 5EU7E 3Q48A 1CL7I 4G3YH 4PJBE 5JQHC 5EDXA 3ULVF 5DEZA 2ZPKL 5CS7A 1LK3L 2P8MA 1AQKH 1V7MH 1OTSC 3BN3B 1KJ2H 3EW3B 5C7XL 2NW3A 1OSPL 1WCBB 5DFVC 4WI2A 1T4KB 1DTUA 3OKDB 1HYSD 4XP1H 4KTDL 5J1AB 2GITB 4H0GA 1OCWH 1JCKA 3I9GH 4W4OC 1O0VA 4NPYA 4IS6B 4OZGA 5TQ0L 3T2NL 4BUHA 5IOPB 5TF1L 2XRAH 4QYOA 2GSGA 4I0PB 4RMSA 1BM3L 4KKLC 1ES0A 1FNAA 2C1PA 2HRPH 3JBG7 4HK0A 4PD4J 5E2WL 1FV1B 5JTWA 4YXLH 1M6OB 4UV7L 5JUEL 2ICEB 3K80A 4I9WD 3UYRH 3CVHA 3U36A 12E8L 2ZSWB 1R3LB 1I8LC 4LQ1A 1GIGH 1Q72H 5I15H 5IM7B 5FUOH 4ELMF 4JPKH 1RZKC 2MJWA 3TIDA 5B4MC 5FB8B 4E41D 3GKZA 4JZNB 1FFNB 5I8CA 4GRWE 1RJZA 2YEZB 1A6TB 5ENWB 5JXED 3RY6A 1FNFA 1NCAL 4LVHB 2EKSA 5K9KB 5FM5M 4LLWB 1FC2D 5C0GA 4P2OC 4WI7A 4PJGE 1LO2H 3ZTJH 1HKLH 3D85D 4JRXA 1ADQH 4YIQB 5BZWA 3DX9B 4ZXBC 4XXCA 1YEFH 4JFOA 4BH7B 3IDUA 2VSCA 5BS0A 3FO0H 3PV7A 4I48A 1S5HB 3NAAH 1F5WA 2ZCLL 3GSNB 4FQIH 1EJOH 3G5XA 2QSCL 4HK3N 3TF7C 2A6JA 2A9MH 3UP1A 2EC9T 3FT2A 2R1YB 2WAHA 4M5YH 4O51A 3IKCB 4AJ0A 2APBA 3LKRA 4RA3A 1AHWB 3LN5B 2EDQA 3P30L 5C0BA 4R4ND 1KCSL 3DO7A 2Y5TB 4PJEB 1YPZE 1OT1A 3NZ8B 1HINH 4FQXB 1AO7D 5DD5H 2YD7A 3EYFA 2EDKA 4M8QB 3DROA 5TF0A 1NFIA 3EOBA 5F7EH 3QCUL 4MCYB 1SJVA 3R06A 3VGDA 4KJYB 3PWJB 1MLCA 2BERA 2JK5B 1MRCL 3FZUD 1G7MB 1YN7A 4NUJA 1JBJA 1EHXA 5FUZH 1YEEL 3C5JA 4NKOB 1FGVH 5D7LE 1R3IH 1NGYA 3VH8G 2BY2A 4NBYB 3H42L 3NCCB 1MI5A 1IGJB 3H3PH 1E27B 1KT2A 1F02I 2D4FA 2H3NA 5DJDA 2MMXA 3K8KA 4PTTA 1CR9H 1R0AH 1MH5B 3NCYS 4LLDA 3UPAA 2V7NA 3MYJB 2X6MA 5DVLA 5D7JC 5IG7A 2EDJA 2YKLH 3NGBC 4I5BB 4LCIH 5DTFB 4M6AA 4H1LG 1D9KC 2X4RA 5KANI 1GAFL 3HNSH 3HE6C 2K1MA 3O3UN 4PJXA 5JIHA 5FDWB 1G1CA 4M6ML 3ZE2E 1MQKL 1R5WB 4RMVA 3GUTA 1RFDH 4YHOH 3VFWB 1S7QA 1J0KA 1TLKA 3S4SG 5DHYA 4LLAA 3GSNH 1JGEB 1K8IA 1B2WL 5JORB 3M45A 3QFJB 1Q9WA 2P47B 3X13A 3MLUL 1AR2A 3TH3T 2GFBA 1Z9SA 1K2DA 1L0XA 3MBXH 4XVJH 1JNHB 4JRXD 4G6AD 5L88H 5DRWB 4JN1L 2XICA 3E8UH 1BIIA 3OJVC 1PZUB 3TBWA 1J1OH 2B1HH 4UIMA 2G2RB 1SYSA 2C3HA 5BS0D 4OF3A 3O41A 3MROA 2Q6WB 1KEML 3RZCD 3SHSA 4GMTL 1P2CA 3ARXA 3ZZ1A 4HT1L 1BPVA 2JKXA 4ZOAA 2MQ0A 4MA8L 1P4IL 1P53A 2NZ9D 5CD3A 1ACYL 5I74B 3U0TA 5DR5L 5EO1A 4MB3A 2YRLA 1IARB 3HKFA 4FMKA 2EDOA 5I1EL 4RCAA 1N6VA 2YXFA 2YHGA 5C0BD 4EN3D 5B8CB 1H3GA 5JLZA 4DTGH 1DN2A 1MFNA 1MFBL 3O8XA 4OSUH 1KB9J 3VFNA 4NPYB 5HXMA 4OZGB 3X3FL 5F7NC 3FMGH 1KEGH 4JFEB 4QYOB 2GSGB 5IK3A 2FBJH 1A9EB 2C1PB 5E8OA 4N1HB 4HPYH 2OTPA 4WI9A 3ARGB 2GKIA 3QIWC 4DKEL 2I24N 3CVHB 1I85C 1NDMA 1MI5D 1A6AB 3UPRA 3QDHA 3MRBA 4OQTH 1UWXH 3DHMA 1D5BB 2COQA 