2JFBA

3d structure of lumazine synthase from candida albicans
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
153
structure length
153
Chain Sequence
KYDGSKLRIGILHARWNRKIIDALVAGAVKRLQEFGVKEENIIIETVPGSFELPYGSKLFVEKQKRLGKPLDAIIPIGVLIKGSTMHFEYICDSTTHQLMKLNFELGIPVIFGVLTCLTDEQAEARAGLIEGKMHNHGEDWGAAAVEMATKFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 6,7-DIMETHYL-8-RIBITYLLUMAZINE SYNTHASE
publication title Lumazine Synthase from Candida Albicans as an Anti- Fungal Target Enzyme: Structural and Biochemical Basis for Drug Design.
pubmed doi rcsb
source organism Candida albicans
molecule tags Transferase
total genus 52
structure length 153
sequence length 153
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O
ec nomenclature ec 2.5.1.9: Riboflavin synthase.
pdb deposition date 2007-01-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.960 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Lumazine/riboflavin synthase 2jfbA00
2JFBA 2A57A 2C9BA 2C94A 1NQUA 3NQ41 1C2YA 1T13A 2C97A 1KZ6A 1KZ4A 1EJBA 2F59A 1KZ1A 1KYVA 2A59A 2C9DA 4KQ6A 1ZISA 1DI0A 3MK31 5IM4A 2VI5A 1W29A 2B98A 2OBXA 1KZ9A 1NQWA 1XN1A 1KYXA 2B99A 1W19A 2A58A 1NQXA 1RVV1 2I0FA 1NQVA 5IM5A 2C92A 1HQKA 2O6HA 1C41A 4J07A 1KYYA
chains in the Genus database with same CATH superfamily
1ZHHA 1F48A 3RVKA 2P4HX 2ADMA 2AGVA 1OU0A 2I8LA 2OFPA 3CVWA 3W05A 3FUCA 2NAFA 2QHXA 1T26A 2D1FA 3JYOA 4O5OA 3LK7A 1GCUA 3KSBC 2BISA 2XMRA 4FGUA 2EKPA 4JNKA 3TB4A 3PNMA 2IXDA 1KKMA 3ZWVA 2WNIA 1AN9A 1T2NA 3FCEA 5L4SA 3H0KA 1PJRA 1M8JA 1G3RA 1M0SA 4AY3A 2QVBA 2B0CA 4QU8A 1B6SA 4JSTA 4YMLA 1V0JA 2XB9A 1GZUA 3L77A 5AJTA 3U3MA 1I6MA 4MGKR 4URFA 4DJTA 5IBPA 1KYTA 2DRIA 1YDHA 2VAVA 5LZ4A 3QI2A 1Z5ZA 3HDTA 3MGGA 3CRZA 3GJ0A 2WSBA 1N8TA 4JYBA 4IXTA 3T4PA 2A6PA 3VISA 2NU6B 4NMXB 2C4UA 3ZZNA 2A78A 3UB4A 1IY0A 2PXXA 2ZSDA 2XVAA 5EGSA 3H2KA 4P4TA 3VDNB 3AU8A 2AF4C 1KYZA 3EIXA 1RKQA 1N7JA 1ODTC 1ZRNA 4F5YA 1MABB 4KPYA 2XUDA 4HEHA 2ZBGA 3DO8A 1KNQA 1AKQA 4NV0A 4K6FA 4PFKA 5JASA 1W44A 4HMPA 1GAQA 1NJ1A 4S1WA 1DPFA 4BXOB 3WIVA 4E3WA 5F5XA 1IG3A 2ST1A 4MA5A 5BOVA 3R9WA 1Z38A 4V0OA 5JCPA 3H1EA 1FBNA 3NWPA 3PC4A 3CEJA 4CUKA 5KWIA 3MD9A 1Z15A 4L2IA 2R1TA 1OGYA 4O1IA 4BFVA 1JSRA 3ZJ5A 3DTVB 5E1OA 3NASA 3RAGA 2Y77A 3JRXA 4PYRA 1JQLB 5EWMA 4AP6A 4D4HA 2D13A 1Q0UA 4YR7A 2CBGA 3L40A 3Q8WA 4EUSA 2JGIA 3ZR4B 1NVKA 5PGMA 2FSUA 2DWPA 1L4HA 2ZRQA 1Z7YA 3L7CA 2CUKA 5KYNA 1KTIA 3ZTTA 2P2DA 1UK9A 4INJA 1VMAA 5FTWA 4DXAA 1RI1A 4U7FA 2JFQA 1EGHA 2O2CA 3N74A 2YWDA 4H7EA 4K2HA 3ZE1B 1O0BA 1J1ZA 3PLNA 4NS4A 3I62A 2NTYC 2AW5A 3M82A 5EZ6B 2RHOA 4GBGA 1FCJA 4TT3A 2VJNA 2PSSA 2VJLA 2HDNB 3QLVC 4IL5A 3V7YA 2A1IA 1ZU5A 3CO0S 4BQFA 1H23A 2CF6A 1Q2UA 3T7AA 2GPWA 4M99A 1E5QA 4ZK6A 2XTMA 4CQLA 3WRXC 2UVDA 2WWWA 3D2AA 3EDRA 4UPDA 4GMGA 4TMXA 4J1TC 2C9YA 2CXUA 3O74A 1D9ZA 5JCJA 5BSFA 2OCBA 1E8DA 2AJCA 3AUYA 1V26A 4W1SA 4R2LA 4CM6A 1LDEA 2HBYA 5JAMA 1Z47A 2F2TA 1LBTA 3GJ5A 4O02B 3HBMA 1FF9A 3FPCA 4MP3A 3D3JA 4NPHA 3R1IA 1PV2A 2Q9UA 5KSPA 3ZBQA 1GCAA 4E30A 5MN5A 3KB8A 3EULA 4B7AA 1DKPA 2W2KA 4YQYA 2EFYA 4LTMA 2CMHA 2CKMA 2Q4RA 4RPHA 5ALHA 5K0BA 3EJ6A 4IUBS 4NC9A 5FUYA 1ACLA 1DOZA 2QRHA 4EJSC 4QFMA 1A9PA 2BZSA 4PQGA 3MJFA 2GN8A 4R41A 5K3AA 1E2NA 3SJ7A 1M6YA 4A0GA 4C6TB 2IIBA 3EMVA 5MHTA 1RPNA 1WTAA 1NVEA 1ZCZA 4HQOA 2HF8A 1MMFB 2EU8A 1ISMA 3I8SA 3IP5A 4HWPA 4UULA 2VJDA 3U7IA 2GJAA 1Z37A 4JASB 1L5KA 2VHCA 3VKWA 4O59O 1F5NA 3CXRA 4NU6A 4IIYA 4RSHA 4MCJA 4TT3D 2PLFA 2Y92A 4IXMA 2VO1A 2GXSA 4WBNF 5BQXA 3L8ZA 3DZKA 1ZI8A 2VXCA 3HBJA 2BCEA 2ZRKA 1ZONA 3TTUA 3N0XA 3CBQA 1DTSA 5DLEA 3UFBA 2UU9B 3URMA 5LIRA 4DV1B 3ZCRA 5EMJA 5JCJD 2I6SA 3RYHA 3S2SA 5C52B 1ISGA 1KS9A 2J46A 3VOSA 3FCXA 4CMCA 1I2MA 1YONA 4M89A 4P4SA 4PV7A 1QJ4A 5AQ1A 5JNTA 2ZBEA 1L4MA 2G5CA 2HA4A 2JARA 4FJ0A 2Q5EA 4OPMA 3RARA 3PGKA 3DLBA 2WKPA 3DZGA 4GHWA 2HNAA 3MRXA 3THYB 4QPPA 1OAAA 1KYXA 1U9YA 1WDTA 1PJQA 3BK2A 3EMDA 3HFGA 3LRTA 3PNQA 1K7EB 3ZHSA 2IX3A 1X15A 4LX0A 3HCOA 1WHSB 1IPHA 4U2KA 3EXIB 3RS4A 3T41A 4DMUB 3G2MA 1SWVA 2GCNA 3EFOB 1I4OA 4QRDA 3QV2A 3RK4A 4JP3A 5C7LO 1AZWA 4C5BA 2HZ7A 3VC7A 3VKGA 3NFYA 4OGKA 2FW8A 2OTCA 3H65A 4MO2A 2D4HA 821PA 2XQGA 2NTNA 4D25A 4P36A 2MMGA 4ZOLA 2QUIA 1J1IA 3ESRA 4X8MA 3KTFA 1OX4B 5BRJA 3ADOA 4OGWA 3H18A 1Y63A 4WZBB 1FOEB 1AA6A 2ZRCA 4N01A 2PT6A 2YNMC 5KAPA 1JBKA 2ID9A 2LTAA 2W7TA 4RVNA 1AKRA 2AN1A 2XMBA 1GZ5A 1M1ZA 1X3LA 2Z8XA 4XIIA 1JFVA 1K4MA 2GCEA 4AG6A 4AO7A 3SR3A 4B6FA 2W2NA 5AKLA 3TKAA 4A2WA 5C7OO 5KTSA 1UODA 2YC4C 4UHCA 4AC9A 1YHYA 4CMIA 1KDPA 4RQAA 2FFBA 3U1VA 4BRWA 1ECPA 4RAQA 1Z2EA 5ARCA 1F12A 3Q3GE 5FUWA 3ZKWB 2VQEB 3U81A 3OD1A 2YC2C 3O4HA 2FSIA 5D3ZA 1PT7A 1I5OA 3LQ2A 3A6DA 3GAZA 4QM7A 2ECOA 5BSKA 4QLBA 1R4ZA 3OIGA 2G63A 1XV5A 3JTEA 1QV6A 5AICA 2VQFB 2XB2A 1S8AA 2IUTA 3QLUC 1UMDA 4CMBA 1WUIS 4AMZA 3AIMA 2JAPA 3SGLA 4B3FX 3NH9A 3LY9A 1V1RA 4ZI7B 4B34A 2O2GA 3GIDA 3HB1A 3O2NA 1J5PA 4XDZA 3NKFA 4XJVA 2R8OA 4XQ0A 3EW9A 4HDRA 2Q28A 2MINA 1U8YA 1MOQA 3SG0A 3EXFA 2W6MA 5KKNB 3SPXA 4DCPA 4E32A 4J7UA 1RWQA 2GJ9A 4V2UA 4L02A 5C4MA 3CE9A 5ILQA 4F6RA 4QDZA 5IKPA 3IEMA 2GN1A 1NJ5A 3HNRA 