2JFCA

M144l mutant of nitrite reductase from alcaligenes xylosoxidans in space group p212121
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
335
structure length
335
Chain Sequence
b'DADKLPHTKVTLVAPPQVHPHEQATKSGPKVVEFTMTIEEKKMVIDDKGTTLQAMTFNGSMPGPTLVVHEGDYVQLTLVNPATNAMPHNVDFHGATGALGGAKLTNVNPGEQATLRFKADRSGTFVYHCAPEGMVPWHVVSGLSGTLMVLPRDGLKDPQGKPLHYDRAYTIGEFDLYIPKGPDGKYKDYATLAESYGDTVQVMRTLTPSHIVFNGKVGALTGANALTAKVGETVLLIHSQANRDTRPHLIGGHGDWVWETGKFANPPQRDLETWFIRGGSAGAALYTFKQPGVYAYLNHNLIEAFELGAAGHIKVEGKWNDDLMKQIKAPAPIPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DISSIMILATORY COPPER-CONTAINING NITRITE REDUCTASE
publication title The Structure of the met144Leu Mutant of Copper Nitrite Reductase from Alcaligenes Xylosoxidans Provides the First Glimpse of a Protein-Protein Complex with Azurin II.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
molecule tags Oxidoreductase
total genus 86
structure length 335
sequence length 335
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2007-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2jfcA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2jfcA02
4A2EA 1W6WA 1AIZA 1OE1A 2P80D 5EHFA 2GSMB 3GYRA 1SDDA 1W6LA 2VMJA 4YSSA 2UXGA 1ZDSA 1IC0A 1JOIA 1URIA 2RACA 1ZIAA 5I6PA 1IBYA 1AQ8A 1ASPA 1R1CA 1E5YA 4UANA 2P80A 1IBZA 1ET5A 2BP0A 1JXFA 3HB3B 4W1TA 3OM3B 5LDUA 1MDAA 2EINB 3X1FA 2XX1A 4WKXA 2IDTA 1JZEA 2FJSA 3SBPA 2DV6A 4DP1X 2R7EB 1TEFA 1V55B 3FSVA 3CG8A 2BW4A 4E9QA 1WA0X 1BYOA 3IN0A 1AZCA 3CZUB 5B1AB 1L9OA 3OQRA 1E67A 2VN3A 3DKHA 5D4JA 3TU6A 1QLEB 1OCRB 3FPYA 3WI9A 3ABMB 3N2JA 1JVOA 2FNWA 2XV2A 5PAZA 3ZIYA 1PAZA 2XU9A 3D12B 1WS7A 1AG0A 4A67A 5IY5B 1PLCA 4PAZA 2FQEA 4TXVB 3ABLB 5B7FA 2MTAA 1WA1X 3NSCA 1CURA 3T6ZA 4DP8X 3X2QB 6PAZA 1HFUA 4KO5A 4HALA 4HHWA 1BYPA 3PXLA 2N0MA 1KDJA 2OV0A 4HAKA 3FU7A 1ETJA 3PAVA 1SFDA 3MBWB 4MFHA 4DP6X 1FFTB 1AANA 2HZHA 2I85A 3S3CB 3WIAA 5B7MA 2JFCA 2IWEA 3WKPA 2PP8A 4AKOA 1KYAA 4BWUA 4BXVA 4WTQA 1JZIA 2HRHA 2YQBA 3IE9A 1ZV2A 1J9QA 1OE2A 3G5WA 3SBQA 2WO3B 5I5IA 3RYMA 4EF3A 2AZUA 2E86A 5ANHA 4JKNA 2J5WA 1JVLA 2B3IA 1JZFA 2MRYA 5F7BA 2X88A 3S3DB 1L9PA 4UF7C 3ZDWA 2PP9A 1XB6A 4AX3A 1NWOA 3BVDB 3PLYA 4UAHA 2IDQA 4KO9A 1SF3A 3CVBA 3EHBB 3IEAA 3QJVB 3V9EA 3T6WA 1BAWA 2FT6A 5E9NA 1AAJA 2NRDA 1N68A 4N8UA 2LLNA 2WO2B 2CUAA 3NJKA 2GI0A 3SBRA 3NJFA 4FAAB 1GS6X 2IAAC 2OJ1A 3TASA 2H5UA 1AOZA 1GR7A 1PNCA 1RZPA 3X1NA 3EH4B 1KV7A 9PCYA 4GYBA 4YSUA 1M9WA 1OOWA 3CDZA 1M56B 1ILSA 2BHFA 1SHWA 2Y69B 1OCCB 3CVCA 2XV0A 2QPEB 2FT7A 4A66A 2AANA 3QJTB 1ID2A 2BP8A 2ZOOA 2PPCA 4BWWA 8PAZA 5B1KA 4N4YB 5I6LA 3DTUB 3N55A 4GY4A 7PCYA 1AACA 2DYSB 2VW4A 1KCBA 1GY2A 2HX9A 2X87A 4DP5X 3FT0A 4CSZA 2GB2A 4KOCA 4Q8BA 1DZ0A 4E9TA 2UX7A 1EZLA 3FQ1A 1F56A 1NIEA 1SDDB 2XX0A 2GC4C 3WG7B 2QPDB 4HCGA 1OCOB 4YSEA 2QDVA 4NERA 3ZX1A 1PY0A 1J9RA 3NSYA 4ENZA 1GY1A 4YSAA 1J5DA 2EIMB 3FSWA 2GHZA 4HCFA 3PAZA 2FWLB 4X4KA 4NB7A 5I26A 1SNRA 2FT8A 3DIVA 5AZUA 5B1JC 3IN2A 2H47C 1X9UA 1I53A 5B1BB 3UABA 1OE3A 2GBAA 5I6KA 2FTAA 5FC9A 4YSRA 2VM4A 2Q9OA 5I5MA 1BXVA 1OF0A 2R7EA 3UAAA 1L9TA 1SFHA 3U25A 1ET7A 1AR1B 4BXSV 4DP2X 1GSKA 2JXMA 2BWDA 4GP5B 4A2GA 3NJGA 3T71A 1V54B 4YVNA 1V10A 1NPJA 4YSOA 2IWKA 4KNTA 3FSAA 3NJJA 2PLTA 2XWZA 1NINA 2XYBA 2YAQA 2YAMA 5F7AA 3EH5B 4DPBX 5I5JA 1BQ5A 1KDIA 2J55A 4YSTA 3FU8A 3PCYA 2PPEA 5D4IA 2CJ3A 4P5RA 1X9RA 1PZAA 1QHQA 1WA2X 3NT0A 4G7SB 2BO0A 2FQDA 6PCYA 3GXUB 4CSPA 3L45A 1J9SA 4AZUA 2VW7A 4HHGA 1GYCA 1SJMA 5I6MA 2GIMA 3FYIB 3FSZA 3X1GA 4BDVB 1RKRA 2PPAA 1W8EA 1KBVA 3NYKA 3MX0B 2XXGA 2YAFA 4FA7B 3EH3B 3ASNB 1CC3A 1SHXA 1BXAA 3WNIA 4DP9X 1A4CA 2GC7C 1AZNA 4YSCA 2IH8A 4A68A 2XVBA 1JZJA 1YLBB 1JZHA 3FYEB 3UACA 1AG6A 1PF3A 2H3XC 2AVFA 3FQYA 1AS8A 3TBCA 2CBPA 4YSPA 3ABGA 1QNIA 1KCWA 1AZUA 2YAOA 2VSKB 4ZK8A 3H56A 4BK5C 4JHVA 1E30A 1JXDA 1NIFA 2W8CA 2CAKA 3JT2A 4YVUA 1ZPUA 2PPFA 4HZ1A 3IBOA 3EF4A 2BZCA 2EIKB 2ZWNA 2PPDA 1E65A 1CYWA 2JKWA 2TSAA 1HAUA 4G72B 3TBBA 3ZBMA 2IDFA 2ZXWB 1A8ZA 1NICA 1PLAA 2I7OA 1NIDA 1RZQA 2DY2A 2HXAA 4KOBA 1ZIBA 5B3SB 1T5KA 1CYXA 2IDUA 2IH9A 1A3ZA 1TKWA 2UX6A 4YSQA 1E5ZA 2FQGA 3KW7A 1ILUA 2A3TA 4GXFA 4GP4B 2BZ7A 1ZDQA 4G70B 1PCSA 3PAUA 3FU9A 3S3BB 1UATA 2WSDA 2XUWA 4KNUA 4G71B 2YXVA 4F2EA 1WS8A 2I7SA 2B08A 1KGYE 3UADA 3ERXA 3AZUA 1J9TA 2QT6A 2HRGA 1N70A 2YAHA 3KW8A 1ADWA 2IWFA 1NIBA 3JTBA 3QQXA 1B3IA 2QDWA 3NSDA 3BQVA 2BP0B 5B1JA 1NDTA 1A4AA 3UGEA 3WNJA 3WKQA 4HCIA 4G7QB 4E9VA 1MG3C 4DPAX 2AFNA 2J57A 4QLWA 1TEGA 1PLBA 4BWTA 1L9RA 4QKTA 3NP4A 3SQRA 1FWXA 2W88A 3OD3A 3NJHA 4A2HA 4DPCX 5B7EA 3FQ2A 4DP0X 1BXUA 3NJIA 4M3HA 1JZGA 1PZCA 1GW0A 3NJNA 3AW5A 1SF5A 2J56A 1DYZA 4AKPA 2OCCB 4E9WA 7PAZA 4E9YA 1BEXA 3HEIB 3X1EA 3X1BA 2YARA 3V9CA 4DP4X 1OV8A 1ET8A 3FU7B 2BWIA 3OMAB 4F2FA 5A7EA 3TA4D 1IUZA 2FQFA 2YAEA 4DP7X 2Q5BA 5AFAA 2Y1AA 1AZRA 1MG2C 2DWTA 4JHUA 3UAEA 1JERA 2VM3A 3S8FB 2YAPA 1PNDA 1HAWA 1JXGA 2CCWA 3T6XA 2EILB 1GS8A 1MZYA 1PZBA 2PCYA 2TSBA 1L9SA 3QPKA 3FPXA 3H4FA 2PP7A 4BDVA 4E9SA 1ASOA 1ASQA 2XV3A 3OMIB 3AG2B 4AKQA 4YSDA 5I6OA 2BW5A 1M57B 3NSFA 2YXWA 3AY2A 3QJRB 3C75A 2PCFA 1PMYA 4AI7A 2UXFA 4W9ZA 3AG4B 5D4HA 3QJQB 2XLLA 1A4BA 1NPNA 3GDCA 3T6VA 3PPSA 1WAEA 2IDSA 4GP8B 1XB3A 3AG3B 4A2DA 5TK2A 1L9QA 2UXVA 2VW6A 2DWSA 3AG1B 5I6NA 5I28A 3H4HA 1KBWA 1AZBA 4G7RB 3S8GB 4KO6A 1NTDA 1BQRA 1NIAA 1RCYA 1BQKA 3NJMA 1AS6A 2XXFA 3QJUB 4KNSA 2CALA 2HLEB 1TU2A 2HX8A 2ZONA 4L0PB 4E9RA 1J5CA 2DYRB 4P5SA 1MZZA 1NZRA 2HX7A 4KO7A 3CDZB 5AKRA 4Q89A 1EHKB 3ASOB 2AZAA 4YL4A 1NWPA 4F7KA 3FS9A 4PCYA 1IKOP 1A65A 1CUOA 3ABKB 4K9JA 5PCYA 5TK4A 2UXTA 3NJLA 4RH4A 3NP3A 1FA4A 1XMEB 2BP8B 3QJSB 3T9WA 3OMNB 1GS7A 1AS7A 2VSMB 4E9XA 4M4RB 4A2FA 2EIJB 1XB8A 4NAJA 4HIPA 1VLXA 1OCZB 3CVDA
