2JFCA

M144l mutant of nitrite reductase from alcaligenes xylosoxidans in space group p212121
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
335
structure length
335
Chain Sequence
DADKLPHTKVTLVAPPQVHPHEQATKSGPKVVEFTMTIEEKKMVIDDKGTTLQAMTFNGSMPGPTLVVHEGDYVQLTLVNPATNAMPHNVDFHGATGALGGAKLTNVNPGEQATLRFKADRSGTFVYHCAPEGMVPWHVVSGLSGTLMVLPRDGLKDPQGKPLHYDRAYTIGEFDLYIPKGPDGKYKDYATLAESYGDTVQVMRTLTPSHIVFNGKVGALTGANALTAKVGETVLLIHSQANRDTRPHLIGGHGDWVWETGKFANPPQRDLETWFIRGGSAGAALYTFKQPGVYAYLNHNLIEAFELGAAGHIKVEGKWNDDLMKQIKAPAPIPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DISSIMILATORY COPPER-CONTAINING NITRITE REDUCTASE
publication title The Structure of the met144Leu Mutant of Copper Nitrite Reductase from Alcaligenes Xylosoxidans Provides the First Glimpse of a Protein-Protein Complex with Azurin II.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
molecule tags Oxidoreductase
total genus 86
structure length 335
sequence length 335
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2007-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2jfcA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2jfcA02
1NIDA 3ZBMA 7PAZA 2QDWA 1SDDB 3OMAB 1B3IA 1TKWA 2YXVA 1ADWA 3UAAA 4HZ1A 4M4RB 2PP9A 1JZIA 3SBRA 4DPAX 3UGEA 1OE2A 1BQRA 4KOBA 2YARA 4E9RA 2EINB 3GXUB 2BZCA 4E9YA 3OM3B 1GY2A 2PCYA 4YSEA 1DYZA 2GI0A 5B7MA 3ZDWA 4BXSV 3CDZA 2XV0A 4BWWA 2XXGA 1FA4A 1JXFA 1CUOA 1ASPA 3NJHA 4G7RB 1A4AA 2QDVA 4GP8B 1NDTA 3C75A 4GP5B 3QJUB 1F56A 2RACA 2CAKA 2J5WA 4E9WA 3QJSB 2R7EB 4JKNA 1V10A 2IDQA 3UABA 6PAZA 1NPNA 3FPYA 4NB7A 1ZIAA 1KDIA 2GC7C 4DP7X 1J9SA 1DZ0A 1QNIA 1OOWA 4GXFA 1PLCA 4HCFA 3X1EA 2BZ7A 4L0PB 1OF0A 1SJMA 2PPEA 4M3HA 3TBBA 2VW7A 2DWTA 2FJSA 2I7OA 2E86A 2MRYA 2XLLA 2ZOOA 4DP8X 4E9QA 1J9RA 4HHWA 3TU6A 1CC3A 1RZQA 4W9ZA 1A65A 2VSKB 5D4HA 4BDVB 4YSCA 4G72B 3BQVA 4HCIA 3T6XA 1NIAA 2YXWA 2XVBA 5I5JA 3H4HA 1JXGA 5LDUA 2DY2A 1WA1X 3JT2A 2GSMB 5B1BB 1BQKA 2DYSB 3NT0A 1PLAA 2Q9OA 1WA0X 2I85A 3S8GB 2BWIA 1MZYA 2IDSA 2UXFA 2JKWA 5B7EA 1A3ZA 1UATA 1AG6A 1NWOA 4MFHA 1L9RA 4A68A 3FQ2A 1IUZA 1GR7A 1OCCB 1ASQA 2PCFA 2GBAA 4HHGA 4X4KA 3NSFA 5PAZA 4DPCX 1EHKB 2H5UA 2XWZA 1FFTB 4BWUA 4RH4A 4UANA 1FWXA 1AAJA 1SHWA 1M56B 3ERXA 2IWFA 1OE3A 2YAMA 2H3XC 2FT8A 1WA2X 2IDTA 1BXUA 3FU7A 4YSTA 5I6KA 3GDCA 2B3IA 1PNDA 1SF5A 2UX7A 3AG1B 2FT6A 3OD3A 1J5DA 4DP4X 4KO7A 3FU9A 1ZV2A 2J57A 1V54B 3AG3B 1PY0A 3TBCA 1ZIBA 2J56A 1JZFA 1ZDQA 4YSOA 2AVFA 3NSCA 1JVOA 3L45A 1AS8A 3PPSA 5I26A 5B3SB 2FWLB 3CVBA 4K9JA 1GY1A 4JHVA 3SQRA 4P5SA 3IBOA 3ABGA 1HFUA 5A7EA 1ETJA 3KW7A 1SNRA 4ZK8A 2QT6A 2XV2A 1PF3A 2FQFA 2HRHA 3T71A 2AANA 1SDDA 2FNWA 1NIEA 1AZNA 3EF4A 4A2HA 1XB6A 1BYOA 3FT0A 3NJNA 2CALA 1AG0A 2PPAA 1OCZB 2YAPA 1ZPUA 4N4YB 4UAHA 4Q89A 3IE9A 1J9TA 2ZXWB 1L9OA 2VM4A 2BW5A 1CURA 3V9CA 8PAZA 4A2DA 4EF3A 2UXTA 1JZEA 2HX8A 1L9TA 4KNUA 3NP4A 1ET8A 4DP2X 1KYAA 4G7SB 3WIAA 2IH8A 4YSAA 3NJLA 4W1TA 4A2GA 3T9WA 1IBYA 3MX0B 1ET7A 2WO2B 1GS6X 1VLXA 1R1CA 1WS7A 2XUWA 2UX6A 1BXVA 4F2FA 5F7BA 4QKTA 1AZUA 3WI9A 2R7EA 3FPXA 5B1AB 3FQYA 3N2JA 2DV6A 4Q8BA 3OQRA 4DP0X 4G7QB 3GYRA 1PLBA 1NICA 3IN0A 1MG3C 3AG4B 9PCYA 2XX1A 1AACA 2JXMA 3ABLB 4WTQA 1E67A 3X1BA 6PCYA 1KCBA 2TSAA 3AW5A 2CUAA 5AZUA 1GYCA 2NRDA 1L9SA 1MDAA 4G71B 4AX3A 3X2QB 1URIA 1AZBA 3NJMA 1OE1A 2YAHA 3H4FA 1QLEB 3S3BB 2GC4C 2FQEA 4WKXA 3JTBA 2XYBA 1KV7A 2P80D 1SHXA 1SFDA 3WKPA 4CSPA 1JOIA 3CG8A 4P5RA 2B08A 3AG2B 2VW4A 5I6MA 5B1KA 5D4JA 2FTAA 3OMNB 2HLEB 4YSUA 3NJFA 2PP7A 1KDJA 1V55B 1KBWA 4AKOA 1PZCA 2CJ3A 3KW8A 2LLNA 2IH9A 1IKOP 1PAZA 2BO0A 3IN2A 3ZIYA 1J5CA 4QLWA 1BXAA 4GYBA 4ENZA 2VSMB 1MZZA 3RYMA 4DP9X 4AKQA 2BP0A 2AZAA 4YSSA 3G5WA 2EILB 3SBQA 2BP0B 2Y1AA 2PP8A 2QPDB 2YAFA 1ID2A 1AOZA 1AS7A 3NJJA 1XB8A 4FAAB 2DYRB 4A67A 1JZJA 3PAZA 1JERA 4TXVB 3UADA 3UAEA 1IBZA 4YSPA 3NJGA 2OJ1A 2QPEB 2VN3A 1M9WA 3ZX1A 3CZUB 4A66A 1PCSA 5PCYA 5E9NA 1YLBB 2W8CA 2AFNA 3ABKB 4JHUA 1KBVA 1CYXA 1RZPA 2CCWA 4KO9A 5B1JA 3SBPA 1A8ZA 2EIKB 2XX0A 3QPKA 1NTDA 3NJKA 3S8FB 2BP8B 3AY2A 1RCYA 4HAKA 1BEXA 1NZRA 1OCRB 1N70A 3X1FA 1KGYE 1RKRA 2ZWNA 3CVCA 3PAUA 3N55A 3AZUA 3DKHA 1AZCA 3OMIB 2FQGA 2XXFA 2A3TA 1L9QA 1T5KA 3TA4D 2TSBA 4KNTA 1X9RA 1JXDA 2HX7A 1AQ8A 1M57B 5EHFA 3EHBB 2N0MA 1PZBA 2OCCB 1PZAA 4E9SA 3NP3A 3QQXA 5I5MA 2X87A 4PAZA 3BVDB 3QJVB 2H47C 3EH3B 4KOCA 1IC0A 5I6PA 3T6ZA 3T6VA 3EH4B 3FSWA 2GB2A 3HB3B 1MG2C 1A4CA 1W6LA 4E9TA 2YQBA 1EZLA 3WNJA 5I5IA 5F7AA 1GS8A 1GW0A 1XMEB 4YSRA 3FQ1A 4AKPA 2EIMB 1JZGA 2FQDA 3DIVA 1L9PA 1ZDSA 2UXVA 4BK5C 2PLTA 4NAJA 4YSDA 1SFHA 1GSKA 4UF7C 3T6WA 1WS8A 2BWDA 2HX9A 1AS6A 4YVUA 1KCWA 4BWTA 2YAOA 1OCOB 2DWSA 1JVLA 2UXGA 4KO5A 3FSAA 2AZUA 1HAUA 3S3CB 1OV8A 3CDZB 5TK2A 5I6LA 3NYKA 5D4IA 1PMYA 5B1JC 4FA7B 5I6OA 5AFAA 1CYWA 4KNSA 3U25A 2HZHA 3DTUB 1JZHA 5TK4A 2BHFA 1BAWA 1TEFA 4NERA 3QJQB 2HRGA 3ASOB 3IEAA 4HIPA 4GP4B 1AANA 1J9QA 3QJRB 1TU2A 3EH5B 3FSZA 2X88A 2IDFA 4E9XA 1WAEA 3S3DB 5FC9A 1NPJA 2IDUA 2WSDA 1X9UA 1AZRA 1NINA 2I7SA 1QHQA 3X1GA 1W8EA 3V9EA 4AZUA 3WKQA 1E5ZA 3D12B 3NJIA 1ILSA 2IAAC 1GS7A 2HXAA 4DP5X 1A4BA 2W88A 4AI7A 1ILUA 3PLYA 3HEIB 2Q5BA 7PCYA 1N68A 3FU8A 4N8UA 5AKRA 2CBPA 3ASNB 4HCGA 2ZONA 3WG7B 4BXVA 2VMJA 2PPCA 2OV0A 2PPDA 4DPBX 5ANHA 5IY5B 4E9VA 3MBWB 2YAQA 3X1NA 3PXLA 4YVNA 5B7FA 1NIBA 3NSYA 1NWPA 1ET5A 3H56A 1HAWA 4YL4A 4A2EA 4KO6A 2IWKA 4DP6X 1I53A 2EIJB 1E5YA 2MTAA 1ASOA 1AIZA 2GHZA 4PCYA 2JFCA 4GY4A 3FU7B 2XV3A 3QJTB 4CSZA 3FS9A 1W6WA 4DP1X 2VW6A 1E65A 2BP8A 3FYIB 2PPFA 3WNIA 3PAVA 3NSDA 2WO3B 1BQ5A 2YAEA 2IWEA 4HALA 1TEGA 1XB3A 2VM3A 2XU9A 3ABMB 3FSVA 5I28A 1AR1B 2P80A 4F7KA 2FT7A 2GIMA 3CVDA 1SF3A 2Y69B 5I6NA 3PCYA 3FYEB 4A2FA 2J55A 2BW4A 1NIFA 3UACA 4F2EA 1E30A 1BYPA 4G70B 4BDVA 4YSQA 1PNCA 3TASA