3CR8A 3D7MA 3EGEA 4HQFA 2QRVA 4CKBA 2IDKA 2QLNA 2DJ5A 2RGWA 4EUEA 1FQWA 3B8EA 3P5BA 3TLEA 4BNWA 1UXGA 3RNOA 1EBFA 5FL3A 3PQ2A 4FINA 3E1SA 2JB9A 3KV1A 1O5OA 4Q9NA 4ENQA 5IJ0A 4P84A 3T0FA 3VNUA 1KR2A 4FC7A 1GSHA 4JUFA 3ZVRA 4H6VA 1P9OA 5TQ0A 1CZRA 1U7HA 2GA8A 2PZKA 2UAGA 4LDAA 2PLRA 4DSUA 4RX1A 4W6ZA 3PQ8A 1XNGA 1V8ZA 2K7ZA 5LP6A 2HHCA 2QAGC 1MJHA 2YZ2A 1R0ZA 4DBLE 1EJBA 1B7GO 1DTWB 4AD8A 5CYFA 4RL4A 1XZBA 1HOTA 2D00A 4MP6A 1SAYA 1ZK1A 5H9VA 3KEFA 1RSZA 1YHZA 2ZTVA 1UPFA 4UHEA 3UTDA 4BQOA 1TDJA 3OA0A 4IFIA 3TGWA 1WKVA 1TK9A 4F3TA 2BMJA 3D4IA 3D64A 1IG0A 3P9SA 1E7SA 3GLFB 1C7EA 1NBMA 1TZ2A 4D41A 1DC4A 1V37A 1NL3A 1KL7A 1QMPA 2YFYA 1L7MA 3T9CA 4FOTA 4HDNA 1AK9A 2WJ6A 2PG3A 1C7ZA 3A6EA 3ZHCA 1PE0A 4IIEA 1MRSA 2YXNA 3RVRA 2H51A 2VSQA 4TGLA 3NIFB 5FLXA 1S8OA 1ZSVA 2BF4A 1U8ZA 2B3DA 2IYNA 3E7XA 2OGWA 2PKXA 1P1FA 2VJYA 2MSCB 3F8WA 3M33A 3OMLA 1RC0A 2IEYA 3OG9A 3PTLA 4LWOA 2Z6VA 4URZR 3VTAA 5B7NA 1M10A 5G53C 4OU5A 3HFRA 4AY2A 1PN3A 1P1IA 1FB5A 1UXKA 2F3PA 4CIXA 3HRKA 4LHXA 3DMFA 2BFMA 1A9ZA 2DEUA 1PAUA 1J2UA 4OXXA 2IE8A 4CEHB 3FTPA 1PSWA 3B1ZA 2FSFA 4WDQA 5CHEA 4WKOA 1TM3E 1NP6A 3DPIA 2UVQA 3PXUA 3H42B 3TS1A 3FNBA 2VA9A 1YS6A 4HV4A 5HKKA 4P5PA 4YFYA 1GV0A 2HMTA 4R7TA 2GERA 5J23A 4K86A 3MWKA 2WM9B 1QTRA 2BUAA 4IILA 5F1OA 5JOQA 1U8EA 4YRZA 3DOJA 3DVQX 2H1IA 1V3VA 3R6WA 3Q1KA 4O4LB 2A5JA 4D4JA 3ZK8A 5THQA 3KT3A 3DQPA 3GDOA 2IUFA 4JP1A 4CYMA 5HKAA 3MCWA 5B1HA 5DYNA 1JG3A 5CDGA 4JYAB 2ZG6A 5FOWA 3UEOA 5CA1B 5IH7A 4B8YA 1T3HA 1ONSA 2JIMA 2LDBA 4Z49A 3G9ZA 3AKDA 2GZDA 3ANLA 3KUUA 2FSVA 3HYNA 1WSBA 1CZHA 3P0RA 3QZUA 4YAJA 4QGBA 4CG3A 1TM5E 1M73E 4L9WA 4D0GA 1F4PA 4Q1AA 1V35A 4KQHA 1H2HA 1HFJA 2GD6A 4P54A 3K0HA 3TOXA 2C57A 2H5LA 5HBGA 3RVDA 5LXTA 1KI6A 3DCNA 1WUTA 1EGQA 4YDRA 2Q2QA 1U8TA 2EZ4A 4MYUA 2HL6A 5E4JA 1VECA 1NW4A 1OE0A 1P9RA 2RH9B 1QP0A 4ZEOA 4FZRA 5I8PA 3TZ6A 4EFKA 2CFOA 5IAJA 1ONOA 3E5HA 2FRDA 3E9CA 2X4LA 4N6OA 3L8MA 1NI4B 2GN2A 4LNHA 4WFJA 1XMOB 4FGLA 3TDKA 1P1RA 5EMHA 5CLQA 3VU0A 3JZAA 3KLBA 4EW1A 2XE6A 3PFNA 5EKDA 4EGFA 5KKCA 1KEEA 3AEKB 1NSFA 1THZA 2B9EA 4LGVA 1FFHA 1H6AA 1V3UA 3IUPA 2YDXA 2GO7A 4RK0A 1XMJA 4X93A 4RMNA 1A9TA 3NB0A 3MMZA 3TX2A 3OEWA 5E3HA 4O4IB 4MX8A 1TW2A 5JALA 5P8WA 4B3CA 2MYUA 2HW8A 5FCDA 1Y3AA 3M3HA 2BBTA 3CMCO 4KQIA 3W9UA 3GUYA 4HGZA 3ZIAA 3WLEA 3HI4A 4D44A 3FPGA 3OP1A 2FMIA 5B57C 4EQZA 5J2TA 2C98A 2HLHA 4QPCA 2ZRBA 4LSMA 1EFTA 1QORA 2IY9A 2J0UA 4JCOA 4A0QA 4AB1A 3K53A 4NFHA 3RAFC 4AZ0A 3SBOA 1UP4A 1ZK4A 4XASA 1UBKS 2R7NA 4BQPA 1YD7A 1ULBA 3UT5A 1NUAA 4D9JA 2MSLA 3IBYA 1BH2A 1Y8RB 2XGGA 3EZNA 4D6YA 4B6RA 3DDUA 2J6IA 3QOFA 3T34A 4W5QA 1X13A 2C7GA 2I4TA 1Q77A 3JALA 4GRAA 4FCTA 4N0MA 1X1EA 4R2KA 3T7RA 2O8EB 2HIHA 3R6DA 4W63A 3R5KA 1PIWA 1F0NA 3K0FB 4O2AA 2QP9X 5FNVF 5L3RA 2BGGA 4NBSA 3RAPR 2R1UA 3WDKA 3LBHA 3S5JA 3K6SB 2I7XA 2PNJA 1QH0A 3LUGA 1CY6A 2BI7A 2R8PA 2JK0A 4W1RA 5C31A 2R0QC 4MEAA 3R7FA 1E18A 5SY6A 4O2BA 1W9HA 1XJQA 3D4OA 3EGDB 4Q3DA 4HQRA 3TKLA 4GKJB 5B3JC 4GRDA 5HDBB 1YIOA 1VPVA 2XMSA 3ZOKA 2XYRA 5IMBA 1JFFB 1CUXA 1YGYA 2FQYA 4LFAB 2J3KA 3BICA 4XSHA 4ZJYA 2O3TA 1X94A 2VDNB 4V0SA 2IYPA 2LKCA 2CJYA 3MT9A 5FOXA 3ZIAD 3COJA 3QPCA 5EIWA 3DZIA 2EX4A 2H1HA 1CUUA 1KXJA 1VPLA 2P68A 5LBIA 1N2CE 4OX9B 4I4NA 1JZSA 3NOXA 2DBVO 4G9BA 4MB2A 2GXAA 3HLYA 5TPWA 2QB5A 3BYZA 2QTVB 3MBIA 4FILA 3L0CA 4LJAA 4DEVA 2ZT5A 3SN6A 1C9YA 3DAOA 1ZMXA 3G2IA 3U7GA 2EF0A 3G2NA 3IODA 4RSGA 5DLYA 5U1PA 3RFVA 4L73A 2RHGB 4PSUA 3IVAA 1MQ9A 3QELA 2JFGA 4YYEA 2BF7A 2IT1A 4COKA 2X5KO 3DBLA 4HZIA 4Y7CA 3TLCA 3RKRA 4DW8A 3PK0A 1MJGM 1V25A 1G4HA 2QTZA 3B2QA 4X91A 4E07A 1TO2E 3F7NA 4L5JA 1LRLA 3WQQA 2WB4A 4TS4A 5JZ9A 4J03A 3VPAA 1SKAA 1Z39A 2FSPA 1XVTA 3HU5A 4NFYA 4WXYB 4FWTA 3PV0A 5FLYA 3UXYA 4R9VA 3MCTA 3GZTB 3IP9A 4BUCA 2Q3MA 2D6FA 2H4XA 5DN6A 4JA0A 1YBFA 2C94A 2WWFA 1NPYA 1KDZA 1OR8A 1M2EA 3VOAA 2JLUA 3WWPA 1F7UA 3K0BA 4HNQA 5E2AA 4H1TA 3HJFA 2B6NA 4KIFA 4GX2A 1N32B 5DJ5A 3DE3X 2V9PA 3U19A 1N2IA 1DLJA 4GM0A 4RNDB 2B4YA 4POAA 2OCGA 2C7BA 3HJGA 4C2AA 4OOFA 1FNNA 1R9JA 1BW9B 2VZLA 3TD9A 1XZGA 4TTRA 2MR6A 3IKMB 5K6AC 2HAEA 3QSYA 1QQ7A 3GFPA 2QVXX 1KQOA 2QU7A 4FE7A 4Q05A 3RQSA 3TFWA 2FFQA 4CM9D 3RS7A 1OJ7A 4Z1OA 3OT5A 5K8TA 5CPFA 2JGFA 4U2CA 1YOVA 1A95A 5KC8A 4B6PA 5K5EA 3N2YA 3ZW8A 1G8YA 1HT0A 1Z0JA 4MIKA 4F2HA 1LBEA 3CZPA 1TPYA 1PG2A 3WBFA 3G0GA 3V4OA 5LBUA 1PG5A 2JIOA 1A2KC 2RK3A 4OJYA 1U28C 3CUUA 5HCNA 1V7QA 3D7KA 1VB5A 3F3KA 4CR7A 4ZANA 1PJBA 4YT8A 4YDQA 4G81A 5BQPA 1FNCA 2O2SA 4BFSA 10MHA 4H7KA 5DN6D 4JBNA 3OOWA 3ZDBA 4FCCA 1FX1A 4MP8A 3GB9A 1K8RA 1WO8A 2J9GA 4GQAA 1Z2OX 4IIHA 4UAGA 3KYDB 1SZJG 1JMVA 1L1EA 3MS2A 3JQ7B 1QHFA 1EE2A 2R8BA 3ESZA 4UXIA 5HF9A 1TMYA 4P53A 1QGUA 4C08A 5F64A 1OBOA 4GBED 4FBMA 1GFZA 1V2GA 3G0CA 5K03A 3KJNA 1TMGE 2DY1A 2V5VA 3I05A 4NOLA 2XVZA 1JPVA 1QZUA 1NVVR 2VDLB 3BJEA 4X7RA 1E5LA 1G8AA 3DT9A 2OUIA 5CIQA 5LB4A 1FEZA 5T4HA 3SYRA 1DKRA 4BJ5A 4AKHA 3PE6A 4ADSG 5HPYB 1QTIA 4WUVA 1FSGA 4K46A 4PBTA 1T6NA 1R12A 3SXJA 5T3UA 3KL2A 1XP5A 2JGNA 4C04A 1T36A 3L07A 1SC9A 4ND8B 1E6WA 1U7WA 3C48A 4FIDA 2ZYUX 4PAGA 2I91A 4RM3A 1RDFA 1FXUA 1G8HA 3O90A 1BX1A 1PR4A 1CJBA 1AHIA 3JVVA 4N0DA 