chains in the Genus database with same CATH superfamily
3CCHB 5I66B 4NQEA 1ANUA 2Q8BH 2Z93A 2WYHA 4GIPD 3CHXA 5INCB 1OE1A 5I1EH 3EADA 2NXYB 3AS2A 3HAEG 5DZPA 4X5WB 3VSVA 2MCG1 2L04A 1MQKH 4JUTA 3K2IA 1ECYA 3WHE0 1JOIA 5TTRA 3W0WB 1VA9A 1OGAB 1ZIAA 5DD1L 4OIBA 3NEOA 1OD9A 5IIEA 4NZTH 2LTQB 3EGSA 1TZIB 2UZXB 1PEWA 4QOKD 4BFRA 3W38A 5ICZB 1KYUA 2CIKA 5JXEA 5L4FA 5GS0D 5DURB 5DEZA 1A3LH 1EXUA 2LHAA 5LWYL 1YNKH 5C09D 5L2KA 2XKNB 4M56A 5CJXC 2AMUA 5DD5H 3L16A 3HB3C 4AL8C 1ZT1A 1RJLB 1M71A 2FLBT 2R69L 4JY4B 4N6RB 3QUMH 3SYOA 3E6FB 3QDAA 3CZNA 4X7DC 5GGTH 1T04B 2JJSC 4APQB 4RSYA 4TPRH 2FQEA 3HNTH 1Q90A 4YO0B 5EDXA 5EIIB 1LO3H 1RSFA 1XGYL 1XXFC 2CPUA 4XBPA 4FG6C 1P7BA 1KTRL 4S11A 4WUUD 2VDMH 2FZ3A 2Y07H 2FK9A 3WFDL 1F6AB 3F7VA 4HC1L 1DSYA 1DQQB 2DIBA 1MCOH 2HRLA 4MA8L 3VD4A 2E9WA 4JMNA 3AAZA 3EG9B 3C60A 4JE0A 5D1XC 4BRVA 5JPNC 1HIMH 1JZ4A 1QLRB 1UUSA 4HWBA 4PVNA 1DFXA 3ZDZB 3TBSB 2Q86B 5HDOA 4ONHA 2CE6A 3MRPB 4PI2A 3ZRFC 4PP2B 3SPIA 3SKMB 1AIFB 4PJ7E 3SBQA 1YECL 1E7UA 3CSPA 3L54A 3AT8A 4JG1H 1CL7L 1PDKA 1UB6A 1JWSA 2JI2A 1PKQB 3CXDH 1LEIA 2B3IA 4WUKL 1G9HA 2ADGA 3S3SA 2X88A 4YHZL 4Z6AT 1MFCL 4H20H 4X2UA 1E8ZA 3RBSA 3H9SD 1WCBA 5KVGL 1W0WA 2PP9A 1V7ML 3ECWA 3IS1X 3L4TA 2NY3D 4L8CA 3FB8B 1DO6A 1R17A 2YRLA 4RMTA 5CD5C 2A77L 3LD8C 3TJEL 3RGVA 3NIDF 2YD6A 5BUAA 3V4PB 1WBXB 3WNLA 3WJJC 4CBZA 3ASWA 2EC9T 2VNCA 5KOVC 1CE6A 3D52A 5KUKA 3K74B 4X80H 5JA8B 4Q74A 3GGWA 3QDJD 4KUCD 4NP9A 4EDWL 3TBWA 3GRWH 3B43A 1DBKL 4JB9H 4BIKA 3RVWD 5JR1H 1L6XA 4NO2A 4GYBA 2K7QA 4BQ8A 3CE1A 2R29L 3CHOA 3QUKB 3ZMRA 2VIRB 1I3GH 4XP9H 4O02B 3CSYB 5FKPA 4WI4A 2W59A 4B5EA 1T1YA 3NFPB 4GAJH 4ERSL 4OI8A 3QQ3B 1DFBH 2AANA 3GXIA 2BP8A 1A0QL 3F01A 3DUHA 1KIPB 5FECB 4UV4H 3S8WA 3NACH 1OCWH 1WFNA 3RVWC 3WFHA 1UXLA 2NXYD 2NZ9D 4GLRI 2NYYC 4NO0A 1LMKA 1KCBA 3EJZC 1GY2A 2WVUA 3SE6A 5FPIA 3BH8B 3ARBC 2GB2A 3FCBA 4ONGL 3NK3A 2JKTM 5EEZA 1OGAD 3BOVA 3MV7A 3O2VL 5DWUH 2K3TA 1ZK5A 4QRQB 5HI3C 4S0TD 3MUZ1 4TNVF 5H2BB 3D4ZA 2ZWYA 3FTYA 4HCGA 5F3HB 4Z7WA 2C3XA 5IFHH 5L2KD 3FT9A 1RXLA 2NXYC 3S3JA 4AMWA 4H8HA 2D3LA 3QQDA 2BNRB 3LKPA 3QWOA 5D9SA 2FWLB 2I07A 4X6DB 3CH1A 1LWRA 5A3IC 1BIHA 1U91A 2NUPB 2BH0A 4HXBH 4U1LA 2FX8L 4BKSC 4P2AA 3BGFB 2NUTB 1SJHB 2ERJB 3O0LA 5B38B 4KJPD 4XBGA 1Z7JA 4I77H 3RFZB 5SWQA 3RWDA 3EYUL 2QQNH 1PKOA 5AD0A 1GGIL 1T6WA 1ZA6A 5K33A 4XXCA 3CFEA 1LO5B 2O6EA 4J1UA 2KPWA 3CBRA 4APQD 4PCKA 4OJYA 1S7VB 2HLFD 4Z1PA 1EZVY 5D70L 5HDRA 3MCKB 3PXHA 4PUBL 5HVHC 3VRLE 4EPSA 1WFIA 4P3CL 4D2NA 5AVQB 3NDYE 1TNMA 1EGJA 4R4BB 2N59A 1NFDF 1T5WB 3EYSL 4YHIB 3SQBB 2ZIDA 1NFAA 2J71A 5LGHH 3ZIMA 2H26A 3WAJA 2ESVD 5C0EA 2WTRB 3H0TA 1EANA 1NLBL 1YN7A 4G8IB 4XN4A 2OK0H 1M9SA 3M7FB 4KC3B 5FA3B 3D39E 2MFNA 4S1SH 4PREB 5T5NF 3UBGA 3ULSB 4DKEL 1ACZA 2LAGB 1QYGH 1WA2X 4FQIH 1FBIH 5SX5H 2A0LC 3FCTB 4LCYB 2KDGA 1TFPA 4Y19B 1NC2B 3DPBA 1MH5B 2NY0D 2C7UA 2VDKB 1J11A 3QO0B 3DX4A 3HE6C 2H8PB 2XA3A 1CF8L 1E6JL 3N43B 1C5DA 2WNWA 3HG1A 4Y4FA 3IVKB 4HDIA 4PJAE 2AS5M 1ZEAH 2XVBA 4K3EL 4MD5B 5JHAA 1UQSB 5GIRB 3ZLQC 3FB5A 2VLKE 4FJZA 1LO4H 1QRNB 4DAGL 1AS8A 3F85A 5F9OH 3PABB 3CN3A 2OXGB 3RIFF 2KUTA 2ICEC 1SXBA 1JGEB 1PX3A 3JWDH 1UOVA 2FIKB 4NN6C 5LAXA 4RAVB 3UTQA 1FZKB 4AG4H 2QL1A 3ZE1F 3WHXB 2OR7A 1IFGA 3UG5A 3VXOA 4HLJA 4NIYE 5CJOL 1EERB 3US1A 3QHZL 2VLKB 5DEGB 2IV8A 4Z7NF 2MNWA 2BDNL 5EEWA 3S2AA 4JO2L 5I1LB 4HUCA 4RGOL 4MB4A 4Y4KB 1Q72H 3QDGB 3IJEA 2NZIA 1KN4L 2B2XH 2YXFA 2ZXQA 3CFBA 3L1OH 3L3GB 1JHTA 4P2QE 1COBA 3D0LA 2W65B 1QNZH 1OXYA 1CLOH 1MCKA 1MPAL 2R83A 4HFUH 1G7PB 1I9JL 4QWWC 5DRXA 1FGVH 3D0VB 4G43A 4PJGE 5JIKA 3C6EA 3V2AR 5TF0A 3LHAA 3C2SA 2FQGA 4WNSA 2G2RB 4BBWA 4LGSB 1KCRL 1R34A 1BZ7A 3LRLA 4UB0H 3P77A 5FGBA 2BZ7A 5HVWA 3SKJL 3FOMA 3UTPD 3FO1B 4IBWA 3A4AA 3ARGB 2D31A 4MNGB 3OB8A 1USQA 4FXGA 4KNUA 4TNEA 4EMZA 5F96L 5HGDB 3JWOL 4YUEL 4LEEA 4NP4H 5DD3H 4J28A 3I6KA 3R0NA 4ENED 2WJ7A 3KBPA 4A6YA 1P6FA 1JK8B 1PPIA 1H3XA 4XZUB 2VXSH 4ODUB 2BNRD 2F08A 2ZNXA 4MYPA 1JGDB 3ESMA 3FN3A 4HIEB 3FHEA 3LKSB 3QQXA 3T3MB 1U8KA 3GKWH 2X6AA 2NR6A 2HRPH 2YA0A 1RY7B 3FU3A 3OAZK 2J5LB 3NH7L 3RUGE 3NJXA 2VLME 4FYRA 4OM0L 4AYSA 2R9HC 3MNZA 1ETZB 3ILDA 2BNUA 3VI4B 5HGBA 2OYKA 2H1PH 4XNMA 1IILE 3HMXH 4AQAB 4HUMB 1S7TB 2MPVA 5DJ8B 1V5JA 3BGFC 4R3SB 3P9MB 4BYHA 4CVXA 2J2ZA 4JGMA 4LLMA 1BXUA 1J5OL 2VL5A 4P46A 3IDUA 1NCAH 5DUPL 4PU2A 1HDMA 2XNAB 1A14L 2LU4A 4K9EH 4FQCH 1BP3B 1T89A 5GGQL 4ONOA 2A83B 2CHXA 3N44B 2FGWL 4OCRH 4R96A 5E8PA 2X7LB 4PRDA 4NRXA 4KNQA 3V0EA 1TR7A 4KVNL 1DUYA 2R1WA 3B56A 2HUHA 2CO1A 3OSKA 2VN5A 4O58H 4W9DC 2JTYA 4KRPB 1ZHBB 4IBTA 3MJWA 