1H8NA 2V5SA 1I4FB 3F7YA 3PWPB 1UENA 3TIDB 1A1NA 4XRCA 2GTZA 4QNPE 3A6BH 5I8CB 3QHZL 5E8EB 5FGSA 5EORH 5KSAA 5BJTA 4PJEE 3P4NA 4HF5H 1F6AA 3DV4A 5HDBF 1DBJL 3ZKSD 2DF3A 1G9ML 4EVNB 1ZVSA 4U0RC 2MPAL 5EH1A 1HCVA 2B1AL 3WS3A 3ZDZE 5GGRA 1XGUA 1IGTA 4JHAL 4OF5A 3RWDB 3W9DA 4DFHA 3RNKB 4OM1H 3QUYA 4JFOB 2CK2A 5BS0B 1ZEAH 3DLQR 2G9HB 3H9ZA 3RZCB 4JKMA 1CTOA 5D96B 4LDLB 1I3GL 4DJMA 4OLXL 4X9FA 4WENB 3FB7A 4YHZL 4OLZH 3CLEH 4OGXH 3QEGL 5GS0H 1BFVH 1UCBH 3P73A 1SJEB 3FT2B 3L1OL 5J7CC 5KW9H 1FDLL 4O51B 2L0DA 2EIDA 1X3DA 1T2JA 3P77A 5I1LB 2JJSC 1NBZB 3MREB 4NT6A 3LKRB 5I75C 4Q9CA 1F97A 5C0BB 1QBAA 4EN3B 3DO7B 3MA9L 3BWUC 4J12A 4MQTB 4OCSL 1FRGL 2CKBB 5KN5A 2GCYA 3WNNA 5IV2A 4L29A 4HMEA 5B3NA 1IGCH 1ZT4A 3EOBB 3O9WC 2LU4A 2W0PA 4EIZC 2YA2A 5JXAH 1A7OL 1AGFA 3WV0A 4MD4A 1MLCB 3QFJE 2JLLA 2HA1A 4G6JH 1YN7B 2EC9U 5ACZB 4X7CC 3O8XD 4HQQL 1NGYB 3I6LE 4YPGA 1MI5B 4XNYH 1CGSH 4OIAA 1KT2B 2G5BA 4UDTA 1UWGL 1OP5K 3BVNB 1K8DA 2BCKB 2V7NB 3D3VB 1A3LH 4GQ9L 1NMCC 3NCFB 4ZO6A 4KKAC 4OTXH 4DUXA 3CFKA 1D6EA 2X4RB 1FN4B 2BOCA 3P0VL 2B2XH 3ARRA 1VPOH 4LU5H 2VUOA 3N0PB 4NSKB 4IRZL 2UYLB 3I84A 4KY1L 1UH3A 3GUTB 1B88A 1P69B 4UINL 1S7QB 5J1SC 5KSBA 5KZCD 5DHYB 4P59H 3QIUB 5IB5B 5KSAD 5GZND 3HNVL 4ZOEA 3QIBB 3VH8A 3D18A 1EEYA 3VFRA 4PD4K 4OAWA 4G6FD 3DUHA 4OZGE 4XPGH 4YHKH 2DMBA 2RIKA 3QQ3B 4JFEE 4P2RB 5DT1H 4NKMB 1BIIB 4PJHA 4JPWL 4D3CH 1L4IA 1NGQL 5TDNB 3QUYD 4H1LA 4LRIC 1SYSB 4R26H 3KJ4B 5IQ9A 4NOBA 1I1RA 4XWGH 2A38A 3O6KH 1J87A 1FIGL 3VFMA 2VXTH 1P2CB 1QBBA 2HG5B 2CKBH 2NXYC 2X1QA 2R9HC 5FGBA 3TO4B 1CFVH 1FFPB 4M1CC 2Z31C 5CD3B 1WFTA 3IFNH 3ZT5A 2HKFH 2X4SA 1J8HA 1T6VN 1KFAH 5JO5B 3S4SA 2E5EA 4AL8H 2BMKA 4E42A 3PWPE 4LEOA 1WEJL 2AAVA 5EO1B 1GPOL 4J1UA 1NEZB 4NO5B 1XF4B 1FZJA 1MJUH 3JWDL 4P5TA 5E99H 1CCZA 4LBEB 5E6ZA 1GGUA 3NCEB 3AS2A 5A3IC 4J2XA 5ETUA 1F8TL 4CRPA 3U0WL 2XWJB 3UO1H 3RWIA 2HFGH 4GXUM 3CFCH 1JRHI 4JJ5A 3FQRA 2QADC 4MQXD 3DX8A 3HB3D 1HKFA 5BS0E 1EO8L 5KVDH 5C0DA 5L2JB 4YK4C 2QTEA 2HMIC 1ZA6B 4QTHA 4OLUH 3HUJA 3UTZB 3QUZA 3TFKD 4JQIH 3MPCA 1LEIA 2V2WA 1MFEL 3I02A 1PVHA 3UPRB 3FQTA 4NRZA 4LLMA 2FEDD 5IBTH 5HPMB 4HWBA 3CMOL 1U92B 4FNLH 3F7YB 4I0KA 3DGCR 3T0DA 2GTZB 3HPJA 5KZCB 2KDGA 3HC3H 5C0BE 3PIQB 2HKHL 3P4NB 4DOHB 3UXFA 5LGHL 4WHYH 5I1IH 3A6CH 1G9MC 3DV4B 3LY6A 4KK9D 2IG2H 5ABDE 5EUKA 1IFHH 2OSLB 4LMQE 1ZVSB 3ZSSA 4V2BA 3VDAA 1BF8A 2X9XA 4UQ2A 1NFDA 1HHKB 5ESAA 5GGRB 3WJJA 4OLYL 2CXGA 5EO0B 1R5VB 3L5XL 5KVEH 5D72L 4JGUA 1MHPH 3WDJA 4K07A 1JNLH 5B38B 3LEYL 1DBAH 1A0QL 3EDKA 3MR9B 