5C51B 3HXQA 3ZCPA 1JFLA 1XT6A 3CBGA 4RA9B 5TF4A 3R8XA 1B6RA 4IHAA 4ZHQA 5LL6P 1JDUA 3PIDA 1V3TA 2G67A 3LKZA 3P71T 1J06A 4CQMA 1DJLA 4NPAA 2GHIA 2PX4A 5FHQA 4CG2A 4KYVA 5JLAA 2Z1NA 1IFXA 2EXXA 5KNBH 4WOCA 1FDRA 1VTKA 2HV9A 4XX0B 1KOJA 1A2BA 5DTEA 1U8AA 2WKSA 4GX1A 2IYZA 3HP4A 1Y1RA 4BLOA 4EUKA 1GL3A 2O3RA 3EQ9A 2WYWA 1I2ZA 4OHBA 1J7KA 3NCTA 4K6HA 2LGJA 2XHEA 3OZXA 4MLCA 4K5QA 4QJIA 1U0JA 3TRHA 5C5IA 4KXVA 4MR7B 3VX3A 2X8LA 1KEZA 1PV1A 1YZ3A 2NZXA 2RG7A 3H8VA 4OH1A 3RYIB 1JXAA 3VXKA 2QUAA 3I5XA 4PG6A 5A0VA 4WXPA 3LLSA 4Z54A 3VH4A 1Q0ZA 3C6MA 1QHGA 4BNHA 3OHPA 1N5DA 3RIEA 4FGSA 1SXIA 3RRFA 4MJLA 4V24A 4F0JA 1VDMA 3INRA 1GIAA 2ILTA 4KK4A 2ZUVA 3N2EA 3SEQA 4DHWA 5JSZB 4EG4A 1G21A 2OWDA 2R62A 3ABRB 2R4UA 3K70B 4CQMD 1Z6GA 3LUPA 4UHKA 4YJGB 1SVSA 3Q3JB 4ND4A 3NT4A 1XX6A 1NR1A 1SPBS 2BKEA 3FSRA 2V7BA 4JYCA 4KIJA 5FV4A 4YJ2A 1GKYA 5EJMA 2HBQA 1VPTA 3I3SR 3BB1A 3GA5A 3ILHA 1H66A 5COAA 4R8KA 3KDSE 4FUTA 2YWEA 3ZE8A 4UMVA 4PNEA 1MAVA 1EH5A 2MSNA 3LC1O 5BURA 2PU5A 1WDMA 3FCUB 1QPBA 4S1TA 4U5XA 4GOMD 4AUEA 5GJBA 3IDAA 2JCYA 3AR5A 1Y6FA 5LOVA 1H0HA 4JENA 3DEYX 4UAUA 4YCJA 2GPAA 1ZEJA 3KWJA 1RACA 5BO5A 1FW6A 3DXYA 1GTRA 1DBIA 2QRKA 2Q2VA 2O23A 5CDYA 1MO2A 1NLZA 1PJLA 4ZA2A 3WV4A 3Q0IA 2CC2A 4CKYA 1ESEA 4KXXA 3LWZA 3KZ1E 4R1OA 3FZGA 4DTCA 1BU5A 1QGZA 1WMSA 5CXSA 1K7FB 2IXGA 3L6UA 2JGDA 3SHVA 3O2JA 6CHYA 2QL6A 3PZRA 5BSGA 4Y7DA 2WP0A 3JSXA 3UUGA 2QPAA 1OY1A 1U0LA 3OFJA 4D81A 1DL5A 5BSVA 2PKQP 3G2HA 2ASEA 2IU0A 5BW6B 4OATA 4JJ8A 3AVUA 1JMYA 1R37A 4NX2A 2J5XA 4BIMA 4KFRA 2WTMA 5A71A 1UXOA 3PFFA 2IODA 3NTRA 1QH1A 1RP7A 1UPTA 3GCGA 3NM6B 4NXNB 1UBTS 1YWGO 1GTJ1 3PIIA 4UUMA 5DP1A 1CY7A 1DOAA 3GV0A 4DCJA 4J90A 6REQA 2GEBA 3H6KA 2ARKA 2UZ3A 1PK8A 1AC5A 3SY8A 3RU7A 3ORYA 5CK4A 4TMTA 3FSEA 1E6UA 2VNKA 2D0OB 4H7HA 1F2TB 3QU7A 5HFJA 2IXBA 1N6IA 2RGUA 5JWHA 4DDHA 4P7KA 4D8XA 1VPDA 2HRRA 1SVNA 4JC4A 1GV1A 4KJZA 2XVXA 3K32A 1FS5A 1L0BA 3TQRA 1GPWB 1CV2A 3MTJA 3V4ZA 4EJFA 1EESA 1E61A 5K0EA 2IZ6A 3OFSA 1NDQA 1J2RA 1XRLA 1EFPB 3F9RA 3PT5A 3AU9A 1DQNA 4ARUA 3O4JA 2FDXA 1RT9A 4WTOA 3H8SA 4FR2A 1BYUA 1TA0A 2GM9A 4A23A 1H94A 4MVJH 4GMHA 4A0SA 4MS1B 2H8GA 1PD1A 2D4AA 2IYRA 4MRMB 2Q7DA 2YIDA 3CZCA 4CF4A 4MNTA 3ZBTA 5J58A 3L93A 4RE5A 4D0RA 4IQGA 4PZAA 3GT3A 2KMLA 4JKYA 2RFLA 5B37A 3Q2IA 1JQKA 1HBJA 3TD2A 4E2ZA 5CCBA 1IYZA 2B3TA 2WU3A 1HH4A 5FD8A 4LOLA 2V6MA 4FLMA 4XARA 4CF5A 5F78A 2A84A 1C4OA 1QO7A 3I2IA 3FN4A 3BDVA 2OBYA 4F9FA 2FN7A 4DSOA 4W9NA 4ZYXA 5COQA 1XSEA 5AVKA 4B44A 1PNOA 3DBRA 3HRHA 2CDRA 1QB8A 1QKJA 2F48A 2O4UX 3D54D 2Q0SA 4IFTA 2X13A 4LISA 5BQ5A 5EHXA 4KFCA 3HXOA 1A97A 1JE1A 2VOJA 5ENVA 1C3XA 2AHRA 2NQTA 3WV5A 2AFIE 4QJBA 1YTUA 4HQ6A 3S2IA 5ILGA 1I01A 5MF6A 1RBMA 3IBFA 2WDPA 1K97A 1UFQA 2D0DA 1YNOA 3QVXA 5AMXA 1NQXA 2QP4A 5DI3B 5CM9C 2BN4A 4UPVA 5REQA 1HE8B 1MC4A 3V2UA 3TXXA 5A03A 3D81A 2YMMA 4IDAA 4INOA 4J07A 5BOSB 1OBVA 4HS9A 1EP9A 4LXQA 4TLMB 4UVEA 1KYQA 2VHWA 3KTOA 4MVJE 4YLYA 2IZZA 2XVMA 1MEEA 1SOAA 4OA8A 4N1AA 2AZ4A 3I4FA 3EIOA 2DLDA 1YB7A 4GLLA 3DNFA 3TJRA 1ZW6A 5KOYA 2Z8ZA 5JS6A 2AR0A 2PUEA 4QTUB 3W06A 4BVHA 2G06A 2PKEA 4NEQA 1D2RA 1KZGB 2AK3A 2PN1A 2KS6A 3G5LA 4INPA 1C9DB 3DT6A 1HDGO 3TNDA 3W2FA 4DCCA 3WQRA 1G6HA 2E4YA 3FGZA 5E8JA 1Y3CE 2OMKA 3N8HA 2FY8A 1EIZA 1E5XA 2P7IA 4L4XA 4J4TA 1L7DA 5DCUA 3WGOA 1B3RA 1W35A 2CXSA 4YUZA 1RWBA 1W8IA 1Z83A 2VNSA 3HI6A 3Q6IA 3QTTA 5CW2A 1GD1O 3UGQA 4KXMA 2H4HA 2NU6A 2OC4A 4KTVE 2O3QA 1X1DA 1YZTA 1ATZA 1KZ6A 3OZFA 4X63A 1KAQA 3MWEB 2VNIA 5HQ3B 2HH9A 1T4BA 4RU1A 1O6GA 2RK6A 4Y0NA 1OH5A 4Z0NA 4YRJA 1FTWA 3GEEA 4IXNA 4WNAA 1MEJA 1Q3KA 3JQAA 2PGJA 3NVAA 3O3OB 4XB1A 5ECGC 1MABA 4Z0PA 1AHNA 3ZK9A 4QPDA 4X41A 3DTTA 1KQ3A 1J0CA 2CMGA 2OCIA 1SELA 4HDQB 1XD2A 3ADKA 2XJ9A 5EFOA 4KMSA 1K8YB 4P1ZA 5BN5B 1QQAA 3GROA 3T1QA 3TG2A 1QLHA 2A67A 1N25A 4B09A 4BXOA 1DKLA 2QDKA 3LX4A 4DM7A 4TYQA 2ZANA 4A2CA 1NUHA 3NTXA 4FZJA 5HFNA 2OD7A 3AJDA 4AKSA 2JIZD 2C4WA 3EGCA 4M0MA 3DTVA 4ROTA 2PTGA 2WWVD 2C4VA 2Q99A 1XYVA 1IHUA 2JBAA 4G5YA 3G2JA 2Q49A 4F12A 1OFVA 5BWLA 4HRYA 1O0SA 4G0MA 3LXXA 4KEAA 3CZRA 3KP1A 4TV8A 2ODQA 1RJGA 1GILA 5E6RB 3V8PA 3PC8C 3MQFA 2EIXA 2QSUA 3O0TA 2WD8A 3AVVA 4NZOA 3LY5A 3TLYA 4IIGA 4DR5B 2WWTA 5ECYA 1L5VA 1S3IA 4Q4DA 1OLXA 2O4CA 1HDYA 2JBHA 3RIMA 4V1CB 4Z1MD 1XEFA 4X5OA 3IKTA 2P3SA 2VDWA 2HGZA 2VTDA 3ECCA 3JQAD 1QWOA 1MZVA 2C5AA 4XWOA 2JGAA 3U17A 1U0SY 5KCZA 4MICA 1ZJJA 1IQPA 2WSSD 2OV4A 3KE9A 1T1RA 1L5FA 1QSGA 4FHFA 1QCDA 4L5YA 4Q4HB 1JJVA 1WMDA 4EYSA 1JNYA 4RV5A 1SXQA 1G59A 1S2OA 4D0NA 1L5HB 5TB5A 3W5SA 1TCUA 2B4QA 1PR3A 1JEYA 2DLCX 3S2FA 3OQ1A 3F5MA 4I5IA 5LZ9A 3BXXA 2NVWA 2FW6A 1JYFA 4MEBA 4Y9TA 4ZWNA 5I7AA 4A9AA 4OBXA 2B2NA 4MTCA 1TD9A 2F1OA 3FI0A 3OCVA 2CKDA 3L8FA 4EMBA 3IKLA 2C42A 3I6YA 4G8BA 2CSUA 1OZ0A 2XD4A 3JQFC 5EE3A 5ICFA 4EZIA 4DDTA 1G7RA 1B3BA 1QHYA 3LHIA 3H5AA 4G0PA 1AJEA 4ZCRA 3WL6A 3OHSX 5D5HA 1IHDA 1WIWA 3AI3A 1U2GA 5D86A 2EF1A 3NHPA 2H1CA 2RHWA 2QR5A 3AIOA 1I4DD 3QEKA 4UTRA 1SVKA 1NX9A 2C2OA 2YRWA 3SJBA 4COOA 3PUJA 1XVIA 4ZZ2A 4G89A 2HB6A 4YJDA 1JKMA 3A1NA 2E37A 1CEQA 1X7HA 2Q5JA 3M5DA 4V02A 3HE3A 4DMGA 4KMMA 5BW5A 1L7AA 3MIZA 3OQNA 3QF7A 4QFDA 2O7NA 