2JFPA

Crystal structure of enterococcus faecalis glutamate racemase in complex with d- glutamate
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
267
structure length
267
Chain Sequence
SNQEAIGLIDSGVGGLTVLKEALKQLPNERLIYLGDTARCPYGPRPAEQVVQFTWEMADFLLKKRIKMLVIACNTATAVALEEIKAALPIPVVGVILPGARAAVKVTKNNKIGVIGTLGTIKSASYEIAIKSKAPAIEVTSLACPKFVPIVESNQYRSSVAKKIVAETLQALQLKGLDTLILGCTHYPLLRPVIQNVMGSHVTLIDSGAETVGEVSMLLDYFDIAHTPEAPTQPHEFYTTGSAKMFEEIASSWLGIENLKAQQIHLGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Exploitation of Structural and Regulatory Diversity in Glutamate Racemases
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Isomerase
molecule keywords GLUTAMATE RACEMASE
total genus 91
structure length 267
sequence length 267
chains with identical sequence B
ec nomenclature ec 5.1.1.3: Glutamate racemase.
pdb deposition date 2007-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01177 Asp_Glu_race Asp/Glu/Hydantoin racemase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2jfpA02
3.40.50.1860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2jfpA01
2JFWA 2OHVA 3OJCA 2OHOA 3ISTA 3ISVA 2JFVA 1ZUWA 1JFLA 3UHPA 5HRAA 2JFPA 2DX7A 5EVCA 2JFYA 1B74A 3UHFA 4B1FA 2JFNA 1B73A 2JFXA 3UHOA 2JFZA 3S7ZA 5HQTA 2W4IA 2DGDA 1IU9A 2OHGA 5HRCA 2JFQA 3HFRA 2ZSKA 3OUTA 2VVTA 5ELLA 3S81A 2DWUA 5ELMA 2GZMA 2JFOA 2EQ5A 2JFUA 5HJ7A 5IJWA
chains in the Genus database with same CATH superfamily
3BD8A 4LXQA 1TEHA 5F76A 3IMKA 3FOZA 5A1TA 4EF5A 3M4NA 1J8YF 3KXDA 4FR0A 4G8BA 2DZDA 2FEMA 4XAQA 1IH8A 1QVAA 3QW2A 1Q6YA 1OCEA 3NYRA 1ISMA 4FP9A 4XE5A 3M3DA 3ZE9A 5CXXA 5A4FS 3BXHA 3JV7A 2CCJA 3EXFA 1VE3A 3HBAA 2CJYA 3ITKA 1KAEA 3EUWA 1J1ZA 3GQBB 4L2IB 2XVZA 5KNDH 3KQVA 1CTQA 4YRFA 2JFGA 2IL1A 3P5BA 5JCZA 2JI7A 2B2XA 2EC5A 4MDYA 4MWGA 4IIUA 4WNIA 1XZHA 5EY5B 2FSIA 1VE5A 3TRJA 1IFXA 3R4VA 3LQQA 1F0KA 2YFKA 1S2LA 5L3SA 2B8WA 1C8BA 2VHQA 4IQ8A 4DYDA 5IFLA 5JH7A 3TGLA 1QYXA 3P97A 4LTMA 2W37A 5GM1A 2QRMA 1IOVA 3PEWA 1U0GA 5FUXA 4MS1B 1PS0A 4C1NA 4MV7A 5FPQA 4ER6A 3E1KA 5TQ0B 3BD9A 3FTQA 2Q7DA 4CKYA 3THXB 2ZBUA 1XNJA 1N2GA 2R3SA 5TGDA 3WRVA 4NCAA 1WVMA 2IUSA 1T2UA 5F5XA 1T8YA 2Q46A 1XAHA 1X6VA 3RS8A 2G8NA 3ETJA 1ADFA 1Z0FA 1YOVA 2E3JA 4GOJA 4QASA 2DWCA 3NWOA 2QUKA 4TROA 5DSTA 3B1KA 1R0KA 2X1LA 5HEKA 1GYPA 1MVNA 3T3GA 1TAQA 4DA7A 4EABA 3EUFA 5JFGA 2VPQA 3K9NA 5FWYB 2ZUVA 4IIEA 1Z6AA 1K4YA 4U6QA 1OAKA 1U3FA 3A8TA 2FPUA 2QOEA 1U3TA 1EVIA 2PMDA 3ROZA 2QG9A 1NXPA 1UXOA 2ADFA 1DARA 2FMIA 1XCMA 2JGJA 2IVZA 2QAGB 2Q41A 3VQTA 1V16A 3B51X 3PCRB 2Q4BA 4O4JA 1U7UA 3FGPA 4P82A 2IOHA 1N5LA 3UWDA 3SNHA 4EZEA 1E2BA 3R6WA 2IF0A 4YO7A 3F2VA 2ZWMA 3GVIA 4LYYA 2P27A 1FLAA 3NHAA 4M8NE 4R01A 2EFEB 1HEUA 5DNCA 4QPZA 3P4XA 4CGZA 5A4AA 4Q6WA 2A5JA 1DCTA 1E3IA 3R6LA 4PVDA 4ZVUA 1EYZA 3D31A 3HSSA 5SICE 2D0IA 2YWEA 3AILA 4FEYA 2X5JO 4HH3C 4BFSA 3GMIA 3CEJA 4WN9A 3F6SA 1R27A 2MTBA 2XBLA 4MRSA 1Z4KA 1Y8QA 4WIAA 4E2ZA 3CEPB 4BNXA 4JU8A 4HNUA 2QQEA 3UTCA 4MGHA 3ZCXA 3LZ6A 5C8ZA 4PONA 4P9NA 1NP7A 2PRKA 3EMKA 5KSOA 3JSAA 1OV4A 3N6XA 4IOLA 1L7OA 2C2MA 4RENA 1LBTA 4B73A 3RNOA 5JYEA 5DIFA 3DDSA 3LL4A 1QC5A 4L8YA 5FUYA 3WZMA 2PGXA 2R48A 3GEGA 2YXNA 2B4QA 5KX5F 1FDSA 1Z13A 1XHFA 1H1TA 3SXUB 2GRUA 5TT1A 5AW0A 1E0SA 1JF8A 1MXHA 2YQ5A 3HY6A 4LXTA 4OGWA 1XL1A 1D4OA 4XUDA 1TT5B 2IZ7A 2E4XA 1E69A 3NAQA 3K6RA 3WLAA 1WU8A 4HQOA 4BTEA 4D97A 4EHLA 5B30A 1FJXA 1O87A 1E1QD 1RHRA 1C3OB 2IHKA 4IH1A 5IC4A 3B5JA 5J58A 2AF3C 2HRQA 3MTGA 1R00A 1JQAA 2TSYB 3ISJA 1ZGHA 2V74B 1G2QA 4J0CA 3TXYA 3K70C 1K8ZB 5KNCH 1U0RA 3JTEA 1UBJS 3MF4A 3R0IA 3DHYA 5HJEA 4FFOA 3HFSA 1PK8A 1SXJD 5HGJA 1JEQB 5FQOA 4AYTA 1DV2A 1T1SA 1XMVA 1WSDA 2R8BA 3GGPA 1PR0A 4RA9B 1ZVJA 3GCZA 5CXSA 1RFLA 3DMGA 3H5WA 4NVRA 4LY9A 4C1BA 5H83A 1QK5A 3Q5DA 4EFNA 4EQZA 1RZRD 2QK4A 3QEMB 3QSGA 3IPCA 1PYOA 4H0FA 1EFRD 1MFZA 1RP7A 2Y1XA 3GRRA 1B76A 1SCUA 1ZM2A 1EX6A 2ZAMA 4PGFA 2J0UB 4J1SA 3VZRA 1E1MA 1MTOA 1CDEA 2CNNA 1D07A 2EJWA 3JATA 5LQCA 1RJ9B 2EHDA 2HCFA 1CHNA 2KYRA 1DOAA 1AQLA 2GZMA 1GU7A 4LECA 3N0VA 4KQ1A 3BUSA 4C07A 1H3NA 5K0JA 5A3SA 3NB0A 1BMFD 3GCDA 4WBNF 2H57A 3TTUA 2P0YA 2IXFA 2V5AA 4WWHA 1GKIA 3IXQA 3ISTA 2FA9A 3DFMA 1MV8A 1LFAA 3LXUX 2CDBA 4WGGA 3A31A 3U3DA 3CTPA 4RK0A 1T3ZA 1M9NA 1ZU4A 2BDUA 2XGMA 4WK0B 2A1TR 4YTEA 2PSHA 1E4EA 3V34A 1Z37A 3CH4B 4PCVA 3WS7A 1OSNA 1JVSA 4JGIA 3L7AA 3ZJTA 4TS1A 1YZUA 1PFKA 