4G9DA 3D85A 3HUJE 2TAAA 4AQ1A 1MFDH 1F97A 1X6LA 5AZEH 3L8QA 4Y19D 4XC1L 5F9AC 3VFPB 3EIFA 3L9RA 1NC2D 5GS0L 3HZ3A 4L8SC 3KHOA 3KPLB 4W6WB 4Z3FA 4XHQA 1B90A 4ADJA 1UWFA 4NQCE 1R75A 3H9YA 2ZX5A 3RB7A 4GSDH 4JFEB 4ELDA 2F1EA 1ONQA 4HIIA 3ZDYF 4JRXE 4CADB 3HUJB 3MRRB 3P30L 1ZE3C 4WNQB 3CN2A 4HFWB 3K71A 3MX0A 3OMIB 1G7LB 1QRND 4JHBA 1AGBA 1N4XL 1NAKL 4J3WA 2MJWA 4UM8A 4KUZH 1NGWA 2HKHL 5I8EB 1A9BA 4NQCB 2EDLA 1YJDC 4KH9A 5GZNA 2QPSA 5I75C 3MA7B 5E99H 4JRXB 1B2YA 2M2DA 2HKAA 1JPEA 3OZ9H 1PZUB 1BJ8A 2DYPB 2VABB 3HFML 4HK0A 4TNVK 4U49A 2ADJB 5FW6A 4G5AA 1F0LA 3WHE1 4Y5YB 5IB1A 1SEQH 4DKFH 4Y4KD 4KY2A 1I7UA 4WHDA 1SN0A 3Q6GH 1NTDA 3QDGD 3SKNB 5CN1A 5DD1H 3G3LA 5DJDB 5AG8A 4ZW7A 1R3KA 2XIIA 3QJUB 2DMBA 3MYJA 3MRBB 5ALCL 5DQ9B 1OAKL 5IKCA 2HX7A 3K2MC 4YK4B 3ZMEA 2V9RA 5BV7B 2B77A 3Q9PA 2E9GA 2I9LA 4WLCA 2W92A 2XZAL 2Y7QA 5FEBA 1R0AL 2WMPB 1LILA 5IM7B 1I8IA 3STZB 4TUOB 5LWYH 3DX8B 3MLXL 1RFDL 2P5PA 4Z5RA 2JVUA 2J4WL 5FUZL 2DQGH 2A4EA 3KPTA 3L5JA 5FLVA 1K4CB 1KPRA 3K8MA 5EF2A 2FAUA 2FJUB 1UH2A 3HW7A 3VXSA 5I2IA 5ID0A 4HIPA 4CC4C 2GY5A 5IQ9A 3IT8D 1EBPA 2Y6TE 3VQLA 1ZT4A 2PYFA 2P80D 2EO9A 3ARGC 3HKZA 3QUYB 4HPOL 4PCSA 3U1PA 1XGYH 5A40E 3LH9A 4HISA 1Q0XL 4R5VA 3KVDD 4GMSH 4Z7VF 4MQ7A 5TF1H 4P04A 1SUHA 3QSKB 4TUJA 5EBLA 3WFDH 2RACA 4NFCA 4HC1H 4U6XA 5D1QA 4MA8H 1E5YA 32C2B 3BMWA 3MLPA 3MRQA 4XOBA 5F7HA 1F4YH 2AQ2A 4H8QA 3DVGA 1DQJB 3FAXA 4ZD3L 2MSPA 1QPPA 5CSZA 2UY6A 4OFIA 4ABUA 1JV2B 1RP9A 4J3UA 3UBFA 4U1JB 2EVJA 4R0LA 1SJVA 1S5HA 1YECH 3BAEH 3EOAA 3IJ8A 5H37H 2J21A 2YSSB 1OCRB 5MENE 3FUNA 3HPJB 4TM9A 1FE8L 2XV2A 4YHZH 1HT6A 1BBJA 1IQDB 2QQLL 3QI9A 4KKCC 1S7SA 2DLEA 5HHME 5CU5A 3RIFK 3RWHB 3ZXAC 1EAPB 2G60L 1WS7A 2WVVA 2Y5TA 5K1VA 4BA0A 5KVGH 4KRPD 1YMMA 1V7MH 4TXVB 3WAKA 2CM6A 4UTAA 1C08A 2VR7A 2YD5A 4XT1C 5IB2A 1N0LA 3NSCA 4X0NA 4L5FL 1QTSA 3ARDA 2BIPA 4X9BA 3P4OB 4CGTA 3JXAA 2D2OA 2XWTB 1MCWW 1XGTA 3TJEH 5TQ0L 1P84J 2OM5A 4Z7OF 3GLEA 3VGDA 2Y7NA 4U1HB 1IT9L 2ODHA 3JUYA 4E0RA 3V10A 4JFED 1FFTB 4LCCA 2VUKA 5F0JB 1E9PB 3RY4A 3NRQA 4EDWH 3IAQA 1AD9A 3LMJL 5A2FA 2UWEA 3V6FA 4WTZA 2GIXA 2X4OA 1S3RA 1YPZA 1IGIL 4XC3L 2R29H 3QUZB 3LDBB 2YD4A 2X53A 4W4OC 3DVNA 2V7NB 5DD6B 1KTLA 3OR7A 1NMCB 4FYTA 2NTSP 4QTFA 1QZNA 2BCMA 2GSGB 1WQVT 5CWSA 2APVA 4UDUB 4CVUA 1A0QH 2DYPD 3WSQL 4BUQA 2H6PA 4HWBL 2V3DA 3NIFB 4QF1A 1A3RL 2AQRA 3EW3B 4G6JL 4N1HB 3IMUA 4OTXH 4J27A 1G6RA 3PLYA 1BWWA 4ONGH 3LQAL 1SF3A 2EE0A 2BY1A 3O2VH 1EQWA 3PNWA 2NQCA 1N8OE 4U4IA 1FI8C 2V4LA 4KK5D 1A2YB 2GBUA 5E4EC 1HHKA 5HYJE 3S7GA 1KXTA 1WBZB 1FNFA 1BOGA 4MDJB 4JFDB 4EI5A 5TQ2L 3SPCA 3KGSA 1PQZB 4Y5YC 3B1TA 2X2UA 1EDQA 1NJ9B 1F5WA 3DJ9A 5J13B 5E00A 2FX8H 3CZSA 2EDHA 4NENA 3GMNB 4L4VE 4S1QL 5KYWB 2AJVL 5HYJB 4KKAD 3ML9A 1A6AA 2ZX8A 2ZUVA 4KRNA 4N90E 5BV7C 5KBMA 2JSFA 5E2TL 3GMQB 1DQTA 1R5IB 3QJTB 4E2OA 2PPCA 5B1KA 3V4PL 4X4MA 4PUBH 5I6LA 2IIJA 3D6GA 3QUYD 4L4VB 5BRZD 3PYCA 4GO6B 4M4RA 4P3CH 3ZE0F 2P5EA 1Y6MR 2BSCA 4WHYH 4KKAC 3Q6FB 2DQJL 3EYSH 3JYBA 2CGZA 4J5VA 3GSVB 2C9RA 4XOAA 3VTTA 4ONFH 5TH2B 1HSBA 4Y1SA 3QW9A 4LHJB 2YD3A 4YBLC 1KT2B 4AEIL 1MI5B 2GC4C 3KL5A 2A6IB 2EYTA 1JNNL 2EKSA 3BAWA 2HMID 1KNOB 1NLBH 2RMNA 2Z35A 2YRBA 5T1LB 3X12B 5KS9E 4KZDH 4XN8A 3T6QC 2KKQA 4DKEH 4EBQH 4HCFA 3KPOB 3PAZA 1UADC 4KXAA 3EGDB 3ARPA 5JW4R 1Z0MA 2F7IA 2BPBA 5AZUA 2H0FA 4P9HH 3RWGB 1BGXH 2ZICA 4DZ8A 5KS9B 3D69B 1MAKA 1U6AH 2AEQL 2GUYA 1E6JH 1BXVA 5D2LE 1FFOA 1A4KA 1RP8A 4Y2OA 1RZGB 1M53A 5BOPA 4XVTH 1TXKA 4JE4B 4U6TA 2OL3A 1FZOB 3IFNL 4MMXA 1QUNA 4FFYL 5FYLH 4GG8B 2WCSA 4XPBL 3GHPA 2XCMC 3MBXL 2XFXA 2KH2B 2DEXX 1XIWB 2DICA 1BEYL 1GZPB 2YRPA 4DAGH 3DV6B 2ITEA 3BKCH 3T3PF 4TUKL 3BUIA 5D2LB 4UQAA 1EO8L 2A9DA 3F62A 4UT9H 4ZFFA 4XO4A 3JT0A 3CN0A 3QPXL 2WTOA 4XAKE 4Z0XA 2X3CA 2YC1A 5AENA 5EOQL 1QSZA 4HJ0D 3PCYA 2NOYA 4KKNA 3FTGB 4RRPA 4LKCA 3FOLA 5HDQH 4N2BA 4P5RA 5CJOH 1PZAA 3BKJL 2LU3A 1EJ8A 3QXDB 4OZGE 4YHNB 2BDNH 3VXPB 4OLWL 4YH6A 3UIZA 4JO2H 5CEZL 1U92B 1MJJB 1I85C 1IEBB 2WXMA 4RGOH 4P9ML 1X44A 1KN4H 4QT5A 3F05A 2ENYA 2VDQL 4PJBA 3ZZQA 3W39B 4QO1B 3OJDB 1I31A 1MPAH 4ODWA 3X3GL 1I9JH 2E7MA 4HG4J 3ASNB 3GJFB 1I8KB 2DTSA 5FM8A 1M6OA 1H5BA 3UG4A 3FTWA 3SOBL 4OZGB 3T2LA 3GIZH 2GY7B 4DQOL 3KYKL 1KCRH 3QUZC 2BVQB 2DJSA 3LDBC 3SKJH 4Y2DA 4K7FB 1JZHA 2ARWA 2A6KB 3ECUA 3N6YA 1NMCC 1SZNA 2AVFA 5HPMA 5F96H 3JWOH 4YUEH 3M8OH 4LE8A 3QCUH 4Q4IA 3VYPA 3Q9QA 4JFDD 3UTSE 1QSEB 1A1OA 3F7KA 4NUJA 3LH8A 3HI6L 1U8QB 3E3QE 5ISZE 4GRLB 1PD0A 5TE4L 1A6VL 4PYGA 2EEBA 1F4WL 2BZCA 5HYJD 1QMUA 3NH7H 1HAUA 4G72B 3CFJA 4Z7UE 3AS3A 3Q8BA 4DZBB 4B27A 3UTSB 3ZHFA 2E6JA 5K9JL 5ISZB 1PW3A 4MMYA 1TTRA 1CYXA 1DHKA 3GSNB 3O4OC 4QI3A 2YN5A 5GHWL 1DE4B 3MOQA 5AKTA 4L4VD 4I9WE 1IM3A 3DPDA 1XSKA 4YR6A 2P7TB 1KGJA 4Z7UB 1J5OH 1MCBA 3BN3B 3MXVL 4JY5L 1PCSA 4PV8A 4APXB 5DUPH 5HYIA 4N90D 5IOPA 1A14H 4F2EA 1OSZA 2GK0A 3T2NL 5GGQH 1MI5D 5CLYA 4JM4L 3MYZA 3RWIB 2CXKA 4E41E 1RZIB 1RZKH 5CBEA 5DC0A 5T1LD 3VFMA 1CVSC 4PGDB 3RX8A 2HRGA 3A22A 1N70A 4KVNH 3HNSL 5B39G 3TGXA 5JO5A 1CG9A 3JTBA 4HZLA 3H6AA 4LHUB 1YN6B 4LOVA 1AC6A 1GMEA 4LSVL 3ESNA 2BP0B 4QRUA 5J12B 4YBQD 4XC1H 4NNXB 5GS0H 3VDAA 5IZ7A 4HJ1A 3RTQC 2O6PA 5IW1A 4A6YL 