chains in the Genus database with same CATH superfamily
3ZYJA 4AYFA 5HY9A 1BMWA 5C0AE 4NQEB 1DUYB 3K5RA 1Q94B 3OMAB 4HUCA 3A6BH 3S2AA 3K0YA 3F6JA 5B22A 2EDNA 4D7PA 5FS5A 1EK3A 1X5AA 4GKNB 4HX1B 4I48B 4YHNA 3VWKA 1Y18A 3QBTB 2NUPA 4X4ME 5GS0C 4R83A 5KSBE 3VFRA 4FOMA 3P9LB 2CK0H 4QTIH 1PX4A 3QORB 4E9RA 5KYXA 2MKWA 3PU7A 2P5EE 2R1YA 4Z3HA 4NFBA 4XP5H 1HZHL 1IVTA 1BIIA 4X8XA 4MQSB 4B95C 3DX9A 5FYKD 1UWEH 1J1XL 2WJ5A 3RGVD 3NJHA 1F90H 1IFGA 4IDLA 1U36A 4BCXA 1UJ3B 1ZS2A 1S4IA 3JV5A 1EXGA 1OQOA 3MODL 3ML8A 4Z7NB 5MI0C 5DZLA 4YDVB 3L1OL 5AALA 4XPAH 2DBJA 2XY1A 2BSCA 1U8KA 1PLCA 1NA8A 3KLKA 4NUQA 4NQXA 2R2EA 1KNOA 4O2EB 1C5DA 2BZ7A 1F5WA 1A7PH 4X0KA 3EYUL 4IRJC 3TCLA 3ZPDA 2AAAA 2BK8A 3GD1C 3TBBA 4Z6AT 1IILE 4XNYH 2DWTA 5ITFA 5TDOB 2ZOOA 1U95B 3L13A 4OFKA 5IQMA 2CDEB 2ARWA 3WN6A 2VSKB 5K5YA 1MCFA 4W93A 1CGYA 3STZA 4K71C 4WFHD 2BNQA 4PGEB 5DC4B 3HS8A 3VVVA 2UY7B 3CLFH 4PP1C 1DBML 4QRRB 2NZ9C 4IKNA 5L8JB 2VDLL 3VXSB 2A9MH 2BOCB 4LSRL 5DJ0B 1WG3A 3QYCA 4EMZA 1E9PB 1E5AA 4NZRL 2I85A 5CUSL 4DW2H 3UBXG 4EDWH 1OD9A 3BZ5A 1NLDH 4QI3A 3S0PA 1AG6A 2BX5A 1TZ8A 2IBGA 3O3DA 3AGWA 3FQ2A 2W9DL 4YAQA 4KJPD 3UJJL 2FX7L 2CLRB 1F18A 3JTTB 3NSFA 1WBYA 3UOAB 1A02N 4X6DB 5E7BA 2E7BA 3AXHA 3NVQA 4FQ1L 3RI5K 4MNGE 4MYWB 3DDFA 3ORJA 4I3RH 3IPFA 3V7MA 2GIYA 5EFIA 4PQXA 1BQUA 1KYFA 5E08L 3FU7A 5DCCA 2F18A 2OMUA 3FO0L 1IGML 3LNFA 3PGCB 4UT9A 4PJXE 1DZBA 4QHUB 3LKOA 2CCVA 4KO7A 5EBWA 4HK3N 1H3UA 4HUKB 4PRNA 1CT8B 5EC2B 1QBBA 2XWJB 5AL8A 2AJUL 4PRAA 3OV6A 3OJMB 4M9OA 1GVIA 1NCDL 5CEXA 2O5YL 3MJ9H 4XE5B 1CD0A 4G7VL 5ETUA 4U6XA 1EDQA 1RP9A 4J7RA 2X70B 4R5VA 1KJ2L 1WRFA 3CFIC 4I85A 5FM5M 2NMSA 4PRIB 1FI8C 4FYTA 4HJSA 2ITDA 2XQ0A 3BMWA 3VGEA 3MBEB 3MV8E 1AYOA 1S7TA 4OLWL 3KWTA 4KK5C 3VTMA 1QRNA 1BMGA 4QPEA 2LABA 3F64A 4LLUB 4K9EC 2XZZA 2PXYC 4KK8C 5B8CC 3P4NA 1OVZA 4U4IA 3B6SB 5BV7C 1G7PB 5FGCB 5ACMA 4NQSA 4MDRA 2NY2D 3QIBD 4C57C 1C16B 4HV8B 2KQMA 4S1DD 4K94H 1WICA 1TYJA 2OSLA 4N8VG 4Z3GA 5T3ZH 1N0XH 4JFEE 3N1QC 5F7KC 1JXJA 3GI8H 5T33H 1XGYL 1GIGH 4P49A 2QFRA 3CFCL 5BXFA 1F4XH 2G2RA 3A67H 5CFAA 3RWJA 4FABH 2A74C 3CFKA 3MGOB 4RMUA 3KLQA 3FC8A 1CCZA 4GRLD 3VFSA 1H9VA 5D2LE 3FKUS 5JHLA 3HRPA 4WWKD 4Y8AA 4HULB 1YVLA 1KGXA 4EN2A 2IADA 3T9WA 3MNDA 5E00A 4A2GA 2FR4A 1NGPL 1TYRA 3WO4B 4U1SB 4X9GA 2MCMA 2BFGA 3U4BL 4UOW0 2Q76B 4DQAA 1AZUA 1OTUD 1UD5A 4EJ1C 5T5NF 4YDNA 1Y0LB 4LZKA 3RX8A 2CMRH 2HP4A 4YE0A 1U3HC 4I18A 3WSQL 1QLEH 3MV7D 2W0FA 4NO3B 3LQAH 4B9FA 1QFOA 3ABLB 3BO8B 2PMZA 2CO7A 1HCVA 2HJLA 3OAZH 5EA0H 3N43B 5AZUA 1NDGB 2WSKA 3VI3B 4NKOA 1HXMA 1ZT4A 2NR6A 3QEUA 1A9BB 5ENWB 1DQQA 2D4FA 2KERA 3NIDE 4X7CC 4AIOA 3W37A 2P8MA 1Y07A 3OWEA 3ZYIA 3EYVB 3H53A 2WNGA 2M2DA 3U30B 3GJFA 4DT2A 1G9MC 5C09B 4BH7A 1D9KD 2HTLC 1KBPA 1I1AA 4E42A 3K1KC 4L1BA 3WNOA 4KK9D 5SWZD 5KG9B 1FPTL 4NIYE 1GZQA 4E41A 4B5ZA 2JKTM 4FULA 1CR9L 3APNA 5FO9A 4GG8A 1XTLA 4WGKA 5D4JA 3KWUA 3V79C 2XTJB 4OV5B 2ZOLA 1XH3A 5JIDA 5DHDA 4QXUL 3NMEA 3DUHA 2XIIA 2DD8L 3DTXA 4P3DB 4NQED 4JFFE 4HU8A 1KSRA 4KKCD 1OCWH 4YHPA 4BFFA 4DP9X 4Y5XC 1MFBL 2ZX7A 2XHNA 1HHGB 3RU8L 4OY9A 3QZNA 4KXBA 3DETC 2I27N 1OTSC 3REWB 2XG5A 5INDB 4J1UB 2Y7LA 1JHKL 2IBZX 5H94A 1HEZB 4AYSA 4HIEA 3QORD 4NX0A 4ZUSB 5DTFA 1DVUA 5INCB 1HJBC 4AJVA 2CLZA 3L3OA 4PS4H 4ZG1A 5CKGA 1E4KC 1KIPA 2G9HA 3P3RA 1MEXL 2J4WH 4PJ8A 4PGDB 4BK5A 3BUYA 3EDDA 3DUUA 4IJTA 3SKJL 3ZN6A 3DJ9A 4OLZH 5DS1A 3Q2NA 4B9JA 2G4EA 4JK0D 3B2XA 1CQYA 4F2MA 2VJ8A 5E9NA 5CMAB 3ZHLA 5C97A 4HK3J 3PIQB 4GRMB 2P7TA 1E42A 4LQ1A 4HSQA 3MFFB 1FRGH 3QRBA 1GZPA 1PY4A 3MRNB 4DQOL 4G11A 3MUZ1 1U2HA 2XFXA 2ZX5A 3WKYA 4K3GA 1TMCB 1YNTB 2F61A 1K5WA 1LO2H 1OGAB 3C8KA 1FNEA 1RK7A 3RX7A 1QD0A 3DK0A 2XI9A 4ONHB 4OIFA 3AQZA 3GZOA 2XZCL 3CSGA 1O9WA 3CUPA 5CR1A 2IAMA 1HS6A 1KGYE 4XWGL 1MRFL 4PRBB 2EABA 1UHVA 4ZX6A 1Q1JH 4WWOA 4X6EA 5LLIC 5DJXB 3L4WA 4AH2B 1D5BA 1YMHA 2VDOH 4QWWD 5BO1L 3CN4A 3CH1B 5AEAA 2OL3L 1ZGLM 4HKXA 1QSVA 1XSIA 3BVDB 1J7VR 2A1WH 4MTMA 4GAGH 1LILA 1JP5A 3JV6B 4G8FA 4ZD3L 1IC4H 5A3IC 3VD1A 3UC2A 3CN3A 3HR5A 2GK0A 1WWWX 4JG9A 5AOIA 4FHBD 1GZHC 3SDDA 3L5WB 4QUOA 3WEOA 1B4TA 2PLTA 1YHPA 2JI2A 3PHQB 4JGJA 4N0YL 1XZ0A 3OKEA 3ECVA 1S7UB 5IJDC 2DQIH 1UM4H 4OF8A 1XCXA 1ZJAA 1XH1A 5LB1A 3BAXA 2IANA 3NG5A 3HVDA 1W72H 2JK5A 4W81A 1UVQA 3LNHA 3Q48A 5DJAB 5FGBC 3L9RA 4BSWB 4Q4IA 1OV8A 3E9TA 4PVNA 1UASA 5I6LA 3WTWA 3PV6B 4DEWA 2GPZA 3QSKB 1FL3B 1PMYA 3EIFA 2B15A 3S4SB 3IFOB 4ELME 5JW4N 4XVUD 4OCXH 3LQZB 3VXRB 5CGYC 1R34A 2FUTA 4I8DA 4WEUD 3ECQA 4JZNA 2VC2H 5EZJA 4ZX3A 4OD1H 1DQLL 1KJMA 2DQUL 2ZCZA 4PJ6A 4DH2A 3MBED 1R5WB 4JO1H 5DJ8B 