5D3ZA 4KXVA 3L7IA 2A4KA 3KR1A 1Z56C 2J3QA 2VH5R 4F5WA 1EXMA 2JHAA 4A6EA 1C8KA 1QZZA 1J39A 1YIOA 1OYOA 2VHVA 2JI6A 4J16A 3UB2A 5HX7A 4MVJH 4ZTBA 4C04A 3E84A 2GFQA 1UC8A 1IZ8A 4MW6A 4TV9B 1SBYA 1VZ3A 2G3YA 4FN4A 3RC3A 1Q20A 1PJBA 2WTUA 4BPBA 4G86A 4C4PA 2PV0A 2QW1A 5I7EA 3KUXA 2RHCA 4QJBA 3QI7A 1ISSA 1W48A 2NU9A 3ZEAA 3U7FB 2OSVA 1N2SA 3QXHA 3NXKA 2HBRA 3X3HA 3HVIA 1Z6YA 2WJZB 2F48A 1E6LA 1I3OA 1USKA 3MTBA 1WCYA 4YJKA 4R81A 4EB6A 2D5AA 1CR4A 1Q0RA 2ZUUA 4O1IA 3I52A 4HWTA 4WBNA 2BGUA 3UW3A 3OPMA 1AUQA 2Q1YA 4A8TA 2XCOA 1Z5NA 4KE8A 3IVMA 4ZU3A 4TXJA 3PX7A 5EJ8A 1B0AA 2W6JD 2LRHA 2ORVA 4FE3A 3AUKA 3JALB 3D5TA 5JISA 5AFSA 2FR0A 1QMGA 2H4FA 2VYNA 2WSMA 3O2JA 4IP0A 4L7QA 4FBGA 4E4YA 3J81A 2GGSA 2PRJA 2WD8A 3R5JA 4FYWA 5A3RA 1JIKA 2H2AA 4I4NA 2PQ6A 1TW2A 4CIYA 1EK5A 3HCAA 1TRKA 4HMQA 3U44A 4LMBA 4HAWA 4P1ZA 3NDRA 4M54A 2IUEA 4U8HA 2DQZA 3ME5A 4RFLA 2MCFA 4GP9A 1O9GA 2KS6A 3D6JA 4OMFG 3RHZA 3PC4A 4DLAA 3MS7A 3OM9A 5IBCA 1M74A 3MCAA 5EI5A 3KL2A 2GPSA 2RONA 4INZA 4QWMA 1X7WA 3KOMA 2BPOA 3A1UA 3OM1A 4P36A 5F78A 5EJ5A 1S9HA 4S12A 4I4TA 3UBTA 3RS5A 3WGGA 2BELA 4R1MA 1SELA 4TQGA 2HFJA 1BYIA 4N7JA 1L1QA 2MYUA 4N3CA 2PYDA 3HL4A 3MFYA 3BXOA 3QK7A 2J4CA 2B2CA 4JBLA 4ENUA 2VJAA 3MM4A 4FHDA 5B7QA 1XR3A 3DUFA 1XTRA 4W6QA 3EZFA 3OZGA 2W2LD 1GIAA 3OX2A 5C31A 1D0SA 3RC1A 3VU1A 4PG8A 4Y6RA 5BSFA 1DWOA 1X8LA 1HDIA 4HNAA 1P91A 2VSXA 2AG1A 3TQCA 4NZYA 1C7RA 3AHCA 4NBVA 1LA2A 2VJPA 4GWLA 3T15A 3AM3A 5B6PA 2VP3A 5LD2C 1B8UA 4HEA6 4UJ5A 2YQ4A 3ZWXA 4NJEB 3AR7A 4K7JA 3AKDA 2C96A 5JBQA 5FWXA 3JQEA 1F0YA 4P83A 3S29A 5CW1A 5L3QA 1QIFA 2IZ1A 4KNWA 1YJXA 3DVQX 2XDQB 1CDOA 3HPRA 4GKBA 1C4KA 1PFYA 3IOCA 2DKFA 3N8IA 4Z4CA 3RRNA 3IB6A 3R5XA 2QV7A 4AF6A 1FIUA 2ACEA 3H1PA 4BMPB 3RK4A 2WP0A 3OE4A 1W4BA 4EVQA 3RT7A 4KFSA 4M21A 4M9QA 5LUAA 1THTA 3RSCA 1G20E 3N70A 4K9DA 3TGWA 3L6EA 5ALIA 2JFNA 3MELA 3EGVA 3VZQA 3RUDA 4D9NA 3I64A 3NCHA 4UTNA 2H0RA 2NX2A 2WLTA 2XR1A 3DZDA 2QTMA 1A88A 4UQLA 2R7MA 2V7WA 3U1BA 2WU1A 4JI7B 2AE1A 2G17A 4E30A 6LDHA 3JVVA 3BWBA 3NIWA 5LOVA 1GM5A 4W5TA 5IAKA 5DN6A 4BWGA 5F7XA 3PHBE 4EJSB 1FMFA 2X0EA 1ADBA 1N2XA 2PUTA 2ZRJA 3NVDA 4EW6A 2PSDA 5L45A 1H2RS 4IHKA 3F4LA 2PEZA 2VJYA 3D6FA 3D43A 3T7IA 4LHZA 3WNQA 1T35A 2P4QA 5EXTA 2DWPA 3V33A 3GLIA 2MYPA 3WISA 3WIVA 5FOWA 1XJ0A 1YR1A 2YUIA 3LYUA 1UJ2A 4IILA 5SY4A 4B45A 2EWVA 4MW7A 3RGWS 2UUCB 1UPUA 5JBNA 4QUDA 4A0QA 3ADPA 3KPWA 1B73A 5ERGB 2ZBGA 2ZIUB 2A9PA 2W4IA 1T5DX 4R1UA 5IH7A 1J9GA 1S0UA 1YKGA 2JCYA 1EG7A 3SX2A 4BEJA 2FKNA 3B6JA 1AGXA 2B1IA 2XTMA 4MV5A 1E2NA 1ODLA 2Q5EA 3NT5A 2QY9A 4RNCA 2NNWB 1THMA 3DAPA 4KODA 1Q16A 1FRFS 3GD5A 3ZLUA 3WDMA 4UPEA 3VR5H 5FR1A 3W2EA 3FVWA 1UZNA 2WWWA 3PGLA 1Z75A 1FB5A 4NY1A 3PFNA 4KVAA 1EUZA 2H7YA 3SVLA 4JI2B 1JLLB 2CK3D 3T99A 5LQSA 4PC3A 1E2FA 2OLKA 2F8SA 2JAPA 3BZBA 3PVCA 4C3UA 4OHPA 1GGVA 2QA5A 1VOTA 3P9CA 3IBFA 3AIKA 5JXIA 1NXXA 3CN7A 1GA1A 4OUKX 1F14A 4AMBA 2GWRA 5C3MA 2AHRA 2FPOA 3O2NA 3IIJA 3G1WA 4PLTA 4BV3A 3AXTA 2WJYA 9LDTA 3Q40A 2WTEA 2X5NA 1YU6A 4QDOA 3K9BA 3HJHA 3WO0A 2R0QC 1HY3A 2HA6A 1FEZA 4OHRA 5A4KA 1GV0A 1IIRA 3RI3A 3DFKA 4LXXA 3ASYA 5A9TA 3EXHC 4E12A 2J41A 1EFDN 4KGZA 1AF7A 4FMCF 4M8IA 2CDRA 2C7QA 3TX6A 1XMOB 4BBAA 1P4SA 1T6YA 2O06A 4MQUA 6ABPA 3E70C 4IWXA 2X3YA 3KM0A 2XE6A 1NMEA 1CCWA 1X42A 3DZFA 2HGSA 1DQZA 2WD7A 3L7KA 4TKMA 5DNAA 1AS0A 1Z0ZA 3A1CA 3JTMA 1JHAA 4H0NA 5FI0B 3SJCA 1L8XA 3KZNA 2C8VA 3FYUA 3IBSA 4HDSB 4DIBA 2ZRNA 5HMMA 3W1EA 2V97A 1MG0A 1U1DA 4Z6KA 4JODA 3DAHA 2ZTHA 3K0AA 5LZ7A 4KXFB 2HDNB 1ARZA 1ONSA 3P8ZA 3DMFA 4US2R 3BK1A 2JGNA 1TKRA 1H94A 4XR9A 2QSUA 2RHRA 2VJOA 4MQFA 3SJBA 4OI0A 1ZOPA 1CJUC 1M72A 3V4SA 3V1MA 1ESCA 1UJCA 2C88A 4KI0A 3SQLA 1YQQA 2AMVA 3KHKA 1VPEA 1S3GA 4BMSA 3G6WA 1BEUB 1VCIA 3HKDB 3IAM1 4XCQA 4FQ8A 3C8HA 5JQWA 1GA4A 2HGZA 1QGUA 2O2SA 4DGQA 1FW6A 5B1DA 2DB3A 5TLSA 1SC3A 4X97A 1WBDA 4HRVA 4ISCA 1JBEA 2Z3WA 5F1KA 5DHTA 3UGTA 2X22A 3VU8A 4Q7QA 2X4IA 4WKCA 2V45A 2EP8A 3WKAA 4B6GA 4DXDA 5HJ7A 1N8KA 4HNGA 3RRXA 1ZVQA 3HGQA 4YRKA 5CB4B 3B70A 1KI3A 4C22A 3AUAA 3ZKAA 2LR0A 2HR1A 4X1IA 1UBRS 3LTEA 2DPGA 3S68A 4FILA 4OSEA 4BMZA 4D1YA 1VKJA 1PL0A 3FRHA 1S8FA 2CVHA 5BQ5A 5TS3A 3B7GA 2OECA 4L4ZA 1YRWA 2ES4A 4XFJA 3S2GA 2I1VB 5MGNA 1VDMA 1G38A 3DOEA 2B4TO 4R1SA 3QWIA 3KTDA 5DCWA 2ZPTX 2ZQ5A 4ZALA 1QQAA 3EULA 1Y8CA 1V6SA 5JPDA 1J00A 3MB5A 1UWLA 1GDDA 3FKSA 1HFJA 3C3CA 5TQJA 2R8XA 2RHHA 4D4LA 2LDBA 