2FEEL 3FO9A 3CLEL 3BLBA 4LBAA 4C57C 3GMRA 4TQEL 1R4XA 1U8PA 1E3FA 1TIUA 3VWJB 1LQSR 1BVKA 1YEDB 3G6AA 2QSQA 5FXCH 2EDKA 3P30H 1VENA 1OSYA 2B1AL 4JN2A 3P0GB 3KLLA 4YBQC 3K7UA 3V55A 5M7QA 2PXYC 1T3FA 2ZUSA 1XIWD 2XQ0A 1R6VA 3MVSA 3ZW3A 5I73B 1Z32X 1N4XH 3SO3B 4H26B 1JZGA 4OCXL 3RVXD 3VFUA 5EBWA 2BIIA 1ROWA 1D5MA 2ATKB 4H1LA 2IAMC 1LD9B 2OCCB 3OXSB 3WTXA 3CVHA 1FGNL 2YJLA 3MRMA 3O3DB 2HT4C 1A6TA 2FH8A 4LPYA 3HFMH 3VB8A 1FZMB 2SEBA 1DJHA 1XIWC 4CJ1A 4XO3A 2PW1A 2ZD0A 3MAWA 3PHAA 1LK2A 4Y8AA 1JPSL 5DJZB 2C4XA 3ZL4L 4C4KT 3UTZB 2DQFB 4ODXA 2WKOF 3QEHB 1KIUA 2GITB 5HYSA 4DERA 4AGNA 1ZVNA 4A37A 3HBPA 5ALCH 4URTB 3WO3B 1OAKH 4G6FB 3VI3A 4DP7X 4F2MA 2VLJA 5C1MB 4WFFD 3BIKB 5DQJA 3UZVB 5B1CA 4DUWA 2XZAH 4D3CL 3CBJB 3QPKA 2WCPA 4L1TA 3MLXH 4OI7A 1RFDH 3DROA 5KANI 1QR1B 2J4WH 1DJSA 4L3CB 2R1YA 2D03L 3HE7A 2D0FA 3K8KA 1M57B 5E95B 3V4VB 3ETBJ 5ILTL 4RGNE 2N56A 4BK5A 1MCEA 5DS2A 1QSED 5D7KD 3G08B 3KMDA 3PP4L 4BFNA 4BH8B 4GRLD 3FFDA 1NBZB 3TPUB 3QK0A 4P2CG 4D0CA 3IDGB 3OKLB 5E5RB 2DM7A 4QHKJ 2XWCA 3IAGC 2BIMA 4ODSL 4PJHA 1Q0XH 1CICB 5I28A 2EE2A 5C0GB 1AZBA 4RGNB 2B59A 1LDSA 1IM3D 3PWNA 3RBGA 1U8NA 1WD9A 1U8OA 1TJXA 5FFLA 5A2KH 4OCSL 5C0AE 2JF1A 2DYRB 3LXBA 4LLUB 3WL9A 4UQ3A 3ARFB 4EKJA 2HN7A 3FULA 4Y5XC 5IBTL 3OF6D 2ILLA 4YL4A 5AYQA 5HHOE 4FQHA 2WXLA 5KANG 3U9UB 3VD7A 1FCCA 3LIZL 3FS9A 4ZFZA 3F04A 1F42A 1NBQA 3ECBB 5LGKA 1TKWB 1LE5B 1HZLA 3T9WA 3UGUA 3T8MA 3E3QC 2AEPL 1QPKA 1Z5LB 5FA4A 4HIJA 4ZUVA 2QQLH 3BWAB 1JWMA 3FCGA 4GS7C 3VFOB 4PGEB 1BJMA 1TYRA 2G60H 4ANKA 2FO1A 4PY8J 4LOEA 4KY1L 3QJFA 4G8FA 4LHUD 1AIZA 2X4PA 4L5FH 4TL5A 3ILPA 2Y5EA 4MKTA 1XF3B 5F1KC 3ATFA 1CLCA 4JZNA 1RVFH 3JV5A 1ZDSA 1FH2A 4U7MA 3MRJB 4KGJA 5TQ0H 3NFNB 4N2NA 4EUPB 1RK0B 4KZEH 1LEKB 1IT9H 5H94A 4YHLL 2L3BA 4GXVL 3WE1A 3VWJD 1INEL 1FO0B 4GO9A 2B3RA 3I9GL 1T5XA 2N7AA 4I4WA 5J12C 2X44D 3PL6B 1XF1A 3LMJH 4M1DL 4WKXA 2E7DA 3B7TA 5CJBA 1JZEA 4YDZA 5D5MB 4TTGA 3BQUC 3CU7A 1HNFA 4XC3H 2NY5H 3NSJA 3NZHL 4XCCL 1RUAL 2ZE0A 2CQVA 2VITB 3WCYA 1WV7T 5IEKA 1HOCB 4X8GA 2VN3A 5FK9B 1KCSL 2R15A 5DZAA 3ABMB 3P11H 3KM1A 1QLFB 3F8UB 4MB5A 4U1KA 3B1UA 4HEPG 3TVMB 3WSQH 2VR6A 4HWBH 1P4BH 3U6XA 5IVXB 4HJEA 3DVFA 2YJQA 1PAZA 1A3RH 4NKDA 2DW5A 5JQIB 4P4KB 4G6JH 3THML 3H3KA 2VLJD 3TNMA 3NUKA 3LQAH 3E8VA 2KI6A 1YNTB 5E8EB 1A1MA 5DFTA 4HHWA 4UNVA 4KUCF 5JIDA 2WLIB 4K23L 2XPGA 3B9VA 3KJ6L 5F8RC 1PX8A 3V0VA 4G6FD 2VDNB 3FQXA 2KLTA 3K5RA 5F1NA 3QPQD 4MMZC 2Q7NA 4PJXF 3HE7D 4FNSA 5GGSY 5IR1B 5TQ2H 3ZTJG 1NEZB 1M7UA 4CBPA 4CSTA 5E1AB 4XX5A 3PV6A 4PRNA 3T65B 3W9DB 3CXHJ 2CBMA 4AKOA 1QP1A 1V3JA 2XG5A 2AJVH 1KTDB 1FNSL 3CC5B 4FNPA 3WS3A 2HRHA 2AC0A 4IGBB 3DSFL 3S98A 4ALAL 3CSFA 4KZ0A 4AIOA 5E4IA 3T0VA 3CAFA 4GQRA 5DHVB 3ZY7A 5C0CA 5E2TH 5CO1A 1NLDL 5F7BA 3V4PH 2BVOB 3IBEA 1LDPL 1T20A 2CNZA 4O5LL 3HKFA 3JWNH 1KFGA 1OAJA 3IDXH 4QXWA 1CICD 1ND0B 3TWYA 1MFUA 4ORGB 1OPGL 4PV9B 3G5XB 2H6UA 2BSTA 2ZG2A 3C8KB 4QMEA 5DJ2A 5TDOA 4XCYB 3RLSA 2CJSA 5JOPE 3ZGIA 4DKDC 1ZWIB 3SSGA 1JNNH 2Y36L 3ARFD 5E0QA 2WO2B 2AJUL 1CGTA 2XQYK 3BSGA 1NPUA 1TO5A 2DLGA 1G6RL 1OB1B 1JD7A 3V6ZA 4P5MA 3BEWA 4RGNC 2AQNA 3F12B 2NNFA 4L8DB 4IDLA 5AKVA 3E0GA 2AEQH 2GJRA 4JDZA 3F00A 1OCCB 4P5TA 2FEJA 2AKRA 2VDLB 3B5HA 1QFWI 1JRHI 2XV0A 2XZZA 3CVCA 3UC0H 2AEOA 4WGKA 1GZHC 1PG7X 2C1OA 2ZF9A 3QA3B 5DCCA 3IFNH 4FFYH 3MLTA 4XPBH 3MBXH 4BCXA 3KBHE 4AMKL 5EPMA 2E7LA 3WGVB 1CLVA 5BS0A 1BEYH 3GSOB 4DP5X 2FECL 3G5YA 4TUKH 3LZFL 3ZDZF 1EO8H 3O2DA 3OR6A 1A6UL 1NIEA 4ANWA 3WLWC 2LFGA 5F7NC 3QPXH 4H4NA 4OIFA 5EBMB 4KJWD 4MJIE 4PLJC 3LQZB 5AVVB 5SWSA 3PL6D 4HJGA 2EIZA 1HKFA 5G4MA 4OLWH 3O3UN 5C2UB 4PWFA 1E5CA 3MGOB 4FXLA 1P84K 3FU0A 5CJ8A 5T3XD 2WZ5A 3MO1B 5IFJA 4M7LT 5CJXA 2FUTA 3IN2A 3VX1A 5IHLB 5HHQB 1Z9NA 1DUZA 25C8L 5G4OA 1OE3A 5EORH 1Z9SB 2FYYB 3APDA 2DQUL 1UD4A 4MJIB 4PJEE 2E5EA 4KJWC 3X3GH 4WQOA 3TVMD 5AB0A 4PP1D 5F7MC 3ROOB 2JJSA 3EDEA 2A74B 4NI6A 2H3NA 4MD0A 2FWSA 2HWZL 4P4KD 3KYKH 3T8VA 4HJSA 4N8PA 3I3BA 2Y7LA 4RDQG 3N40F 4MB1A 3ZUNC 3ETSA 1T4KA 1WK0A 2CR6A 3FTXA 3U1SH 4OZFB 3MNVA 3TVMC 1DJGA 3TXAA 2V2WA 5MEQA 2MOGA 3MFGB 3JVFC 3UC2A 2VDKH 1R3LB 3FU5A 3HI6H 4EN2A 5JPNA 4EIBA 2V6HA 1H8LA 2APXA 4KJYA 1WT5C 1JYNA 1X5AA 3GXNA 1A6VH 1FNHA 3S37X 4G82A 1EHLL 1F4WH 3MRCB 4GPVA 3ZJAA 2F58L 3MRKB 1BQHA 3ET9F 4IGBD 2I9TB 3ESUF 4K8RD 1PD6A 3P4LA 4U1MA 43C9A 4ZUUA 2ZUQB 1UZ6F 2X9XA 1IFHL 1TENA 4HHGA 3UBXA 4RDBA 2GIMA 1DVSA 4POUB 5C3IA 2XWBB 5K9JH 3X11B 4PB0L 2P8LB 2BMKB 5GHWH 5GQBA 2G5RA 4ZFQA 3AREC 1A4CA 3BWZA 1EX0A 4U0RB 4YSCA 4J3OD 1BVZA 2CK2A 2JIXB 2VR4A 4YL9A 3MXVH 2PWDA 4JY5H 4QXGL 2QJDA 1PF3A 3P9LB 2ICWB 4DVBA 3I50L 1U42A 4X6DF 3TBCA 3S97C 2AXFB 3FUMA 4JM4H 3VXUE 4H25B 5CEXA 1N12A 2RR3A 3BZ4A 1H0DA 1LWHA 5F7KC 4IMLA 1CFMA 2R56L 3W11C 5AL0A 4N87A 5HYFA 2EICA 3ETBF 3TEZA 4XMUA 2DIEA 2R4RL 3DV4A 4LSVH 1WGVA 3ARRA 3HFFA 2Q20A 3EF4A 1AY1L 1ACCA 3HG5A 4D0BB 4PRHA 3VXUB 3QH3A 1WWWX 1UD8A 4K5LA 1QI3A 3GMPA 4M8QB 2BNQE 4M1GH 3CLEH 4KAQL 1S78C 3AY4C 4F92B 1C5BL 4TQEH 3BPCB 2HJKB 4GEJA 2DY2A 1SPDA 1QVOA 1T80A 2DAVA 3AGVA 5I1AA 1K5NB 2JJVA 2B1AH 1NUGA 3MREB 4N2EA 1MCQA 3BCDA 3BH9A 3CLFL 2DQCL 2X6UA 3WXVL 3ARBA 3O81A 5C0FA 5EU3A 4DSYA 