5EIIA 5ISZD 2DKUA 4PJCA 1MI5E 4NCC1 4PB9H 4PBVC 1ZA3A 3WNOA 4C83A 1FAIH 3BZDA 3D69A 2R0ZL 1G0YR 3P73B 4U6XB 5T33H 4R3SB 1I1AA 2APTA 4LPWA 4CMMA 5MHSE 2QV2A 3D3VE 1J1XL 1V8HA 1JYXA 1EVUA 1WFNA 4KMTH 5E5RB 1VCAA 1B0RA 3QB7C 5IGXH 3OHXA 5E6IB 1I8IA 1IAOB 3BEWB 2HFEA 4TUOB 2R8SH 3GSQA 5CP7A 1J8HD 5IV2B 5A16B 1F45A 1V3LA 2CDFB 4G42A 1AGCB 2VXQL 4DGVH 4JDTL 1UZ6F 4N5EC 4MD4B 3LIZH 3MJ9H 4P5TD 4KI5F 1IQWH 3ROOB 5IW1A 4LPUA 5BV7B 3ULVH 5L0QC 3LDBB 1WTGT 5F44A 3QRGL 2YUXA 4YPGB 4P2QB 4P2CG 1VGKA 2G5BB 3G5ZA 3GHBH 4P2RE 2C7UA 4LOUC 3JWOC 4NM4L 1K8DB 2EDDA 4MZ3A 3GMOA 1MCOH 4MSWA 1FPTL 1NKOA 3QUZD 4JFDB 1U91A 1D6EB 2EXWC 4PJAF 4NHUA 3NFPB 3DURA 3LV3B 3VFTB 5F3HA 4BZYA 5IMLB 3ILQC 5HBBA 1V7ML 2DMKA 4QRSA 5IBUB 3UAJC 4PR5A 5H2BA 2D7QA 4XP1L 1JZ3A 3TH4T 1OCWL 3SBWC 5JDJA 3VFSB 2PTUA 5ISZB 2GEEA 3BH9B 5GJTL 3CMGA 1PBYA 1D5IH 4OLWH 4XH2A 2ZUSA 3TN0C 5EU6A 4OI7A 3TZVC 1MCHA 4YXLL 3B5GA 2IAMC 4M62H 4QHNA 4R0LA 4DGYL 1A6WL 4IJ3B 2EDYA 5EBLB 1KYOK 1KULA 2R69L 1GIGL 1Q72L 5I15L 1G7HA 3MNZA 4DKAA 3KWWB 5FUOL 3FO1A 3S36L 1J8HB 4PY7B 2I9LB 5KAQG 1I1AD 4E42B 1S9KC 4JFQB 4K3DL 3MUY1 4ODBD 4OUOA 5E00A 4LEOB 4PGEA 5BV7H 1KTLB 3PL6C 3VXNB 1FZJB 3C5SB 1XF3A 4DOHE 5K9JH 3PDOA 5ICXB 5ETUB 4PGCA 5IMMA 3O4LB 5FGCB 3C8HA 1AGEB 3MV9D 1HKLL 5AYUH 1ADQL 4CNIA 4WW2F 1JYVA 2OM5A 3FQRB 1A6ZB 5GZOC 4U6VL 3AS3A 1YEFL 4U3CA 1MCSA 3NZHH 3MRNB 5GHWH 3FO0L 3V0WH 4K94C 3NAAL 3INUH 5C0DB 3V6ZB 3KPRA 1OWWA 2WBWB 1WWAX 4U31A 3HUJB 2E6PA 4XTRD 4HFWB 1T66C 2DB8A 4YX2H 3H9SB 2V2WB 4X7TA 2WM0A 5GRJH 3RNQA 4NRZB 3EO9H 4LLMB 4APQC 3B9VA 2F5BH 5TDPA 1KB5L 5ADOH 1IEBA 4F7MA 1WZKA 2NY1B 2MCPL 5CCKL 3MRFB 1EX0A 2PETA 1G7IA 4NZJA 5FYKE 4NWTH 4BQ6A 3HC4H 4P4KA 3PWLB 3O45B 5F9OH 1TVHA 1LE5B 3U30B 5EUKB 1PQZA 5D2LA 5F7EL 2SEBA 3REVB 2FZ3B 1JN6B 3WNKA 1XMWA 3SGKA 1T80A 3Q5TA 1D5XB 2DM3A 1QYGH 5EU7C 2OL3B 5FUZL 1JZ2A 3OMZA 4LCWB 1C8PA 3GJFA 3B3IA 1H8SA 1S7XA 2BVOB 4HC1H 5EIIB 3WIFB 4P2QE 4PJCB 1N7MH 5IJKA 5SV4A 4MXVF 2YD6A 3NIDF 3D69B 1A7BA 1CR9L 3NFSH 1R0AL 1KJVA 5DZOA 5EU6D 4ZTOH 4XBPA 5LKNA 3OKEA 2KUTA 4K9EC 3UDWA 4LVEA 1I1AB 2X09A 1GSMA 1QSEA 5A40E 2H2PC 4LCIL 3RPKA 3MJ7A 1B0RB 2BK8A 2ENSA 2VR9A 4JFDE 3LKPA 1I8IB 3HNSL 3Q5YA 4K3EL 4LHQB 3GSQB 5CP7B 3MV9B 3DYMA 4UOJA 2NYYD 4ZS7H 1RFDL 4YHOL 5F96H 3A67H 4PUBH 5MP6L 5F89B 3S3JA 4RGNC 3F7PC 1X5FA 1UQSB 5FO8A 4KJWD 2XT1B 5EFIA 1FNEA 4WHDA 5TJWK 3FCTB 2I26N 3WFEH 5ISZE 3T0EB 3MBXL 4XVJL 1KPRA 1XR9B 2FX9L 5L88L 4HULB 4N1EA 1MF2H 1OAXL 1IKNA 1G9NH 2FLBT 4QCIA 5CILH 3G5ZB 4KMQA 4XC1H 