3PDIB 4EJ2A 2ZPAA 1YIAA 5JROA 4Q4DA 3IQFA 3HYSA 2QX8A 4YRDA 4RFVA 3CV3A 2ZAYA 4HAOA 4C2TA 1MA0A 1OA1A 2N1BA 3OEHD 3GN1A 4JKIA 5EMJA 3G9XA 1XMIA 2DLDA 1PU2A 3GRAA 3QELA 2IOFA 4RF2A 1KJ8A 3JD1A 1C50A 3EN0A 3VTFA 2BHTA 1GU1A 2QL9A 4IJ6A 1VKRA 3MGGA 3OLQA 2NG1A 1G5FA 2I6UA 4BKQA 1YI0A 1ZH8A 1JAIA 1CXZA 3ONFA 1MH1A 3F4KA 5AW5A 2B9VA 2I54A 3AVYA 5DV9A 4ZO6A 4EFKA 1VE1A 3RYCB 1RYDA 3MLBA 1T8RA 5JCPA 1EDEA 1EZ1A 3C1OA 5F52A 2CDAA 1PV4A 1ORRA 4X3OA 5I7HA 2FZKA 4ZO9A 3VHRA 2GRAA 4KX3A 2R6CA 3DS8A 3X1WA 1CDDA 3QQPA 1Z6QA 1S2MA 4MV8A 4WLEA 4RU1A 1JDSA 1LQ2A 2J3MA 1F3OA 2ZZKA 3FJOA 3M9XA 3NHMA 1X77A 4XYGA 2IEZA 3T3OA 3THWA 4ARSA 4HGOA 4Y1RA 1RJEA 1XP8A 1CY4A 3HBFA 4Q01A 3SXPA 4MUKA 1SXGA 3BEOA 4G5SA 2HYDA 4AMGA 1I94B 1U6JA 1ACJA 1P3Y1 2DCMA 5CB6A 2M2IA 5CB4A 5H9VA 3FMVA 1P17A 3ICOA 1ZK4A 1W1WA 3T1TA 3P32A 3VGJA 1PCXA 1W5TA 2HOQA 1VBNA 3MOIA 3U39A 4BQEA 2NTVA 5CFPA 2XKKA 3SQMA 4H7HA 5EESA 2A9QA 2XQFA 2C7RA 3R0VA 4JEMA 2G1PA 2J33A 1FFXB 1XI2A 3DTTA 4PRKA 2XECA 3R5TA 1CUXA 3V2GA 3NETA 2P5TB 2NO7A 4R2WA 4EHAA 5AHXA 5HTKA 1V47A 1SB8A 2C99A 2J5BA 3EGEA 2JDID 3GLRA 3ND8A 4ZMSA 1XEFA 2GWHA 3GFPA 4J9UE 5K0LA 3ROPA 3CH6A 2BD0A 3FX2A 1DEOA 3KZ1E 3QUSA 5CG2A 5I7FA 5FJIA 2XA9A 3FTNA 3UY4A 1G18A 4AJKA 5KNBH 3FBGA 4Q5IA 2HPVA 2RGCA 4Q9DA 5GWXA 4PNZA 5TT0A 4DLVA 1VG1A 5E1OA 1YA6A 3MN1A 3MWKA 5L4SA 3R41A 1BN6A 2WQ6A 3AX6A 2OZLB 4COKA 4L50A 2VLIA 3NEYA 5HM8A 2G40A 4Q34A 1PR3A 1W8DA 4LEIA 1LF5A 2G76A 3AFOA 3F8TA 4CEHB 4KO1S 1K68A 4WT7A 4EG5A 1E3TA 1RI2A 4ACAA 3ICPA 2YXDA 3W6UA 3OOSA 1EE2A 4QBFA 1A96A 4OYYA 1DAKA 4AO8A 4P4NA 1VMAA 1XZAA 3KAJA 3K9WA 5AI5A 5G0VA 4F46A 1K7FB 2FPGA 4X93A 3GOHA 3T54A 3W90A 1L1EA 4NDZA 1ZEJA 3I61A 2QSJA 2BAGA 5J9FA 2P9YA 3QV1A 5F51A 3S2UA 3L07A 1XOIA 4D82A 4CG3A 3KKLA 1WIWA 1T1GA 1ETHA 3C41J 3W2TA 3ENQA 5I8PA 3MJFA 1FS4A 4CFYA 4NU6A 5AW4A 4RVSA 4WFKA 1TFRA 1GA6A 2FQ1A 3WQBA 1DQRA 4BP1A 2WMOB 4ER7A 4BNTA 1EPUA 1E9SA 3K1ZA 3NUQA 4HLQB 1NVXQ 5CNIA 3ZK9A 2YICA 4EJSC 4Z3KA 4NRDA 1RMYA 3NYIA 3LQYA 4FUQA 3A1WA 4TLLB 1UR5A 3IBTA 1QRAA 2F8LA 4NBKA 4LDRA 4EB6B 2DERA 2PA3A 4LA4A 4E5YA 3OI7A 3OSUA 1BQEA 4FNAA 4IZ6A 4U5XA 4Y9UA 5A6SB 4R5MA 4WNAA 1RABA 3MUEA 1NP3A 4FEEA 3V46A 5AW3A 1EP2B 1KSHA 2I7TA 3GLGA 1O96A 2J31A 3N8KA 3LH5A 4YCLA 2MU1A 4G5RA 4ZCPA 3S6JA 3VAAA 3AM5A 4J90A 4YP9A 5BRAA 3NDJA 4ML3A 2BI4A 4RSGA 2P3OA 2PNJA 5FOQA 1CS0A 3EF3A 3ADDA 2GBPA 3GZ4A 1SKMA 2DG2A 2QN8A 1QO9A 3EIUA 2AEJA 5KDOA 2OFPA 3CJTA 3HG7A 1T36B 4O4IA 1E2HA 1HT1E 2OA0A 4BNHA 2BEUA 3WZLA 3E7PA 2CYBA 2H1OA 2BE7A 5KVAA 2ORYA 3OF2A 5LWHA 2I3AA 4N0PA 2OQRA 2WICA 1CUAA 1EGMB 1GADO 1J4AA 2H0AA 2XXJA 4L8LA 4FONA 4HDCA 4QQNA 3UOGA 3BAZA 3VPHA 1NBHA 1M2OA 4NATA 5B3LA 3EW9A 3H9GA 2ICAA 1VG9B 2W48A 4ALJA 1OXMA 1NHWA 3K70B 1JLRA 2GPBA 4GX1A 2BI7A 1PQUA 4NESA 2I4LA 4KMSA 1RBQA 3GGSA 3PRKE 4UBMA 4PM4A 1UEXC 3L7LA 1C9JA 4GX0A 4JP2A 4O59O 4TM7A 4AKIA 1NQUA 1EE9A 1T34A 2IODA 1M1ZA 3I2GA 1Z5UA 4ZVQA 4FNMA 5D6NA 1EK0A 1CQXA 3IB3A 5F7OA 4Y0NA 4BFYA 2ZSFA 3FR8A 4X92A 1PGJA 5F2NA 1OX6A 2Q29A 3Q6MA 3E9CA 4YWHA 4A8JB 1SVUA 2H1SA 1ENOA 2BTQA 3KBOA 4L27A 1GWNA 4WBSA 4HB4A 4M22A 4EHFA 2EAUA 2JFQA 1IZ0A 2VOEA 3CRNA 3MZ0A 4QDTA 3LDFA 3FNFA 1QIKA 1RMTA 1ECCA 3AZOA 3ROFA 4P0QB 1NPDA 1IY9A 2P3LA 4IH4A 3QYFA 1RXSA 4MAAA 2C4MA 5BSRA 2GA9A 4ZDWA 3R7FA 1PL7A 3AGQA 1XRNA 4L8FA 1MXFA 4YT2A 4DDMA 2JD0A 2GTHA 1YCHA 4YRJA 2XDYA 3KJFA 2B1RA 5KTPA 5IULC 1SVSA 4D96A 2OE2A 5CITA 1FNDA 2RK6A 3O8CA 1XZLA 1E3EA 3ONNA 3AP1A 1YJQA 2P9CA 3E48A 2ZQZA 4UVGA 2W7TA 3BORA 3HADA 3NT4A 1BXGA 1I0IA 2MHCA 3FDXA 3ONEA 4GI5A 1K5DA 3WMFA 1Q0UA 2JHFA 4J16C 3B6IA 3VI3B 1TPYA 3OZUA 4DJDC 4QOGA 1ZD3A 3MTQA 3V80A 7YASA 4K05A 3IIMA 2VP0A 4R68A 1TMKA 5DSZA 5TX7A 4E5KA 3QEAZ 4ND7A 3CF0A 4XM2A 1QGED 3EBPA 4JU9A 1NR7A 3BL5A 4Q3KA 5EXEA 2BHSA 2Z4TA 1H42A 1UKBA 3F9RA 3H97A 2EJTA 2WZCA 3MQFA 1E6MA 4JV5B 3QLVA 5MGBA 2OV2A 3PD1A 4O4HB 4RXMA 3UV6A 3WYEA 4H7DA 1R0YA 1YS4A 1NP6A 2WE8A 3ZC3A 1L5MA 2PD4A 1XRLA 1KDYA 2UU9B 2D1YA 3L01A 4A8JA 3SWWA 1XJQA 1IHDA 2EP5A 3WADA 1LTHR 2QG6A 1P31A 2QE7D 3AR8A 3PTAA 3OP4A 3P2EA 3GFBA 1Q7GA 4LXYA 2A14A 4G09A 2GF2A 1JAXA 1WXGA 4LYHA 4XIGS 1F2UA 5GY7A 1LB1B 3LC1O 4G3XA 2O3RA 1NXTA 2XMBA 2YBDA 1NC3A 2PGJA 5AJTA 4NFHA 3ACCA 3D4LA 3U37A 1ATIA 5EOVA 1GTSA 3HXPA 3KVVA 1NRIA 1T43A 4H77A 2PK3A 4QSMA 1K7CA 3WB1A 3U81A 3HCOA 2D2VA 1COZA 4OM7A 3HVUA 1XLUA 3G8AA 3P2KA 1NI5A 3TMYA 1YB1A 4NZMA 