2FO8A 3C2AL 3H7BA 1RUKH 1T1XB 4LSSH 3IJYB 1FHNA 2QVFB 4D0BB 3EH5B 2DMGA 3EO0A 2OMYA 3HE7B 3QDJA 4OF6A 3NPZB 3GFUA 5GRVK 5DEFB 2C8NA 2GTQA 2DAVA 2WQSA 3CQQA 4M93C 1NPJA 1MRCL 2F19H 3P0GB 3V5KB 4PY7A 1PZUB 1FNLA 4PCKA 3P02A 2Q7AA 3SQBA 5JW3L 4A7GA 2JIXB 2DH2A 2BFVL 4J4PD 3OZ9H 2V5RA 2ARJB 3ETSA 1BEYL 3CFJB 4NNXB 3ARGA 4IU2B 2X0VA 2IPTH 4TVPH 1T22B 1TTCA 4LXFA 1A1MB 3CX5J 4YBHA 4XXCA 5JPMB 4P5MA 5F3HB 2K7PA 3ARBB 2YAQA 2CLVB 3MFGB 2VGLM 3O3UN 4WHTB 5B7FA 4RMRA 2GIXA 2XKNA 3CC5B 1RD6A 3GSNA 4M5YH 3PF2A 4JJOA 1D7CA 3WDHA 4K23L 3BN9C 5FYJE 2WWMD 3RWGA 2VAAA 1ASOA 1BFOB 2YA1A 1R47A 4QOKE 5LBSH 4MHHI 3F5WB 2JFCA 1AQMA 3QPQC 2P46B 3WD5L 3S88L 1M53A 4X83A 4FQXD 3KPLB 1GOFA 1I1RA 5K59F 2Q2LA 3FHQA 5SWQB 1R5VB 1S7SA 5EU3B 1HHHB 2D2CC 3NFNA 1KIQB 4MCZB 2VDQL 2X28A 1T20A 4Z78A 3GGWB 3TVMB 4P05A 5E4IA 4Z95L 1KYUA 3DARA 4XP9L 2V2TA 3FTVA 1QI4A 1FO0B 5CEZD 3FH8A 1HINL 1MFCL 2IOOA 1LNUA 4Y1SA 2X3AA 1X9QA 2I5YL 3AVEA 5IV2A 1A4KB 1R24A 3TNNB 3VXTA 4G43B 4Z8FL 1E30A 1BYPA 3SDAC 4F91B 4NFDA 5C7XH 4WI3A 1NM9A 2CGYA 3K6OA 4TNFA 1XGQB 5EIIB 4HCRA 4ZMQA 4HD5A 4X98B 1UCBH 2O6PA 1B88A 2XTJD 3MTRA 4C4UA 3RFZA 3FCSA 1X5YA 3POCA 4IHBA 2O5XH 4P9ML 1JPST 1UZ8A 2V3DA 2OK0H 2OTUA 3UTTE 3U4EA 1S9VB 1R19A 3JVGA 1OAXH 2VL4A 4YHNB 1ZD6A 3VWKB 3PFQA 1S78D 5T8IA 4GXVL 3ULVE 3UGEA 5L8KB 1HZKA 1E8YA 4ZUWB 3RTQB 1ZLEA 3DGGB 3O41B 4M62L 5H2BA 4FL4B 2WQRA 1CN4A 1UM6H 5KYXB 1BZOA 5FAAA 4YN3A 3BUIA 2EVJA 2R1YB 2XXGA 5IK3A 1CGSL 1ASPA 1U93A 3CFEB 3LN5B 2VLRE 5IB4A 1BIIB 3E6HA 1ZS8A 2DQFA 3DX9B 1N5AB 2YPKB 2HT2D 3KD4A 3WFEL 2A0LC 5EBGA 4OF3A 2ADGA 4WNQA 2BWQA 5HYJA 3QIUC 3UG5A 1LXMA 4LRIC 1Q9WB 1X3DA 4M5SA 3WYRA 3ZSTA 4XAWH 3ZGIA 3QUMH 4F33A 3WELA 3ZQXA 1QSEE 2WXIA 1AE6H 4ERSL 3TNMA 4F24A 5IVXA 4YWGH 2JKRM 4P3CH 2WBJC 1KNOB 2V9UA 1C5DB 4M3HA 3FU6A 4YNYA 3RZWA 2E86A 1CIUA 1YUHA 3HKZA 1CLCA 2QGBA 1XGRA 2A4EA 2VMFA 4ETYA 3JWNC 5EUOE 5F9WB 1NAML 4OJYA 3DXAE 4A7VA 5IROD 1U8QA 4BCYA 2J5LB 4ZW7A 1IM9D 4ODTH 4FP8L 1JXGA 4DOHB 1MW0A 3HHMA 1WBZB 5KSVA 2GSMB 3SPHA 1IZJA 1BQKA 1FYTA 2P49B 4AVIA 4WZ9A 2ED7A 4UOJA 4JRYE 3RZCA 1VIWA 1XF3B 1NFAA 5CJQL 3O3DB 2GBAA 3Q13A 4MMXB 4RFNB 1ODAA 5DHEA 2XIDA 3MA7A 4JG0L 3SZKC 1P5UC 1WBYB 3KLLA 4W4NA 3QHZH 2H3XC 4OTXH 1P4BL 2FT8A 4MJIB 3BH9B 5DS2A 2CHDA 3OG6B 4AVJA 5A2IH 4NN5C 1IQDA 1GGIH 1PKQE 5KTEL 4RVBA 3O6FC 2Q8BL 3QNXA 2B3IA 1SEQH 3PDDA 5DGRA 4KKQA 2M83A 2OMUB 2V9TA 4M5TA 2Z7ZA 4PWHA 5GRVL 2B16A 3Q05A 4QF1A 4JL2A 1SYVA 1EH9A 2NY5L 1V54B 3UJIH 4EI5D 3FSOA 2CD0A 5D1QE 1DVZA 5EBWB 5TF1H 2XIBA 4K4KA 4KUZL 3ZKSD 2G5BB 4IOIA 5ALBH 4PRAB 1NOAA 2FJFA 3BKMH 3QQNA 3C60C 3CVBA 3VXRD 3LNDA 2EXYC 4JHVA 5I9QC 3IBOA 5I8KL 4HDIB 5F6HJ 4ZX4A 2J1WA 2YFNA 3BUQA 3FCGA 4MD0A 3IDMA 2ITDB 4OZGE 4N20A 3B34A 1S7TB 2BSSB 4M00A 5AW5B 4KKNA 1QRNB 5EO0B 1KWKA 4C54A 2BIOA 5ITBH 5DK0A 1M1XB 3G6JF 4D0CA 3LRSB 4XPBH 3F12A 3HE7D 3TV3H 3S36H 3OX8B 4WRLA 1UC6A 4N4YB 4U1NA 4Q9RL 1EZVY 3AM8A 2NT0A 2JIXD 3DBSA 1N26A 4KXZI 3QG6A 1DANT 1HNGA 2HVKA 4L3EA 2JELH 3FQNA 3MJWA 4OI9A 3VD7A 3RWJB 2C3VA 3NP4A 5E6YA 1GH7A 5E2VH 2HRPL 4KJYB 2EXSA 1FVEA 1WGVA 5KVDL 1H3TA 1W0YT 2C7UA 1XD1A 3DVNB 3ARBD 5JYLA 5MHSE 1ET7A 1AC0A 5JXEC 1CMOA 1HKLL 2VERN 2V3EA 1IM3B 1VZHA 2OMVA 1JCKA 4JR9L 4R97B 3CDGA 4F2FA 1H3PL 1T04B 3RGVC 1T0MA 2L04A 2Y7OA 1AMYA 2GFBA 4UMSA 4B9GA 1A3QA 5E2WH 3AITA 2AJVH 3L1GA 2P8PB 5ALCL 4P2QA 1B90A 4DP0X 4F8QA 1I82A 2PTUA 4MXVE 9PCYA 3QDGA 4WTQA 1YEDA 1J5OL 3WS6A 4JM2F 5DQJA 3X1BA 1GPOL 1RZKC 4LPYA 5E0FA 3AW5A 4TLUA 3ULSA 4WFHE 4BBWA 5A2BA 3KJ6H 4U1KA 3TVMD 2DTML 3RB5A 4PVBA 4G71B 2H32A 5JW4M 3JWDC 5DO2D 1UH2A 4LHUG 1NEPA 4BA0A 2YAHA 4Z0BL 5ANMB 2YEZB 1NGWB 2XA8L 1KJ3H 1QYGH 2P8MB 3VFTB 5KYYB 3NTCH 2P80D 1SHXA 5CZXC 1GAFH 4ZQTA 4FX5A 2B08A 4E42B 4GSRA 4J28A 4Y5VC 5E6RB 1MJJA 4V2CB 1ZXQA 2WZ0A 4EUPB 4PREA 4E41B 3C5ZA 1ZT1B 4OGAD 4GIOA 4P59L 1P7QA 5K1VA 4FXGB 1Q38A 1V55B 4K15A 3EJQA 2XC8A 4CSSA 3DTXB 1Y6KR 1KPVA 2CJ3A 1MFNA 2QQNL 3N91A 4TUKH 5DK2B 1ZHBB 1YY9D 4TSAL 2XG4A 2GAZA 3U0PA 1RK1A 2F8IA 2I9LB 1RJZB 4PV8B 3VWKD 1SEBA 2F5AH 1I1FA 1VACB 2FO4B 3HHRB 3RTQD 1MWAA 2GY7B 5I1DA 3G5XB 2VXVL 3X13A 3SN6N 1IBFA 4JHZA 5K9KA 2D3NA 4A67A 3RJOA 3EFOA 2IQAA 3BP6A 2R1XB 1PKOA 3GC3A 4Z77A 5BUGA 1LK2A 3DUUB 4ODXB 1SBSH 4LCCC 4TPRL 4G1MA 1PS3A 3VMPA 4F2MB 2MHAB 3NCEB 4R4BB 5F9JB 3ILDA 2E9BA 3B2UC 1X7TA 5I1IH 1S6NA 2CKBA 3K2UH 1BM7A 3VFNA 1NDMB 2OLDA 1OWRM 2XFXB 1B0WA 3QXUA 2FJGA 4AY0A 5I6XC 1OCRB 1LO4L 1Q4NX 4U05A 4BSVA 2KBGA 2VT0A 4Z7OE 1MCQA 5IHZA 5HDWA 1TFPA 2W80C 5C3IA 1AZCA 1NCUA 1XGUB 4FQIH 1B4LA 3ZE2F 3ZE1B 1CTOA 1IE4A 4HT1L 2FQGA 4X7SH 2BNQD 3D4YA 3LEVH 2EAEA 3S5LB 4QR7A 5JW5B 2N0MA 3ZZLA 1TZIB 2F9BT 3D2UB 2X87A 4PJIF 2Y23A 1IKNA 4HEPA 3L3KA 1UWFA 1XHHA 4HKXB 1JHTA 1X5ZA 5C0BB 5IQ7L 3MX0A 4C59B 1R5IA 3SJVB 5C0FB 4HK0B 1NCJA 5J11C 4G8FB 1UWGH 5I24A 4MJ5A 4ZFZB 5DC9B 4AUJA 1GS8A 5ACZA 3H9HA 5DMGD 3HR5B 4OCWH 2GK0B 3MV7E 4PN6A 5DQ9B 1NBVL 3DMMC 4MJID 4MMYB 4G80A 3TCTA 3F6LA 3V0VB 1OTUC 2ZX8A 3FU3A 4I87A 4OIIH 3GXFA 3SDDB 1YJDC 2VJXA 3TFKD 2X2JA 2R23A 2A38A 4KFZC 5JORA 4GUPB 3BYYA 1TTFA 1JVLA 4LP8A 4AEIH 3S3CB 2JK5B 3FQTA 3EOYG 1HQ4A 1U6AH 1UVQB 2ZXDA 4YFLF 4JANB 