3F4KA 3GBSA 4U8HA 5EYPB 1CY2A 4CCSA 3P2MA 1LSOA 2YJ3A 4Y2JA 4YUYA 6ABPA 4IDFA 4LMBA 3GQVA 4G56A 1HNNA 2J09A 1TUEA 2PRKA 2YH2A 3K30A 3NLLA 3PWSA 3RH0A 1DG9A 4B84A 1X7XA 2F8MA 2NV6A 4P7JA 4MGEA 3USCS 5JTTA 4AJLA 3NUZA 2C4HA 3C43A 3S68A 1XMSA 2D7CA 3NBFA 4G25A 4BX3A 1MO4A 1U7UA 2O8VA 2AEJA 4RZXA 3AGQA 1BFDA 4I2VA 5K0CA 4LVUA 3TBHA 5EE5B 4LYEA 1PZHA 1AMOA 4X65B 3VRHA 4DSZA 4FE3A 3IOCA 4D9FA 3BFXA 4EJMA 1FVOA 3QY9A 4B5KA 2WHPA 2DGDA 1WHSA 2C5FA 3W2EA 4N7BA 3L6CA 3U7RA 3EXIA 3DL7A 3MT0A 3EFOA 1AUPA 1MGOA 1URPA 3KKNA 3WWEA 2AYZA 2PKYX 4Y2HA 4BJ6A 3BWCA 5JEEA 1KU0A 1Q19A 5KOJB 1V11A 4A0RA 2ZVDA 1G9TA 1T9KA 2WAOA 1V8BA 4FEEA 1HRKA 5DW0A 4ROSA 5F12A 4MWSA 3MLEA 3VZPA 1XKQA 1EFHA 1Z6QA 3NBXX 1JR4A 3EG5A 3PL5A 4LXIA 3M6FA 4N5MA 4ZJPA 2XGJA 1LRJA 2HTEA 1YRHA 3KQPA 5GAJA 3DMRA 5KSWB 1T1EA 2QJTA 3OE5A 1HE2A 3H97A 3TOVA 2DPLA 4JODA 2WU4A 5C34B 3ITDA 1IAVA 4YRFA 3KQHA 1WB4A 5LWHA 3E48A 4M1OA 2FR8C 1NVTA 2BDTA 2OHFA 2QG4A 4WN3A 1RYBA 1VYVA 2H1RA 3Q0EA 4C14A 4CW7A 1K98A 2A9OA 1P5HA 2VZEA 3BRQA 4E2YA 2GPNA 3PFWO 4RK4A 3A37A 5EJ7A 3KUXA 5SV2A 1E1CB 5D6OA 3ZKWA 4R40A 4HYEA 2F00A 2BR3A 2OBFA 2RJ3A 2B1IA 4L50A 2GCGA 3OLWA 1UM9B 1T6BY 1J70A 2ETVA 3EVGA 3IXLA 2OO3A 1X42A 2JANA 1TQ4A 3JQ9A 4J9UE 4WOBA 4ZCLA 4B0OA 3L43A 3LO5A 4ZVRA 3EYWA 1Z22A 2I6XA 4Y9RA 2GN9A 4K88A 2H17A 3UOAB 2YOHA 4L57A 4BEBA 3C3YA 3H1BA 4YV0A 3K8OE 2BL4A 1U98A 3AEXA 2DUWA 3KE8A 4IVQA 4IHJF 4MKFA 4XQEA 4ZD6A 3U1TA 4F7DA 3IAS6 4NL4H 1HYEA 4XTCS 2GX6A 2JRLA 2VP5A 1ZVKA 2JS7A 4KRYA 2C3UA 3PD0A 4NBNA 2WQZA 4CE6A 3P96A 3IVCA 4PN7A 2OZPA 4E7PA 4F97A 1KVTA 4KLCA 4BUZA 4HKTA 2NYAA 4HNTA 1W5TA 1XYGA 2BJWA 4HB2A 1LFDB 4M1QA 1BEUB 3BBLA 5EQJB 1XNHA 1ESMA 3LPDA 3UYKA 2P65A 1I9GA 1ZMOA 1S96A 4RGVA 3ZDQA 4PCVA 1SU6A 1ISHA 1PCXA 4MGYR 3FUXA 2HPAA 1W29A 1MX3A 1W94A 2JL1A 1C0LA 1PKXA 2FSSA 2ZYGA 2DPXA 3LDGA 1GPAA 1PEDA 3V8QA 1DAMA 1DUVG 4KQWA 4WCFC 3TAHA 3W6OA 1PS9A 3CJQA 3MOGA 4M0DA 3GXBA 2Y99A 1DJQA 1PR9A 2G4LA 2Z2IA 3MMSA 4I3FA 5AUQA 1YB6A 3RBXA 1KWGA 3HUTA 4JWKA 1XMIA 2DUJA 3O9VA 5AI4A 4ZFNA 3SZLA 7MDHA 4L8FA 4WAUA 3VSBA 4B87A 1HC7A 2V7WA 3M1YA 3SIXA 1SHTX 3UV3A 5C4IA 4DMFA 2IZ7A 4LV6A 3QQ5A 2FJ0A 2BP7B 5JSKA 1YFLA 3R3WA 2HSDA 1YDEA 4QC2A 2H2DA 3N7AA 3RSFA 3BK7A 2ZZMA 2B30A 2YQZA 3ETDA 4MLDA 3NJRA 3OQMA 4N03A 4IUYA 3I6BA 1P2TA 1I3NA 4TQGA 4XDHA 1Y5IA 3GVXA 3KQMA 2E5LB 4JSRA 1BD4A 3M8KA 1ODSA 4C5AA 3GLFA 2R97A 3ZG6A 2G70A 5FUMA 3TGPA 1X19A 1EXWA 3G2OA 4TZTA 3O83A 1H42A 3A1CA 4MV4A 1LF0A 1JDTA 3LGAA 4UKDA 4AWXA 4HTFB 2FXVA 4TSKA 4X7BA 3FHLA 4YTEA 4AJPA 2D1SA 2C7PA 2WFMA 1H6DA 3AF4A 4OCZA 3ET4A 2X5XA 3T9FA 3LP5A 3URKA 2R66A 1U80A 2W6IA 3UJ7A 3OA2A 4UOEA 1SVIA 4KDCA 1Y8ZA 1I0LA 1ZO8A 2PD3A 4LY6A 1KI3A 5DPMA 4PZPA 2CUTA 2IPLA 3QVSA 1QP8A 4EYGA 1SCBA 4YAWA 1Y9EA 3E9QA 3GCWA 3H2GA 2AG1A 1OWLA 4Q24A 1D0VA 3DC7A 4JLMA 4NBKA 5FFFA 4ZCPA 4GPIB 3RGGA 4AF7A 2Z1DA 3DBVO 4EHHA 4S05A 5T8KA 1LTQA 4C05A 4D5GA 1NYQA 1N2CB 3LQ1A 1O6CA 4ZCIA 2VBIA 1T10A 4MMZB 4CL3A 3WMFA 3B3FA 4L9SA 3V2HA 4QARA 1GU7A 4UBOA 2QD2A 5BQ3A 2OAEA 4XVQA 4YH1A 2PXCA 3EASA 3Q3EA 4H7JA 4I9NA 4JEHA 4UHDA 2WABA 2PKCA 3M81A 4NOKA 4O4LA 3VR1A 2F62A 4KXWA 1VFPA 1EM8A 2IXEA 3BE5A 1H1DA 1WAMA 4GC5A 4U0JA 4G6ZA 5FOUA 2EBUA 4TVBA 4MA0A 2JJ1A 2YHIB 3GRCA 3RBZA 2SICE 3G2LA 3KQSA 3GA0A 4JN6B 4QUKA 4MB6A 4F8EA 1IOWA 1YS4A 1D2MA 1CR0A 5L3SB 1CU1A 1R8YA 2JJQA 1FW8A 2R7AA 3X1MA 4BVBA 1W6UA 5AIAA 3BORA 1QE5A 2YIMA 5JS8A 5KIAA 2WY2D 1C8BA 1L4NA 2G08A 3PHIA 2JGRA 4IY1A 4L0DA 3RFUA 3NMUF 3D9QX 3OZWA 3VZCA 2YY7A 5JQGB 1HNZB 3HBLA 2O0KA 4XQGA 1NI4A 1VA4A 5BY2A 2ZPTX 4FGKA 3L4BA 4UZSA 3B5EA 5C1IA 2IYSA 4IUCS 5DNVA 1O58A 1ZSYA 1VCMA 5I8WA 1G8SA 4CM8B 5JMOA 1OB5A 3HZRA 1YZQA 4LMRA 2D7DA 4E5MA 4JMPA 2PWAA 1J25A 4DMMA 3UMMA 1WPXA 3G2PA 2P9ZA 3HVJA 1YRYE 2IYLD 4IXWA 4QEDA 3GRZA 3JWPA 3HWX1 2CDCA 5IC5A 1NX6A 3VVMA 4CLDA 4UD6A 5A6VA 3LWDA 1PDWA 1SHJA 1UEXC 4KDRA 1JA1A 2Q1TA 1A5ZA 3O3MB 4JLOA 4L5IA 4EDFA 4MW0A 1JH8A 3RD5A 1WCV1 5LLDA 4K28A 1MB9A 5KSOA 2RK4A 1TIKA 1G7CA 1RBQA 3DG9A 1Z5NA 2GBLA 3U40A 4O4JB 5KUTA 3IDOA 1TIBA 1VM6A 3CR7A 4Z4HA 1VHWA 3OJEA 4Y6PA 3QMWA 3HV0A 1CEYA 3VHLB 3RFFA 1BHO1 2HGSA 1I7NA 2ZXFA 3LSTA 2ZWVA 4Q1DA 4Y6SA 3EZLA 3BIJA 3OOEA 4ITRC 5FBQB 5I8ZA 4B8ZA 2O8EA 2C0PA 3ZCXA 3WQHA 1ZM3A 2W8BB 4A6PA 2HA6A 2GF2A 3QQPA 4LF8B 5I48A 3A05A 1V8OA 3DB1A 3CIOA 1PHRA 4TVKA 4YRBA 4NG5A 3K6SA 2O19A 3WMXA 2Q9BA 4MGIR 4W5OA 3FH0A 2R6ZA 3AR9A 1FDVA 3R6LA 3M4ZA 5AVZA 1AXGA 2WPDD 1MOPA 4G1VA 2NYUA 1GG8A 1X7YA 3FMPB 4BVKA 1R6TA 1HA3A 3D1LA 4L8VA 3UT6A 1ZJ6A 4C4YA 5H4GA 1FNSA 2IDZA 2OBXA 2HWXA 2PT5A 3RHSA 4C30A 1JFFA 3UOGA 4AT1A 4C7JA 4YCSA 1L7RA 1VCNA 4EQ6B 5BUCA 3MT7A 4QTYA 4PNZA 3LIPA 4X1YB 1ZOPA 1J99A 3O91A 1MO5A 1L3IA 2MSWA 2QLJA 4HBZA 3KYJB 3CPSA 1GUAA 1N6PA 1D4ZA 1N2SA 3QU2A 2Z3ZA 4IDPA 4JLDA 4OQMA 1T9CA 1I14A 2ZJ8A 5FA6A 4CTMA 4YUVA 3JVUA 2GRAA 3PPYA 3QHQA 4W8HA 2PV0A 2O8FA 1NE7A 5IJXA 3RS5A 4DAOA 4JCCA 4YCBA 1Y4ZA 3GIWA 2ONYA 4LOJA 3ODPA 4Q37A 1NR5A 3DCYA 3CRW1 1CKEA 1DAGA 1CC1S 1VPEA 1MCZA 2PRYA 1SK9A 4P7GA 4FYWA 1RWMA 2C9CA 3BIFA 1VSTA 2DPHA 2Z2KA 3UBMA 4FFDA 5TIIA 4JJ7A 4YDSA 4AXXA 2JVKA 1E9AA 1DWPA 1IAQA 4V38A 2H1SA 