2P45B 5F6IB 2CIIA 2EH7L 1TYJA 2OJEB 2BNQB 4OCXH 4C56B 2J8UE 2VZTA 1JUFA 1QBAA 2IFFH 3MACL 4GG6E 1KGYE 1VACB 2DMHA 1OL0A 3AZUA 4JAMA 1WTLA 1R24B 4YXLL 1FGNH 4OGXL 2WXFA 4ZW8A 2O5ZL 4NM8L 3DX7A 1OF2B 3O2WH 3RWCB 1W72A 2CHZA 2LVCA 2JK5A 3N91A 1JPSH 1BFOB 3N43F 4AYFB 2J8UB 4B5ZA 3ZL4H 3S4SB 4LLAA 5IROA 2VN7A 3BHBA 3PJLA 1Z9PA 3U46B 4AITA 1U8HB 4XN5A 4HCIA 3NGBB 1CIDA 5EO1A 3IF1B 5CKGA 5F7DA 3ZQ9A 4FG2A 4JFQB 4QLWA 1EEUA 4JREC 2R2CA 1UWXH 2QPUA 2RBLA 4FOMA 3H42L 3SQRA 4Q6IC 2FL5A 4IBUA 2OCFD 5J6GA 2X1XR 2DMCA 4L1DA 2JB5H 2BOBA 3H53A 4N6RA 2D4DA 1XL4A 3BUDA 3VTAA 1G7QA 1GL4B 2D03H 3IKCB 5KW9L 2QVKA 1ML0A 3U6RB 4A7QA 1SXSA 3EJRA 4HG4K 1T04A 2WAHA 7CGTA 3GIVB 4QHNB 5B3JF 1PAMA 1BVNP 2JCCE 2AJZB 2XKUA 4AWJC 4LSSL 3PP4H 2CO3A 4LLYB 4N8VG 3FMGL 3ZHLA 2L7UA 2V8MA 5BPPA 3H7BB 4JPIA 4XXDB 4HVBA 3WNKA 3FUEA 4ODSH 2YIHA 1F6AA 5LDSA 2DMKA 2KL6A 5JXAH 1DQQA 3MRNB 1HHGB 3RQ3A 1YY8B 5AAMC 3CVHL 3LIUA 2ICCA 4HS8H 3HE6A 4JPVL 4YC2C 2EE9A 2F8VA 1AXTL 2IGFL 4X6CE 5K9QG 2R23A 3P4MB 4F7TB 1QLRA 2BFVL 3KWWA 1MF2L 1TFHA 3EGXB 4JJ5A 5IBTH 4GSRA 1GAFL 2YAPA 2P28B 3TL5A 3LIZH 4R84A 1OEZW 1PCXA 2TSBA 2JIXD 3ZGHA 5LXVA 1GC1L 1XVSA 4AV4A 4BDVA 2ZUQC 4YIQA 2CK0L 5JZ7D 1MVUB 2MWCA 1KB5A 2ICEA 3T3MF 3AY2A 2CA3A 5CSBA 2V2TA 2JLPA 3FO2A 4AI7A 2AEPH 3A6BL 5IJVA 3RZCA 4F33B 3AG4B 5F1SA 4G9FE 1THCA 2CBOA 1E4WL 1LYQA 2V2XB 4PJ7A 4U0RC 5JYMA 3VE0B 3LHPL 2ODIA 1UYWL 3WY3A 1AVAA 4IIQB 4KY1H 4L4JA 4ZZFA 1MLCB 4WFGE 4R2GB 1XB3A 4HOZA 1Q1JH 4WU7B 2NNAA 5A43C 1G0DA 1ZGLB 4LKXB 1F4HA 1I4FB 4QAWA 4HMDA 2IDCA 4FQLL 3QO1A 2ARJB 4ZTEA 4MD4B 4GXVH 1NC4B 4QHLA 2JLLA 3F5WB 1INEH 1EMTL 4M8VA 3SGDI 3FW6A 3I9GH 3MGAA 5I0ZA 5I1DB 5DJAB 1A4JA 2AZAA 1IC7L 4IYKA 4GUCA 4F7KA 1HINL 1A65A 1JGVL 3L3OA 4PJDE 5TDNB 3EJQA 5IB5A 2BY3A 3PG2A 3NA4A 2D7OA 3U0PB 2ED8A 4JKLA 3P73A 3L4UA 3NZHH 3NP3A 1F2XK 4O02A 3QJSB 3ZHNA 1O6VA 4C56D 5BJTA 2DTMH 2XICA 1R5WB 3SDYL 1YG9A 2VERA 5KYXA 1U8CB 5DR5L 4IU3A 5ACZB 5I74C 3K6SA 3RVVD 3QDMD 2QKIC 1KCSH 3BZFB 5H35A 1A7RL 4MZIA 1WHPA 2COQA 3VH8G 4FI6A 3CN4A 4HGWA 1J0HA 3M6DA 5MEOA 4ORZC 4PJDB 4V1DD 5ENWA 4X5PA 3WU1A 4A2EA 3UAJD 5TDPA 4YDMA 3TBYB 1MFAL 3BUYB 2YD2A 2FJHA 3GYRA 2CRMA 1JZ3A 5F3HA 2L7JA 1Z6JT 2G5UA 2UVFA 3GMLA 2WV3A 1IC0A 4K23H 3TIEA 2Y4SA 3KJ6H 5HHNA 1IVLA 3QZBA 1E4XI 1GZQB 2Y24A 4JFFE 1AQ8A 5FR3A 4GXUM 3TN0C 3B2UD 2G4GA 5LBVA 2WAQA 4H0IA 4K15A 2X4UA 5L2JA 1CD0A 2QVIA 2R8SL 4IHOB 4HKBA 4XX1E 2NUTA 1FFPA 1HN1A 1TQCB 2DDQL 3E80A 4AXWA 1VZIA 2DV6A 2J88H 2D3NA 1FNSH 2HVBA 3DSFH 1WA0X 3QCVL 3ABZA 2JXMB 4ALAH 3OLEA 2GAZB 3PIQB 3QORA 1E67A 5MP6L 3ARWA 5ACLA 3MMEB 4AQEB 4ZS7L 1NLDH 1OZTG 4OCWH 1LDPH 4NO5B 4O5LH 2PTUA 4FLOA 3RNQB 4RNRB 4M43L 4XZ4A 2OTWA 5KSUA 1FO0L 4FLSA 1KPUA 1S7XB 4RIRA 1OPGH 2ATAA 4PBXA 4NNYA 3FQUB 4L8SA 3BP6A 4KO5A 4XMKL 4MWFB 3MLZL 1BYPA 4Z3EA 4QXUL 5EZIL 5DC4B 4XMTA 2WWKO 2ED7A 2Y36H 4N1CA 4K7PX 5T3XL 1NCUA 2AJUH 4Y1AE 4BZYA 2J3SA 2V9TA 3T0AA 5AAWA 4LCYA 1G6RH 3GSRA 3UX9B 3RZCD 3VXRE 3MJ7A 4GKSB 2X6MA 2IFGA 3WKPA 3PWJB 1HHJA 3V5DA 1PD1A 2MPAL 3DX2A 4JGUA 1QFPA 1NMBL 3DXAA 3RI5F 1JZIA 2YQBA 3IE9A 3D39A 3RFRA 1OE2A 3DOIA 5DJ0B 3L1FA 1DVFD 1ZJBA 1B0RA 4ZSOA 2HTLD 5I15L 3IKKA 4IOFD 4I18B 2VN6A 3Q8AA 1N18A 3OZLA 1TSRA 2FH6A 3IB4A 1CFQA 4G8AC 4R2GD 2VDNL 4LDCA 4X50A 5F0LB 1QA9B 1HI6A 4AMKH 4ZO7A 4LASH 9CGTA 1WZMA 4LOUD 5DMKB 1I9IL 1WITA 2VB5A 3N3EA 5TE6H 3BZEA 1TF4A 1S7UB 5IB3B 2FIKA 4LSTL 1NGZB 4PJAA 3S5LG 3LZFH 1N6UA 4NLAA 1A6UH 4N22A 1P4IH 4RMUA 3RIKA 1NC4D 2H2PD 4WEUD 4IIQC 1RHHB 3U2SA 4N8UA 2VLKA 4WW2A 2LLNA 4F7MB 2CUAA 1GOFA 1LGVA 3JTTA 3T04D 3UP1A 3CPUA 1L0YA 1UD3A 4N5ED 3W81A 5EG6C 1KN2L 3TZVB 1PNCA 2NY6C 3SODB 3K46A 1IL1A 3W5NA 2SODB 1CDUA 4UYQA 1C16B 2G75B 3K6FA 4ZMNA 25C8H 5BO1L 5MEPA 2XWRA 2DQUH 3VFVB 1FL3B 2EEDA 2F7PA 1KBKA 3LS5L 2X4TA 4LVHB 4P06A 5CIPA 4OFVA 4A66A 1P1ZA 4NKMB 1SN2A 2HWZH 2ZOOA 3BAYA 5EU4A 5JW4Q 3HC2A 4DKTA 3QGVA 4P2QA 1YPZF 3WXWL 4CN6A 4PWHA 5HGDA 2QSTA 3D3VA 4FQXC 5I17A 4PJGA 5F7EH 1H6FA 4UIKL 3SDCC 1ZPLA 2UX7A 3BXNA 3EYQD 4YE4L 5AVSB 4BZ1H 1E5BA 1S7RA 2KZWA 2R51A 2XX0A 3LKSA 2G2PA 2VC2B 3K91A 4MBRA 5FOBB 1QW8A 1TCRB 2C34A 4F9PC 2XWDA 3QORD 2VDOL 4Q97A 2EIMB 4MAYB 2VDLL 3KGTA 4YHKL 1S9XA 1EHLH 3LAFA 1SLXA 1OD7A 1HJCA 2F58H 2NLJA 2X4SB 3NIFF 1AD0B 5CXPA 3RPBA 4ABVA 1E43A 2WP3T 3BPOB 3FSOA 1PLGL 4OGYL 1ETZA 2H47C 1IFHH 1HQ4B 4XBEL 4GOSA 3AABA 1PFCA 1QQDA 3LXUX 4KK8C 2ZXBA 4R7DA 4B0MB 4GEIA 4PB0H 4G11A 1DLHB 1TQCC 4L9LB 3RUGA 1YEHL 4L29B 4JPKL 4F93B 2HUEA 2NYZA 3CXHK 4C8XA 2CLRB 2ENPA 1DQLH 4GI9A 4IBQA 1AP2A 4AL8L 1BX2A 2A83A 4QXGH 5KYUB 2JWYA 4J6IA 4PTUA 3IDIB 4WY7L 2MCPH 2X3BA 3RPIB 4I7ZC 1BIIB 1FSKB 3EH5B 2IALA 4ELME 4HSCX 2NW2A 3LRMA 1KDIA 4W93A 3WUWB 2CDFB 3KLKA 4NYLB 4DO6A 5EFIB 2Z7WA 5A2BA 1JF1B 2X89D 2ENSA 3RL1B 1WH0A 3UJJH 3IDMB 1RULL 4L37A 1UWXK 5DJXA 1QHQA 1AY1H 2C3VA 3MCLL 3IWVA 4L2LA 4ZMOA 5SX4I 4W4OA 2PO6C 5HGHA 4ELMB 4BK4A 5IQ7L 5ECJE 4WWID 3PDOA 2W0LA 4KAQH 1SJMA 4CADA 1C5BH 4YBHA 5AZ2L 5DUJA 1W8EA 1KBVA 3BVTA 4IKLA 2YD7A 4KGLA 2OCJA 2B15A 2ZUTA 1CK0L 3NN8B 3CLFH 3GI8L 2DQCH 2XZQL 4JDVA 5I8EA 4KKPA 1SBBA 4X7SL 2WVSA 3BO8A 2F53D 4QTHB 1EEYA 3KWUA 4LXFA 1QO3B 3E8UL 3MACH 