1JL8A 3T2LA 3B9KA 5I15L 4ODUA 3KH3A 1TJMA 1AR1D 1U91B 4YHYB 4U0RC 3H9SA 4B0MB 4XOCA 4GKZA 6TAAA 3GS7A 3IEAA 4V1DB 1EAPB 2ZUXA 2OP4L 3B4NA 1KJMB 1OY3B 1OKEA 3GKWL 4JVPA 3RDTA 1MAMH 5CBAA 1TU2A 4NQEE 3W2DL 3H7BB 1QRND 5E1IA 2F1EA 4G9FA 4KMLB 2YGNA 3QCTH 5DYOA 2YPVH 2EVIA 4K94C 2IDUA 4RZKA 4KTEH 1N4XL 1VCBC 4OW6A 4FJ6A 4NZDA 3N06B 4PJ5B 2GJRA 3QH3A 4PY7B 4XMVA 2WVUA 4Y7MA 4LGPB 2UUDH 4F7EB 1U8OB 1E27B 3SKMB 3SODB 5HDQL 3CSYB 4G8GA 4XP6L 2ODHA 5F0MB 3FU8A 1ONQA 1RPQA 5IHHA 2EUXA 5DR5H 4M6MH 4F7TB 1I31A 5EU4A 4JM4H 4LDOB 5JHBA 3PREA 4E9VA 2BS9A 3CPLB 2X1OA 3T0EC 3H3PH 4P5MB 3DGDA 3NSYA 3S37L 2MJWA 3H56A 2VRAA 2W59A 2CK2A 5BVPL 4ISVA 4Z7NE 5D7JA 1IM3D 2XKNB 5FHBH 3GSNB 2DTSA 3FCTB 1CFNA 3GLZA 2D7TH 1NMCC 2MTAA 1U58A 3QCUL 4HIXH 1JI1A 3PGFH 5IR1A 2WOBA 2RFXA 2VCOA 4MHHG 3ZZ1A 5JLZA 2EP6A 4O9HH 2CPCA 5BQDA 3MVSA 3GMNA 4LL9A 2ADFH 4L4VB 2N0KA 3LQAC 2Y72A 1M6UA 3TH2T 3APCA 3MA9L 1S46A 1MPAH 3N40P 2J6EA 4F7PA 4XGZA 2YAEA 4WSKA 4D8OA 1NCBH 3BT2L 3ABMB 1FAIH 2C5DC 2DQGL 4O2FB 4QRRE 3WTUA 3VXSE 3CX2A 1I9IL 2NR6D 3NSXA 1P0SE 2R69A 1SF3A 5LO7A 3MOBL 1A1OA 1LNUB 4ZXBB 1JWUA 2LE9A 3DWTA 3R8BB 2F58H 3FO1B 1NIFA 2JB5L 3PNWA 3TBWA 4WWID 1INQA 4N8CH 3VQ1C 3VD5A 1RULH 4EZMA 2O1AA 1KB9J 3BMVA 2W65B 1G1KA 4HWEH 4X6DE 4E41D 3ZBMA 4LL1A 4GFXA 2VO5A 3SY0A 3HRZB 5CXPA 5E8NA 3T6QC 1TETL 4JO8A 2FWUA 2DWEA 5HVHB 3SGDH 4C8XA 1SJEB 1SQMA 1N6QH 4H88L 1MCEA 4KY1L 3F7YA 4MA7H 4XPFH 4JFXB 4DKAA 3MV9A 2WKLA 3CSBA 5I0YA 2OTUB 3BGMA 3U4EB 1RUAH 5A7BA 4M7LH 1DJXA 2R0ZH 2WANA 4UQDA 2GW5A 2Q0ZX 3FT3A 4E9YA 3AQXA 4UU9B 1GY2A 5E2JA 5FF6A 1OP9A 2D7PA 3B9AA 1MHEA 2NY0D 1M1SA 1F42A 5FYJH 1WZ1H 3HUJF 3O4OB 2BVTA 3BKJH 3V4PL 5IK3B 2X9WA 4AYGA 3DURA 4RGOL 3UTZA 3BIBX 2QDVA 3I6KB 4W9FC 3E6HB 4PRIE 4ELKA 1N8ZA 3GHBL 4XMUA 4PJFF 5KYUA 4TUJA 3NH7H 1JPFB 5KVEE 3CPUA 2G9KA 4I13B 5T1DL 3J07A 2Q8AH 1NPNA 4KQ3H 3A47A 4AQAB 5HYJB 4AMKL 2FZ3B 4I4WA 1G4RA 1ZHNA 5FGCE 1UENA 4J3TA 2RQ8A 4EI0A 4F33B 2X4PA 1CTNA 1B4RA 4IKIA 1T7ZA 4IEFB 1EPFA 3D0AA 1DEEB 1S3KL 3D9AL 4OLEA 5LG6A 2VNCA 4CN1A 3ZJAA 2JQMA 4YNYB 4WFGD 1T83A 3BQVA 1YUHB 4FYSA 4XWOC 5D72H 5IG7B 5EO1B 2ZXCA 1FYHB 3C8HA 4M6AA 5I5JA 4JO3H 3RG1C 2KH2B 4NYLB 5J6SA 1NCWL 3B1UA 5HI5D 4AGNA 1ETB1 1YO4A 4KI5E 3GO1H 5G55A 3SQOL 4HJGB 3WIFA 2NW2A 4N2FA 2XJKA 2Z8WC 3OF6D 3T2OA 5C0JA 3N50A 25C8L 3DSNA 5KJRH 1A5FH 3DV4B 1UATA 3D2UD 3V6ZA 3R7QA 1U8MB 1LK3L 3AWGA 3KGTA 4ZFGH 3M7FB 2AMUA 2V2WA 2WLHA 5EEZA 4R7NB 3GBNH 4NP4H 3SJVD 4I5BB 1IRAY 1AD9B 2QHLA 4RH4A 2BIMA 2VH5L 4UAOB 3C6LB 2AF2A 2D0GA 1PG7W 3VA6A 4BUQA 1Z9SA 4P23B 35C8L 3M8OH 1CWVA 4TQIA 3ZKNC 1G84A 1JNHB 1BXUA 1UA6H 1U2YA 5IHBA 5B38G 2WWMC 3MLZH 3B9EA 1F4WL 3VCLA 3VSVA 4WGVB 3SDDD 4MSWB 2BP5M 4FNLL 1IQDB 4ALAC 2ZE0A 5GGQL 1MH5A 3CFDA 4FQXC 4QCIA 4KPHH 2YBGA 4OSUL 1XGPB 2KZBA 3I9GH 4PJAF 4H1LB 1T2QH 2CWRA 3I75B 4IU3A 4OM1L 1JGVL 2WNKA 3HJEA 4JHWH 5DT1L 5C09E 3WTYA 2IPKB 1BECA 3JWNG 5HGDB 4TQEL 3ZT6A 1PQZB 2OPCA 4NUPA 4IOIB 4R4FL 5HD8C 5HGAA 4K9JA 1NCGA 1WFOA 4GINA 1UXMA 4G2AA 3IJSB 2UVEA 2GYSA 4YDIL 2XTJE 5AOZA 2A9AA 1TQWA 1VKXB 3E6FA 1B6DA 4M61A 4MD0B 1BZ9A 3IDMB 2XV2A 5E23A 3PWJB 1KENH 4NM4H 1IMHC 4NT6B 4N5ED 4Z76B 5DK0B 4D0CB 3TZVA 1CGTA 2YMXH 3EF4A 3QDJD 4HC1A 4M56A 1BYOA 2NW3B 4O02H 3VGAC 2YEVB 1TJXA 4F37K 5HDBB 4DCQB 3AWFA 1KF9B 2OQJB 4MLSA 4PJ5D 1MCNA 2OSWA 3VI4B 4WO4C 3GSOA 1XD0A 1KJVB 3QXDB 3LS4H 2VXUH 4H2AA 3D18A 3KG5A 1DFBL 2NY4C 3LXAA 3GUTA 3RVXD 3V9CA 3QG6B 2HLFD 1JZEA 3IU4L 1S78C 4HOMA 3HBGA 4NJAL 3O9WA 2VR5A 2QPSA 2C3VB 2AQ2A 3ARGD 4FG6D 5E0QA 4FZ8H 4FFYA 1EHLL 1U8LA 4HIIA 1H6FA 3WMPA 1FVEB 5A2KH 1ZV9A 2C7UB 4G3YL 4Y4FA 5JYMA 3VNZA 4F58H 2YC1B 4WI6A 4XCFH 3WFCL 5E4AA 3LN9A 4XVTL 4B9CA 4Q8BA 2GFBB 3T1FB 3CFQA 1DVSA 1OGAE 2R39A 1PLBA 4LCIL 5D6DA 4ZFOB 1CFQB 2DQEH 3K6FA 4UV7H 4ODSL 2DBLH 3TV8A 5FR3A 5JO5A 3B3IA 4DKFH 4R7LA 1OK8A 1YEDB 1UGNA 1CDYA 1HDMB 4KXCA 4JE0A 3EAKA 2FBJL 3IS1X 2XZQL 3NJMA 2OMTB 3PWVB 3VW3L 3S3BB 1ECZA 3EUDA 3X14B 2AJZA 3QGVA 2HFGH 4D8PB 3O4LE 5D1ZB 4ZXBD 1SFDA 1CD1B 3AB0C 1GOGA 3SKOB 3IDXL 2ZCHL 3EDJA 5D2NC 2N7BA 3HFML 3U0TB 5I1GH 2P24A 1DBKH 2LV4A 1C5BH 3MKKA 3G6JA 2DIEA 4JY5L 5EEYA 5BW7C 2YRPA 2XN9A 1P7QB 4FXKB 1ETZA 1G7JA 3KWVA 4N22A 3BKYH 5DEGB 1PZCA 4ZMZA 5AB0A 1JGEB 2CJTA 1KPVB 1I1CA 2G60H 3FTGB 3OBAA 1TJGH 1CICC 1J1PH 1D3CA 2XG4B 2BP0A 1TNNA 2B2XH 3MRHA 5E24E 1OAZH 3DC0A 4HFUH 3L17A 4Q0XL 2CBQA 4LSQL 4LVHC 4S2SA 3ISWA 2F5BL 4JCWA 1ID2A 3DX6B 3FU0A 1T1WB 1AS7A 2E75C 3Q8FA 1AO7B 2NY1B 3DI2B 3E1ZA 5I1DB 4X5WB 2A6DA 4FNPA 1M7IB 4H8QA 4N2AA 2KQNA 5I1AB 4EI5C 1YN6B 4L1DA 2WUBH 3I2CH 3QS3A 3WIIH 2VDNH 2ZF9A 4KJWC 5IMOB 4Z77B 1XEDA 1V7NH 3U1PA 1JAEA 4LKXB 3ZUNC 2DIBA 3K72B 3MXWL 1IIIA 1NBYB 5I30H 3QIWA 4TTDD 5F9DC 3ZHKA 4NKQB 1NM4A 4IK6A 3MCYA 4O2CA 3NABL 5HYJD 2WMPA 4B60A 2HMIC 1SMAA 3BAEH 2IG2H 3ILQC 4OB5L 3U7AA 4A6YA 3ZO9A 5HPMA 3NJKA 2G0LA 1CQKA 3VFNB 4JM2A 2YSSB 5DD5L 3P73A 1TR7A 1GC1L 3DX2A 3PAUA 3ROOA 1LO0L 2NYYC 3HZYB 3HMWL 4BSVB 2JKNA 4ZPVA 4LGSB 4NOBA 5F8QC 3MUGA 1X9RA 1MHPH 2CO4A 2DOCA 3ZHNA 2HX7A 5IFAL 2M1KA 4ICXA 4KVCL 1ZLVK 1M57B 3UGUA 4UT7H 3ATBA 2HTKD 4OCLC 1PZAA 3QG7L 5JR1L 3P69A 4PAZA 2KDYA 3FUEA 5IJKA 4NPKA 