3HU2A 1VPLA 2P6PA 1HOTA 1TM7E 2JRLA 4PBRA 4Q48A 3SHFA 3E1GA 3PWTA 4WCDA 1QE3A 3GEMA 3VHXA 3WV4A 3TJRA 5F21A 1TCUA 2GOYA 2D4AA 3DWFA 2IOYA 2PT6A 4LYFA 3T38A 1BJKA 2D3WA 2JLSA 3DO8A 5HZKA 1HG0A 2LD4A 3UKJA 1O0SA 3SZRA 1BGWA 2JFOA 3UAOA 5L3SB 4O4IB 2NXWA 2WF6A 4EG6A 1Y9JA 4QGFA 1GCOA 1GQQA 4DM4A 3U56A 2P30A 1CLUA 3JVUA 5C7OO 3RJ5A 4WEOA 2Y0CA 2Y0PA 4DPMA 2JATA 4P34A 5BUCA 1NQTA 4TRNA 3AVXA 1YT5A 1TJ5A 2RJOA 3CKLA 1OFIA 4DLUA 5HS4A 1N3LA 4XGIA 3UPTA 1SQFA 3SEFA 5FUQA 4B8ZA 3GF4A 1O96B 4UEOA 2WWGA 4QVIA 1ORIA 3TS1A 2VNSA 3SPXA 1T4CA 5E2AA 4CF4A 5BSVA 1YBVA 3O0DA 1F6DA 4E3WA 3DR3A 4X6UA 4EUNA 5IT0A 2ECQA 2R85A 1O58A 2DLNA 5TARA 2G9UA 3MG9A 3OU7A 3KLBA 2HNKA 1SG0A 3A06A 2X13A 4Q66C 3KFVA 4P32A 2RHOA 3AHIA 4DZTA 5EHZA 2FUEA 3D2BA 3HU3A 3JATB 3V8NA 2HWKA 4N3BA 2O48X 1QVWA 1Q0ZA 4BNDB 2YV4A 2H1HA 5IXSA 2LVBA 3OU6A 4X84A 3LCVB 1P62B 1VMEA 3GT7A 2ZWVA 1R50A 3L06A 1T2EA 3RUAA 1ST3A 1QLJA 2TMYA 1PDVA 4H60A 3R7DA 1CU1A 1UDRA 2R62A 4KXNA 5TF0A 1JILA 3UJCA 5E6SB 5C8VA 2VCHA 4TWJA 3AIIA 1MW8X 2GK7A 4EPWA 1UXIA 1EINA 3R3WA 5CD1A 1V1MA 1PQWA 2VZ9A 1Z0KA 3GA0A 1RP1A 4FYPA 2NACA 4V0RA 5EZSA 3HP4A 3TZHA 1I6KA 3DF9A 1DQPA 1E2KA 3PWKA 5CX4A 3K7EA 1G21E 1CD5A 4ID9A 3I6IA 2BHRA 3OUUA 3CZCA 3OY7A 3QLUA 4OI4A 1P5HA 4PPFA 1LDGA 1COWA 1P2VA 4Q21A 1DXHA 1FUUA 1TEVA 3BWYA 3I72A 2YHUA 3MJEA 4RMIA 3PEVA 5JSKA 3ZY2A 1RRFA 2F55A 5K51A 3M0EA 2VRBA 1CR2A 3PZBA 2PO5A 3W8NA 5A4JA 1MAAA 2H7VA 3WLSA 1SD5A 2XQVA 3TLMA 5U1PA 4BZXA 1A9YA 1A04A 4OU4A 2ENUA 3GHHA 1KXZA 1CRLA 2ECKA 1XD2A 5AK0A 2IE8A 1B4DA 4HLNA 1LEHA 2J4DA 4DR5B 1NVFA 1QQ7A 2W9XA 3LQRA 2HRRA 1B8NA 4LUCA 4EHHA 1WWKA 5CVUA 4CMEC 1B8VA 1U8CB 3UJPA 2F90A 2B1GA 2JGIA 1KY2A 3PU6A 4IVQA 4DSAA 5LD2B 5B4TA 3FHCB 5FAKA 1RTTA 2B2NA 3KELA 1T26A 1JLSA 4DT1A 3IULA 4M8SA 3PUHA 4A73A 2GR9A 3OZTA 1NQAO 1GNVA 3IODA 1W46A 4K9OA 4NJMA 5EIXA 3ZX5A 1K6EA 2WJIA 2ZR9A 3GJQA 1GRVA 2ACKA 3NDPA 5REQB 4D4IA 1X7DA 4X1YB 2GHIA 3GPBA 1SEPA 2QAGA 1UPXA 2I6FA 4HX9A 1ZY2A 4RH1A 4Y6LA 1YR2A 2AL7A 1GTJ1 1UXHA 4HWPA 5MDHA 1DNPA 1ULUA 2QENA 4LJLA 3SZLA 5JC8A 2W2NA 3L5KA 1ZD2P 5JANA 5DULA 1W2HA 5EA2A 4LV5B 2I65A 2IZ0A 4M76B 1NL3A 1Y9DA 4QU5A 1VLLA 5KO2A 2OM6A 4H17A 4N0MA 4URZR 3QXXA 1ID1A 2H08A 1RLUA 1VJCA 1ZKMA 2JEYA 2PR7A 3EDOA 1ZC3A 3TQTA 2FFAA 4IHJF 3VV2A 4AIIA 4D9FA 1EFAA 2YHBA 1HZZC 3EGXB 2I29A 3D6UA 4KITB 1FL9A 5HF8A 2G8LA 4PCAA 4OB8A 1KOGA 2QTVA 3VU9B 1Y6ZA 3N6RA 5KJCA 2C8KA 5CYGA 2LTAA 3THXA 1L8QA 1PJQA 2BBTA 2GMWA 2JLBA 3A0RB 3AI3A 3OMWA 3WGHA 4B35A 1PNVA 2PKQP 3BE5A 1GRRA 1N2ZA 2GARA 2Q5FA 1ZICA 4BLOA 5LXTF 3A3NA 1YFZA 1ZOOA 4U7DA 4MCIA 5IJWA 1VHLA 2FPLA 4PIMA 1AURA 2DCUA 1L9KA 1SQ6A 3EWNA 4I14A 3TINA 4E14A 5K0EA 4IFTA 3RW9A 4N1AA 1FDTA 2QTTA 2ZANA 3QOWA 4QUEA 3EPHA 1GNTA 2IYSA 3PHHA 5JNLA 1QFSA 1U2ZA 1XAIA 5H1YA 4GMFA 1N5RA 2JHGA 1P1JA 2HSJA 2QD1A 2PLNA 3I2YX 3NTOA 4OHOA 4WLFA 2ZIFA 4B74A 1WXIA 3BQNB 1WZIA 1C4WA 5CVEA 3TW0A 1HT0A 3ELDA 2PR2A 3A37A 1LJLA 2YFQA 3GX1A 3KB8A 2H17A 3SZGA 4E4TA 3QUTA 3S81A 4JSTA 1DO2A 4B9AA 4JUAA 1PT7A 3GJ6A 3VO2A 3CLVA 4QULA 4R0VA 3VPXA 3CPHA 5KVSA 3INRA 2WSLA 1S89A 3HA7A 2FG5A 4MXDA 1JJ7A 1XDZA 2NUBA 3DDZX 4JA0A 4YWJA 1WQ3A 5REQA 1LX7A 1AO3A 3PUKA 2AN5A 2PSFA 2VF4X 3B1ZA 3CLRD 3WA7A 4NMWA 3Q6IA 4W5HA 2R6GA 4YHBA 4V2IA 1X7ZA 2OHIA 5EXDA 3ZOZA 4DR7B 4FGZA 3TTYA 1IHPA 4F5ZA 4IJ5A 1NQVA 1OT5A 2ZR8A 1Y3BE 3B5EA 1XHLA 2H7CA 4WBXC 2Q27A 1DCFA 1GPMA 2UZAA 1P74A 3OLZA 1C9NA 1RBMA 2DLCX 4U02A 1K6XA 1SC6A 4MJLA 3PLAE 2IXEA 1RXUA 4BO7A 2BEWA 1NI4B 2PTGA 4CMEA 3AGPA 5J2UB 1DHRA 4ZJZA 2JC3A 3L82B 1DQYA 1P5ZB 3FBWA 3AEUB 3G1UA 5EJ2A 4WZBE 2DBQA 2DP4E 3KD3A 2X9NA 3ECAA 4KDCA 3G1TA 1OGYA 3GZJA 3TUZC 2XUQA 1QO7A 5LNK1 1XTPA 1XDSA 2WZBA 3KPJA 4DG8A 2Z8XA 3B38A 2BJWA 3D0QA 4R6WA 3VC7A 1RXIA 2O3SA 4EI2A 3F8SA 3PKZA 5EHIA 5DNDA 4OATA 2FI1A 1YASA 1YJCA 1J8DA 5KPDA 5E8JA 1OWLA 5IT5A 1NW4A 4UM9B 3CH5A 4JBIA 4BVHA 2Q2WA 1OF1A 3FB4A 4HDOB 4BQIA 4TT3A 1T0JB 3PQ3A 5CLLA 5AUQA 3RWMB 4N39A 4B84A 1HMYA 1RJDA 1ZK2A 3TIVA 3MILA 3HL0A 5J2TF 2GHQA 1TZJA 2PH3A 3GFRA 4MR7A 4KOAA 3VDNB 1FU7A 1BHJA 1T6XA 3QENA 1OBOA 4G9GA 4UBJA 4A2CA 1QGAA 4LZJA 4ZQHA 2BGJA 3KCNA 5COAA 3TKYA 2E89A 2QX4A 1I1QB 3ZGNA 4POOA 5BP7A 3DA8A 1U81A 5GJCA 5IFKA 3IXLA 2JS7A 1TUGA 2UYCA 3KXIA 2V96A 3UNXA 2RD2A 2XUGA 4CMGA 3C45A 4P31A 2AOTB 2B61A 3K0BA 2JGDB 3D7LA 5B1EA 5BW8A 3I6MA 3MW8A 3LI2A 4HWSA 1DBVO 5KNBA 4LZWA 1KDOA 2X9GA 5CBPA 