1J1OL 5JW4Q 2IBBA 5J12C 4HIXH 5IMOA 3ARBD 2VDMH 1MPAH 4M5ZH 2VZVA 1N26A 3GMOB 3KPRD 3RL2A 1IL1A 2FIKB 3RTQB 1IAII 3IGAB 4L3CA 3K2UH 5KVGL 4KZDH 4M7ZC 3V95A 4NHUB 1J8HE 1C16A 4AEIH 1W0YT 5F3HB 1A4JA 4P48A 1C12B 5I1AA 3QPQD 4JFYA 3Q1SH 2BSRA 2GJZB 3HI1A 1BEYL 4QRSB 3QH3A 2OYPA 4DTGL 4NHCH 3TBVB 3X12B 1Q0YH 1P9MA 1NAMB 1RULH 3O4LE 5FGCE 1DQJB 4OSUL 4P4KD 4NP4L 2ICWA 3KLHC 1N6UA 1C5BH 4YXKL 4JDZA 1JGDA 4YDLC 2WP3O 4KPHH 2BVEA 2NXZB 5EC1A 1CE1H 1KEGL 4Z7VA 3TEUA 5SV3A 4HDIB 2B5IC 2H8PA 1N4XH 1GJIA 1RZJC 2DQCH 4IIQA 2O5YH 1PYWA 4QHNB 1DCLA 3ZT7A 1CFNA 1A2YB 2V6HA 3HUJE 5GGQL 1N5YH 3H9SE 1A21A 2NX5A 5CGMA 4HUUB 4OQTL 4U6YA 4KJPD 5KVMC 3MNZB 2FH8A 3IDJA 3LQZA 3UZEA 3WSQL 5LJYH 1DVFA 1QSED 3A6BL 3GK8H 4PJFA 2P46B 4ENED 3BX7C 4GUPA 2Z93A 4K71C 4DEPC 5GGUB 2ZUXA 4YEEA 1KCUH 3G6JF 4KJQC 1XF3B 3PDOB 2V5RA 3WO4B 3W2DH 4D94A 1LP9A 3S97C 5HI3D 2VC2H 4MA1B 1P7HL 1BFOB 3DETC 4CNIB 4QO1A 4HUNB 5E08H 2NY3D 5DHVH 1R3HA 1F4WH 4EDXA 4F33B 5HHXH 3C9NB 4UT6H 4OM1L 2KKQA 4ZUWB 2XZAH 1F13A 3ARBB 1ZEAL 1ROWA 4M93C 3EYQC 4LCWE 4YBQC 2ILLA 4OGYL 2DQGH 1PKQB 1H3WM 4PJCE 4OLZL 3CLEL 4OGXL 5BMFH 4JO2H 5GS0L 1BFVL 1UCBL 4WUUB 4X7TB 3GRWH 4YHNA 1CL7L 2FD6L 1JP5A 1HZHH 3IVKB 1A6UH 4BSWB 1IEBB 1A7QH 1Q38A 2YPKA 4L3EB 1FZOA 4CMHB 4I0PC 1UH2A 4P4KB 4XI5C 3MV9E 4FFVC 4IRJA 1IGCL 2SEBB 3SE4A 1X4YA 3BN9D 4PLJC 3DGGB 4ZOBA 3U9PH 2O26U 4DKDC 3QUXA 4G6JL 4KC3B 3V6BR 2Z91A 3MRRA 5DA0B 4XZUA 3KPNB 3RAJH 4NNYA 4PJ7F 3GJFB 3B3IB 3T0EE 5L6YH 4Y16A 4HKJA 1CGSL 4BSJA 5E9DA 1TTUA 1DQTA 3FB5B 3MXVH 2DOCA 3IRZA 3QJHA 5BXFA 1FBIH 3GI9H 4XBPB 3OKEB 3F7VA 4AQ1B 1H3TA 1QSEB 4HXBH 5DURD 1A3LL 2XZCL 1QFOA 4OBRA 4LSVH 3WE6B 1YNTA 1NGXA 3HR6A 3MJ7B 3SDAA 3N1GC 4KHXH 1TJGH 4J3OC 3LKPB 2NX5D 2B2XL 2MSPA 5GRUH 5F72S 4X5XB 3FT3A 2ZNWA 2Y06H 5C0AB 3U7AA 2NY3B 1DVFD 2NY4B 2QQNH 4WWKD 3JZ7A 1NLDL 4P59L 2J12B 2PYEA 5AAMA 1XGTB 4CN4A 5HVFB 5DK0A 5EFIB 5F6HI 2B39A 5D1ZD 2P8LB 2L7UA 1CLYH 4U1JB 2D7MA 4CJ1A 2R1XA 4LSTH 4YHKL 1CXLA 2ZUTA 1AHWC 5DQ9A 5DT1L 1FO0B 3PABA 4QCIB 4D3CL 2F53A 4Q6IB 1LD9B 4R26L 5DC4B 4FQXC 4XWGL 1BZQK 2VXTL 1TVBA 2IH3B 3LRSB 3NVQA 1B90A 4HHAA 2FGZA 1CFVL 1NUFA 3IFNL 4PLNC 1KFAL 4LGSB 5E2VL 4AL8L 1C16B 3LEXA 3ISWA 4JZJB 4MWFB 2BVTA 4PJIA 3S5LB 2DM2A 1MJUL 3MRPA 2BSRB 3P4MA 5IVNA 3HI1B 5EWIH 5HHMB 1QR1A 1A14L 4X99B 3NN8B 5I1HL 2HFGL 3MRDB 2ICWB 4OF7A 4JDZB 1UM5L 1JGDB 4ODVL 3VFPB 2KZ1B 4IRJD 4XBEL 3B9AA 4Z7VB 3QNZB 3RA7H 5JA9A 2H8PB 1A7RH 1ERNA 5KVDL 1PFCA 1QFWI 1ZANH 5DURB 1B0GA 1PYWB 4M1GH 1PKQE 5TE7H 2V7HA 