3ULUL 4PS8A 3EOAA 4R90H 2XRAH 3EH4B 3RWFA 1AQDA 5MERA 5ECJE 2WIIB 5DRWA 1NEZG 1JHTB 4E9TA 3KYMA 4NGHH 5IT2L 1BAFH 4BQ8A 1HH6A 2AK1H 4ES8A 2WXMA 2EUZA 3C6LD 5F71A 3V4LA 2VMDA 4WK0B 3FF8A 4QRFA 4P23D 4CC4C 4UILL 5HSFA 2GTZB 4XMLH 4WSJA 2VXQH 4LSVL 1W0WA 4KVNH 3HW7A 4OLXL 1I8MB 1JFHA 2V0AA 4G6JL 2AJ3B 3IGAA 4LVOB 1Z3GL 5CN3A 2VDRH 2BSTB 3ZVVA 5BS0B 3ILPB 4KO5A 5L0QC 4PJGF 4GXUN 5JORB 4J3SA 3U46A 4DNLA 2NY7L 8CGTA 3KVPA 1DJZA 3MJGX 2ZJSH 3EYFA 4AJYV 1H0DA 1HQ4B 4KNSA 4J6RH 5LBGA 4B9IA 3B9KB 4FFTA 2EE2A 3BVXA 2BSED 4ODUB 1IGIL 2YD2A 4QXWA 3ZDYF 1MKFA 4TMPA 4QHPA 1FNGA 3BZEA 2DLEA 4LQFH 1RIVH 3SBWA 3CFTA 3A6OA 2OW6A 2JB6B 4XXWA 5J6GA 2VR4A 3P0VH 3Q2CA 4GKZB 3IDJA 3EXJA 1VCAA 5T3XH 2IDFA 3O3EA 1IKFH 4WWPA 2BVUA 2ENYA 4DUXA 1KJ2A 4K3DL 4OCYH 2PUQT 4KZDH 4G8IB 4ZMYA 4YHZH 4FA6A 5DYOB 3JQOB 1TZAA 3EDFA 5KUMA 3SCMA 3QEGL 3WKQA 1E5ZA 1FGNL 4HS3A 4KTDL 1JGUH 4GEJA 5HHPA 1YY9C 2YLKA 3QUZC 2APFA 2F2HA 2CK0L 1L6PA 4QTIL 1EO8L 1ILUA 1AQHA 5I1KL 3HEIB 5CGTA 3ASNB 5AYQA 4L3ED 2ZNWA 2ROXA 3OB0K 4ANWA 2I60H 4PJIA 4MD5A 1UWEL 3S34H 1MFUA 1MFMA 1KTLA 2ROYA 4YVNA 1FVDA 3BZ4A 4GQPH 5BOPA 5IVZB 3G04B 3FRPB 1QR1A 2SODB 4IRZH 5HJGA 4L3FA 5T1MA 5IW6B 2KC0A 2WINA 1NCIA 4ISVB 3BKCH 4RQQA 1NMBL 5HDOA 1AGCA 4NBXB 4Y4HA 3WU1A 3US1A 3TFBA 4PRPA 5IHLB 3T4AA 1YUKB 4XPAL 4JPKL 1YAZA 4JJ5B 1HCFX 2Y6SC 4P2QD 1MQKL 2PNDA 1A7PL 4H25B 3GMNB 4KGJA 3FYIB 1NGYA 2PWGA 3PAVA 1G7MA 1XO8A 4NZUH 1PD6A 5DS8A 2RCSL 4XXDB 1ZRUA 4R4ND 4XGZB 4DOHE 4JRWA 2HFFA 2EEXA 4GW1B 5AUMB 4EIZC 3EJTA 2GIMA 3LB6D 3RUGF 2A9ML 2DMCA 2MH4A 5EOCJ 3NEXA 1AI1L 1YC7A 1W2KT 2BW4A 3UACA 4KKPA 3RPIA 4QXVA 1NLDL 1QAWA 4TSBL 1A0QH 3GM8A 5CAYB 4GG6A 4F8OA 5GISH 1BX2A 3RVTD 2KS0A 1WYJA 2XPZA 4RAHA 2WNXA 3DJRA 3G9VA 5E5MA 4NC0B 4EN3A 1P7QD 1CXLA 2YXVA 3EOTH 4MJIE 3SY0B 4I3RL 5E8NB 1FFOA 2DWEB 3IMWA 4TOYL 3MV9B 3SBRA 3WJLA 3WUWB 5HHQA 3LH9A 1NUFA 3HN8A 3QAQA 3IAPA 3QNFA 4N86A 2BZCA 5FUOL 2GK2A 4CILA 3HIZA 1M7DB 3QDHA 3TFKC 4YQXH 1P6AB 5IJCC 2I07B 1AO7D 2NY1D 3FB8B 1J8SA 3V4VH 5E1AB 4QXGH 1MHEB 1GGCH 5K1NA 1YEKL 4PB0H 1A4AA 1BM3H 1A7QH 1HE8A 2CPUA 5AAWC 5BZZA 1BZDA 3ABZA 2CR6A 4TF4A 1UT9A 4IS6B 5IEKB 2O61A 2WC7A 1M3JA 3V5DB 2H1PL 4AE1A 4E9WA 2IOIA 4UTAH 3E8UL 1JG9A 2FJHB 1QNZH 4KDTA 1AR1C 1QRNE 2Z91A 4L05A 5E1GA 1RU9L 4TNVF 4NZTH 4LF3B 5L2KA 3VFGH 3F84A 4BFIA 1ZHNB 4ZMXA 1N10A 3WDJA 3R19A 1FORH 1LYQA 3R1GH 3HG0A 1G7LA 1A7BA 5B39G 1QVOA 3ZE0F 4TSCH 1MCOH 5FWRA 4MAUH 4HA1A 3GI8L 1GOHA 4HBCH 2PF6A 1GIGL 4OZHF 1JTPA 1T6BX 4FMKA 3LJ3A 5T1KB 3QZWG 1KXQE 2QSQA 3A67L 3I3BA 3KYOB 3VXMB 2QVIA 3NCMA 2WZ6A 3VWJA 3BOVA 4HQQL 3VRLE 4JZJB 4QRPA 4XNXH 3HNSL 15C8H 2OX5B 3SYQA 5ID0A 3TS8A 3VRJB 2IBBA 3AU1A 4JFVA 4TVUA 4BKSC 4JRXA 3FW6A 2EDTA 1TQCB 3GSVB 2A9NL 3L5XH 4PJEB 1NWOA 3RVVC 1L9RA 3DSNB 1SY6H 3LXCA 4A37A 1GJIA 4ZS6D 1TNMA 3GLAA 2BS8A 3M88A 4OZIF 4TUOA 1V7MH 1A25A 1FFTB 3WY2A 5CF3A 2V2WB 1XIWA 3L3IB 1BOYA 3APMA 2ED9A 2WLYA 3L1FA 4Q52A 1KXVC 3DRTB 4MVBD 2CMRL 1Z9SB 4AYID 5GPRA 3BHBB 4M48L 1CDJA 1QLEL 1J5IA 5J56B 1LMKA 3DYMA 3LKNB 2BY1A 2FT6A 4HKBA 4XMKH 3VCLB 4JHAH 1EBAA 3ECUA 5JQ6H 1HL8A 1AY1H 1DE4B 1Z32X 3ZOAA 3NRPA 4P48A 4N1CA 2P48B 4JLRA 3WNLA 4DGIH 3MOAH 1KEGH 3MSPA 2HN7B 4I18C 5FO8A 5CJ5A 2XWXA 5DUMH 5ANME 5KVEH 4JKMA 3EO1A 4WI5A 1HIMH 4MA3A 1FZMA 2WLZA 3E3QC 3MR9B 3L45A 5KSUA 1AS8A 2Y1YA 5EOQH 5E56A 4LMQE 2Q2EB 4AEHL 2WXQA 3B9KD 5FCUL 1VGKB 2HPTA 5GQBA 1EGJL 1NOLA 4PJFA 2FGWL 4AGPA 2LHAA 2NZ1A 3TPKA 2NTFA 1J11A 4JDVA 2HLAA 5I18H 2X0WA 2W1NA 5SX5K 3QUYA 4PBVC 3H9SD 4TRPH 4LSPL 1FGVL 2VLKB 2QT6A 3R06A 3H0TA 2R69H 3TPUB 3E6FB 4M61B 3U1SH 1UD8A 2DLFH 4FLQA 4ONFH 2C3WA 4HAFA 1I1AC 2ZYIA 1GGBL 3RDTD 4M7KH 4XCEA 3ZSSA 3UPRB 3GMOA 3JWOH 5CJ8A 2NXYC 3BWUC 3UXFA 2XOTA 4P2OA 1OCWL 3PP4H 3V0WH 3LRLA 2Z93B 1F00I 2J25A 2ICWA 5CILH 5CINL 2FATH 4O00A 4UTBL 3F58H 3LQMA 4OH2A 1KELL 1F2QA 5TE7L 3MRBA 4JG1H 1BZ7A 1T0NB 3D18B 3J2PA 3EJCA 3QNZB 1RZGA 3QO1B 1QASA 3WTVA 4G7SB 4YSAA 2J4WL 3DJZA 5GSVB 2B1HL 2DKMA 5JXAL 4OLZL 2NY0C 5JIQA 4ZFQA 2WO2B 3L9YA 4U1MB 2R1WB 1U8LB 5C0DB 1P69B 4G6KH 4HF5L 4F2ME 1ZMYA 3L3OC 4R7DA 3HC0A 4L8SA 1CDHA 1F4AA 2FBRA 3B43A 4Y4FB 2OXGA 5ESAA 3GXIA 3QQ4B 4PJ8C 43C9A 3N1GC 1F3RB 5FA3A 1JZ2A 1IC7H 2WVVA 5B3JF 4P4KA 1SDAB 1NQBA 4KQ4L 1Q9LA 2L0DA 4MCYA 3QZLA 1DBBL 3CLWA 1JNJA 4LLDA 1BWWA 1N7MH 5C9JA 4UDTB 3M1OA 5CLZA 1Z9OA 5JO5B 3B3IB 1MDAA 5E8DH 3ILEA 4PJAA 3ZE1E 1PZDA 3ZXAC 5IJVA 1C8PA 2IXQA 4YS4A 2OMZB 2EIEA 2V2XB 2NX5A 3NRFA 4Z7VF 4KK6C 3VTTA 3TH3T 1HYRC 3VYPA 2SEBA 3WS3A 4YXKL 2IAMC 5C92A 5EEXA 4N2OA 5CCKH 4N85A 2NT1A 5C0BE 1DQDH 1PG7H 2PW1B 4GAGL 4NHUB 3SJVE 4BFKA 1OXYA 1Y1DA 5M94B 3WJMB 4PWFA 2CDGA 2R4RH 3OLIA 4JFWA 3Q2LA 1GYVA 2GBTA 5F97E 4A7SA 1XGTA 2WW8A 4L8DA 5KN5A 3BVTA 4AQZA 3X11B 1FH5H 4ENZA 1MELA 1MZZA 2VSMB 1KN2L 1I8IA 2IFFL 1WFTA 4HUMB 2GTWB 3MV9D 3MHZA 2BP0B 3REVA 3PWUA 1AXTH 3LTVA 3MRHB 1W72L 1JWMB 2BNUA 3BEVB 2AKRA 2B0SL 1U41A 4L9DA 4S2SB 5EO9B 3MRFB 2ENPA 2ZWYA 2WLMA 3A23A 2B59A 3UADA 1ACZA 4DGVH 3NJGA 3ET9F 4O5LH 5DHYB 5FFOA 1NC4A 2VN3A 2XVKA 5E5RB 4HUVB 3D3VE 5K69A 3CLEH 4OCMC 5PCYA 2X4UA 2BNRA 4V1DE 4NO0B 1OAQL 3IGFA 1A4JA 5HHOB 2AFNA 2H0PA 4KO9A 2C1PB 1PFOA 