4DF3A 2AOUA 3OHMA 1F9AA 3VHLB 3AOEA 1I9GA 3IO3A 3TIFA 1QTQA 4Z54A 2RE8A 3A11A 1Q1NA 2C0CA 4O4LF 4UEJA 3GRPA 4F3CA 1IHXA 1QG2A 1ZA2A 2J46A 2OBLA 2OBMA 2ZREA 3I37X 4C0KA 3CSSA 4Q18A 5CM2Z 4ESHA 5K8JB 2JEZA 2Y8EA 2CHFA 3DFFA 1V39A 4GPIB 5AK4A 4O2LA 2VBIA 4AI6A 1JR3A 1QS0A 4BBJA 4U9HS 3RG2A 4I8DA 2BMEA 3VISA 5FBWB 2GFHA 1YGPA 2FEOA 2GXSA 3LSTA 1UJMA 5HCNA 2PZBA 4N8EA 1GGKA 3DPSA 5DYYA 1KBOA 1WBJB 3PYLA 1C3XA 2I03A 1HQDA 1IPHA 2BMWA 4MMYB 3NWJA 4UD2A 5KSYA 4RESA 1HDRA 1R0CA 1F8FA 1VRCA 1WM1A 2GCGA 5IF3A 2AX4A 4QATA 4MQEB 5ELMA 2VK2A 1UL1X 2YFHA 2HB6A 3JQ9A 3CFYA 3QIVA 1G59A 4ID3A 3NDIA 4I99A 5DNUA 3GFOA 4CF3A 5K6AA 3Q7PA 1E9BA 1N6NA 2DE0X 2QAJA 1K63A 3PKJA 1RTKA 1HDXA 5GZ3A 1OYVA 3W4JA 4IRUB 4EJSA 2CXQA 4OYRA 3NU1A 4GXTA 5BYBA 1BC5A 1QPBA 1Q21A 4GWGA 3S27A 2A0FA 3VYTB 4Z99A 4B4UA 4FMDB 1C0LA 2GEDA 1KQNA 3F5MA 2VS1A 2ZR0A 4DDWA 2UVQA 1N75A 2MMCA 4IRMA 1DC6A 2H92A 2IC5A 1XTIA 4N5DA 4WECA 1PRYA 2WKSA 3GFFA 3FWZA 1RPNA 5D87A 5JOQA 4R4JA 4U6NA 1N3IA 3MT7A 1X7GA 4I2VA 4P38A 5ERYA 4BMXA 2GUGA 3DE0X 3T3NA 2J7PA 3ZBPA 5AXCA 3NGXA 2O52A 1T1IA 4FDUA 4ZZ1A 1ZXLA 1AGPA 5JR3A 2JBHA 3CA8A 3PBKA 4LF5B 1TI7A 3FOCA 1LC3A 2ZSIA 4RCZA 4WESB 3E9DA 1NUAA 2NU7A 4LWZA 3DDHA 3TW8A 4RE6A 4N40A 3B9RA 1KC3A 3K92A 5AVWA 2H5JA 1GFZA 1XZQA 3HBJA 1DG3A 3K0CA 4LVUA 1PNOA 3NHJA 1W1IA 3MIIA 1GITA 2FN9A 2XWJI 3Q15C 3C5WP 3I04M 3RHFA 2RGDA 2RAUA 4YMLA 4JVMA 4L51A 3LBNA 4I55B 3TQQA 1NWCA 3BBPA 3DYIA 1KZ9A 5B1SA 2ZSEA 4J4HA 1JPUA 3A6PC 3D4BA 1KMIY 2R96A 3HB4X 2IYVA 4NU0A 2F7SA 2ENWA 4YRGA 4N41A 2EEPA 2P79A 1OLUB 2AG5A 4OHBA 3T9AA 1IHUA 3WSWA 1NTRA 3KB6A 4GQIA 4CMAA 3S8EA 4QOFA 5ESXA 3RRJA 1T1RA 4DMLA 4N3NA 3ENWA 3EEBA 1QP8A 4FPXA 1O08A 2QTCA 3OFVA 1PR2A 3IEKA 2W98A 3K35A 4HHEA 4KO3S 2HM7A 2CYAA 2NPIA 4GEKA 4I0WB 1N4AA 2VKTA 4CTJA 3LVQE 4E4RA 1T4MA 2YJ5A 1JFFB 1GQRA 1HE2A 5CX1B 1Q1BA 4M0DA 1RACA 3PNKA 1BU8A 1CY0A 4YP0A 3BTVA 3B7PA 3CLRC 2TMKA 3R3XA 4FCWA 2AB0A 4EPYA 1NKSA 4FM9A 4WV3A 1L4GA 3U4QB 4EENA 1U4OA 2ZJOA 2AFHA 2FW9A 1QYVA 1G3IA 4MVJG 3OJXA 3NPAA 5BORA 5GINE 3L1HA 1PWZA 2EF1A 1QDEA 3K15A 4FC7A 1WDMA 1LSUA 2VDKB 1W76A 1VL5A 4O2AA 1VHTA 2DMRA 4JJFA 3TXXA 1JDVA 2WWHA 3PC3A 2JLCA 2IYRA 3NRBA 4UMVA 3JVEA 5T67A 4EB3A 3HYLA 1CLEA 4Z7NB 5B6JA 1UJNA 3LUBA 5D51S 3KOYA 1HTBA 4NLLA 1RQ7A 4ZCLA 4A6XA 3E7XA 1E98A 4XWGA 4JGGA 3V1NA 1OC2A 2V3VA 2A57A 2OOSA 5JDCA 2XOEA 4P3PA 2PG3A 2X7XA 5FKJA 3TLBA 3WTBA 1BWQA 1DKNA 4K5QA 5GVRA 4X7RA 1TM2A 5CEEA 5JAIA 1PZHA 4D79A 3D0RA 4JYMA 2ZSAA 1GTRA 2AJBA 4TSRA 2ODQA 1Z7GA 3G7SA 1A1VA 3ZGOA 3OEYA 4RDCA 3B7WA 5HFJA 1KARA 3FPLA 1DX6A 3SC2A 3ZWMA 4EFLA 3L6RA 3ITNA 3GG2A 3LQ1A 2QXUA 3TRFA 3LOUA 4IXWA 1A2KC 1QRDA 5LNK6 4KBFA 2O5CA 3W2FA 4YDHB 4Y2SA 1GZSA 5INTA 1QS0B 3WYCA 3K5IA 1QR2A 1AKNA 1OAOC 4FDAA 4TM8A 2YIJA 5CYOA 2O54A 3GJ0A 1U1CA 4E15A 5CGZA 2BFDB 1SOMA 4A0FA 4D4MA 2Q1WA 3I83A 3T5AA 3HU5A 1P2DA 2PWPA 5B3KA 5B1YA 1SU8A 1U4NA 2JCGA 2YZNA 3U61B 4Z1MD 1S96A 5IZCC 5CBKA 5C46F 2IYTA 2YYSA 4GC5A 4R54A 5JAPA 1EU1A 2AMYA 2AV6A 1XE3A 1Z8FA 2E4VA 3EWAA 1ZM4A 5AJUA 5UKDA 3TPFA 1SOAA 1US8A 3DE4X 3VPBA 4D26A 2BFNA 3I53A 3VVBA 4FKZA 3HFGA 2G88A 3R8XA 1GUZA 1N2JA 2RC6A 5AQEA 1E7SA 3AJAA 1E32A 1WNTA 1YGYA 4WDRA 4F0JA 2FZWA 2P78A 2R6DA 5F2OA 1JECA 5DI3A 2JKZA 2FPIA 5ISMA 4M9SA 3C85A 3AHGA 1DX9A 1H2HA 2WSSD 4IJUA 4LFAB 2Z8ZA 2ZSJA 3DM5A 1KOFA 3QEOA 5K0SA 5AJVB 4JT9A 4OK5A 1M76A 1W36D 4LF4B 3JR3A 4IF4A 2BGNA 2GZSA 3N8DA 2VCEA 3MSXA 3BL6A 4LHYA 3ZNPA 2HQ1A 1MGPA 2H1CA 2RGUA 1EHIA 4N9WA 4EYOA 2M6KA 2HIMA 2J9ZB 1JEOA 5AM4A 1DFGA 2HF9A 1T3GA 2AK2A 5JMTA 1UMCB 1RD4A 2EIXA 2ZIZA 5B55A 1P3DA 2VPWA 4Y3UA 3AEUA 2GPAA 3G13A 1TDJA 1VJ1A 3T1YB 5E7IA 3L1KA 1SGWA 3O83A 2VF7A 5IJXA 1UEIA 1K7YA 2DBRA 2H5EA 3BICA 3D2AA 4WQMA 4DMCA 2WM3A 2HC9A 3GUVA 4YV0A 2OAQ1 1KK0A 2PQ2A 3P9NA 4UNRA 3ROEA 2I87A 2RKBA 1A9XA 4FOOA 2PN1A 3HNPA 2IUYA 4RLHA 1CK4A 2O8CB 4UTRA 4LOLA 1FP7A 1NBOA 1CF4A 3UC9A 1M6NA 2C77A 1FFXA 1N8NA 4AJIA 5AVYA 3EA0A 4R1LA 5IM4A 4AY2A 3H3XA 3L1UA 2PXHA 3WL3A 4EJ6A 1KOJA 1NW9B 1QH1B 5JXHA 1NUSA 4CG0A 2RC5A 2Z5FA 2CVFA 5KMGB 1JWAB 5GVSA 3VOBA 1V11A 5J4LA 1NFFA 2Z8YM 4TLCA 1SCBA 3B1FA 1U3WA 5FBZA 4BJHB 3ZN2A 2BEWB 4ME6A 3KQNA 3NORA 3K0HA 2A9OA 3L7YA 1UKCA 3RODA 1T9DA 5GAJA 5LFAA 3NVKI 1JHPA 1AB6A 4QDZA 3L02A 4BJ5A 2PQ0A 1QNFA 2YV1A 3L18A 4XVRA 3SJAA 4D9HA 3HJBA 2FP4B 3AONB 4P5DA 3VR4A 4OXKA 2J5QA 3OPXA 1JMYA 2ZRLA 4B46A 2WA1A 4NYIQ 1W5BA 