1YA5A 1W0VB 3SQOL 2GJZA 5KVFE 4YXLH 1UENA 3ZO0A 1BM3L 4OGXH 1HCVA 5LB1A 4M02A 1I75A 2O5ZH 1ADQL 4Y5YA 2DKUA 4RBPH 3TZVD 3V9FA 2VO5A 4U7SA 1G7JA 5E8DL 4MJ4A 1DVTA 4P48A 3FRPB 5KVEE 3MRBA 3MI6A 2FATL 2EIKB 3V5HA 1CS6A 4S10A 2XTJD 4OLEA 5F71A 3TBBA 4P4RA 2J1XA 3TH2T 3FTSA 4LLDB 5F1IB 1H3PL 5FS5A 3WTWA 3TZVC 4P2YA 4X7TB 1CXFA 5B3SB 3H42H 5IHBA 1UGNA 1IB5A 4JFVA 1TVBA 4WK0B 1E5ZA 5IJCC 4L0ZA 4P8QA 3GD1C 2W60B 1F4AA 3QG7L 1YCSA 2Z65C 3MUHL 3QXVA 2WSKA 2JH2A 3WEMA 2W94A 5A2AA 3VRIA 3MOBH 2GUOB 5KW9H 2VN4A 1C9SA 2EXYC 1QTYT 4RMQA 3DGGA 1XF4B 1JPFB 1Z66A 4HJIA 4HWNA 2ZAGA 2AABL 4LSSH 1FIGL 2OTUB 2H2SD 3KW8A 4MAYD 4UWQB 4G6AD 4P23A 2BLFA 4LARL 3ZDXE 4BGDA 2B39A 3L5WB 4LVOB 2FDBP 3OJ2C 3BZ5A 4R5TA 4PRAB 3TC9A 5AQ0A 4XHJC 3UYOD 3D25B 3D87B 4NWTL 1JIBA 3SB3A 3CVHH 4XH2A 2X4NA 1YSOA 4JPVH 2IGFH 5I1GL 1AXTH 3BPNB 4G1MA 3RI5K 3WD5H 4Y4HB 2BFVH 4MCZB 2AFNA 1CVRA 2OMXB 1MF2H 4MAYC 1CFTA 2B20A 3KXFE 4G6AC 3PWVB 4N9GA 1GAFH 3FCSA 3ZDXB 1JYWA 1JV2A 2UYLA 3ZYIA 3LKRB 43CAB 2W5PA 4B41A 4ZFOA 1JFQL 4NPYB 4Y16B 1GC1H 5CZKA 4BQBA 5J57B 3OKYA 2AV7B 1JV5A 3FHQA 2CK0H 5DEFA 3SKUD 4OZIA 4GNKB 2MIZA 3IXTA 3L7EB 2X1QA 2EECA 5F8QC 2HFTA 3RWHA 4L9LC 3KXFB 3A6BH 4KPHL 4JM2C 3HAEA 4Z95L 1DO5A 1E4WH 3SDAB 3DUSA 3NIGB 3LHPH 1UYWH 4LIQL 1R3JB 1X7QB 2X4QA 4NQVB 5GISL 5DYOB 5DJ6B 4CC1A 5LBGA 3L7FA 5ADOL 4FCAA 4FQ2H 3B8YA 1HE7A 3CQPA 5MENA 1NFKA 1I85A 3ULAB 4E5XG 1L9MA 1RV6X 1ZTMA 1T2JA 1WIOA 1FSKC 3HZYA 3U0WL 5KBLA 2EC9U 3QIWB 1H3TA 4FQLH 3ZO9A 4OGZA 4JHAL 1KY7A 4HCRA 1ZV9A 4ZXBB 3U0TA 3FDWA 2Q5BA 4UU9B 3EYOA 1WIPA 5CZXC 1IC7H 1MXGA 3SE3C 2VQ1A 3QUZA 1HINH 1FV1A 1JGVH 5D93B 2PCYA 5DD6A 2PP7A 2ZCKL 2GSGA 4EZMA 1OTUC 1I1YA 3SDYH 4UDUA 1SYSA 5DR5H 4W4NA 4CNIA 5I6OA 4OLYL 2BVTA 4JX0A 1A7RH 1VGKB 1TTUA 1ZTXE 4O51A 4FLQA 3SPHA 4V11A 4ZAKB 4YDLC 3TT3L 2CDGB 4Q6YA 4W9HC 3OX8A 3PPSA 1UVQB 2RIKA 4B9YA 1EZUA 5EH1A 4XE0A 4EO5A 1MFAH 4DJMA 5TK2A 3VYNA 1A6ZA 2QMKA 1E8WA 1KB5L 3P0VL 5I6NA 1CYGA 1WBZA 4S1DC 3EKCA 5I0WA 4H13C 4I8DA 2QTEA 2XXFA 2ZG1A 1G1CA 1QKZL 4XXWC 2CALA 1J5CA 1KZQA 2UZIL 2WBJC 3Q1EA 5DRWB 4P5SA 4PJCA 3BVWA 1NZRA 3OB0H 2R8SH 3V4UL 1S4IA 2DWEB 3QZLA 5IF0A 3LXCA 2PYEB 4AJYV 3W82A 4R7NA 1DBML 4EI6B 1EJ6A 1KWKA 2UXTA 2J1ZA 1RZ8A 3AMLA 4QXTB 3FKUS 3TCLA 2Y5QA 3QWRD 3QCVH 3CVIL 4CW1B 5EUOA 4AM0B 4H2CA 3U1QA 5MP6H 3PP3H 4E9XA 2EXWD 1J1XL 2AERT 4DOHE 1MWAA 2ZOWA 1G0XA 2I26N 4NZUL 4ZS7H 4EUPH 1WZLA 2N7SA 2WHVA 2WQXA 4DGYL 1VLXA 5KBPA 3RGBA 2CUIA 4F7EB 4PLKC 2PTTA 4M43H 3EDDA 1P2CB 1M2VA 2NY4C 2QV2A 1FO0H 4TL4A 1TZAA 5IHUL 2XWXA 1KT2A 3BIAX 3P2BA 2ZYIA 3RTQA 1HZKA 3LEXA 2EZ0C 2EXWC 2VLRB 3FTUA 4QXUH 4DOHB 1PFOA 5EZIH 1V05A 5K9OB 4URKA 4PW9A 5T3XH 1QFUL 4LVOC 2AK4E 3NZ8A 2EDQA 3UJTL 3ZHKA 5IMMA 4G1EB 5K1JA 3REWA 1D5BA 4EIGB 1BF8A 4Y16D 2C4FT 4PJHF 1YHPA 2PXYA 3H2QA 3X1FA 1HILA 3KJ4B 4YXKL 1MAJA 5EZLA 1FNLA 2WBKA 1J12A 3OMZA 1V55B 4BGLA 1NMBH 5IMLB 4HKJB 3KHQA 4Y4HC 3CG8A 3ULUE 4L3EB 2EACA 4YLCA 2IAMA 3KXFD 5I15H 3QCTL 2G3NA 2DQIH 4AGOA 1FZOA 1IGTA 4MS8D 4DKAA 3SDAD 4GG8A 4WTZG 4X4ZA 4DVRL 5GZOA 5GGUB 3JV6B 4UV7L 2VDNH 1DQDL 2FLMA 1WISA 2FGZA 4PHXA 3MJ8B 1GZPA 2VXVH 4H8WC 3O8XB 3H3BC 4IM8A 1W2KT 4YGVA 3WY2A 2BSDA 1BF2A 3OL2A 2A6JA 4K7PY 1KYFA 3V7AG 1ED3B 4LSTH 4M5YL 3QIWD 4AYDC 4M7KL 1HFUA 1CZ8L 3QYCA 4MS8C 3SDAC 2PR4L 2IXQA 2Q3ZA 5JNYA 3FTGA 4P3DB 4QNPF 2WXRA 1T1ZA 2N7BA 4HAKA 4K8RH 1TQBB 4LNVA 1DJWA 1SFDA 4M61B 4BUGA 1KN2H 4Z3GA 1DJYA 5DEJA 2ADIA 3PS6A 2V0AA 5SWZE 1WUZA 3MGTA 4CMHB 3GSUB 2PP8A 3N1MC 1TLMA 5F72S 4QO1A 4ZXBC 2VISB 1KYAA 3LN4B 4IBYA 3CFKB 3GJFA 4J3OH 2ZOKB 4BJLA 5BO1H 1J9QA 4R7XA 4EN3B 1CXKA 3D2UB 2Z7UA 3OKNB 4ZAKD 3LS5H 1XR8B 3L3IA 5D93C 4HULB 4X99A 5SWZB 5JPMC 1ZVSB 4OKVA 3E9UA 2QGCA 5EIVA 1HEJC 1ZGLM 3WXWH 5BRQA 1W91A 3ZDWA 2IQAA 3I9PA 5I8CA 5ID1A 3PUUA 1JZ2A 1U3YA 1YJDL 3UG3A 3QZWB 5D5MF 4JLRA 5KSBE 1AHWA 5ESQB 1NAMA 1ZS8A 2C9SA 2J7LA 1GA2A 3VG0H 5JUEL 3ATAA 2HVKA 2YBGA 2VH5L 1INDL 2X40A 2FHBA 4Y5XA 3H6JA 2WYZA 2PYED 2VDOH 5T1MB 3NJFA 4O2FB 3VCLA 5IP4A 3NZUA 3ZOAA 2VDLH 3ZR5A 3KPNB 2EUXA 4V33A 5IVXF 4L4TA 1WIUA 3K4ZA 5AW3B 3O4LE 4IRSB 3G5ZA 4KI1A 5DS8A 5KSBB 3S37L 5KJRL 1PLGH 4OGYH 2ETWA 1NBYB 4LCWE 4HH9A 4XBEH 3GSNA 1B4JL 1LP9B 2OQJB 3CUPB 4TYUA 5D7LA 3V0HA 3BVNB 2J73A 5CLWA 1FYTE 4LCVA 1YNTF 1HHIB 3TO4D 3O6FB 3EH1A 1YEHH 3RX9A 1T66D 3FT3A 4JPKH 4JFHD 2ITFA 3SDDB 1AKJA 5EN3A 3O4LB 2JV6A 4N4YB 3SEPA 1AACA 2BP5M 1EFXB 1U21A 2DYSB 3UCQA 4AYEC 4DGVL 3KYNB 5IV2B 4HZAA 4RBPK 3SPGA 5J7CC 2VLRD 2X87A 2YEZB 5CMAA 4WY7H 4Q8BA 2Y2TA 3KPSB 3BZDA 2YPLE 5AB1A 1UXWA 2H1LM 5DTFA 3CFIC 2R1XB 3DYOA 2B9BA 4JK0D 1D5ZB 3DK2A 5D71L 3N9GL 4OCMC 3BKML 4OQTA 4BSWB 4D7PA 2BVPA 3BQUA 3FSWA 3K72B 1XD0A 4ODVL 1RULH 4E41A 3ULVD 4F5CE 1M05A 4NZRL 3AADB 2D9CA 5AOZA 1QSFA 1SNRA 4L3ED 3VXNB 5IQ7H 3HS0A 2DOCA 5B1JC 2W0FA 3PDDA 5I5RA 4J4PD 4RRPG 4J3OF 2P8MA 5A6IA 2GBAA 5AZ2H 2HVJB 2P42B 4OZFH 1UJ3B 2OTPA 1FPTL 1BZ9A 4QY8B 5DI8B 3GJEA 1L9TA 3CHSA 1MHEA 1CK0H 3O8XD 4M8UA 4Y5VA 3GI8H 2XZQH 1KXQE 3MNWB 1AJ7L 3AXHA 1LEGA 3CDCA 1KUMA 2CLZA 1LM8V 1MVFA 2VQUA 2V8LA 4MLIA 1DN2A 5H4YA 5IVOA 1UA6L 2MQGA 3NJJA 3QIUB 4ZPTA 1KC5L 2YFNA 1OPOA 3MR9B 1O6SB 3QNXA 4NFDA 4OB5L 