1HH6A 4OLUL 4JQIL 2AABL 1YEJH 4HH9A 4Y16D 2VXUH 3EZJB 1TQCB 2NX5B 2GK0A 4WUUE 2UZYB 5E9DD 5E56A 3QT2A 4ODXA 3L3DB 4X5WB 5CJXC 1BD2A 3LQZB 4FNLL 1I7ZB 2AW2A 2F9BT 1DVFB 4OD2B 1T22A 5ERWA 4WWKB 4LIQH 4PJFB 2EH7L 3HC3L 3QWRA 1MWAL 4IMLA 1UJ3A 4L3EE 1X5AA 3SDAD 1MLBA 1E4KA 5E8DL 1MRFL 2X70A 5D1ZB 4JVUA 4YE4H 1FZKA 2Q8BH 5HGGS 4PRNA 4CW1B 2IG2L 2VIRA 1FO0H 4YBHA 4DZBB 4GAYA 4KROD 2VSDA 3SCMA 3VJ6A 2WBJC 4EDXB 1R3HB 3ZDYE 5KVEL 1K4DA 2DQUL 2PYED 5ELIA 1MHPL 3ZYOA 5I1CH 2J1KA 1JNLL 4FA8A 5I74C 5F7WC 1GRWA 1DBAL 1EK3A 4LSUH 1NBVH 5CEZH 1K3ZA 3STLB 5T5FH 4PB9L 3PP3H 1BQLH 3QQ4B 1N64H 4LLUA 4CUCA 4XPAH 4ZFZB 4EOWL 1IKFH 4ZD3L 5B8CC 1Q1JH 2F53D 5ICYB 4XPTL 3C09B 3ARQA 1JK8A 1QSEE 4G7YH 4KMTL 1VKXA 1KG0B 3RDTA 5IGXL 4RBPK 3BP5B 2NW2B 4NJ9L 5T5NG 2Y6SC 2CPCA 1OOAA 3SGJC 5HJ3A 2R8SL 1GGCL 1M7XA 1YA5A 4WW2B 1L0QA 2AJSH 4P3DB 2A6DA 1A6VL 1U2CA 2VLJA 3I6GA 5C0AE 3MRGA 3F62A 4DGVL 3ARGC 1EBAA 4LMQI 3LIZL 3ZKMC 1IQWL 4XVSH 1ONQA 2Q7YA 3GJFK 4RDQF 2VZTA 4NQUA 3ULVL 3EGSB 3FN0L 2HFFA 3MRRB 4MAYA 4XZUB 2GSIB 4NNYB 3VWKA 4R4BA 4Y5VB 3PWVA 4YFEA 3T3MF 4PV9A 3K4AA 1OB1A 2D0GA 2UWEA 3KXFA 3OX8B 5TGBB 4RMRA 1MCOL 1CE6A 4Y1AA 3UC0L 3WLWC 2UUDK 5F7FA 1NANI 3ZKNC 3BDXA 4G6AC 4QHMA 2YWZA 4JAMA 1RZFH 1SJHB 4KXZI 5TE4H 5CZVH 3D1MC 3RGHA 4EZMA 1J12A 4TN9A 1ZLSH 1QBLH 5L7XH 3MGOA 3H2WA 3MA7B 1R24B 1BD2D 3RZCC 2MKLC 5E0QA 4LCCB 5K9OA 4X6DA 5D96C 2XQYG 1M1SA 1NMAH 4S1DD 1ZT1A 3GI8L 1I3VA 3QWRD 2VDRH 4KAQH 4K8RD 3S8WA 3TIEA 5DK0B 5HHME 3DECA 1KCRH 1AXTH 3LD8B 2IH1A 1OTUC 2C4FU 1VSCA 2XN9A 3MRIA 2IPUG 3SCMD 4Z7VE 5DQ9B 3MLTA 4Z7UA 1FNGA 3OAYK 4N0CC 4EN3C 4DCQA 2YXMA 4P5KA 1MJ7H 4M62L 4NCDA 3JTTB 5HTSA 3ZDXF 2H1PL 5MEQA 1U3JA 4MXWH 3CDCA 5DD1L 3CZJA 4PJ8A 2JJUA 2F19L 1XIWB 2NX5E 1PY4A 3CSPA 3QZWG 3F5WA 3RHWF 4XPHL 5FA3A 5KG9A 3S88H 1QO3B 4JQXC 5I1KH 1OTTC 3ROLA 2BY0A 4PJFE 4HS6A 3RDTD 6CGTA 3MRPB 4FN0A 3MX0A 1WGOA 4PRPA 3ARTA 3EYSH 3MLZH 1W72H 1HHIA 1G6VK 4HIEA 5FCUH 4KQ4H 5C0FA 4KTEH 2ZUVA 2VLJD 3BGMA 1NGWB 5ESQA 3NZHL 4MAUH 3CXHJ 3V0WL 2R2HA 4HV8A 5E70A 3INUL 3T4YA 4LDEB 5IESL 4N0UA 4EJ1C 4MAYD 2J5LB 4NIKB 1N0LA 3CPLB 1KJ3H 2V7HB 5MEPA 1DQLL 4YX2L 1OP5H 2XOTA 3VWKD 5GRJL 3D48R 4HUXA 4G8FA 4OCWH 3EO9L 3QIUC 2F5BL 3MGTA 3QIBC 4KKBC 5ADOL 1MHCB 2Z9TA 3UTQA 4QEGA 3ALWA 1KTDA 2LAAA 3G04A 4FZEH 3KXFD 4NQVA 3BKMH 1T22B 4Y1AD 1CLZH 32C2A 5EULV 4IMLB 1X9QA 4H8WC 4YHLL 5E24E 4GFTB 2F5AH 4MLIA 4XVUD 3F6LA 2BRRL 4P46A 4WIQA 2B7DT 4M61A 1FZKB 5F9OL 3VCLB 2B0SL 3KJ4C 1RIUH 2DYPA 5F1IA 3D87B 1YECH 3SCMB 5C0JB 3KNBA 