4FCCA 4BO2A 1SC1A 3M6FA 3REGA 2XYRA 4NICA 3V5NA 3HHPA 2GI4A 4OHZA 3HKCB 3G2MA 3KEFA 3KU4A 3O82A 3H04A 4RIEA 3PR3A 4D8VA 1Y6RA 3A14A 1GARA 3OT1B 3COVA 3VNVA 2X4GA 3RYCA 2WJAA 4JBWA 2PX2A 4BASA 1UKZA 1WL8A 4UCWA 1ZHOA 4DMRA 2K5UA 1FTQA 3A6LA 5F77A 2C98A 2F6RA 2GK3A 1LV7A 2XE4A 3B89A 1VPWA 4KO2S 3SJUA 3T5PA 3ED1A 1HYGA 5I51A 1U8XX 4LPSA 1N8TA 1ZRHA 1GL6A 1YQXA 5JSYA 1E79D 1P7PA 2IU6A 8MHTA 1C9EA 1AG9A 1SQSA 2QW8A 2CVQA 1NVVQ 2CD7A 1MMFB 2CMDA 1ZIOA 3L7JA 4IS3A 2VQDA 2AFIE 3N39C 3FZEA 2B7CA 4OJNA 1E2EA 3FUVA 4Z2YA 1OWOA 5DF1A 4PSCA 4ALLA 4EEZA 2ZUFA 1PF7E 1F17A 3RSZA 1SIBE 2TMGA 4KNVA 3HVJA 3QBDA 4KBYA 4MIEA 5HG0A 3FH0A 5L53A 2ZUSA 3FW1A 1PJZA 1R9MA 4R7TA 5I7VA 3IAS6 4OGFA 2BE9A 5ENZA 2HWWA 1DJNA 4HVAA 3ADCA 3VAYA 3W8RA 2WAOA 1DADA 2C97A 2VTBB 3QUAA 3TZQA 4ND2A 3RTDA 3VV3A 2GB4A 2P2DA 3NATA 4X1IB 1W581 4HDNB 5DCUA 3STWA 1I5EA 4KMRA 3ITEA 2YN0A 3QVUA 1TYDE 3D4OA 1H9AA 2O0MA 2VWHA 1WD5A 2XNHA 2OHFA 4H7FA 4W9NA 4A0RA 1GDTA 4RS4A 3OIWA 4UU1A 1F9EA 4CKEB 3IIIA 3IKVA 2O1XA 4ZI7F 1IM5A 4GBJA 3K1YA 4LS3A 5EYPA 5F5NA 2E7ZA 5ESWA 1XK7A 3RKSA 2REQB 2VIIA 1NMQA 3C6QA 4ZJYA 3BRSA 3LCMA 3OCYA 4M9XA 4HDQB 3LY7A 5A3JA 1XVIA 4KLCA 3VVCA 3EPLA 1IN1A 1RC0A 1ZCBA 3QVMA 1BIFA 2C9DA 5L6MB 4TZTA 1B74A 2IBMA 1QOPB 1U8AA 1WUJS 4H31A 1VYHA 1ZOLA 3UHJA 3DH0A 4CM7A 2BYTA 3VYVA 3L6CA 4Z0NA 4ZZ3A 3UANA 4J0EA 4N6NA 3KVYA 3E5MA 1CZKA 4PC7A 1YJAA 4U00A 2QPAA 3R6GA 4ITUA 2QTZA 1GHTA 1SUPA 3HJNA 1J2TA 1G8MA 4HN9A 4YJFA 3L4SO 5EXXA 5FBQB 1ZDMA 3VOAA 1P75A 4F3RA 5KYWA 1R5JA 4D92A 4F2WA 1LPAB 5CVCA 1AN0A 4TYQA 3TL2A 4DCOA 2EX4A 3OZAA 2YMPA 2Y27A 2MT9A 4XOUA 4M1TA 4ZVRA 2NUTA 4C4XA 2CSXA 4P2GA 3DKRA 4HYQA 4U7TB 3WYFA 4BKMA 2BBSA 2QTWB 1AKEA 4CIWA 1C1XA 3QFSA 1NV8A 5HF6A 4ARCA 1PFUA 3V4ZA 3EZ9A 2AZXA 3TG2A 3S2YA 3NPMA 2AUMA 2R6ZA 4PLZA 1DUSA 3L0ZA 3CRW1 1OXUA 3AV0B 4RJIA 3RSFA 5J4HA 2OGTA 2CDCA 1JTEA 4FI3F 3WK6A 1QP0A 2ZJ6A 5ESRA 1H85A 5T57A 4QECA 1HR0B 3H2ZA 1OY1A 4M60A 2ZXUA 1MDBA 5CB0A 1ITZA 3KX2A 5FLXA 1DAHA 3G2KA 1EM8B 2VUSA 2JBAA 4EL0A 3A0UA 5ERXA 4ZVMA 2WG1A 3OQ1A 5IZ4A 1E62A 5E9JA 4X20A 5F2EA 4EG7A 3KJQA 5JZVA 2W00A 4OF4A 1GPYA 3VR6H 1OIWA 1MU0A 4UAVA 4DFDA 1A8PA 4S1PA 1VZ2A 4CUKA 5JNSA 3P0IA 1GZUA 3WOHA 1GGNA 3K8ZA 2I71A 1GSIA 1FTGA 4WASA 3TQOA 1XJCA 2XUAA 3HR7A 2XTZA 1U9ZA 3VZPA 3HVRA 2O8EB 1XQWA 4E5MA 3CY6A 3C7TA 5JS7A 2WEKA 1WZCA 4V1CB 2OFXA 1RRPA 3H6HA 3MS2A 4M37A 4I7EA 3PXUA 2Q3HA 2OB1A 3U0VA 3E58A 1U02A 4AP9A 1AKRA 2I4TA 4KACA 1QOQB 4G0OA 4YH1A 2D5CA 1A72A 4C7KA 5TQ2A 1SRRA 1XNHA 5LYYA 2N47A 4N12A 1DKMA 2V8BA 4H35A 4RWZA 1QBGA 2D1RA 4YRSA 3HEBA 4GDMA 4ZEXA 4LISA 3MWLA 3KRTA 4WY5A 2K87A 1E4EB 4JI3B 5MHTA 2V6GA 1II9A 4XYEA 2QZ4A 2EGHA 3M6XA 1PR4A 3I09A 2KW5A 5BMVF 3O8QB 2PT9A 4MQMA 3U7RA 5BXQC 6REQB 3SIPA 1KI8A 2BR3A 3FROA 3H7IA 2WB2A 2V1XA 3OJWA 5JDIA 3I01A 3WAJA 2FW6A 5JFTA 1DGQA 3RO7A 4QT0A 1UQUA 3IH5A 4WXRA 3RREA 3KAKA 5CJ2A 2J7KA 4S24A 4UZFA 5ECYA 1JU4A 4LRXA 2O2GA 1BWRA 3WL5A 1YE8A 3ZE2B 4UTPA 1EG2A 4D9IA 4QBTA 1SCUB 1HLPA 2NV0A 3BGWA 3RUEA 3P26A 2AKEA 1EX1A 2HJGA 3FN4A 5G1NA 3FNGA 1C7FA 3GL9A 3RVBA 3NW9A 4FGUA 1KDTA 1NBWB 4LNUB 4RE5A 4YFYA 1N78A 2QX7A 3PGVA 3SQDA 4RIIA 2J9YB 3QU5A 1YB5A 4YJGB 5TIIA 5KJ6A 1PT5A 3OBIA 4NZNA 4YASA 3S7ZA 3DD1A 2HDWA 2CZGA 4URWR 4EPVA 2G1JA 1I7PA 1ISPA 1E1DA 1I10A 1X80B 2HHAA 3HUUA 1L4FA 1E2JA 1MCZA 1PVDA 3OCZA 4JL6A 4JSRA 3DXXA 1KAQA 1NXQA 3A04A 3NVAA 4Y30A 4GLOA 4D41A 4LW8A 5KB3A 4DUGA 2ZS7A 1NU6A 2O5RA 4P5PA 1XMSA 2CLKB 5LZ5A 3BMQA 4UULA 1GTG1 3ROTA 3DEKA 1NF9A 3E9RA 4J0KA 4X1OA 2IPNA 4QFDA 3RVNA 3SXUA 1FFHA 1C8VB 4UDNA 5COBA 2PO7A 1V8OA 4WLNA 4RF3A 5FTLA 2QUIA 2QT0A 3A3YA 7MHTA 1R16A 3WGMA 2A5LA 3A7EA 5JDIC 2Z1NA 5GIPE 3CURA 1VP9A 3AZPA 4MW2A 4JFRA 1W36C 4FC6A 5ARDA 2C78A 5DEIA 1LBSA 3V1UA 3AVVA 2Y99A 4P35A 2CLFB 1KO8A 1Y98A 4JT2A 4Q9KA 3UGJA 1IXZA 1I1OA 1ZYUA 3DDUA 3TQIA 2FDXA 1KP2A 3LPAA 1JB9A 4TN1A 1LVGA 4HWRA 5K6AC 2WQ7A 1GZ7A 1EUCA 2PMCA 5AOCA 4AICA 1SXJE 4LRYA 4ZAXA 2NAPA 3U5ZB 4J3JA 4J1QA 1XTZA 4RXTA 2C9BA 3B85A 2DU8A 1LY1A 4LGCA 5CLIA 4G9EA 4AM8A 1JZQA 3ZXUB 4F12A 2O5EA 2GLXA 3RRBA 4MV1A 1UKAA 2FQXA 4NBSA 2ODEA 5TEVA 1SR8A 3JS5A 4N7BA 1KMHB 3BIJA 4DCCA 4LN1A 3BS4A 4MMZB 4DEVA 2XUHA 1G2PA 4LNHA 3LWZA 3LYAA 4OAOA 4ZC1A 2QBYB 1TZKA 2Y1DA 4LJ4A 3TRHA 1TYCA 4C01A 2HMVA 2O8BB 3OVMA 2FUCA 3HUTA 4A2QA 1K2VN 3WMRA 4FYMA 1OREA 1M2VA 4EJMA 1NFRA 3JWIA 1TK3A 2PVPA 5D3MA 4XLTA 5CEJA 