3LEXA 1RMFL 1XCTA 2QGEA 4DAGH 2H1XA 4Z7WF 4HGMA 2WMPB 4JPVH 2XX0A 3KPQB 2YXMA 3BPOC 4A6YB 4U3SB 1S7VA 1JPGA 1NZRA 4HAKA 1RK0B 4WUUB 5LWYL 4PJ5E 2R29A 1JV2A 3SGDI 3K6SB 1I8UA 1DLHB 5AENA 5HHVH 2NPLX 5CR8A 4MBOA 3C08H 4ZAKC 2NDGA 4KNTA 4OFYD 2K4AA 3RNKB 2ZP8A 3KLHC 3UFIA 2DPKA 5I5MA 3JTSB 4JQXA 4EZKA 4XMPL 4OQTH 2MTPA 5DJCB 3S3SA 1WSST 4FG6C 3ARGC 3Q6FA 4XNUH 5JOFA 2VUYA 2G75B 1GTFA 3WNJA 1KLGB 1NC2A 4YSRA 2YUWA 4XXCC 1P7KA 5FM8A 1PZ2A 5TH2A 3NCYP 5DHXB 5DMIH 5F21B 2H26A 1XH0A 4L4VE 4LVNB 1QX1A 1B0GA 3ATEA 4HMDA 3MRJB 1JPSH 5D4QA 1WS8A 4YVUA 3UZQA 2KLRA 3L8QA 1W0WB 4PJBF 3AXIA 4YZWA 3FSAA 5DC2A 3KM1A 3NUKA 3RL1A 2ZWKA 3CZGA 1CFMA 1XWVA 3U6RA 4UT6L 4KU1A 4PSRA 3JYCA 1H0DB 2IPUK 1F3JB 2GUOA 4AC2A 4MA1C 3MACL 3FO9A 5IBUG 4WFFD 2ZXEB 3OKMA 1YECH 5C7XL 1MCRA 3CU1A 5F93C 5MEQA 3BZEB 4J2QA 5SWSE 4ZFFA 3C8DA 4DWHA 2AGJH 4ZTOL 3IMVA 5J6GB 1QFWM 2X88A 5GGVH 3KPRB 3IDJB 4YK4C 2AQ1A 2Z31A 3UC0H 3INUH 5LGJA 4LLMA 1S3RA 5FC9A 2JCWA 3WXVL 2MOGA 3IE4A 3IJHA 3KPOA 4NQVA 3NPSC 3BLBA 3K80A 3I74A 1MCLA 3M7OA 2ADIB 3W9EA 1PYWA 4CMHC 3RFZC 2DIJA 5AVUB 2HXAA 3O2WH 5C0RH 3DVGA 5HHPB 3PLYA 3ISRA 1BQHG 1TF4A 3KBFA 4G9DA 5E1QA 1OANA 2P45B 4HCGA 4LCUA 3ZKMD 1R3KB 3JVGC 4ZOAA 1QFWH 2HAZA 2DL2A 2JV6A 3LD8B 5J12C 3UJTH 3AABA 1T3FA 1MCWW 2YWZA 4GS7B 2BVEA 2A2QT 1KTLB 2N7SA 1FVDB 4CVXB 5TDNA 3UBXB 1DVQA 4H8VA 3B7TA 3BSZA 1E5YA 5HYJE 1QR1B 3KNBA 1WD9A 3OG4B 4Y4FD 4PCYA 4RQQB 4GY4A 4H7VA 3QUML 4XAWL 3S35L 3TBYA 1AGCB 1J10A 3S7GA 1XCQB 2ZAIA 4PBDA 2DLIA 3OAYH 2NSMA 4RX4D 4P3CL 3EUUA 5HP5A 5AW1B 3MLRL 5FB8B 1M7UA 1NGYB 3DX4A 2Z8SA 1J1XH 1WFNA 5CP3A 5KZCB 2KL6A 2VN7A 5DS8B 4POYA 3CXHK 4F9PA 2BY2A 1CPUA 4LPTA 3B8YA 5LN8A 1BFVL 3R7RA 3MODH 2A6IB 5FV2A 3WLWD 4RMQA 3NACH 4BUHA 1I3GH 3L1OH 1H8NA 4BDVA 3IDNB 5H37A 1A9EB 2B1OA 2EC9T 3QAZC 2WBWB 2IV9A 1N64L 3EYUH 4ANXA 4P2RB 5B4MC 5IQOA 4LLWA 1TKWA 4RGNB 5HYSA 4EXPX 3B3BA 1QPPA 3RZCC 5AZEH 2QADB 5J7CC 1Q9OA 1H19A 1JZIA 1WPCA 3KH4A 2VDLH 3BUBA 2V7NA 4LSRH 1GGTA 1ND0A 3AC0A 3HE6B 4MJ6A 3TO4C 1X5GA 4EE2A 5LGYA 1R3HA 1KCVH 3FFCA 4N8VB 3D87B 2BJML 2EO1A 3CZFB 2ZOKB 3SDXF 3ZKXB 1QLFA 2W9DH 1DBAL 1J05A 2FX7H 3BZFA 5GGSB 3T65B 4WDIA 2FEEL 5K33A 3V6OE 2LW3A 3MRDA 4FQ1H 2JKLA 1YQ2A 4NO2B 3UCQA 5KBLA 1D6EA 1V10A 4CDGC 1NBZB 4RMBA 4UBDD 4UIKH 3FO0H 3FT9A 5HHOD 1IGMH 2HKFH 2GC7C 2J1ZA 3UO1L 3MKGA 5E2TH 3T8XB 4GW4A 1UD2A 5E8PB 5ITBL 4XPBL 1VFAA 1ULVA 1UM5L 3P2TA 3WXWL 2E0PA 1I7RA 1OF2A 4N68A 1J9RA 2AJUH 2PYFB 2WXHA 4WUUD 5HDBE 3S36L 1A65A 4K7PH 1QVOB 5D4HA 1KIRA 3VI4E 4HH9B 4XC1H 3IKKA 3RGHA 4G7VH 1AD0A 3AY4A 3QFJB 5B8CA 4XVSH 1KIUA 2VSDA 1GGYA 4G82A 3ALPA 3RUGA 4D9QD 2DYSB 1J48A 3NT0A 1QQDB 2IDCA 4N0FB 4R84A 1J0HA 1U8PB 4H5SA 2RAMA 2GCYA 1IUZA 4TN9A 1ASQA 2W91A 3L2NA 4U6VH 5AKTA 5E03A 4XX1G 2A74A 3GMMA 4X6CF 5EMYA 4BWUA 3O0RH 4JFPA 5DZAA 1KC5L 4TUOB 4D0DA 4LSTH 5E2WL 2AJVL 1XIWB 1UXSA 1XGYH 1ZKAA 2F8VA 4HUXA 1OLZA 2D7QA 4X50A 3AG1B 3FONB 5J0BA 4WHCA 1I7TA 3FFDB 4K9EL 3AG3B 5HVFB 3UDWA 5JMRA 2NXZB 5I76B 5C0CA 5IM7B 1K3ZA 2QSVA 3KYNB 3SO5A 1NGPH 3CSFA 3DA0A 3L48A 4GMSH 4DF9A 1J8KA 1T1ZB 4YSOA 3HUJB 3P3UA 2VWEE 1FFPB 1M2OA 2GUYA 1QYGL 3EO1B 4N9OB 4NPYB 3KPPA 5CSZA 3Q3GB 3NTCL 3STBA 3FAWA 4MA3B 4GBXA 1FZMB 1XSOA 1GY1A 5KSUB 1GAFL 3GSUB 1MIEL 4PJFB 3WEMA 3LB6C 4OZFA 4OUUB 4HS8L 4WI2A 1H5BA 1CJYA 3WSQH 2HLAB 2ICWJ 1Q9KA 1F6LL 3QUYB 5B3NA 3US0A 2QKIB 2FECI 4KRMB 3T2NH 3KPRD 4EVNA 5TE6H 1WWAX 4TUKL 1F86A 1XB6A 3EFFA 4M4RA 2BOBB 4KV5F 3GMOB 2V6HA 3H2WA 4GPVA 4OLVH 4ZODA 3C5ZC 1UH3A 1J9TA 4HPYH 5FA4B 2NUTA 1WIUA 3EXLA 2BW5A 3RFRA 2H0FA 4RSYA 4RFEA 1AO7E 2W92A 5TQ2L 1FPTH 4ZTEA 3ZMRA 2WP3T 4BK8A 2CGRH 4Y2DA 3W11D 5HGHB 5BOJA 3IB4A 1QWHA 1EXUA 4QXUH 1X44A 2DQDH 3TURA 4KNQA 1YEEH 2DD8H 1LP9A 1FDLL 3QUKB 1V3KA 3VX0A 1MW3A 4OZIA 3B7RL 2X9YA 1SBSL 2UZYA 1UWXH 1YEHL 5E9DE 5KANI 4N2DA 5T1JA 3FQYA 1N9PA 4LLQB 1R3LB 4L37B 5DZ9A 1MFBH 43C9B 5AW0B 5FA3B 1T2XA 2AITA 2WVVB 2WYHA 3D09A 3K2UL 4GH7B 4P4KB 2VXTL 4U1JA 4Y4HD 1JHKH 1DQMH 3EGSA 4QKXB 1E67A 5DUBA 5I17A 3A6CH 2Y24A 1JMXA 3DECA 3JT0A 3ARQA 1F8TH 2NRDA 5JA9A 2CJSA 1JZ4A 4OCNC 3SKJH 5AVVB 4OFQA 3RLSA 4OFIA 4EUPH 5KZCD 1IVLA 4PJAB 2Y5TB 5IJVB 4WEEA 4ZOEA 2IXQB 2OFQA 3LEVL 2NX5B 2WTRB 5LN4A 3V52H 1LEIA 3RY6A 3LN4B 4K8RD 5IJBC 2WZPD 3VXUA 1ANUA 1FJ1A 3BE1H 4DQOH 3U83A 2WVTA 1E3XA 2Y5EA 1ZVNA 5I8EA 2PR9A 2PP7A 1P9MA 1PZ5A 1RIUL 2XZCH 2VDPL 3CVHB 2Y1VA 4P2RD 4JFOA 3K71B 4YLQT 4OJCA 2HT4C 3VU1A 2IALB 1NCNA 1IKNC 4XWGH 1IKOP 1PAZA 1MRFH 3KPMA 3QXWA 5C07B 1XGTB 1TTUA 3L3HA 4MX7B 2QADD 2OCJA 4CSTA 3FL7A 4Q9QL 4PRHB 2ATAA 2BCMA 5BO1H 5DJ6A 5BS0E 3SOTA 4YGVA 2OL3H 4HWUA 8FABA 3K74B 2V9QA 3VRIB 3MRIA 2MCPL 2OXHA 3VB8A 5ICXA 3WEAA 4ZD3H 1FSKB 2AJSL 2AKRB 1RZ8A 4APQC 1EAOA 2B9AA 2COQA 4IQHA 3BW9A 4YSPA 4WW1A 1NBQA 2B59B 3UERA 5DUPH 1DVFB 4I1NB 3ZX1A 3CZUB 2MEJB 4A66A 1NC4B 3FT2B 3UP1A 4AL8L 5C0IB 1TSRA 1RZ7L 2X4UB 2BNRB 2VQ1A 3AFLA 1CZ8L 3B9KC 3G08A 4N0YH 3KGRA 3OJDB 1MAML 3V4PA 5IESH 4L0YA 5I0ZA 4RGMB 1HHIA 5JZ7C 3DGCR 3UPAA 5L2KD 3MNWB 4QEGA 5KBKA 2JCCF 2YPVL 4FGMA 1NGZB 2FLBT 3P3TA 5FCSH 4CADA 1NFDA 3TEZA 3IFPA 1S7VB 3F7QA 3RDTC 1PTZA 4C58B 4MMZA 2CCLA 4AK2A 5E99H 4RMTA 4YE4L 2OULB 