4K3JH 5DRNA 1FVDA 1HE7A 2FSEB 3VRLF 3BWAB 2IJ0C 3VD9A 3TO4C 1T7WA 4KGJA 1FL5A 4RQQB 1QYGL 4XMPL 1UEYA 5GJSH 5D9SB 5I17A 1GZPA 4YBLB 3S6CA 3LN9A 1BJ1H 4HC1L 3NH7L 4YFLI 4PY8J 2VLKB 2XN9D 2P45B 1U8LA 4KUZH 5HYSB 3NFSL 4LLUB 2CO7B 2NLJB 1XEDA 3HMXA 1YUHA 4S1RH 4P3WA 2GYSA 2D03L 5FECA 3G6JB 3L9RA 1M05B 3FT4B 1QFWM 4JPIA 2V9RA 1PG7W 4IOFC 2DIAA 3P0YL 1C08A 4PJ8D 2IPKA 4YDJB 5J57B 2ED8A 2K7PA 1INQA 1UWEH 2A6DB 3OKKB 3I6GB 3BISA 1JRHL 5F96L 3FN9A 4HIHB 5C0IA 1AGBA 1NEUA 1NJ9A 1WT5A 4L1HA 3KAAA 3VA2C 3LEVL 4MXVE 4PRPD 2X4PB 1AY1L 1MF2L 1G9NL 3DVIA 2W91A 5CILL 3PWVB 4HCRH 3VXRA 2ZUQB 4HEME 5F1NB 3BP6A 3VG9B 4HIXL 4QXUH 2AK4A 5GZNC 1E4XL 1X7QA 2VDML 3FN3A 1MPAL 1OB1B 4IHOB 1DEEB 3KXFB 4EI5A 1T0NB 2JELH 4XNQA 3CU1A 3MLVL 3T65A 4QHMB 4Q6YA 2CMRL 3K2UL 3MACH 4F58H 3QNXB 4AEIL 1T1XA 4C4KO 5SWZA 2WUBL 1CDJA 1L9NA 2EE9A 1IEAB 4X6DB 3SKNB 4DWHA 4N90D 1IT9H 1RK1A 3BIBX 3ARDB 3Q1SL 1ZT1B 4DKFL 2FJHA 2I07B 4NHCL 4U6HA 1Q0YL 5FYLH 3TIEB 3AREB 1Y18B 4P46D 5D7IA 5I0DA 3E6FA 4PJ9A 1C5BL 1CFSA 3Q6FA 4BH8A 2ATKA 1NC4B 4KPHL 4J23A 1RJYA 1CE1L 2DYPD 4S0TD 3ARUA 1ZHKB 4FABH 2JB6B 1KNOA 5E6IC 3BIKA 4DCQB 1RZGA 2DQCL 2ADGA 4LLQA 2O5YL 2X05A 3WFZA 2LABA 1ZKAA 3W5NA 4MJ5A 1N5YL 3GMRB 5C08A 4PJ8B 3MRQB 4OFYA 2J88H 4H25B 1XAUA 2Y9RT 2EDRA 1D3CA 1S7WA 1LO3L 3IXAB 1OAYH 5BV7C 2PR4H 3DXAA 3ECBA 3GK8L 3LDBC 2VLLA 2OZ4A 3REWB 3HHRB 4LCUA 2DQTH 5IB1A 3HC0A 3R8BB 1UM4L 5F9DC 3W2DL 2X4NA 1CVSC 3CIQA 1U8MA 2VL5B 4PRPB 2X9YA 5HGBA 2VC2L 1CFTA 4XCCH 3D39A 4MMXC 5FKPA 4JQVC 1I8KA 4MDIB 1FL6A 1UT9A 1OGTB 5E08L 1FLRH 3BGMB 5DYOA 3D0LA 5HHXL 4UT6L 3WFDL 5ESQB 2VOTA 2GUOA 1BVLB 4QTIH 1S7SA 4QY8A 2E27H 2X1XR 3BI9X 4IM8A 4YPJA 4HV8B 3B2VL 1F6LL 2X9WA 5F7DA 5IB4B 1MCKA 4QHKJ 5FYLE 3VGEA 2FECI 2VLKE 5AUMA 5MEPB 2HWZH 4X7EC 4JO2L 5BMFL 5D2LF 3SE8L 4L8SA 3G5VB 4S1QL 3GMQB 3MRMA 4G8FB 5EO9A 3VXRD 3TA3C 5LGKA 4UOW1 1LEGB 2HLFD 1A6UL 3MRHB 4JG0H 1KTDB 2GAZB 3FHQA 1A7QL 3G6JE 4PGDA 4EI5D 3QUKA 2IWGA 3WLBA 1YY8A 5E1AB 4GW1B 1RJLB 3RKPA 2CLVA 3NCJH 2X1OA 3GNMH 3LKNA 4FTVA 4P46B 4OZFG 2Z8WC 5FA4A 4S2SB 4Y4FC 5JQ6H 4N0FB 3S3PA 4ELKB 1DANU 1LWRA 5FHAH 5SWZD 5F1IB 2VYRE 3ARSA 4BFIB 4BJLA 1FVDB 3V4VH 3U9PL 5FGBC 1ZHLB 1FL5B 1JPFB 5F7LB 1GZPB 1PSKL 4PJ9D 1J10A 1D6VH 4HLZH 3VMOA 4QF1A 4ZFOA 5T1MB 5I30H 2EYSB 4W4OA 4Z18A 3MXVL 1P1ZA 3KR3H 5J8OA 1FBIL 2V5MA 4OZIB 4PJDA 1CDYA 1QKZH 3ULUD 1QSVA 1WIUA 4MX7A 5E5MA 5A2KH 3KXFE 1F4YL 3SKJH 2CLZB 3G5YA 4LSVL 3L9RB 2Q87A 4S1SH 1R3JB 5FYJD 1TJGL 1W0WB 3GSUB 1C08B 3V4UL 3EUUA 5C08D 1IC7L 1S3KH 