5JMWA 4HWGA 4DNPA 4ZHQF 4R71A 4RVUA 2C59A 4DMFA 1TMGE 5A7HA 1EH5A 3WYDA 2ETXA 3H87A 3HXQA 3LIPA 4I4IA 4NNPA 4BB0A 2HRZA 5CFZA 2WAXA 4PBTA 5EWMB 4I6JA 1FPQA 2V5UA 5AVOA 2EDAA 2C9CA 2P2YA 3EA5A 3WJAA 4AS3A 4BNFA 1V45E 3HA5A 3PXXA 4CLOA 5K8CA 2YIMA 2C5FA 4G5HA 5A6VA 2HIHA 5KAPA 3LG2A 1CY1A 2GZHA 3P2JA 1Z7YA 2HSEA 2QM3A 5HGXA 1B0UA 5FBHA 1F1BA 4OAPA 1YR3A 4XTRA 2YJ6A 5TMDA 4YDRA 1WP4A 4YB8A 1G19A 5CIQA 3ZHCA 2J3LA 2V54A 4QWWA 5JS1A 1NNEA 4D56A 3K8OE 1A4IA 2I8CA 5SZIA 2RBKA 1G291 3CF4G 4EPTA 3FSGD 2FWNA 3BHMA 4WCFA 4RVFA 5EP2A 3KYCA 3RU2A 4ZOAA 4W1RA 1LBIA 5P8WA 2CXRA 3Q41A 5EMHA 1WE2A 3PUVA 2QMQA 3NOXA 4NEGA 3F1LA 4RV5A 4TSFD 3E9NA 2XHZA 4BQRA 5HSGA 4YRAA 1NN0A 1BTOA 5DW0A 4K6OA 2P4SA 1E5QA 1QWOA 1HMPA 1G8PA 1JTVA 1KI6A 1V26A 1XXLA 2V5VA 3KVNA 3ZKWA 3TR5A 4CR7A 2R1VA 2QVGA 3T7JA 3PFWO 5CK5A 5DMHA 2H1RA 1CS0B 1SOUA 2IXGA 1JKJA 3TJMA 3IT2A 1U0SY 3WLTA 1WETA 1IQ0A 5EIFA 2V7VA 1M1UA 4Z86A 5JZMA 4O3FA 2C7GA 3CS3A 1VLMA 3I4FA 3ZGXA 5BNTA 1Z7WA 2HXYA 1LLQA 4XSHA 3Q5EA 1CUYA 3L79A 5KWSA 1FX1A 4ZOCA 4E2YA 4QDJA 4C0BA 3PE6A 4JCCA 2PGIA 3AHDA 3AYZB 3I45A 5CIYA 2QV0A 4NOKA 1ATZA 3NBAA 2NT4A 2AEFA 3NTUA 3CUKA 4RV9A 3W1WA 4F2GA 1WXHA 1FUEA 4PYLA 1F3LA 4FOLA 1F6WA 4Z7QB 5JZBA 5KQRA 4WCVA 4ZT4A 1OXTA 2TECE 3BHIA 5F73A 1K3FA 3A36A 1MAVA 2X8WA 5AW7A 1XLWA 1ZLYA 3WJ2A 3I1JA 2Y9MB 5AW9A 1CQWA 2AD1A 5B1HA 1ZI6A 3VR4H 1Z3CA 2POQX 2AFHB 4JAVC 2O8FB 1XLTC 1FOEB 2WHPA 4YQEA 1W88B 3UH0A 4DA9A 1N32B 1B0ZA 1HNNA 1HURA 2JIBA 1D9ZA 3CR3C 3LUJA 4OQZA 5AOAA 2DXIA 3ZE0B 1Z16A 4NBTA 1GCGA 1RI5A 2GXAA 3FZYA 1SBQA 2C42A 1N5KA 2HMTA 2BKLA 5EN4A 5AQ1A 5SV2A 5KYUB 5LQDA 4M87A 4NXNB 1T5TA 2G9QA 5LDDC 1KDPA 5ADHA 1UOEA 2CL5A 4MR8B 1L5RA 1YJ8A 2V8OA 3H83A 1GZ5A 1MRNA 4UREA 4XGRA 3W2HA 4YDQA 3U16A 4OH1A 4KMMA 2FDRA 1R37A 1WCXA 3HA2A 2XTNA 3RRFA 3QVVA 1ZONA 2O3UA 3AB8A 4EAQA 1E3WA 2HFKA 2QTLA 2WYWA 3BK2A 4IX9A 4CVNA 1T29A 3BF7A 1OYWA 4YCAA 3OLYA 5IKPA 1L5QA 2QUAA 4JQSA 5L7WA 3HO6A 4RUKA 3P9XA 2FWBA 4H15A 4BJ6A 4LMRA 1SPBS 4QDXA 1LQTA 3ONDA 4K2HA 2QDKA 4DQLA 1ZN9A 4G0VA 1RQ2A 3LDUA 2JBWA 1C0KA 3DLAA 3QX8A 3ANYB 2NSDA 3V3KA 3G0OA 3PFGA 9MHTA 4GQBA 2Q6IA 4GHWA 5FEMA 3WQSB 1XQ6A 3MD0A 4TUYB 4AJJA 1X9IA 3A9WA 3JARA 3W5IA 3OIYA 3X1YA 3A1FA 4DMKA 2YASA 1G64A 2R5FA 5K09A 1IDOA 5CCXA 3SMQA 1XCGB 1FDUA 2XOXA 5U4QA 4Y2XA 3HUEA 2PKQO 2EWMA 5CP8A 3RU3A 4M0MA 1C30A 3DZCA 2AS0A 2UUPA 3DMRA 1ODIA 1PBTA 1PWHA 1R4NB 1GPWB 1W4RA 2ONCA 3K5PA 4HQ6A 4HY3A 4MULA 4CKEA 1WVIA 2R6HA 5ITSA 2GH1A 2JLQA 5EVCA 1M5RA 4CEJA 4PLVA 4BE9A 5E2IA 2DUNA 3ACBA 4UOEA 1OTXA 4WCFC 3AB3A 3BJZA 2XVAA 4LTDA 4A27A 2RKOA 2GJ8A 2CXTA 1A5SB 1EFUA 1JU9A 5ALYA 5AVQA 1SHTX 3RLFA 4WINA 1CBUA 2F67A 2ZT7A 4RY2A 2ID4A 3WY9A 4RV4A 2JCVA 1H2FA 1KE2A 1E9EA 1JUDA 1NJ6A 3MPUA 4UPDA 4B3GA 3HYTA 3H5IA 4XJTA 1XVUA 3LCCA 3LOPA 4D0RA 3DZBA 5KIAA 4B6FA 3GUHA 4RJTA 1G8KA 1HL7A 4OL0A 4UM5A 3MWFA 3L05A 2ZI6A 4DM3A 2BMFA 4BFWA 2SECE 3D6MA 1CNEA 1F8YA 2P9HA 3QU9A 4YT8A 3IDZA 2QXTA 2PA0A 2IBTA 3GDOA 3IDOA 1M8JA 5ILGA 3CVVA 1EZZA 1FDOA 2NVUA 2WYIA 2XIJA 1O1YA 3QVTA 4J9VA 2I78A 1UWVA 1N0WA 1QH0A 3A4IA 3A6ZA 4IIJA 1ZX1A 3NP7A 2C9ZA 1I13A 2K2WA 3HCFA 4LKRA 4ANFA 2CEKA 3IQIX 2G5TA 4YFVA 2GS9A 6REQA 1BDHA 1J5EB 2FF7A 1SCIA 5TPWA 1QRRA 2VHUA 3OPNA 1XCLA 1DS6A 5AHRA 3ESDA 3W5SA 2DFPA 2GPTA 4AX8A 3EGIA 3GRCA 2QIPA 3OOJA 3UFXB 4A36A 2Q4EA 3FPKA 2V9ZA 3WK8A 1YHNA 2W2OA 2O4UX 3QLJA 4IJMA 4ZT2A 1TM5E 1DBQA 5DTRA 4WZAE 3RQIA 1KDRA 4FT2A 2P41A 3WRXC 1IBLB 4HPXB 4AN1A 3ZH9B 4R9NA 2NZXA 3BFJA 3RUPA 2G63A 2P6MA 1P7CA 1NOKA 4MO9A 3MUNA 2DPMA 2EJUA 4IO1A 4YAKA 3L7OA 1SN7A 1YUNA 3E2IA 3LYLA 3TDMA 1Q91A 1V9SA 5DNVA 1Y4ZA 5DBEX 1RVDA 3AWIA 1FLVA 2GCEA 5HS6A 1UJ4A 5GPBA 4DJAA 3Q7IA 4GI3A 1NBME 2RB4A 3FBTA 4QHTA 5J47A 5J2TA 2XMZA 2B4AA 1ZKDA 3GAZA 3HDTA 2P9TA 4JJGA 5F7JA 2PVSA 4PN3A 2Q7OE 4WPGA 4C0XA 1KIFA 1L5ZA 1AHPA 4IIXA 1PEKE 3EFEA 2XA1A 4XWYA 5LMZA 1U28A 4AZVA 1DC7A 1SCKA 3KQHA 1ZAKA 5JDCC 4MS4A 1YBFA 5EZYF 3B13B 1X1QA 2YHAA 1IY1A 2D7CA 3BGDA 3G9TA 3M6IA 1ZFNA 2Z08A 4FYKA 4PS0A 1E7YA 1S2GA 4UUAA 3IALA 4TQAA 4OVKA 1YK1A 3CGGA 4AF8A 2HRCA 2WJGA 3HB0A 1M7HA 1XCPA 2E9SA 1YMVA 2O7NA 2XZTA 5IT9A 4MLZA 3MMPA 3IFSA 3BCRA 4CKWA 2AUNA 1QFJA 3ZQUA 5HRUA 3JPYA 2Z2ZA 4BEVA 2AT1A 2BFMA 2FETA 3TZ6A 4L7VA 3RANA 4G2TA 5CIWA 1C14A 4UE3S 2YTZA 2X8AA 5A5FA 1ANKA 5HIKA 5IP5A 1A7JA 2Q5OA 4Q1CA 2I22A 2SKDA 2YV3A 2UYGA 4U3JA 1T15A 5JXGA 4Z4FA 1G3RA 