4J7CA 1XDZA 3PNPA 5JNWA 1NQVA 5GM2A 3PI7A 3QKSA 4HQKA 2B8JA 3LA6A 4ZOCA 1B8PA 1K5DA 4UBMA 1GZ6A 1UDBA 5GTDA 3DUFA 1Q1AA 4NY1A 3DMPA 2XUQA 1W5EA 1WG8A 2A57A 4R3WA 3R9XB 3DCIA 1KVSA 5TT1A 3CTMA 1UP7A 2J41A 3VI4B 4AMVA 3JYNA 4GL2A 2XYGA 4P98A 3INYA 4BP9A 3INNA 1EVLA 1SBCA 2ZUEA 1LJ8A 3CNQS 4FUQA 2VDRB 2FVXA 2ZBRA 1NDUA 4K1XA 2B20A 1GVHA 1JXOA 4IDCA 4V0KA 3LHFA 1CD5A 4H0NA 4ZO6A 2Q5QA 3U6BA 3SHOA 4PIPA 2E4UA 2XNKA 3JZIA 5LQRA 3LQQA 1DTEA 3IR6A 5G02A 4B2YA 5IJZA 5EIXA 4L7QA 3VUEA 4L16A 3LT5A 1S7GA 1P0IA 1QV9A 2J5KA 1NFQA 3HLKA 4JWTA 2ZJ4A 3NWBA 5JDIA 3K73O 4L08A 5L3VA 2Q8NA 3BD7A 2IV2X 4E5UA 2WE7A 2XBMA 1T8PA 3DC2A 5E3IA 3PC7A 1QK3A 2IGBA 3REGA 5T6MA 5LNK6 3QBVA 3MWDB 1E1LA 1OLSB 4BLWA 4MQEB 4C4XA 1MF7A 1I30A 1ODIA 2YV1A 4URWR 4EITA 1EP3B 2BI4A 2YHUA 3ORRA 2JLRA 3WLOA 3EEOA 3U44B 4H35A 1IE3A 4MPDA 2HYIC 3WRVA 5FTJA 2OQVA 3SLRA 3FPSA 5EQTA 5J63A 1A1VA 1H9CA 4R2JA 1A5BB 4PLTA 5IC4A 2XSZA 3NXSA 5CFPA 1S01A 3A1UA 3CF2A 4GPTA 1JR2A 2JJ8A 3ZCVA 4R8LA 4KITB 1L5MA 3UV7A 2PNFA 4AY4A 5A4MS 3CN7A 3WI7A 1C81A 3JWIA 5BXQC 3KYDA 2ZYVX 3OCZA 3C3WA 4GT1A 3JQ7A 4ND5A 4V0QA 2O48X 3IQEA 4ZJZA 2H63A 1CP2A 3C7DB 3GEBA 1XD9A 4BDTA 3PJRA 3M6VA 2UZ0A 2WTXA 1R5NA 2FPIB 2WTNA 1PFKA 1PZEA 1XDBA 2R7LA 3E9ZA 3RS0A 4I1IA 3UMCA 1QU2A 4XXHA 1EG2A 1JEOA 2FX2A 2PLAA 1TCAA 1P3JA 2E2WA 2G71A 2P2NA 5FWYA 5K0SA 5HIAA 1PGNA 5IF9A 1D5WA 1KRXA 3B48A 4X6UA 3OCYA 4DYHA 2K4MA 4L22A 4M8SA 4XX1A 2AG8A 1N2OA 5JO0A 1N78A 3ASYA 3VOTA 4M1KA 1WUYA 2D1YA 1DDOA 1XELA 1JALA 2XT0A 2CL5A 4TQUS 4PYNA 2KBEA 3J81A 1JR3A 4RA9A 2CNBA 4UAJA 4ONEA 3Q0TA 3R7NA 4X8OA 3MQ2A 1EK2A 4TUYF 3TXAA 2GXQA 4G1CA 1NVUQ 4G5OA 1L4LA 3FTQA 4WNYA 1UDXA 2ZI4A 2GJKA 2XSZD 1IY2A 3MA0A 5I9IA 2B2CA 5JG7A 1MNQA 1XQ9A 2QX9A 4JC0A 4PPGA 4Z6KA 3HCFA 3RT9A 4QNRA 5I7FA 1WWKA 3KZXA 3IUMA 1CUFA 1GYPA 3DLIA 3DF9A 2EAUA 4JU8A 3W1EA 4JC8A 3ZQ4A 2B7CA 3DPUA 4MQUA 3LV8A 3P2IA 1ZJ5A 3OPNA 1SXPA 4FC6A 2V0NA 4PHFA 2YZMA 1DEHA 1G0NA 1W8DA 4JQCA 4MR7A 2WYOA 2FW9A 2FYTA 3NVDA 4PXAA 4AQ7A 4JJEA 1V41E 4HH1A 4HZUA 3RYIA 5H8WA 2DB3A 3U4QA 5CG1A 3ICEA 1IMJA 3HCBA 3FVWA 2ZVQX 3O21A 2OZVA 4XVHA 4LDPA 2DFNA 5IEJA 4OHYA 3GO4A 2JK1A 2R96A 3QPBA 3B5JA 3H9UA 3M6XA 3I23A 1QQTA 4W82A 5G2OA 3QENA 2L0XA 1G20E 5BNFA 1NJ2A 3MJ4A 3RTBA 4WFIA 3SSNA 3MCAA 3UC9A 4B32A 1MAWA 1QK5A 1XZLA 5DO9A 1KJNA 4NSNA 3BXOA 4HB4A 4KBFA 4RZQA 3R6TA 3T7JA 3ZBPA 3EFBA 1LWOA 3OQHA 3KETA 2C04A 3T54A 4DLBA 1YO6A 3GBPA 2XJ4A 3CLSD 3M2PA 3LWBA 1EBUA 3UWPA 2AFIB 4MUMA 3WKDA 1F2DA 1ECFA 3SC2B 1PL8A 5H0IA 4YJGA 2WAYA 2LCFA 3P2EA 3A10A 4YMWA 3V2GA 2GHRA 1CZNA 1XQXA 1V4VA 2GPYA 2H54A 3PFGA 1UMCB 4RS3A 4TV9F 1NXOA 5BQOA 1RM0A 2IYAA 3N28A 3GEGA 3OIWA 5DHQA 3QUCA 3A6HA 3FPKA 4D8VA 3L4JA 1SG9A 2WU0A 3OT1B 4IX1A 1LX7A 3IV7A 3U13A 4XPIB 3T9BA 5LLSA 1FNBA 3KSAC 1DAIA 1LBQA 3UKOA 4F2GA 4EZBA 4MK4A 3ACBA 4MRNA 1QDLB 4Z2AA 3PG5A 5CNIA 3WL8A 5CLFA 3IUNA 4GKAA 2FPGB 3AM3A 4B35A 3DAHA 4GFDA 4G63A 4UMEA 4GI5A 2QT9A 4ZVKA 5LSAA 1X9HA 4D4LA 2RARA 3V97A 4LMAA 3E0XA 1CJCA 3KS9A 1T0PA 1YIDA 4OQEA 4RJJA 4TN1A 1P2GA 2HK6A 5KQLA 3N7UA 4NCHA 3VJKA 2OXFA 5AJYA 3ZI0A 1ECGA 4XM0A 6ADHA 2C2HA 1FRNA 2HWWA 3B13B 3N39C 3L0BA 4NYIR 4HLQB 1DC6A 4AROA 4OHOA 3AKEA 4FEAA 5DBGA 3TLGB 1IZ9A 4U9UA 1QE0A 4OHXA 2X0DA 2DQ4A 2P9GA 2BM9A 2GSDA 2RAVA 3V6MA 3QPAA 2YYZA 4CDRA 1PLLA 2OE2A 4RY8A 3AESA 2ZB8A 2H2FA 5KTYA 4UM7A 1H85A 1LGYA 3DO6A 3IXMA 3B1XA 2F1IA 3R41A 4YAGA 4ZYVA 1BTOA 1J8YF 1UL1X 1EU1A 4MUEA 4YROA 1XR3A 1Z0KA 1X2EA 5TEVA 4ARVA 4IFEA 3W4IA 1SO8A 1AIPA 1GQYA 4HGNA 3DL2A 4PBRA 5IULC 3DFFA 4ATNA 2JI9A 2ZWPA 1RCUA 1AQJA 4EPXA 2ZYIA 1CS0A 1EHCA 3OETA 4HNAB 2WWYA 4BJ1A 4NBRA 1NU6A 1GPJA 3T3OA 3A3PA 3OFNA 4I6GA 5F76A 5CX4A 5LQUA 2B83A 1D8TA 1Z0DA 2YMQA 3CKYA 1R0XA 2JKYA 2B5WA 2Z2XA 2Z8YM 1P1CA 3AF0A 5T4FA 1FIUA 3WRYC 4CMEA 4YJ3F 4LZJA 1RU3A 3JQBA 1LX6A 4M8IA 3EZGA 4HAXA 3BWXA 3GOQA 2PXHA 1TNDA 4MS1A 3T3GA 5FUQA 3B6IA 4MRMA 2QQEA 1N0UA 1EDDA 4TMFA 4P58A 5DHPA 5B1SA 3QXGA 1EX6A 3DV9A 4BMDA 2QENA 3N87A 2P9JA 2GK7A 1X86B 3RRNA 2XKJE 4BZQA 4CGZA 1NE2A 3DL4A 2BGIA 2ONZA 1W6RA 4H7DA 2HA7A 5JD4A 1R4MB 4GXNA 4N3BA 3AF5A 3ADPA 3BCRA 3PFCA 3ZQKA 3DFZA 1XTZA 2OAGA 2OXEA 2QLMA 3VNBA 1KI9A 4E5SA 4TQAA 1DO0A 2ODEA 1E7QA 4UEWA 3E5MA 4RZSA 3AF1A 3LDFA 5C2JB 4LI0A 3K2IA 4PANA 2HRZA 3FUTA 4DWWA 4D7AA 3MG9A 1NWHA 4EJSB 4ZN6A 4NCIA 3RU2A 1OAKA 4ML3A 1X7WA 4ES6A 2HXYA 3W7BA 4IDBA 3VYRB 3FKSA 3BMNA 2X1VA 3PHLA 2QYSA 4D45A 3CJTA 1VHTA 3OFND 3UICA 3R75A 3WNDA 3MUNA 3IS3A 5KEIA 1QYVA 3W6PA 4EY3A 3ENKA 1A27A 3CYFA 3GELA 4FR0A 4ITVA 5JJLA 3I9V6 1C7IA 1ML4A 2CN1A 3KQTA 4HPJB 1QNFA 2OOSA 4OL9A 4ZOAA 1H2ZA 2WFZA 4FYYA 4ZT3A 2HXSA 1E1YA 4EY8A 3HY6A 3TQHA 3C1OA 2ANCA 1Q57A 1IUPA 2E82A 4R68A 2PU7A 5JCZA 3VJRA 3PRKE 2FKNA 3IBSA 2IXTA 1YKGA 1IM8A 1AO3A 3HJHA 3I72A 3K8YA 1KYIA 2GF0A 4RS4A 5JE8A 5JRDS 4BO0A 1GAXA 3VH2A 2BRUA 1KFCB 1Y8QB 2WT4A 4N0PA 1BFUA 2GARA 1QIGA 3DH0A 5ALVA 4BO7A 4GBJA 3BCHA 2BM8A 4FCVA 4FFNA 1IUNA 2R8RA 3EZYA 2NNWB 4LQLA 1DBPA 1WXIA 2HCFA 4TLEA 5ALUA 4AN1A 4JQOA 4Z7NB 1YQXA 3TB6A 2NV2B 1YK0A 2VRWA 3HYLA 4C9BA 1P5RA 2NPOA 1XA4A 2HLNA 4LGYA 2I33A 4RPGA 1LA2A 1M83A 1GGNA 3G0DA 4RIGA 5L4NA 1EGAA 