5GRUL 5ADPL 5I76B 1RVFL 1I8LA 5JOPE 1CZ8H 4X6DE 5JOFA 3DXAD 4PV8A 2E8ZA 2IFFH 2P42B 5KSUA 4ACPA 4CADA 5IHUH 3RL1A 3C87A 2FJFA 4XX1G 1BWMA 5HHOA 4RISH 5KTEH 3LB6D 3T0XA 4O4YH 1ZVYA 1ETZA 1SEQL 5AZ2H 4LSTL 3D39D 2NY1C 3FB6A 4P2OA 1XGRA 3RU8H 5BOZG 1U8PB 5HGHB 2Y23A 3VXRB 3HRPA 3WFCH 4ZXBA 3CFEB 1OL0A 1U8NA 4G7VL 4Q58C 2A2QT 3NIGF 5DQJA 3U30C 4XNQB 5ESVB 3BPLB 3T65B 2PF6A 4CVXA 2EIBA 1QA9A 2EEBA 3S98A 3CX5J 2C3GA 1T1XB 2DL9A 5GS1A 3TPUA 4GMSH 4TTDC 5EUOA 2DBJA 4U1KA 1RK1B 2NTSP 4FQQB 5IVZA 4DQOL 3FQWA 3CXDL 1QG3A 1T04B 5EWIL 4UBDC 3AMKA 5D7IB 4FTVD 3CXHK 4PRPE 5I1DA 5IMKB 3GB7A 1CXHA 4MYWB 4PJ9B 2P5WA 4XNMB 1A4KB 1RJYB 5IVXB 1HXMA 2DQEH 3RA7L 4F80A 5TH2B 3DBXA 2FR4B 2ZWLT 5IHBA 2Z4QA 5CJ8A 1A7RL 2QLVB 1XCQB 2ADGB 3PGFH 1ZANL 1A22B 3LH2L 3VI4E 3U7WH 5CD5C 5DFVD 1LP9F 4KK8D 1YEJL 2BP3A 2J8UF 2R1WB 1FORH 2VXUL 3BXNB 4MJ5B 5C08B 2F54B 1YQVH 3NTCH 2FRGP 1C7SA 2R29L 1EHLH 4MNQA 4U05A 1I9IH 2EXYC 4KKLD 3DXAB 4LIQL 4N90E 1HH9A 3O3DA 3T0EC 2IPTL 1N2RB 4LCUB 5D7JA 3QDJA 1I1CA 1INDL 4YE4L 2Q8BL 5KAQF 2X4NB 1D9KA 3KYAA 4TOYL 5HGBB 2HJFA 1JV5A 3HE6A 1CFTB 1GL4B 3D39B 1L7IL 1K5NB 1FE8H 1XGQA 1FL6B 4EXKA 5LGJA 3RTQC 1FNLA 5JPNA 1M7IA 5B4MD 4QY8B 5BO1L 3TVMB 1MIEH 3MLSL 4FXLA 5CIPA 5HHOD 5F7DB 4LSUL 1RIHH 5CEZL 4YHPA 3S96A 4UUJB 4P2OD 5DJ0B 1T7ZA 4IOIB 4QOKA 4XPAL 1IKFL 4UDUB 1I75A 1OF2B 1ZHNB 1Q1JL 5DEFB 5CFHA 3MRMB 4U1IA 5EO9B 4OZIE 2F74B 4ZXBD 5C6TL 4G7YL 2CDGB 2CRIA 3DTXA 3QUKB 1JFQH 3WLBB 2J8OA 4Y5XB 5D5MF 5GIRB 5LWYH 3I3EA 2NXZC 4ZFFA 1VACA 2AEIT 1IM3B 1ORQA 3LKNB 2OQJA 3L5JA 3QUMA 2QQLH 3S34H 4PRHA 4NO3B 1J05B 1MFAH 1QLEH 4WGVB 2J8HA 4HKZA 3LS4L 1T21A 3BUTA 4CAGA 4U1SB 2ID5A 3SPVB 4JPVH 2YSSA 1G6RB 3B8YA 2WBKA 3CZFB 2P5WD 2W60A 5IVOA 4QF1B 4ZFOB 5E5UB 1CD1A 3VXRE 2R23A 4GG6A 2P8PB 3O0RH 4WNQA 4FHBD 1CFQA 5E5MB 1TZIB 3J7HA 1W2KT 4OZFA 1W8NA 4XXDA 1MELA 4YHML 2FWOB 1RZFL 4HKXA 5DUML 4WTZA 1HNGA 5TE4L 4FXKB 3QIWA 2AI0H 1I85A 1QBLL 5L7XL 1I7RA 4TSAL 2YOCA 3ARBC 1UCTA 4RWHA 1CGTA 3OKYA 4MQ7B 3T77B 3MMEB 4EDWH 3LMJH 1PLGH 4ALAL 4MNQD 5CMAB 1NMAL 3EOTH 3IDMA 2VDRL 4KAQL 3U9UA 4F37K 2P7TA 5D7JD 3QDJD 2RR3A 3GIVA 2FJFB 2XFXA 1KCRL 1U8JA 5D7IE 1LMKA 1D9KD 3T3ME 1ETZB 1CF8H 4WJ5B 3HE6D 1E6OH 3FB6B 5FOJA 5IVXE 1XGRB 3SKMB 4M7JL 4PJIF 1CIUA 5BZDA 4CMHC 1BLNA 4ZXBB 3CVIH 1DQML 5HVHC 1S9XB 4YJZL 4XT1C 1D5MB 3DYOA 4HWBH 2DQFA 3O2VH 4WWID 5C08E 2F54E 1QA9B 1JL8A 4QOKD 2BFVL 1VENA 2GI7A 1S9WA 3SDDA 4UNVA 3BT2H 4Q9QH 5GS1B 3DXAE 1CGXA 4EI6A 3TPUB 5I1JH 5EUOB 4U1KB 4YHYB 1GGYA 3ES6A 1F3DJ 