3RNKB 3S96B 1HNGA 4MMZA 1BM3H 3N0PB 5B8CB 3TYGL 5HYQA 3LPPA 1VKXB 1RPUA 1FNAA 1E2ZA 5HHXL 1ADQH 2JKRM 3RY6C 5FO9B 2H32A 2JKSA 3ULUC 5GRJL 5A2CA 3TA3B 4HD9A 3VXTA 3RL2B 4PQXA 5E8DH 2N3JA 1JJUA 3ZPDA 2FATH 2V5MA 5IMOA 4JRFA 5D7JB 4JKWA 1OGTB 2E0PA 1UM5L 1WLHA 5IG7A 4U1SB 1FUNA 3RDJA 3BJ91 2HKFL 1T0PB 1G7MB 1GYUA 2YPKA 4YDJA 2DEYX 1F8TH 1JI2A 1LQBC 2F5AL 3APFA 4EN3D 3PXJA 4BH7B 2WANA 3SDXB 4XNQB 4PRPE 1B88A 3UP6A 1H3PH 4N86A 3IWUA 5SWZD 4U3SA 1BXAA 3IXAA 2Q7YA 3OJVC 1I7ZB 3IFPB 3QG7H 2ZWKA 4IEFB 3V4VA 1QG3A 3WN5B 5DK2B 2EE6A 1A9VA 1YLBB 1GTFA 1VZHA 1F58L 2H3XC 1FRGL 3G08A 3VXQA 4BZ2L 4PRPB 3L4CA 4L4TD 3RKPA 2GFBA 1N8ZB 4PMFA 1QI5A 3O6LL 1S9YA 1B2WL 3RDTA 2AABH 3IDGA 4PJ6A 5MI0B 3G04B 2VSKB 3HPLB 4MDRA 2JQMA 1T2XA 5D7LD 2DL2A 4YFDB 4X4XB 3VFRA 3QZMA 4PR5B 5C8JA 1N5YL 2ZP9A 4IRSD 5F21B 2AV1A 2V7HA 5D2NE 5EZJA 2GT9B 3B3IA 3MLYL 3H3PL 1T1XB 2WPGA 4EXKA 5I1GH 1V3KA 3U9UA 4FQQA 2J6EL 3BGAA 1KJVB 2NZ1A 3DIDA 1X7SA 5KSVA 1K2DB 1M2OA 3CIQA 1CL7I 1CF1A 2CKBA 3FQTB 4LSQL 3SDDD 2IDUA 3X14A 1RIVL 3O4LD 4IRSC 1JFQH 1TKWA 3VD5A 5D8JL 5C0AA 2B0SL 1ILUA 4UMGA 2WQSA 5C0JB 5A6MA 5HSFA 4WFED 4OV5B 4X6EB 4ZI8A 5CN2A 4UTBA 3WIHA 5HHOA 4LVNB 3KPSD 1UZ8A 3O6FC 3QS2A 3GB7B 4GKZA 4KPHH 4FFZL 1I8MB 1EWHA 5DT1L 4Z95H 5JQHC 3SDDC 2VXQA 1PIFA 4PJIB 3ZL1A 2GG1A 4LIQH 1I8AA 4LT7A 4ZQKA 2CDEA 4MA7H 5E1GA 3ZQWA 2FEDC 5FO8A 4PSPA 3MRJA 5E5LA 3FFCE 3HCVA 3F7YB 2I27N 3CZLA 1A7BA 3NSDA 3OB0K 3DRTB 1KYOJ 1XBRA 3R06B 1S9WB 4NHUA 3U0WH 4B0MM 1A4AA 4AOFA 1BFVH 4ANVA 1QEWB 1KCVL 4ZX4A 3NIDE 5C6WH 1I8LC 1IGJA 2OMNA 2NXZC 4I0PB 4JKPH 4OM1L 2YUWA 1Z9MA 5JDSB 2EE3A 5CCKH 3PWUA 3L3DB 1S5IH 1HEZB 3IGKA 1INQB 1L4IA 1M1XB 3PP3K 4QKTA 2W38A 1TPXC 5E70A 1UWGL 4UOW0 1KFAL 2VITA 4LZKA 2ZCKH 4ISVB 2QMJA 2WP3O 1SYVB 3NIDB 5IHZB 3DO7A 1MRFL 5LNGA 4OLYH 2L7EA 3U83A 4OD2B 1RMFL 4M7LL 1HWHB 4F58L 2MHAA 1IKNC 4AKPA 4PH8A 3APNA 4ZFOL 2HFEA 3HZKA 1WT5A 4XOCA 1JD9A 2RGSA 3TA3D 1YMHA 4WWKC 5DZNA 1GYVA 3AC0A 2YQGA 2IMNA 3QIUC 2OJZL 3MODL 3BWUF 4F2FA 5K69A 4HS6A 4AQZA 5AVRB 2WXIA 4OLUL 4Q52A 1JN6B 1MCSA 2B8OT 3QNZA 1UH4A 2GQHA 3RX7A 1QKZH 3GHEL 3BUTA 1NFIA 2UZIH 2EXSA 4X8JB 1WFMA 2A9CA 4EZJA 1AC0A 3AREA 3EOBB 1HHHB 4XWOC 3CX5K 1OHQA 1OLLA 1DBMH 1I8UA 2PCPB 1MCRA 1MZYA 4I3SH 5D7JC 4Z77B 2AF2A 2C1PA 1DP0A 2FR4A 2BC4B 5I9QC 4H5SB 5I6XB 4LGRB 1GGCL 4MJHA 3CVIH 2BIQA 3BW9B 4FA8A 5C0NC 5A16A 5KSAB 4HU2A 4PJ8C 1R33A 3GNML 1IAKA 4NZUH 5AKSA 4CN4A 4MDIB 5DHDA 3AITA 4DGYH 3CZJA 4ORGA 3GINA 2MCMA 4Z3IA 3GI9L 4GP8B 3B7UX 1F11B 1X5FA 4YAQB 3ZTNL 4F80A 1TVHA 5IHUH 2VRKA 3CFDA 4XMZA 1BW8A 2HFGL 2X6BA 2DWSA 4NC1E 2IBGA 1NFDE 1SMAA 2AI0L 4HIHB 4M6MH 3NCBB 4NXKA 2NNRA 3JV0A 3H4HA 1KBWA 5IBUB 3S5YA 4G7RB 2X5PA 5K39A 1BQRA 4G6KL 4NNPL 5DJYA 3LB6C 1NGPL 2AJ3B 3KE0A 4ZYKA 3IFOB 1QFUH 2ZONA 1OW0C 1UD6A 3H2PA 1YEWA 1MZZA 4X9FA 3CDGB 1YEFH 1FL6B 4MVBC 3MUGA 3OKDB 4YXKH 4QRSB 1GPOL 1NFDB 1SMOA 2EYSA 3BGMB 1IKOP 1AFVH 2C3WA 2YBRB 4WHYG 4K0OA 2E4TA 3SGKC 3DHMA 3CHRA 3NJLA 4PTTB 2PKDA 4Y89A 1RI8A 4GXUN 4FRWA 1Q9LA 2OMWB 3CZFA 3QCTH 1HXMA 5GS1B 4JKMA 5AW7B 3O6ML 4BKTC 1JCKA 3I02B 4DVRH 4UV7H 2AGJL 4LEXH 2G5BB 5D2NC 2IPUG 5FFGA 4K94C 1S9VB 4ES9A 1AHMA 2ZX7A 3DOSB 2VMEA 1K3IA 3BAIA 5EU6D 4JFZL 1AZVA 4LVNC 2WCGA 4AEEA 4MTMA 4QRTA 3CMGA 3PHOA 5EN2B 4JFXA 4M5YH 4OLXL 4M7KH 3B2XA 1U8JA 1CZ8H 1K6QH 3AB0B 3L95B 3MV8D 2GJJA 1DQKA 1R46A 1L0QA 2P3YA 5DMIL 5I8KH 2Z91B 4I0PD 2E75C 3NEEA 5AOKA 2D2CC 3D2TA 3KBFA 4FTVE 1XR9A 1U0QA 3ZE1E 1E5AA 4Q6IA 2ZP0T 1AR1D 4IKIA 4Z7QF 4N0UB 2VQTA 3NQIA 1X5LA 3MRFB 3VFWA 3N0AA 4Z7NE 4WJ5A 5E2VL 3RTLA 3SBPA 3ELQA 2EDJA 2ALAA 4ZMTA 2WNXA 1URZA 3P0YH 4MJIA 1P53A 2BCKB 3A24A 3GC3A 4I5BB 3FSVA 2GTQA 4RFNB 3T4YB 3V0WL 1RJYB 5B22A 1AZCA 3KPMA 3DKHA 3ZE1B 1K4DB 2M8XA 5DRNB 3QFDA 2ZOLB 3G6DL 1JVOA 2GBTA 1UOWA 5CCHE 2XYCA 1U58B 4RGMC 1GJIA 3B9AA 3ZT7A 4Z7NB 1KBGL 1L6PA 3QZPA 4FA6A 4PJEA 2LW3A 1X5KA 2F6AA 3P3TA 3CV5A 4RWHA 2VLLB 3U9WA 2R0LL 2V9QA 4DP8X 2VDPB 4WCYL 5AAMA 3ARVA 2VYRE 2EIBA 2HJLA 2XQYG 4ATTA 5IOKA 2Y06H 1U3HB 1X5MA 3ULVL 5D7EA 1JNJA 2VH5H 1WWBX 2WN2A 1INDH 1XTLA 1A7NL 2EAEA 3FU7A 4OT1H 3PWPA 4YHML 4TLSA 4A7GF 35C8L 3MBWB 5KVDL 1QFHA 3LOWA 3MLSL 3S88L 5E6IB 4P2RE 1UFGA 3I74A 1II4E 1FL5B 3DJRA 3OG6B 2ZCLL 5KJRH 4R90L 3FQNB 1U8MB 3X11A 3WDJA 4KFZC 5JHLH 4PBWD 4FMFA 4JZJB 1F90L 2C3GA 1B4JH 4XMPL 5KSAD 5L9DL 3U9PL 2OA9A 3LYRA 3QEQE 2J5WA 4DO4A 5C08B 5E6UB 3TYFB 3B9DA 4D0DB 5CGYC 1KPVB 4Q14A 1T4WA 3WFBL 3ROLB 3MBEB 3MN8A 1H19A 5I6XC 4YFLF 1XB6A 4QRRE 4DGVH 1ZT7A 4E68A 4KO9A 5ESAA 5EMYA 4NRYA 4F15B 3SO5A 3UEZA 2DPKA 3QEQB 2ATPB 4B9IA 4X4YA 5A2LH 1EFQA 5DYFA 4NKIL 3T0EB 4UZUA 5GGRB 1T7ZA 5D71H 5JMRA 3M1BA 4U6YB 3NJKA 3BKMH 3ESOA 2G3MA 3AU1A 2ITDB 3VXUA 1PZ5B 2KZ1B 5LVEA 3U7AA 4QRRB 1AOZA 5FB8A 3HC0A 1CQKA 3ZYJA 4NZRH 1BVLB 2F1AA 1J86A 1NAML 2IPKB 2CJUL 4AV5A 5DRZB 1AXSB 4LU5L 5K9KA 2QKIA 3PE9A 2OXHB 2J43A 3MREA 4I48B 2P43B 4NC1C 2FT7A 4KX9A 3SIKA 4NPJA 1Y18B 3ZDYE 5T1KB 4LF3A 4RAUB 4R83A 3GLDA 2G3ZA 3S36H 2OMVB 8PAZA 4X8XA 8FABA 4LAJH 3ZZSA 4OZ4A 3LN5A 1BM7A 5J1TC 3IDNB 3TBTA 4IOSA 1KC5H 5GXBB 3FT0A 4OB5H 4F7CB 3N04A 1DLFL 1X7TA 5GSRA 3TYGH 3TN0A 1FVDA 5HHXH 3IJHB 3V79C 1L5GA 