1Y3IA 4J1NA 5HR5A 1BNCA 4E2FA 1R9MA 4NZNA 2VHQA 2XQKA 2VPPA 1AY0A 3BG5A 3T1NA 3WLJA 2C03A 2J9FB 1ZUWA 1PYGA 4RMJA 2QROA 2NU7B 2QUHA 4B2IA 3EK2A 1IZ7A 2X7JA 2DAPA 1KJJA 2G1UA 2Q46A 2ZBUA 2QJFA 3D31A 4R0NA 5BR4A 3GUVA 3QMVA 5L53A 1A04A 1ZSNA 4MHTA 4EB6A 3GHHA 5B7GA 3G49A 3MHPA 5AKYA 3MWEA 4D8YA 1IOLA 1QE3A 3B85A 4ND2A 2QV7A 2Q7OE 3DDOA 4NU0A 4P3NA 5HQ3A 1G0OA 3A25A 4CDMA 3GP8A 1ISSA 1O95C 4L9RA 3C14C 4C7OA 1IULA 1JSZA 1P6UA 1QZZA 2NVBA 5FFNA 2M6RA 4LZZA 2L2QA 4BB9A 1T0JB 4LDJA 5AKHA 3ZW7A 1EDOA 4TTTS 3RJTA 2C2XA 4LJKA 4DM4A 4DV2B 2GD2A 2FPXA 3RDPA 4IIFA 3FOFC 1H4SA 4QNMA 2DOKA 4BEVA 5G1OA 3OM8A 1WDWB 4YMGA 3JATB 4K9DA 3OQJA 3STYA 1XIVA 1JPUA 4AIRA 3UWSA 3HKDB 2PZMA 4WA8A 5JUWA 2D2EA 4ARBA 1A4RA 1WOMA 1E2QA 3MJSA 5I4BA 1F20A 1Z82A 4OP3A 1CERA 3DEKA 1T13A 3FPAA 1QPGA 1JHVA 3OIFA 3HM9A 1I9CA 4HFNA 3UK6A 4BNDB 3MINA 3PU6A 3ZYCA 3U6KA 3TI9A 1LCIA 1EVEA 3ONWA 3C3AA 3OC6A 4OFBA 3FYCA 4HLUC 1M3SA 4G1MB 2EHJA 2NG1A 3NAMA 1B42A 5EINA 4DNFA 1XJWA 4BEJA 4UQLA 1R7RA 4L75A 1ACJA 5AM4A 5JZSA 3EVTA 3MTGA 2QLLA 2Z56A 1Y5NA 1HYGA 1J2JA 1KC1A 4RWZA 1UZMA 1HLGA 3TUJC 3PJFA 4N5NA 4B73A 4EHJA 1JPJA 3LHKA 1Z5GA 4DANA 4E21A 2NSHA 3BFKA 3FYUC 2C5SA 2WJWA 5KQPA 4N12A 3NEYA 1L4EA 1PP4A 2FK7A 1LU9A 1KARA 4G0XA 1DELA 5JDCA 1E2HA 1G8GA 2GJ4A 3AXTA 4L1KA 4LG1A 4N6GA 3C15C 1EXDA 3D3WB 3FNGA 4ZARA 5C46F 1XVLA 1K63A 1U99A 4LVNA 1L5HA 4R1LA 4F96A 2FWIA 5CLGA 1LFAA 3HNOA 4I9FA 4WQMA 2I99A 3M6WA 1JRLA 3UAXA 4EVQA 2E85A 3IOMA 1SG6A 3NNSA 5JO9A 2V97A 4X6XA 3QVVA 4GSLA 2GYVA 4PLCA 3I58A 3T12A 4A6XA 3ZW9A 1UBNA 1ECJA 4C22A 1AD2A 1TEXA 1P61B 2DFVA 2JIPA 3IPXA 1KDYA 4PC6A 5ALWA 5LB2A 1LJLA 5DLDA 1L8QA 4L6CA 5CLLA 4NJEB 5K1ZA 3UK2A 3OVMA 4BX2A 2I2WA 2MWMA 2PGNA 2JHFA 3A6LA 3DCJA 1EWKA 3IAM6 1I0IA 4G36A 4O0MA 3L4EA 4Q4AB 4TM7A 4CKWB 5IKMA 4HSGA 4S35A 5CFRA 1M1YA 2QAGB 5U4QA 2WF5A 1RRMA 1M54A 1UQRA 4TYPA 2REQB 3AB3A 4RDHA 4E94A 4DLUA 4MI9A 1ZZGA 2VDQB 5LM3A 1GGEA 1UAAA 2VH1A 1QQBA 4OQNA 4IDQA 4FBLA 1RCFA 1Z0IA 5JSQA 5AVXA 3VJLA 4Y2QA 4BP8A 1Y6ZA 1XCGB 1SBTA 3AZPA 3R7AA 3L6BA 1IY8A 1QTNA 2XV1A 3Q6NA 5EYPA 1YQEA 1ICIA 3PUKA 2WZCA 5A4DA 5GVSA 1G7TA 1BFKA 1JJBA 1U5CA 2R6CA 4G0UA 4B6QA 5LD2C 1TM2A 3II6X 4AJNA 5GONF 3NKLA 5DK4A 3V8MA 4WNCA 2R79A 1ZEMA 3F3SA 4Z3DA 3ZZTA 4CMKA 3OKPA 1Z5VA 3AHIA 3C6YA 3DV0B 1HT1E 3WBJA 2B21A 2C3YA 2QLFA 2AS0A 4RHCA 1GFWA 5AVJA 3TTXA 3JAWB 1O94A 1X74A 4EZEA 1OGJA 2QM0A 2BHNA 3I4CA 5A7GA 4OA5A 3I52A 4OQDA 2B25A 3NHAA 4EMSA 1A9OA 1ZD9A 3PXBA 3V7FA 3ZUPA 5EZYF 2XZTA 3K4HA 4Y67A 5EXEA 1YRAA 221PA 2XA9A 3ZBUA 5KYGA 4I1PA 4L8LA 2J1LA 4GQIA 1KFKB 3ZE7A 1G5RA 5LZ5A 2OYCA 1E3EA 4KOEC 1EFVB 3KKMA 3H2HA 4ZC1A 3W5AA 4FS3A 2OO5C 2ZJ3A 1NF2A 5KYVA 5BSRA 4EDHA 2GZ3A 3KYBA 4OB8A 3Q9SA 4TLLB 4UHFA 3W2HA 3WADA 2OGSA 2CZQA 4RK5A 3LYHA 5DMXA 5JNLA 4I4TB 1JLLA 1TYAE 1HEUA 1L7OA 4J2TA 1IDOA 5A9SB 2JLWA 1C2YA 4BC0A 5DT2A 1ORHA 1G8PA 1JT2A 1USWA 2IUEA 5HE9A 3RJ9A 4DZRA 2BFCA 4RF2A 2XT9A 3H2IA 3VNSA 4BMZA 5A62A 3D2BA 1BEEA 3UCEA 1NTRA 4B8WA 4PGHA 2QZPA 3SDBA 2L69A 2R5FA 3NOQA 3VVBA 4RCYA 1TQDA 4R1TA 1KK0A 4UNRA 4BBZA 1LPPA 4Y18A 2C1ZA 1XNRB 4EG3A 4D9MA 2NADA 1E2FA 1I5EA 1O94D 1X7GA 3DEAA 5CP8A 1Z18A 2EGGA 1FC0A 3EWNA 2DTXA 1E1CA 5CX1B 1KAMA 1XCMA 1JPNA 4JOCA 2WDZA 3OU7A 4QUAA 3TTYA 3V1TC 4IKEA 4DAEA 3RKSA 2GKGA 1GITA 4WEOA 5AW0A 3RYCA 1FP7A 2O2EA 3DVRX 3FWHA 3OUZA 4LF6B 4S2UA 1LPNA 4FU0A 5TVKA 4P81A 2Y1CA 1XQ1A 1ZIOA 3HCNA 2A59A 3E27A 2MSDB 3OPMA 1XZCA 5EXDA 4PGFA 3CXUA 1UDAA 3T3MB 2FGJA 3SF8B 2HSEA 1PHPA 4LXGA 3SC4A 4F5WA 1XI2A 2ZXEA 2R65A 4UC0A 1W25A 4Q3BA 1XLTA 3QFSA 1KY2A 1WSWA 2WD7A 5A5EA 3C85A 3ZHTA 2XYQA 5AK5A 5DWVA 1BQEA 1PGOA 1AF4A 1X3SA 3UJAA 4AS3A 2YZ7A 4GXQA 2WBLC 1LSSA 1A2OA 5K7SA 2FTKE 5I7VA 1TF7A 1A8QA 1TL7C 3VAYA 1AVTA 2AWOA 2PGAA 3OX2A 2G3YA 2XZPA 1T9GR 1L3CA 1DVRA 2ZE5A 4K6MA 4NMMA 2AOTB 2X3UA 1LSJA 3ZWMA 5IZ4A 3E3MA 4UREA 2B1RA 5B58T 1JG2A 2CW5A 3UZUA 2P90A 3ORSA 3P4XA 1XRPA 3B2EA 2N42A 3K1TA 3DMYA 3PX3A 4TMVA 1V8PA 1BE0A 4KDEA 4MRVA 4K9SA 5EIFA 5FI0B 3S81A 1NW5A 3P45A 4KYIB 4OMUA 2COUA 5DXFA 2YFHA 3D4NA 1UIRA 4UM9D 1P31A 1ZVMA 1AQLA 1MXHA 3P9XA 1OYYA 2CUZA 3WWCA 4ZKDA 2QGZA 3QW4B 2CJXA 1BWQA 3TZBA 3FDXA 1ILEA 1D3AA 2GAOA 4CL8A 1TF2A 2DYKA 2OCYC 2BP7A 1DRWA 5LDGA 3NT5A 1CYDA 1KBOA 2G4VA 4QQ8A 3WP1B 2AOVA 3G7UA 5EY5B 1XA3A 4PN3A 1RM3A 2WWRA 1Y7IA 5EKTA 2EFEB 4WFKA 3L49A 1Y81A 2YFQA 3PYLA 1RRPA 3P9IA 1OJLA 4S3MA 1K6IA 1JDPA 3LTEA 3MJDA 2GNPA 4RD1A 1KDVA 3EIWA 4URYR 3PFIA 4N49A 3W2TA 1QCYA 2R4QA 5ALFA 4Z3OA 1SB9A 1ZBDA 4NOMA 3E6AA 1DX4A 5CNMA 2Q3BA 4H4EA 1JWLA 4X1KB 3QEJA 2EX1A 5LMUB 3TLBA 1CW2B 2WPNA 2HJSA 1VL8A 3BQNB 2QZ4A 4HTFA 4H6PA 2OQRA 3C6BA 4QBIA 2XYPA 5AI6A 3VZSA 3A0UA 4BBPA 3FMFA 4MKIA 3HRIA 4DLWA 1U2DA 2HJHA 4UNSA 1EK1A 3TE6A 4B3RB 3P0FA 2XAAA 3BWYA 1S02A 1THTA 2AOXA 2P4UA 3P2YA 1U2EA 5CTJA 3PWTA 4QOGA 3QE9Y 4RTKA 2YVAA 4BVAA 3BE6A 5F1KA 1R50A 4ZCMA 1PR5A 4JR0A 5LBTA 3SM3A 3TN7A 1M7BA 1GL6A 2HFJA 4QU5A 3OLZA 2JAWA 1PQ4A 2VP9A 1Y7TA 4PU0A 4HHEA 4RKWA 4ZI5A 1CUAA 1DIBA 2SCUB 5C1BA 1FFXB 1KPHA 2I71A 3AILA 1IHOA 4JU9A 5DYIA 2REOA 2XQJA 3O92A 1MO3A 2HSWA 2YHBA 1EXMA 1SIWA 2CY0A 4D56A 2AI1A 4E5YA 1J5EB 1L7VC 