4UZGA 1G6RH 2JJSA 2WLYA 3FQWB 4PP2B 4X5LA 3E0GA 3V6FB 4AK1A 4M1DH 4OLEA 3EYSL 4HXAH 4UT7L 1W72L 1UM6H 5FCUL 3D39E 5EIVA 4KTEL 2NTFB 4V1DB 5LBSH 3RBSA 4O2EB 2ICWI 4NZUH 4PRHD 3D0VA 2BNUA 3G6DH 3O9WA 2Z4QB 1N6QH 2PYFA 2ZCHH 3NACH 1A1MB 3NIFF 1KJ3L 1UC6A 1ZHBA 4I4WA 1MCRA 3C6LB 4O9HH 2NY3C 2NY4C 3K0WA 4BKLA 1P4LB 1AD0B 5CZXD 5TDOA 4OCWL 4GAJH 3U79A 1ZLUK 2KH2B 1X5JA 5BW7C 3BKML 4XBGB 5HI5C 5HY9B 2VXSH 2ZOLB 1T1ZB 3OKMA 1Y0LB 2IPUK 5IB2A 2MHAB 2F5AL 4GLRI 1KIPA 3QDJB 5D7JB 1BECA 3VGAB 3NGBB 4Z77A 3GM8A 4Q6IC 1B6UA 2VH5H 3KVQA 4HUKB 5IT2H 5CP3A 1YECL 4K3JL 5LGJB 5JPNB 1PDKA 1FVCB 2XPGA 4WCYH 1JWMB 2CD0A 3SGDH 5GJSL 3UJTH 1XT5A 5T1LA 2VLMD 5CIPB 3JV4B 4JZJC 5E94B 5C6WH 4KI5C 2QR0A 1WCQA 4LEXH 4YHIA 2Q3AA 4GJTB 1QRNA 1E6JH 4JREB 4XP5L 1CXIA 5HSFA 1P9MC 1Z9OA 5KJRH 2VDLL 5ITFA 1LVEA 2DRUA 1DQQA 3B6SA 1MEXL 1KPVA 4EQ3A 4AMKL 2HT4D 4DN4H 3BZEA 4E5XA 5D71L 4X80H 1RK0A 1U3YA 4KQ3L 1DLHA 2Z31A 5KBNC 3VRLE 3SDDD 1WBYA 4Z7NF 4IDLA 3I2CL 4PRHB 1KPUA 2VXVH 2NY2D 4HKZB 5C3TA 4R90H 2ZKHH 4L9LB 2J3SA 1T21B 5HYIA 3V2AR 1AXSA 1BIHA 1WF5A 1J7VR 3HZKA 2R4RH 4I1NB 4OGZA 2WINB 3QCVH 3U0PA 2W60B 2DI9A 3CSYB 5FO7B 4WWKC 4HCRL 1JF6A 1Z0NA 4G8GB 5DMIL 4QXUL 1J88A 2Q8AH 2IMMA 3OPZL 3O9WD 4GS7B 5D1ZC 5GGTA 4OUUA 2JELL 1P7KB 5DSCA 5DLML 1FG9C 4M4RA 1ACZA 5HHVL 4XXDB 4YNYA 3T0VA 1CN4A 1DDHB 3MACL 2E9IA 4POZC 1GZQA 1I7RB 4PRAB 4Z7UF 1B4RA 2CQVA 5HHNB 2APXA 4JO3H 3VXMA 1IT9L 5ACLA 4PGBB 4ZODA 5EUOE 5MEOB 3F6IA 3H9HB 3LKSB 4BZ2H 1HSAA 1U8QA 3DARA 2EH8H 3HAEG 4TVSa 4KKAD 5F6IC 2WK2A 2GY5A 3C09C 1FQ9C 1GC1L 4V1DE 4DFIA 5DJXA 1WQVT 4NZRH 4FABL 1A3RH 1RIVL 2F58L 4NQDB 3KPOA 5BZDB 3QG6A 3KJ6H 4WW2C 4JFXA 1AC6A 3MLXH 5T1LD 1CTNA 5DVMA 1BFSA 2DQFB 3OAUH 2DKSA 5M94B 1XCTB 2J88L 1BQHA 5FYKU 5LAXB 3KPTA 1QRND 4M7LH 4PRBB 1U93A 2EDXA 1OAYL 1LK3H 3CDFA 3SDDB 3ME0A 2PR4L 5C7XH 5T3XH 1OSPH 4KTYA 3RY4A 4EI6B 5DI8A 1FCCA 1P5UA 1I1YB 1VERA 2NY2B 1B6DA 2XI9A 4C58B 1HHGA 3ES6B 3QDJE 4G9DA 4H26B 4Y5VC 4KTDH 3RWGA 3V4PH 4DGIH 4NNPL 2NXYD 3TM6A 4O2FA 3T2NH 4EUPB 4XCCL 5KS9F 4LHUG 2W9DH 3BOVA 2Z31D 5HGAA 5JZ7C 5E2WH 5F3BA 3CFJB 1J8KA 2PXYB 4UV7H 5JUEH 2FEEI 2E27L 2ESVB 4ONFL 3O9WB 1WWCA 3DV6A 3C8KB 3L5WA 5JW5B 2E7HA 1KGCD 1BJMA 1SY6A 1ZHBB 4I4WB 4LCCC 4FQCH 2HWZL 3VDBA 3C6SA 1G0XA 1EXUA 1TMCB 4BKLB 5TDOB 5IROC 5J11B 3QP3A 3U6RB 5F88A 2QADD 3SJVA 3LD8C 4NQXA 1HQ4B 2LQRA 4U0QB 1QTYT 1M7DA 2HMID 4F15B 2RGSA 3NCJL 1KC5H 2RBLA 5H94A 3GNML 2CSPA 5J4MA 3LKQA 1OAQH 2W65A 5JQ6L 3LVEA 3MFGB 1VFAA 2AJ3B 5FHAL 2AV7A 2BX5A 5JMOC 2BDNH