4Z7VA 4J3OH 3NEOA 1I9RL 3EZ8A 4AYMC 1AQ8A 4JZOB 5C9KA 3II2A 3C2AH 5D5MF 5KEZA 3VWJD 4JM4L 2VZVA 4XNZB 1XT5A 2YPLB 1ITBB 5GGRB 4XO8A 3KCPA 2A6JA 4B0MM 1TQVA 2W38A 3C9NB 2E7LA 1HQRA 3DIFA 2I9TB 5F1NB 3ZMEA 1MRCH 2WN2A 2F68X 3D0LB 3EJUA 2PWFA 3OR7B 3Q6FB 1IGYA 3ZDXF 2D7TL 1SM3L 3RWEB 5JW3H 1JZGA 3GM0A 3IXAA 1XIWD 2BFVH 2A77L 5TH2B 5D7LA 4P4RA 4MNQB 1BEYH 4Z7IA 1B0GB 3TTYA 2OMXA 5D7JC 3IMUA 3CZLA 3HZMA 5ESQA 3MLSL 4FMVA 4BGDA 1MPAL 3D25B 2NXZD 1BBJB 4HZAA 4ZW3A 2YD9A 4QJ4B 5JHDA 2P42B 1EDYA 2EKSA 5I6OA 4PJHF 1MUJA 2BSBA 3MMEB 4K23H 5BVJA 3U6RB 5TK4A 4ETQA 4N0CD 5EZLB 1FVCB 2R0KL 4AK1A 1FZKB 1SN0A 3FB7B 1XAUA 3KGSA 3IJEA 4ZQKA 2E7MA 1PL3A 3WD5H 3S88H 3D4CA 1RULL 3IFLH 4XP1L 3FO9B 2CNYA 3CWGA 1SXSA 1E7UA 2WWKT 3L3GA 1HILA 1IB5A 2FWOB 2X4QA 2Y4SA 3M46A 1TFHA 4AQEA 4Z7WA 4MASA 4S10A 2VDQH 3QUYD 3SGKA 3IVKA 3ULAB 2WKOF 2VJ0A 3EHBC 1LD9B 4BHUI 1O9ZA 1KGCD 3ZRFC 2B8OT 4XODA 1N6QL 4LLMB 4MA7L 4TQ8A 4KI5C 1HINH 5DZOA 3X1GA 1HE7A 1MFCH 3OKKA 3OLEA 3BDBA 2ZP0T 3MRQA 1A3RH 5IOKA 1ILSA 3NN8B 2JSFA 1S9KC 3FO2A 4P2OD 5CGBA 1HSAA 5TPWL 3TO2B 3IDYB 1RSFA 4YMPA 3W9EB 1PYWB 2I5YH 3CHQA 3OZLA 3FRUA 5CJBA 5EPMA 4QRQA 1P7BA 2DZEA 4KAQL 3U82B 3V0GA 2DM2A 5AKRA 5GRUL 1F13A 4ATWA 2NDFA 4C56B 4KDVA 2VMJA 2X10A 5FYJL 5FK9B 2J8UA 4L0ZA 4RZCA 1M05A 3V6FB 3PJNA 3BCDA 4P9MH 5E8OA 5FECB 1X4YA 2VQUA 1JZ7A 1FLRL 3NH7L 3BPNC 1WAAE 5GZOD 1KG0B 2RMNA 3IGLA 1E5UI 3KNBB 5DD3L 2XKSA 4GXVH 4CU6A 3D52A 3ALWA 3V7AE 1F02I 5K59E 4JKPL 4P4KD 4UOZA 3MREB 4RAVA 1XZWA 3GRGA 2BP8A 2FX9L 2NCMA 3BP7B 4PJBA 3KDMB 3WNIA 1QWNA 1CGSH 2OKMA 4HJUA 1BF2A 1PIFA 4IBSA 2XWBA 3OJ2C 4PGCB 5HGBA 1ZHKA 1ZWIA 4PJGB 3FSVA 3J27A 5D72L 5MI0B 5I28A 5IFJA 3VXME 3BH4A 2VLJA 3WFEH 1YNKL 3CVDA 1BD2B 5D7IF 3BP5B 3GO1L 2NX5D 1T1YB 2AQSA 3AS2A 4FD0A 1RLBA 1U92B 2B4CL 4IRJB 4PG9B 4F3FB 1T83C 4PJEE 4G70B 5KJRL 3KLAB 3ZDYB 5A2JH 3RHWF 4BDVB 2HJKB 4QD2E 4K71B 3TLRA 2ZWZA 1KTDA 3ULVL 3MRGA 4FXTA 5A16A 4OM0L 2FIKA 3UAAA 1NAMH 5C07D 1UA6L 4JX0A 4XT1C 4FP8H 2H0JA 4C4KO 4HSAC 1RURL 2VN5A 1OE2A 4UOW1 3DNKA 4LSDA 4PRHD 3F7VA 2B5IC 4WV1A 4KPHL 2V7NB 3GXUB 4L1LA 1O6TA 5GGUA 5A2LH 1ND0B 1YMMA 2H41A 1DYZA 2R51A 4KRPC 4ODBD 3ZDWA 4B7IA 4S11A 1CO1A 1R3HB 4LCWA 3I9GL 3LZQA 5E4OA 1C9SA 5CJQH 3QXVA 2LLGA 1SHMA 4WU7A 4F7CA 1KYDA 4LOUC 1DN0A 2BM3A 2Y36H 4GP8B 4JG0H 3BZFB 1YYLL 4PGBB 4WFFE 3QXTA 4WDIB 5HI3D 1DVFD 2WWOA 3NJVA 4AW4A 1P4BH 3ATAA 1NC4D 3LKPA 3DBXA 3K4AA 2PO6A 1BCIA 5KTEH 1I85A 1MCWM 2VLKE 1ZIAA 2BNRD 4MDJA 4PWGA 1D6EB 2Q8BH 4OIBA 3TEYA 3GZKA 2XWTA 3BFOA 4R8WL 1BV8A 2JXMB 2NY5H 1SJMA 4Y19E 5F6IC 1VFAB 1FCGA 1FF5A 2VW7A 5CIPB 2N4IA 1KB5L 3TU6A 5KBMA 3WY1A 4KUZH 4ZMOA 1W8OA 1OF2B 1WO2A 4I0PA 1TPXB 3K8MA 2VXUL 1DEDA 2DDQL 5LDUA 2ZAHA 2Y7SA 3IU3B 3TZVC 2PXYB 1T03L 1KCSH 1DDHB 3OGCA 4AQOA 5B8CB 1KIUB 5BV7B 1N0LB 4BKLA 4RA0C 5F3BB 3X12A 2LR4A 3IRCA 3FU5A 2BHZA 1N59B 4DKEL 4LHUB 2D3VA 4NN6C 4QRTB 2YPLD 1FFNB 4H5SB 2JKIS 4D9RE 2HWZL 4HOWA 4N6RA 5AKSA 2VISA 3SKNB 4F58L 2MNWA 1AAJA 1TQBC 2A74B 3O9WC 3O6LL 4HSCX 3MLTB 2HKAA 2YAMA 4D0DB 3MGTA 4Q9RH 1ERNA 4ORGB 3PUUA 3TBTB 4AUYA 5C0NC 4H1LH 4HUUB 4LEOA 4HUXB 2V5TA 4MNQD 2YD5A 4DKFL 3FU9A 2IH3B 3E7JA 4N9GA 2J56A 2HRPH 2WCSA 4OKVA 3CDYA 5D6DC 3CU7A 4EI6A 1KXTA 2V5YA 3JV4A 3NZUA 4QXTA 3EYOA 1INDH 2BY3A 3M17B 3WFBH 2UWEF 1M71B 2J8OA 4JR9H 5GJTL 1U3HB 4GAYB 1MFAL 4EOWH 2AJXL 4JJHA 1IJ9A 2DEWX 1UACL 4BQBA 4YR6A 3S9DB 1J8RA 3KPPB 5CU5A 3SQRA 5ALCH 3V55A 2K1MA 1W0VA 3DI3B 3CNKA 1A7OL 4IKKA 4KHXL 3KW7A 2ZX9A 4UQ3A 1Z3RA 2FQFA 4ICWA 2P5WB 4NO5B 4K5PA 4ZO7A 2C9XA 1GPOH 2BC4A 2B1AL 1QA9B 4ZTPH 1D5MB 4Q7DA 2DTMH 3PXHA 4X8JB 3G3LA 4X6BA 3L7EA 3B2MA 5DDHB 1BVLB 2WQUA 1R17A 3FQUA 3ZE0B 5FYKL 1A6WL 4XOAA 4Q89A 3UBGA 4Z0BH 2AXJA 5T5FA 2XA8H 2B2XL 4OZHB 4JFDA 4HFUL 2LVCA 1IBBA 1WAPA 4N90E 1QEXA 2X89A 2XSKA 4NUJB 5DD6A 1SYSB 3VVWA 3A0OA 3UBFA 4GI9A 1ZHLA 4C56D 1DJYA 4L2YA 4W1TA 5ID1B 3ATDA 1RZKL 5GZNA 5CJXC 4PW4A 1WUNT 3HNTH 3I2CL 3O3AA 4JFYA 3RQ3A 2APBA 3QRLA 3WIIL 4Y5XB 2VDNL 3PUCA 5HYIA 4X6CA 1V7NL 2QQNH 5GS0D 4OZIB 4QKTA 3ULUE 1JZ3A 3KWWB 3WI9A 5HHOE 2UZYB 5I30L 1S7QB 5IBTL 4ZMLA 5DFAA 2WGXA 3Q43A 1NEZA 2L7UA 4TNWF 1BAGA 2KMWA 4LNRA 1AHMA 1NANH 2FH6A 3AG4B 1HWHB 2VDPB 3ZRCC 4WUUE 2A5UA 5IB2B 5KBDA 3SGEH 3BD4A 3QIWC 6PCYA 4XX5A 3EGSB 3TWCL 3O2DH 1GYCA 3OXSA 5I17B 4HU2A 3ARVA 1E4WH 4AX3A 2FAUA 1IGFH 1URIA 2E6PA 3RWHA 2WQ8A 1XF2B 4LARH 4BQ9A 4IRSA 3W38A 4D9QE 1AIFB 5BZWA 5EN2A 5CWSA 4JM2C 4TPRH 5MENA 1G43A 4K5LA 3G5ZB 5FKPB 1BD2D 3GRWL 1CXEA 5F7UA 5D93C 3KHOA 3IXTA 1JF1B 4IRJD 4XCCL 4JREB 5FO2A 1E6OL 3PWLA 4UQAA 3VXUB 4UM9A 1QFWI 1ZVSB 4JN2A 3PE9A 3CVIH 4IIQA 1T66C 2FEDC 3QEQB 2ICES 3FB6B 3WKNA 2AS5M 3FN9A 4NGHL 4MZIA 1LO4H 4AIZA 2HVJA 4PP1D 3RILA 1F45A 2NZ9D 3V95A 1EMTL 4ZNEE 3A24A 5IJKC 4JFOB 2BO0A 3IT8D 3ZIYA 3N41F 3SYAA 3HMXL 4OJDH 4HT1H 4JO2L 3KPMB 1KCRL 1NMAH 3GMLB 3V5HA 4KVNL 5I0XA 4LCVA 1NGXA 2CXKA 3G5WA 4FTVA 4NQDA 3S8WA 4WI9A 2VDRL 4HIHB 4L18A 2X4SB 4X4YB 1E28B 2V17L 4YGVB 2FB4L 1WC7B 2DI9A 4G59C 2EDDA 1K8DB 3DMMA 4ABVA 3H9YA 5T5NG 2E7CA 3O11B 3OKLA 4U6YB 2K9FB 4P06A 2PYEE 3N44F 4NJ9H 2UY6A 4IMLA 4KTYA 2GEQA 3GMQA 2QL1A 3BW9B 4OGYL 2WHVA 3TT1L 3WNNA 1DCLA 