4A27A 2IH4A 2FUKA 3DV2A 5FXMA 5JJIA 3KR0A 3QOYA 4NZPA 1H1LA 5DM2A 2C8KA 3LXRA 5EEHA 5C8YB 1JHOA 2DR0A 4R1NA 5FKJA 4D8WA 2O05A 1YC2A 4FLEA 5IT9A 2EKZA 2H7YA 2R6DA 4U0KA 2R6AA 2Z9BA 1V6CA 4CI9A 3WJ2A 3H9BA 3FTEA 2E7ZA 3LBYA 2NTJA 3S1AB 4MR9A 3OESA 3ZVNA 4EI8A 2YYAA 1W5FA 1K9VF 2YHIA 3OIYA 3TNLA 3A6FA 1XLUA 2ZJ0A 3DR3A 3KSRA 4F6LA 1TKRA 5AI0A 3R9IA 2ZRGA 3KD2A 2HHHB 4CV2A 3OCCA 3ED5A 1RJ9B 5L3SA 2W6ZA 4CZ2A 2GBFA 4IOKA 4ZVUA 1C29B 4LKOA 4U2DA 4R7ZA 2CD7A 3SKYA 2ODBA 3BWMA 3HN6A 4L4SA 4AJHA 4BV2A 3DOIA 3ZZMA 3AVXA 3T5PA 2CLCX 3MCZA 2OV2A 3A04A 3BGIA 3V8BA 5C7IO 4UCQA 3V55A 2Y2VA 3OOSA 1A7KA 5AW3A 3WLAA 2J32A 5KDDA 2VI5A 1D9XA 1KH1A 2BCGY 5G4KB 5J2UA 1B2RA 2JAHA 4NYIQ 4CM8A 3RG8A 4EY7A 3N86A 1XQWA 3K6JA 1Z8NA 2IE0A 3W0LB 2N1BA 5KSZA 1AE1A 4EEZA 3VBEA 1JJFA 3EN0A 3NHKA 4ZEMA 1JEEA 1Q3HA 3HCWA 3LUHA 3PGMA 4EGCB 5KB3A 4EG1A 1QVAA 1II8B 1KO5A 3JRWA 1JDVA 3HU3A 3MTEA 3WLFA 5EZSA 4HLUA 2YZNA 1Q84A 5JNVA 4D43A 1GRCA 4JOQA 1DKMA 2ZPUA 3CB4A 4KCGA 1YBHA 2ORVA 3H0CA 1LVHA 4V2IA 3HBFA 1U65A 4WBXC 4AKIA 2I1VB 1AM4D 3HHEA 1VBFA 2ADFA 2FWPA 5JXIA 3C3EA 1P0MA 1ORDA 5KX5F 3ROKA 3QWBA 2J08A 2YZKA 4ME6A 3UMVA 1OD6A 1R88A 1KAEA 1BXKA 1P4AA 4RH1A 1EMDA 4QL3A 1XCPA 5FOSA 1ZOOA 4RMGA 4YX9A 3HDGA 5MN4A 1ZRMA 2Q62A 4DDWA 2VQDA 4DCSA 2EEPA 1BHJA 3W8FA 4DGSA 3UYLA 2EYUA 5JD3A 1RAAA 2PGLA 2VA8A 3F8SA 4JVLA 4BX0A 3CRQA 1N6KA 3VHQA 1W0KD 2BT4A 4QQKA 4LF9B 5DFAA 5EXSA 1QHNA 4Z53A 1XEXB 3NIWA 4DRZA 3VDMA 3S2GA 2O54A 3NWJA 3RAJA 4RFVA 1NUUA 1VMKA 4IHKA 1E3QA 1DRJA 1QUFA 4X1YA 3DAGA 4FNAA 4KWTA 4KGVA 4RETA 2XCTB 2CLHB 4DR3B 3SZ3A 3FRHA 1QAQA 4O2RA 2C9ZA 4DABA 5L3QB 1CZLA 1NN1A 1S8NA 2HFKA 3VU9A 4QGSA 2ORWA 1OZFA 2XTAA 3EMBA 3JR3A 4S1OA 3K09C 4XGKA 4BN0A 4I5EA 1ECCA 4C4AA 3N8KA 4YJKA 5F3RA 2IY7A 2AD5A 5KYUB 1Z6XA 5K51A 2YXLA 4KRFA 1JAZA 1GN9A 1VE7A 1WW8A 2DCMA 2YS7A 4JLSA 5CTAA 2ZOSA 4KQXA 4AFNA 3VR4H 2I2CA 2NNLD 2WD9A 4BC1A 4EKDA 2MYPA 1A8IA 3OPXA 2D0PB 1E98A 5IAOA 1P1HA 4Y9DA 5K0NA 4H60A 3REOA 1CQIA 1C1HA 2V7UA 3BJRA 2ZIVB 5JARA 1SA0A 1ZCAA 3NO4A 4BGUA 3QUTA 4CG1A 3QVMA 3C1UA 3O2QB 3D7NA 2AA3A 4NONA 4P32A 2K87A 4R3UC 4RWEA 2BGMA 3OLXA 2JA2A 2QRJA 3M2TA 3NC0C 2I6QA 4GPEA 4QJ4A 1F2UA 1MAHA 2DX7A 2YS6A 1S4QA 4M1ZA 2CDBA 4I7EA 3R9XA 3OJOA 4LTDA 1X38A 3U62A 3V8RA 4AIIA 5HK9A 1DRKA 1G20B 2PUWA 3L0PA 3UANA 1V8FA 2XUZA 3DDHA 4OGGA 5HUHA 2ZRNA 5JFOA 3A32A 3UY4A 4RNCA 4WESB 4J9VA 5L7WA 4P0TA 4M8LA 2SKDA 3H5NA 4I55B 2B9VA 3Q7QA 5DYWA 1JQJC 1BDHA 2JZOA 2HIGA 5FBHA 5F21A 3LOPA 4WE3A 2FOLA 2O0MA 5KYYB 1M0EA 3JS5A 1UINA 1RWOA 2C92A 3NBMA 5JRZA 3RAEC 1Y1QA 2QJRA 1XVAA 2C4NA 4C4OA 3SYTA 4D42A 2Z3WA 4MUAA 4UM5A 1LF5A 3MWDA 4DV3B 4MQEA 1BE8A 1LD3A 1XK7A 2Z4RA 3R0QA 4G97A 1K3TA 2RAUA 3RUDA 4CF7A 4A91A 1TCCA 5HMLA 1B6GA 1DADA 1K75A 2D74A 4G09A 4OY3A 2Z6AA 2O8DB 4BHTA 4CLOB 3JAKB 5HKLA 2DH6A 1SFRA 2Q41A 4X6YA 3RC7A 5IM4A 4RDIA 3PXAA 2Y1FA 3AY0A 1X7ZB 2YWXA 4KAAA 4ZAYA 1NJSA 4HWRA 3SE0A 5FHRA 1G5IA 5JATA 4EL0A 4XUEA 1QHSA 3E2MA 3RE1A 4OLBA 3KJEA 1QKKA 2FUCA 4W1PA 1SJ9A 2Y9MB 3N58A 4X6LA 3S44A 3TRFA 3S2YA 5ICMA 3BOSA 1LKZA 3BDAA 1PX0A 4EENA 1ZA2A 3MTAA 4G0ZA 4LFBB 2PSJA 3VAZA 2NXEA 4WOKA 2JFYA 5ECWA 3HKCA 2FPIA 2H31A 1X9IA 2VTBB 4QQNA 4Q9HA 4ABYA 1TU3A 1N4AA 3A6GA 3DOEA 3TCNA 4NNPA 1OLUA 3CCCA 3JQGB 1UXIA 4RQBA 4PYLA 1NKTA 4JQZA 5DP2A 3X1WA 1ISJA 1B73A 2ZAGA 4CM4B 2NT4A 1BS2A 3NBUA 3PDJA 4MW1A 3A36A 5IBCA 1Z6AA 2E48A 2OSBA 2JHAA 4LCEA 2FW1A 4KU4A 4O6VA 3H4TA 3NBYC 4PCLA 4RL6A 1HQCA 3R7WA 4H9GA 4WA7A 4YS6A 1VYUA 4GI7A 4I1SA 4KI0A 5E9WA 4H7FA 2G04A 5E6SB 4C7XA 4DUZB 1N9GB 4A8JA 4TYWA 1TADA 3HDYA 1NVGA 1UCFA 2VAMA 5CYOA 1Z9BA 2X1LA 4ZQCB 2NM0A 1SXJD 5BSUA 4Z4QA 1FJ2A 3WTCA 5L40A 1JDSA 3X1DA 4A6DA 4EUNA 2RHMA 2OP1A 2HREA 1P5JA 3DVLA 3OX1A 2FUNB 5DTRA 5KTPA 3PP8A 4MW6A 3TG8A 1K7XB 2OOKA 3F9IA 3IPRA 1W76A 2HV8A 2ZSJA 3H3FA 2ZWAA 3EFEA 3PDIA 4FMPA 1K4YA 1LTKA 2YWRA 3DZBA 5JZVA 2NO5A 3K9BA 1NLMA 1IM5A 3ABQB 5L95A 2CCGA 1KF0A 2A58A 4ZDWA 4BE7B 4WJLA 1OZAA 3GUCA 2O8CB 3K9QO 4CL2A 5IX8A 4MPJA 3ZD8A 3ZVKA 3IUQA 5DN9A 2ERCA 4M0PA 2OCAA 4N47A 5K3OA 1LK0A 1TE2A 3OO0A 2J48A 4B4UA 4PQYA 3O8BA 3WLSA 3P0HA 1FRQA 2FZEA 1JJIA 2ZSKA 4LX8A 1C2TA 1E66A 4XYGA 1T3LA 5EPEA 2REXB 1A7AA 2G6BA 5EJIA 3FRJA 1JAYA 4MQ6A 3VSDA 1K06A 3FR8A 4LVCA 4HDCA 2P91A 1OMOA 4Q4LA 1II0A 5TX7A 1Q14A 3Q7TA 1KKUA 3TDMA 3SC2A 1OASA 3FVTA 4EYEA 4Q1EA 4DWOA 5IDWA 3T1HB 2LKDA 3T9EA 3K7EA 1ZJ4A 3RV4A 1O96B 3WB9A 5LJLA 1XYYA 1UMCA 3GR6A 5ED4A 2AKEA 3LCRA 4C0WA 4G1EB 4WX2B 1BVUA 2BZ0A 3KWLA 4BO4A 3K0SA 3DMGA 3GLHA 3KQOA 5TE9A 1KRHA 4XPIA 3RIGA 3TQFA 1GDHA 7ABPA 1UBCA 1Z4OA 3V9AA 1Y6QA 1Z3CA 1CVRA 1C7RA 1FTYA 5IYZA 3OX3A 1SCKA 5ALNA 3AF2A 2FPGA 3U3OA 4F3RA 4JVNA 4DOMA 2FZLA 1FFBA 3TH5A 4S04A 2QIOA 3QNMA 5F4ZA 2RMKA 1L5SA 1SGWA 2BMAA 4YREA 5BYBA 3DWIA 3SNHA 5IAEA 4Y1RA 1GYQA 3A2KA 1QU3A 4OXRA 3GL9A 2GM3A 1JDZA 2OCLA 1A3CA 2AZXA 1A76A 2VYCA 1SIBE 4RSRA 1EHYA 3TLGA 3OFVA 4M7OA 3I9KA 1ZUNB 4XB2A 2V4ZA 3QVOA 4GGOA 3K0CA 3DDWA 3QJ5A 2QPOA 1JKJA 5J5CA 2QYTA 3SJAA 1J1UA 1G55A 2HTFA 2CEKA 3BF8A 3NBQA 4ILEA 1I4EB 3MGBA 1OX5A 4GM4A 4AMUA 3ZDDA 2J3MA 2NZVG 3F98A 3OEED 4HUJA 2JFUA 3VR4D 4N5DA 2EJBA 13PKA 1E8NA 