2IH3B 1OCOB 1AH1A 5GRJH 3QR2A 2FBOJ 2Z92A 4GG6A 1B0GA 1RL1A 4ZMYA 1P1VA 3AB0C 2WXJA 4AZ8B 3B83A 4S2SA 1UM5H 2VQ4A 4NO3B 1NEPA 4M7JL 2F5AH 3IMBA 4WW2F 1I53A 2WNGA 2FD6L 4WI2A 4OV6F 1AQDB 2CMRH 3L3HA 4BSVA 5AYUL 4IHBA 5JIQA 3GXPA 1CI5A 4PJ9D 4H44C 4JG9A 4GSQA 3U6RA 4GP5B 3PWPD 3SPVB 3UBXG 4AGMA 3VRJB 2FO4B 3IMSA 2KDYA 4E42B 1F58H 2UV3A 2EABA 1FRGH 2NY1C 5L6YL 4BZ2H 5CU9A 1U3HD 3KNBB 1NGXA 5B39A 2OMZA 4KK6D 4F20A 1BBDL 3BRFA 2YAMA 5I0YA 2VKWA 1B2WH 2K6ZA 4PGCB 4EDXA 4IOIA 1BZ8A 4PJ5B 5AWNH 1CR9L 3MTRA 3M17B 1OK8A 2IVFC 3NCEB 1N5YH 2JCCA 1HH6A 4OFQA 3L3JB 1D5XB 1UXSB 4P0DA 2FQDA 3AU0A 2CO7B 1YEGL 4Z7VE 3UMTA 1N59B 4HMEA 4MGXA 5ABAA 3FZUC 2F7RA 3WO4B 3MNDA 2CO6A 2J6EH 4GW1A 4P2OB 1LJMA 5TE7H 5C08D 3NCJH 4CMMA 4LSQH 2BRQA 5E6IC 3J07A 4EVNA 3TURA 1FVEA 3KLAB 1RIVH 5EF0A 3F3HA 4E36A 2Q0ZX 1TITA 5D8JH 5DZ9A 4X6CA 2B0SH 4Z7VB 3QUXB 4N0YL 1AGFA 1Z3RA 3MRLA 2JKJA 3U4AA 4LBEB 1U41A 2K9FB 5CKAA 2E76C 4NC2B 1XSOA 3QEQD 4FFZH 5DT1H 3TIDB 4DCQB 4JFPA 5CZRA 3T0ED 3ABGA 4TSCL 2EEFA 3MBEC 5DJCA 4XNUL 3O3EB 1E9QB 4WU7A 3S2CA 4QRRD 4I9XA 4NSKA 5BXFB 2HTKC 3FT4B 4RQQA 3SD2A 2G9KA 5F2FA 1J0JA 3IGAB 1EHNA 3L2LA 3HHSB 4G9FA 5ALBL 2VR9A 5ITFB 1CDIA 1CLZH 2VO8A 2BSEA 3C6LB 2TSAA 1KCVH 3QG6B 4Z7OE 1PY4A 3IETB 5HGAB 1QATA 4N2OA 3FBKA 4OM1H 1YEJL 4ZO8A 5TDNA 4YS4A 1F4XL 1QHOA 1ZHNB 2X4RB 3L5XH 1NIDA 4IKKA 4N0FB 1D6EA 4KOBA 1D9KA 1ZIBA 5CNHA 3DUUA 5T1KD 1MFEL 3P3RA 3D07A 1KFAH 3HI1B 5DQDH 1U8CA 2K8MA 4FQXA 2VAAB 1OY3B 3SDCA 3JWDC 3DBXA 3MJ9A 3C09B 5IK3A 5AEAA 4B60A 2ZSVB 4TVPD 3OKEB 1MRFH 5L4IA 4D8PB 1RMFH 4DETA 2EUZA 4M7LH 2CRIA 4KRLB 4FQPA 4PJDA 1KIRA 4B3EA 4F58H 2HFFA 2CKBL 4GRWB 1I1FA 2C7FA 2XIDA 2GCYA 4AC4A 3SGJC 5KG9B 1LLAA 4M5ZL 3SPJA 3TBYA 1KWGA 3TTYA 2HCZX 4F9PA 3VWKC 4ZMZA 4Y9CA 1SVCP 1I1AB 3RWEA 1SBSL 1FG2B 3QXWA 2CLVA 1JNLL 4UTBL 4AW7A 3MODH 1KXVC 1ZA3A 2XDHA 3D8MA 3OKMA 3C5JB 5LBSL 5EF1A 2AAVA 3ES6B 2FNBA 3HAEH 3NRFA 4OLUH 2VXQL 5EIIG 2LFEA 4W9KC 3WKQA 4E9VA 4J2QA 4IHOA 2P5WE 4HHAA 5AUMB 4I13B 4YLQT 1BVNT 1I7RB 4XPHH 1BAFL 4NRZA 4UQ2B 3TJHC 4JFOB 5F0MB 2BM3A 1TQWA 5J11B 4LCUB 4JFFA 3ZK0A 4BFFA 5F88B 2R2HA 5GGVL 3OXRB 3MZGB 3FQ2A 3GSXA 1GGCH 2XXCB 1NL0L 3Q5TA 1TQSA 1UB5B 2GSIA 5D96C 5CBAB 4DTGH 1ZRUA 3BP7A 5FUCE 3GNMH 3ZKMD 3O45A 4KKBD 3RNQA 3ARUA 1YYLL 3TS8A 2IANE 3TNNB 1CGSH 4CL7A 5JLZA 2YKLL 3LSOA 4P07A 3VA6A 1IM9A 2ZJSL 1NCWH 3LKNA 4WU5A 4PJ5D 1OZUA 2Y6SD 4PLOB 4X5XA 5KVGE 5C07E 4MNQE 3DMMB 5ICUA 3ZTNH 3ZE0E 2W9EL 3P4NA 2G9HB 4K4KA 2WIIB 1ZXQA 2AI0H 2PO6A 4Q6KA 1CFVL 1Z5YD 1J1PH 4KKBC 2HB0A 4G6KH 4NNPH 1SUJA 1P7QB 2FQFA 2WNKA 1NGPH 4P59L 3ZZLA 5L4JA 3OV6A 1J8SA 1OP3H 4N2AA 4LDEB 4GKSA 1G5GA 5F93C 5LKNA 4JDTL 4LESA 4MNQB 2NY7L 3EXLA 1JERA 3MRDB 3ZE0B 2NX5E 4KV5F 3JWNG 3M88A 3NSXA 4K9EC 1PL3A 3BEVA 3QUXD 5DHMC 1X4XA 1H8SA 1JNHB 4Y1AA 2WUBL 4N1EA 1R5VB 4P2OC 4JFYA 2GTWA 3VXRA 5FGSA 2XZCL 5IFAL 1J9CT 1JYXA 3C75A 5CEYA 4UBDC 1QA9A 3O11B 2BSED 3PGDB 4G8GE 2RA1A 2A9AA 4FQJL 4XBMA 2AGJH 5L8JB 5F3FA 1B6DA 2XLLA 1A4BA 1N26A 1SLVA 2FJGA 4JR9L 1G1OA 4TNWF 4JFZH 1ROCA 4OZIF 5KJ4A 1VFAB 1L9QA 2CR3A 4FMVA 5IJDC 2UXVA 5B4MC 4OLXH 1ZANL 5MHSD 1AOHA 3FQWA 1NMAL 1LO0L 3WE6A 1NOAA 3T3PE 5DMIH 3CIAA 3LPFA 4XE5B 2CGRL 1NIAA 2DQDH 4G80A 4KNSA 5ITBH 1AS6A 3Q13A 1OAUL 1Q0EA 4OFDA 2A5UA 1F3JA 2WK2A 2WXKA 5BZWA 1PZ3A 5FGCE 1KJ2A 1TMCB 4QHKI 3KM2A 4QYOB 5E6YA 4I88A 4BKLA 4FXKC 4XP4L 3B9KD 2FWOB 4Q2ZA 1EJOL 5E2VH 1QABA 2FBJH 2A9BA 2YZ8A 3C6LC 3NIGF 4IDJL 4MBOA 5PCYA 5SV4A 3T3PB 1SY6A 5D72L 1M4KA 4NT6A 3V0WH 3GDBA 4KK9D 2ISDA 4UOJA 3NK4A 3D9AL 3OMNB 2YLKA 5EZOH 2H7WA 5FGCB 4PRBB 2EIDA 5B38G 3G6DH 2XG4B 5FLUA 4I0KA 1PIGA 1UJTA 1RURL 4NAJA 5CM1A 3TO2A 5IJBC 5EF3A 5BW7C 1UTDA 4GUOA 3IRPX 3Q2WA 3P1VA 3HVDA 2HT3C 5EHFA 2R0LH 4FEMA 1DDHB 4D9RE 4ICWA 2Z8SA 4KK9C 1MFNA 3O41A 4DN4L 3WKML 2UXGA 3DTXA 4GH7B 5EOTB 3H8NA 2Q6WB 3ULVH 4N0CD 1XCQA 4ZMWA 1ES0B 5DVLA 4PY8I 2EDRA 1I1AC 3HN5A 3R7QA 3LZNA 3TP4A 1A7NH 4YHMH 2QLYA 2WINA 35C8H 4UDTA 5KVDH 3GUTA 1JXFA 3VGEA 3EBGA 1E42A 3MLSH 3HI5L 5ICXB 3O9WA 3OAWA 2QVMA 1N2RB 4AYMC 4PGBA 2ZCLH 4GUPA 5D1ZB 4R90H 3U30B 3O3AB 1F90H 4XMPH 4L9LA 3DRQB 2V33A 3QEUA 2ZAHA 5L9DH 3KLHD 4JM2A 5DUBA 5KN5B 4PJCF 5B1AB 3U9PH 3ZU8A 3VDBA 5GS3A 4NQDA 2FRGP 3GZOA 1U93B 3N2JA 2YFOA 1WFJA 3WFBH 4U1GB 1T22B 5PAZA 2WLLB 4MQXC 5D6CA 3DMMD 4FFWC 3UO1L 3WEXB 3AWEA 1IKFL 1J8KA 1WA1X 5EUOF 1AO7E 4IJ3B 3DIFA 1EXHA 3FF7A 3MROA 4ANUA 1MVYA 2F5BL 1P7QD 4HALA 4ZPVA 3LKQA 3CK0L 3VFSA 4NKIH 1CGUA 5BQ7B 1JSYA 3ZRCC 3UDWC 4MNQD 2FX7L 4LHQB 1N6QL 3L17A 1JTTA 2FEEI 3T1FB 2H41A 1M7IB 3HOGA 4ELMA 1J8HB 5C0BB 2DIJA 5FUCC 2VERN 3O3BB 1NAMH 3WV0A 2CJUH 1J5IA 3OHXB 4PWEA 3PDGA 2H9GB 4LU5H 1E4XH 1YEKL 1UWYA 1UM6L 1U4EA 5EO0A 4XNAA 1QUPA 2VDPL 1ZHLB 5T3ZL 3ZTDC 1CFSA 1JVLA 1X5IA 2NT0A 2MRYA 3UZEC 3WIFB 1RPKA 3S3DB 3APMA 1T0MB 5LLIC 5ICYA 3V0DA 2X70B 3L13A 2WLJA 4NOBA 4A1RA 1NWOA 3X3FL 3BVDB 5CHNA 1DLFH 1G7HB 4XXWA 3ULVF 1P4LB 2WBJA 3SCMD 4EOWL 1ORQA 3LEVL 1N68A 1OM3L 4QGTA 2Q1EA 4JZOB 1RLBA 3FRPA 2R59A 2JI3A 3MFFB 3K1DA 3MJ6A 5DHYB 3WN6A 3BSZH 4LNRB 3SKOA 3QQ4A 5JHDE 4X0KB 3TM6A 2OI9B 1U95B 4LLDA 4XCNB 4LDOB 4FL4C 1TVDA 3VGAB 1JHKH 2PW2B 5HY9A 3DTDA 4M7JH