3BQUA 4MB4A 4GAAA 2BSRA 5IVOA 1L0YA 5EBLA 4APXA 4FCHA 2ATKB 3LIUA 5F88B 3MJ9A 3KPRE 4LB8A 2VQ1B 3EYQC 2EIKB 1MCHA 4BM7A 5AAPA 4OCYL 4Y2OA 3MC0A 1A2YB 1GGUA 2HH0L 4KZDL 4TM9A 4XXWC 2CR3A 3ARUA 4RNRB 2ZSVB 4P9HH 3UTQA 2IMNA 4QDGA 5DFWH 3CVCA 4A63A 3JUZA 3OXRA 3AZUA 3MRMA 5I15H 3IFPB 1JGUL 4HEPG 4KK5D 3VFMA 2QKSA 2QHRL 2Q6WA 1T5WA 4Q6IA 3F83A 2PXYD 4KK8D 1B2WL 4AITA 4HLZG 2P43B 5EUKB 3SCMC 4JQIL 1YJDL 3ARXA 3ARDA 2OCCB 2OP4H 4M93B 3GKWH 5BCAA 3UEZA 4LHUD 1IC0A 4FLHA 1MJUL 2E27H 4PS7A 3W11C 1JYWA 2YMTA 4JPWL 1DVYA 3LD8C 4ZO9A 2CQVA 1HQRB 3DIFB 4K0OA 5IHUH 4IRZL 1N4XH 1FE8L 4XNQA 3BKCL 4WI8A 5J1AA 4AKPA 1DVTA 3GB7B 4KDWA 5IKCA 3IRPX 3IJ7A 3WY4A 3T08A 4LSUL 2W60A 3IXAB 5HDQH 1F11A 1GSKA 5IWLA 1IEBA 4XP6H 5BQ7B 4JDZA 1LEGA 4HHAB 1LJMA 1KULA 1QSFB 2BCKA 4FFZL 1OCOB 3MAWA 4KVPA 4Y4HC 1ZLDA 2AZUA 3HJ0A 3NZSA 5ESQB 3T4AC 4CL7A 4NZUL 4NOFA 5AB1A 3QVAA 5FUCE 4IM8A 2ZICA 4J3BA 4RAUA 3S37H 5C0CD 3AAZB 3MN8A 4JFHD 5DRNA 5BVPH 1PY9A 2Q86B 2DF3A 2F7IA 3B7SA 3AREA 2ESVA 3KS0J 1G0YR 4BZYA 2WUCL 1BAWA 3QCUH 1XR9B 4EQ2A 5BVJB 5EC1A 4IBWA 1VZGA 3HI6L 1D5ZA 1RL1A 5GSRA 5AD0B 1H6EA 3IJEB 4ZQKB 4QAMB 3LS5L 5GISL 1H9DA 4K8RC 4P2RE 2EEBA 4Y9FA 4JY4B 3L3GB 5AOJA 2P5WD 3MA9H 4MB5A 4RGNE 4I9XA 2JCCA 2F53B 4N0RA 5GS3A 2VAJA 4R9HA 4AT6B 3BT2H 2O93L 2DQGH 3F3HA 3GZPA 1G7HB 3EGDA 2JJVA 3SDAB 2UZIL 1JWSA 1I9IH 2VR6A 1XL6A 1PZ3A 2JH2A 1XF1A 1I3RB 2Z35B 3MRQB 3QUXA 3GEWB 2MPAH 4EN3C 2FSEA 3FO2B 4AXWA 1QLRA 5T1LA 5HHNB 1G6RB 4PJ7B 1MF2H 3FRUB 4LESA 3QZWA 4YQXL 1F0LA 2CUHA 3OMZA 5D5MA 2DJMA 5GGTH 1UCTA 5ANHA 1W9XA 1AZVA 3DROB 1WBXB 3WJLC 2O5ZH 5I1EL 5A2CA 3NCFB 1UXLA 4PB0L 1BM3L 1NIBA 5ERWA 1TETH 4QRAA 5E51A 5KVGE 3GTTA 3B7YA 2HJFA 3DETD 4NAMA 1OTSD 3DX8A 3WHE1 3DVIA 3D2TA 3L95A 4FADA 1UD3A 5L2JB 1U21A 3KPSA 4NZTL 4X80H 4A1RA 4HGWA 2MMXA 3WL9A 1NCTA 5M7QA 1N67A 4JMXA 2CU9A 2VW6A 3D06A 2G30A 3WFHA 2WCGA 1CFTA 3LZOA 3EJYC 2ZYSA 3ZYZA 4KDTC 3BSGA 1VFOA 1MCOL 3GIVA 1BQ5A 3EZJB 4MAUL 4PJBB 3QIUB 4OLYL 4I0CC 4HBCL 5B38B 3QFJE 4G7YL 4LBEB 3GI9L 4RGOH 3OJVC 2G3NA 3ESNA 5HGBB 4PJHA 3GHBH 4NKDA 1ZE3C 4ZOBA 2VLJB 3FYEB 4XNXL 5ICYB 5T1DH 4CW1A 3EDEA 3P2BA 2Y1ZA 4LPCA 4AMKH 2WBJB 1JCVA 1LTXA 2WXRA 2XWDA 4HIJA 4I77H 2ICEA 3T3PF 3L5XL 2WXOA 2O6CA 3VXUD 3VWJC 1V7ML 1VZIA 4NRZB 2QDWA 4WJ5A 5FX3A 4FNUA 4B50A 3QEQD 3D9AH 2WKOA 3TEXA 5I16B 1VPOL 5J9PA 2MPVA 1B3IA 2CJUH 4KZ0A 1ADWA 5C6TL 2LU5A 1T4WA 5A16B 4YHML 4W70A 1LE9A 5HHMB 3W0WB 2X9ZA 3MCG1 5DLLA 3M86A 2J8HA 4DPAX 4R0LA 3BP4B 1PD0A 3MROA 2XVGA 5ISZA 2NZIA 4JDEA 1E5CA 1P6WA 1S9WA 3SQOH 4EIUA 1AY1L 1KB5B 3RJQB 5A3ID 4QYOA 1S9YA 3UYRL 2WYTA 1HWGB 3Q0HA 4JQVC 4ZPTA 1OSEA 4BXSV 4JL1A 1P5UB 1XBDA 1RFDL 3CDZA 3MOAL 1LK3H 4LMQI 1QTYT 2A83B 3HUJE 5DUML 2C9UA 1HIML 1ZGLA 4NN5B 1PLGH 4PB9L 5DD1L 32C2B 3QWOA 3O6FB 2XQYA 1RV6X 3NZ8A 4PWIA 4WU7B 1W72A 4RRPM 4QHMA 3OGOE 4PJFE 4PVMA 5EH1A 3RBSA 2FD6H 5K39B 35C8H 3RBGA 1JRHH 3I85A 1L0PA 2ZT9C 5I18L 3DV6A 3ZL2A 1DJGA 4N0CC 1Z0NA 3HG2A 1F4WH 4E0RA 4AVKA 3DBXB 5GRJH 1ESOA 2XPGB 4FNLH 1HU8A 4G5ZH 4HJJH 4MDJB 3WHXB 3U1SL 4X5XA 1KGCE 4GXFA 2DLFL 3PL6A 5GGQH 2EUVA 4WAFA 2RIKA 4Y88A 4OSUH 4TLKA 2V4LA 1P4LA 3JWOL 2FJSA 3C60B 4M8VA 2AK4A 2BS71 1CC3A 3N42F 1N2RA 3DOHA 4K2UH 1N3NA 3PP4L 5I9QB 3V0WL 2RH0A 5DT1H 1JGDB 4OM1H 1JGVH 3O6KH 1E2WA 5CILL 3OR6A 4TQEH 2FATL 3F6IA 3GHPA 3F58L 4R4FH 3VH8A 1G87A 3BPLC 1QO3B 2YN5A 2PABA 4JG1L 1TOXA 2OZNA 3KS0H 3CK0H 5D7IA 4P2OC 3OGCB 4YDIH 3GT6A 3S8GB 1UXWB 2CG9X 1TVBB 4N2GA 4ALAL 1RUQL 2IDSA 3MCKA 1YG9A 3QJHA 1IEAB 4WO4A 3CQPA 2C3GA 2KDGA 2NQDA 3P54A 3T2QA 5ESVB 1ES0A 3QFDA 4DPCX 1JPEA 1JN6A 1U3ZA 1HOCB 4TLSA 1CGWA 1B0RA 4ZMNA 2HFTA 4XO4A 2VISB 1CLVA 1OE3A 5DVNA 5CEZL 1ZOXA 2VSCA 4WUKL 2Y06L 3GDCA 4Z7QF 4JPIA 2F1AA 5LQBL 2UX7A 1XH2A 3A4AA 5FDWA 3OD3A 4R7XA 5ICZB 4L8SC 3U36A 5KVMC 3IU4H 1XGZA 2M8XA 1IAMA 1TVHB 3AT0A 4NJAH 2J57A 3FUNA 1QSFD 5HYQB 4P2CG 3BWAB 5HXMA 5LBSA 3DO7B 3RGVB 3WOVA 4PJCB 4N9GB 1EHLH 3BN9D 1E9QB 4PJAE 4URTB 2WM0A 1WZLA 3SDXB 3VNYA 5JHDD 2NX5E 3RGBA 3FT4B 3EYOB 3O81A 3K2MC 1BG9A 4UQ2A 3C5SA 4XVTH 2VQTA 2JJSA 5E4EC 5FM4A 4HD9A 3RWIB 5CCKL 3K46A 4B5EA 4DGUA 4IHOB 1PG7L 5J8OA 2JTYA 4ZO6A 2I24N 3BAKA 1A6TA 1FZJB 3ATFA 4F20A 4ODSH 2ICWI 2X4OA 2C9AA 4OJFL 3WAKA 1K85A 4K7FB 5C07E 5EZPA 3SDYL 2GITB 4F15C 2FBJH 3DHMA 5AWNH 2XZQH 4WFED 4XN7A 3VW3H 4X6BB 1XQ4A 4OF0A 4PRHE 3FQUB 3SDAD 4Y5VB 3SB3A 4NBZB 5C0GA 2P52A 2ITCB 4N0UB 5BW7A 1AXTL 1Q0EA 4F5CE 4HG4K 1VFBB 2ZCHH 3IDXH 4ACPA 5JDSA 3HFMH 3WIAA 1SDYA 3FQXB 4U3CA 1WWCA 4Z5RA 3FUDA 1CICA 1TQSA 1P6FA 1IBYA 4K3JL 2YGVA 4O5LL 1HL5A 2W0LA 4OJEH 4A2MA 2ZUYA 3WTTA 4B9PA 4JFYB 1G7QB 3Q6GL 3QULB 5F7BA 5BRZA 3C5XA 4X6CB 1AHKA 5B1AB 1DL7L 4P5KA 2NY3C 3UTSB 2ZF8A 3L2MA 4ANKA 1JUFB 2DV6A 3PHSA 1L6XA 1CI3M 1OTTD 3AS0A 1Z9NA 3HCVA 4LKCB 4NKMA 3EFDL 5EU7C 3VDBA 3FQWA 1NEZB 3LYRA 1CG9B 2OJEA 2MFNA 4JVUA 3PQYA 2F5BH 1I7ZA 4LNRB 3QZBA 4B41A 2BVPA 1KLUA 5D1XC 3JYBA 4BZ2H 2GSIA 3D0VA 1KCBA 5LVEA 3I84A 2A0LD 4LCCB 4AIEA 2QQLL 3P9WB 3I9AA 3QUMA 2RQEA 4MD4A 3QIUD 4HBQA 2DJSA 1CF8L 4CU7A 4LEXL 1EZVX 2GC4C 4QHNB 2UWEA 4WKXA 1UWYA 1X5LA 4P46A 3MXWH 2VLJD 1A6ZB 2WZAA 3QR2A 4G8EB 4R26H 4XBMA 1T6WA 2YPLE 1EJ6A