1EWTA 5FAKA 2P5TB 5EUCA 1HDIA 1VJRA 1I7QB 4NPCA 1SVWA 1SUFA 2AI3A 5BV7A 2C95A 2M9MA 2WG2A 1ADCA 2ZAMA 3G1TA 5A0FA 3PPIA 3VTFA 3AP3A 5JXGA 2MT9A 4F1JA 5KBYA 3BDIA 4KR2A 5M2QA 2E4ZA 3KHSA 4XWWA 3I01A 1SC3A 4PQEA 1GGHA 1V9SA 1W4BA 1MH1A 3ZVMA 3AP1A 5IP5A 4QPZA 3TNJA 4G5SA 4C2TA 3THOA 4DYVA 5TMBA 2Z4TA 1WNTA 2C5LA 5JCOC 2QPTA 2X8JB 3MW8A 3RSZA 4Z4IA 5AHXA 3E22B 3JYLA 4Z0HO 5IBRA 3WRXA 1NMYA 3EGXB 3KQUA 4J1TA 4W5WA 3WO0A 1AZLA 1QIMA 5EJGA 1LS1A 2X1HA 4J0HA 1WU8A 2PBLA 3IEXA 5DOZA 2V1UA 4IGEA 4KIUA 1M8FA 4QU0A 3RSGA 1PNTA 1QYDA 2PH3A 1NA5A 2KX7A 3FOCA 3IURA 1LLQA 1QMGA 2HOQA 3AHDA 1L4YA 3L6DA 3OEYA 3MWFA 2DFTA 2Q3DA 5IG2A 1P29A 1U9IC 3G8BA 4KQFA 1PT6A 2FPLA 2P30A 3RJMA 1UQTA 4OUKX 3RVSA 3NHLA 2QTCA 4C0AC 1QIJA 1RLIA 3AI2A 1G41A 3RJZA 3T9DA 1XKLA 1T43A 3OTWA 4IIXA 1FFAA 2G7ZA 2QZ9A 2RBKA 2PMWB 2ZSBA 2IUUA 3FG9A 3EXAA 1CJKC 1HK7A 3FDZA 1M2OB 4ZOLF 1AGYA 1WM1A 3OM9A 3WAJA 2PMDA 3N3AC 1NF3A 2H4WA 3RRJA 4H59A 5A5FA 3ZZ0A 4OSOA 3FROA 4DR2B 3OM1A 5D7NA 1U6IA 2BJVA 3WGJA 2A30A 3R44A 4BKUA 3L05A 3FIJA 3IUBA 1ZLXA 5AJZA 2QYOA 3EXG1 2IIQA 1P5ZB 1R8XA 2Z9CA 1TU4A 2FI1A 1WUJS 5CR9A 1ZR4A 3Q3HA 2R3SA 3NCHA 5IW8A 1YVUA 1W1UA 2BGTA 3ZJ4A 3EXHC 3VR6A 2D8AA 1XZKA 5DNAA 5THXA 4CIAA 4A82A 3D1VA 1WDLA 3ILYA 1IMOA 3ZWCA 2OPHA 1XRMA 1XKXA 4LSWA 3MELA 1N33B 3Q7RA 4KOAA 2Z2ZA 2X22A 1XUOA 4FQ8A 5E6UB 1YC5A 3FE2A 5A4JA 2UZ1A 4OP1A 4MSUA 1ZC4A 2V7QD 2ZIXB 1Z4PX 3U3XA 2OBMA 2PBFA 1G6OA 5CDHA 2NZ8A 5ARBA 4OB7A 1I2AA 1XCOA 2GOYA 1XK6A 3E2IA 4ZQFA 1SVUA 5AVOA 4ZVMA 4CUZA 1P4GA 4ZU1X 3BGOS 3ZXSA 2J9FA 3CGGA 1RTKA 1ZDMA 3IEKA 4EY4A 1T24A 3BGDA 1MN6A 2C4KA 5CNKA 2QJOA 3BJIC 5IKXA 5CB4F 3HSSA 3U4HA 3ELWA 1DO2A 1EB8A 3E9RA 1JKFA 1O9GA 2E4VA 1OBHA 5H81A 1CNFA 1QIIA 2YNMA 2Z4SA 2QI9C 3LQ4A 1DFIA 2AX4A 3HCRA 2Q0QA 4LOIA 4NMWA 5B12A 2P75A 4HN9A 4R9RA 4NENA 5TRTA 2C4TA 1FUYB 1N6HA 4M7WA 4ZJUA 5T4EA 3ON5A 5DSTA 4H15A 3VR6D 5FR2A 3W04A 3IHTA 1WCXA 5AVRA 3GGSA 2R47A 2A94A 3CEPB 1E1QA 2ATCA 3HB9A 3QPVA 4FN4A 4E5VA 2VDVE 3CSSA 3JATA 3FNIA 2Q2OA 1N75A 2YJ6A 3HKDA 3V2IA 4I1UA 5TMEA 4Z4GA 2H2WA 4OAQA 5KQSA 1B16A 1D5CA 3LC0A 1S89A 4FFPA 4JLWA 4QDOA 3BMOB 3OKCA 3T38A 4P0QB 2I1WA 1OZHA 3QLUA 5LP6F 1N2BA 3DJFA 1I6KA 4QXAA 1HRDA 3A4LA 4CRWB 2N1MA 4RAOA 4KKXB 1WSDA 2XR1A 1CQJB 2VUIB 3R76A 1YR1A 4CLEA 2OGZA 4NU5A 4W1QA 4CKEB 4MVYA 3DE2X 1K0UA 4N8DA 3N8NA 3ZWYA 4EG8A 1T3GA 2PT7A 3KIPA 2HRDA 2J6CA 2DM6A 3W4KA 4YCCA 4QTXA 4E2XA 3V4RA 1PL0A 2Y0EA 4LCJA 5DVZA 2CNOA 3QVLA 2QLTA 4R51A 1XZHA 4UFOA 4FYXA 3WO1A 1EXNA 2ACKA 5EUBA 3VYUB 421PA 3P27A 5FWDA 1R5BA 2HNBA 5C4GB 1N2GA 3D3WA 1HM5A 5F3DA 5IK2A 4QLAA 4PLGA 3VX4A 1SU4A 2FJUA 1UR5A 4UBIA 3TIFA 1AUXA 1TQHA 3R20A 4QVIA 3HPQA 1EEHA 1THGA 3C4QA 3BL8A 5SZJA 1H5NA 4MVJP 1PLJA 2R8YA 3Q5GA 5H83A 1OPRA 1U8FO 2WSMA 3PUVA 3RHFA 4MQFB 4WCFB 1G1MA 3S6JA 1JVNA 5JPIA 2NUAB 4QUHA 4TM8A 2NU8B 2Q27A 4HY3A 1IY1A 3VOBA 5I6DA 3E0QA 4A5OA 5IWCA 2YOFA 1ZHFA 2VJMA 3E03A 2DUNA 3X2SA 4JP8A 1CZOA 3JWGA 4R8VA 1UC5B 4PHCA 2XNHA 4RABA 3D6TB 4CKWA 2OXRA 3R5SA 1EFDN 2QAGA 3R0ZA 3WLHA 2IYXA 1BXRB 2C96A 2REQA 4M1TA 3ENQA 4E51A 5K8LA 1RQLA 3THXB 4ENVA 4W5HA 4XGRA 3TIIA 5B7PA 2GO1A 4I50B 3GEHA 2P9YA 4QGAA 4B3MB 3PC6A 4PFQA 5CT5A 3LNTA 4AKGA 3FPFA 2WM3A 1X1AA 3HSKA 5DHUA 5HUJA 1EZ1A 2ABWA 4Q01A 2P1ZA 3RUHA 5AD1A 1XMQB 1SCQA 1A8UA 1CEXA 2GEFA 1P0PA 2O0JA 3LUFA 1EDZA 2ZTSA 4UASA 4NZYA 1AT1A 1U0RA 3OCUA 3WKAA 5IK2D 4KE7A 3DV0A 4BV3A 4A6EA 4CCAA 5AM2A 1UQUA 4OXIA 3SWWA 4MB0A 5FP0A 3QX9A 3EGWA 3TX6A 4OBWA 3WNVA 1D03A 1ZGAA 3B82A 4UVHA 3P0JA 4R84A 1PVVA 4K05A 1NY6A 1OI7A 3MJTA 4PAWA 2QTGA 3QKRA 4ILKA 3RUFA 4B9EA 6GPBA 1UBOS 5LXTF 1JIUA 4KQ6A 4A10A 5JU6A 2I3BA 4UTXA 2AKAB 2ZBVA 4MMYB 2AJDA 1XZ8A 3LOQA 3CUVA 3V4PB 3GMSA 1M6NA 1JECA 5HJEA 3EUAA 2ZI9A 4JYZA 1Z8DA 2I2DA 3OH8A 1C1DB 1M2GA 1VRWA 2HF2A 4CEIB 1U3GA 1EFVA 5KOHB 3ZV4A 4AU1A 3DW1X 4R16A 1NOKA 2DHEA 3HGQA 4NLLA 121PA 4BFXA 5KYXB 3T7IA 5K2OA 3A27A 1FUKA 1RAEA 3O6VA 4MW5A 5HP4A 2HJRA 3MYRA 1E64A 1VBNA 1VIYA 4TPKA 1P4HA 5DLQC 4I4TA 5FTLA 4LJ9A 2IZOA 1X1BA 4LE1A 1Y6JA 1ZN7A 1F17A 1VXOA 1Q15A 3KC2A 4IGIA 1VKHA 4PPQA 4W6QA 5A9TA 5A9SA 1ZVVA 4MDEA 3RF7A 4RTRA 4FT2A 2XUFA 2H2IA 2SKEA 4PZEA 1EHIA 3N75A 4WUTA 3LPCA 2Y4NA 2HO5A 2JGLA 2QRZA 4IJKA 1U31A 4JGBA 4OJKA 4E33A 1S1MA 4C07A 1CUWA 2JLQA 3O47A 5CA0B 5J2TF 1NNUA 4DA4A 2EW1A 1OT5A 2ENUA 1CUZA 3Q6MA 1FDTA 2NUPB 4OIMA 4W9MC 1CUSA 1PT5A 1EZ4A 3EF1A 3JASB 4HVAA 4XFDA 3T6KA 1IIRA 2OPBA 2QNBA 3GJSA 4EOGA 3KT6A 4TKVB 4GMDA 1I51A 3FCCA 3UAGA 1SQ5A 1PBTA 2A9QA 1GKUB 1SURA 3VZRA 1JLRA 1KJ8A 1XZPA 3I76A 3KUKA 4P3PA 4MH0R 3UHAA 3ZWXA 2Z08A 5EJ5A 1LTHR 1EKXA 1P17A 1RJFA 1Y9JA 1ZY2A 2G1JA 2GK3A 2OV8A 3BSYA 2F3QA 4J0GA 4O2AF 4OHMA 1EK6A 2X15A 4UHHA 5DZSA 3ZZ1A 4DUPA 1WL8A 3PNBA 3UVEA 1U3VA 1DFGA 4JBHA 2ZBQA 1FQJA 3UWOA 3D8UA 4CI0B 4TTJA 3TAXA 4EEXA 5KJ6A 3N2NA 4M49A 4N4AA 2XGSA 2FPMA 5CT9A 4O2BF 3DBIA 3RVLA 2A5DA 2NO0A 2X2EA 1Y9DA 4R6WA 3KXPA 4GIBA 2XE7A 1FP2A 1IHXA 1QX3A 2P2LA 2QOEA 1V1JA 4GVPA 2AMJA 2YN2A 3HUUA 4DMKA 1QBGA 3T5TA 4BLVA 1G6Q1 3LGXA 3AOEA 5GJVC 1Z13A 3ND7A 3WIBA 4MWOA 2WWXA 4BNTA 2X23A 3PLRA 1QRUA 1L5LA 1Z36A 2XCRB 3NONA 2C61A 5C5DA 3BXPA 4JHXA