1UKYA 1J21A 2WVAA 4G5OA 3NBZC 4NJOA 4L8GA 2WBLC 4NMLA 3O5AA 1G5RA 3BMXA 4WFQA 1N5JA 3PNVA 4IG9A 3PE3A 3ZE8A 2YX1A 2W8BB 1K0FA 3OMXA 4CLDA 2WU4A 3DSRA 2JAOA 4WE3A 2PGDA 3JR7A 5IM4F 3ELBA 2GBFA 4GYKA 3R3ZA 2IUTA 1DKQA 1XZNA 4HSEA 4U2CA 4QTYA 2QYOA 4MGYR 1O5OA 3KV3O 4X8OA 3TNYA 1LUAA 3OTIA 1PWXA 2OCIA 4QUIA 4KPGA 1D1QA 2DPHA 5AKEA 3D2LA 1SY7A 4DKXA 1RPTA 1F2VA 4Q3LA 3VBEA 1U5AA 3RIHA 3IMFA 3GLVA 3WE7A 3QVWA 3U3KA 5CVDA 1ZXBA 4DCTA 1H2WA 3CEAA 3DV0B 1Y4UA 3G23A 4I1SA 3SN6A 1AGNA 2NZ8A 3IGFA 2FP3A 1N6HA 4MTCA 4QELA 3ZGVA 3SQWA 1ZM9A 3H9BA 3QA9A 5I9TA 1VYTA 1FRQA 3HN2A 3R1IA 3E9ZA 2PSEA 4QQ8A 2KM1A 1ODFA 1TE2A 2BGMA 1SHLA 2G6BA 3KUKA 3LDGA 3N5KA 2TYSB 3HV0A 4KAXA 2YWGA 4FINA 5K8VA 5KTOA 2OHJA 3PLNA 3LXXA 2B0CA 2BFDA 2QN6A 3K5HA 3B6ZA 1ZPDA 5C18A 1J20A 3ER9A 3FCSB 4FHGA 4GOMD 3X1JA 1C0IA 4YMVA 2KBEA 3SX4A 3LC2O 4OKNA 4GKJB 4EY7A 4YIHA 4RYLA 3VSDA 3ENKA 1JQLB 2X3FA 5KSWB 1PR1A 2WRZA 1N36B 1KGSA 1WXDA 1T0BA 3HJTA 1L0BA 1V43A 3DBRB 3HYNA 2A3RA 1M1YB 2WHXA 4FVTA 1E2LA 4G4JA 4U7WA 4F9EA 4AKSA 4PNPA 2XYPA 3R76A 3RSGA 1SB9A 1QDLB 1U4SA 3H2JA 1BN7A 1P9RA 3CC8A 3MGKA 1IAVA 3GUCA 1SCJA 3A9UA 4JUDX 5DP2A 4YP1A 4BN4A 5B4UA 2XHEA 2ZIXA 4P5EA 2FSFA 2ZBRA 2X0JA 4DLYA 2HCRA 1JZTA 1VL1A 3TLGB 2VSOA 3KIPA 1WKCA 2EWWA 4ARIA 4Q02A 3PC2A 3R4CA 4O33A 1JLMA 3IHTA 3QWAA 4OFXA 3MJCA 5LOVB 4XARA 4B48A 4ZQBA 3W78A 5KYGA 4KIUA 2JJYA 1WLYA 3NEAA 3QQ5A 1J99A 1L4MA 1Q6ZA 1YR8A 2D2EA 4MJ3A 3GH3A 3NJ8A 1R4NA 1UADA 5EEHA 5A05A 3VR3A 4AVYA 8ATCA 3RE1A 5BN5B 3OWHA 3F6PA 2C4UA 3D8RA 3T1NA 4CM5A 3S2EA 2OLJA 4M46A 2VBFA 4FGJA 3H1EA 3LDAA 3T5DA 2COKA 1XDWA 2EKBA 1RR6A 1Z8NA 2YWCA 2ZRGA 1P0IA 3B6KA 4A03A 4I4CA 5JS2A 2WG2A 2VDVE 2EV9A 1IOLA 2JAUA 3TD2A 1EVKA 3HB7A 4ZI7A 3M4YA 3LIIA 5K99A 1MJ5A 3DT9A 5A5GA 3CG0A 1MV5A 1A8IA 3ESXA 3LF2A 4R9RA 5LQJA 5B53A 1O4WA 2BGTA 4H16A 2ON6A 2W6JA 4R0NA 4CU2A 4OOFA 1D7OA 3GDGA 2C7OA 1OD6A 3CSUA 1PUIA 3WGLA 2SICE 4DGSA 1QE0A 1L5YA 1OKKD 2Z2KA 2ZI3A 3C3JA 3E9YA 2OGZA 4I8IA 1WDWB 4FLEA 1V5WA 2UDPA 5FQNA 1XEWY 3R7SA 2HBZA 3CR7A 4D9GA 3BL8A 3PEUA 2MDTA 3JYNA 3ORSA 4TKUB 3VKGA 1BXRA 5TRTA 4I2NA 2RIPA 4MWCA 2G0NA 4B44A 1H2YA 2A88A 1IWPB 4DIKA 2VYQA 3UWOA 4BFVA 4BEBA 5DGTA 1EP3B 3ZDQA 2PZJA 3ZBUA 1M6EX 1G20A 2ONKA 4QBIA 2F9LA 4IMPA 5IM5A 3LO5A 1LLUA 3PGJA 4UTXA 3AM1A 4OXYA 1L7DA 4LXGA 3DEZA 1SZCA 3S8MA 4P98A 5JAMA 5A0FA 1M2HA 3HXLA 1AZSC 5DWVA 1Y5NA 1VE6A 2JH3A 4H3SA 4KH1A 4CV3A 3EPKA 1AO0A 1XDGA 4PQRA 3JRXA 4J03A 5HCIA 1FBNA 3VOSA 1TAGA 2PHZA 3LW8A 2ZXFA 2BT4A 1BSVA 4WBNB 1LDBA 4YRNA 4Q7EA 4ZVKA 2HKIA 5D2CA 4DLSA 2OCAA 3MWGA 2VUTA 1HRKA 3FG9A 3STHA 3AR5A 4L76A 3OLWA 1NU8A 1QV7A 1E5XA 1KKLA 3REOA 4CUJA 5F9HA 1V41E 1TJYA 1EGHA 1JQBA 3PXDA 4BX3A 1YVUA 2FWMX 1V1MB 2Q1XA 5FWNA 2O19A 2DT8A 3ZXXA 1KYIA 5JUWA 1IJFA 2IELA 2R7LA 3INNA 5EE9A 1CEQA 3L84A 3M34A 5BSKA 4BLRA 2RGWA 1P61B 3V55A 5CM9C 3M1LA 1OASA 1OX4B 4GG1A 4BZWA 3A7DA 4FSDA 1EFRA 2OCPA 3F90A 3DKKA 1Z0IA 4FNOA 3H1AA 4HFRA 2IYNA 1EGAA 5JYBA 1AKYA 1E9RA 1FTWA 1QCZA 1YD7A 5DX0A 5AP9A 1ZJYA 4BO6A 5JC1A 1R10A 1QCCA 1KI6B 2ISCA 2B1JA 4IV8A 4G0UA 2OV6A 2HK6A 3HMKA 1X1BA 4YJDA 3SBOA 1ZD9A 5FL3A 1T3LA 4MPJA 2G82A 3WB2A 1GAJA 3O7MA 3KDAA 4O5AA 4Z8XA 1ZGZA 3ON5A 2UZ4A 2DHCA 1JKIA 4PINA 5K3CA 4B3CA 2NMVA 3R6TA 1NNI1 3EC1A 2H06A 4UBNA 3UGQA 5FO1A 1SD2A 5KX5B 4LJYA 3DC7A 4RACA 3O8RA 1CETA 4JI0B 3WWZA 1ZW6A 3I6YA 4JK3A 3OF3A 3TB6A 1NYRA 2PBZA 4GLLA 4NP6A 1JJVA 4ZDIA 1IY2A 2Q0SA 4IUCS 4MSUA 5K0GA 3W6PA 3QUBA 4O2BA 2CXPA 3ZWVA 1G41A 1NULA 2GM9A 2OFFA 3T7AA 4BVBA 2YKGA 4F92B 2J85A 3KLPX 1SC4A 3OCWA 2NT3A 5CDUA 2P5SA 5DWDA 1LPSA 3JQ9C 2YS7A 4XM1A 3WXMA 1M67A 1Z35A 2EVWX 2OHVA 3DMPA 4G6ZA 3QX7A 4Q3NA 3ZGLA 3PDHA 2VYND 1JEQA 1V1RA 2ZUCA 1XK6A 3U31A 1VBMA 2DSNA 2GAOA 3GJ7A 4HQ0A 4LHSA 3UKOA 1P1CA 2REBA 2NSYA 13PKA 4MUBA 1AKTA 5KQSA 3QX3A 1W9MA 5JPIA 3CYFA 1TA9A 3M81A 1FY2A 3D6HA 4KEAA 1JR6A 2GTPA 3KWLA 4AS1A 3F5QA 1OT3A 3R9IA 1E6WA 3ZPXA 2OBNA 1DJPA 3FPHA 4I3HA 4DJEC 4M4SA 3IR5A 2FZ5A 3WHPA 3DLIA 1RT9A 2PQMA 2YC2C 4NF2A 4PLHA 3UUEA 2OT3B 1Z2CA 4CMHA 4PZZA 2HZBA 1DJLA 2Y1EA 5D5PA 5G4KA 3PT5A 3ZDAA 3KQUA 1P8AA 3A1DA 4IX1A 1R0RE 1OLOA 3DD5A 3LFTA 3PNBA 1QG0A 3QXGA 2JANA 1JSRA 5KYYB 5D01A 3GBSA 4TKLA 4K9PA 3NHSA 1MC5A 1WMFA 1A8UA 3D1LA 4PXSA 2PUGA 2MOKA 1C1XB 1QHXA 2P68A 2AW5A 3EVNA 5FAXA 2I2XB 3O73A 1JHUA 1GR1A 2DBZA 2VXOA 1EUDB 2OQIA 4TTIA 5C1IA 1T5LA 2EGGA 2RI1A 3IVAA 4JFAA 5BMVA 3KFLA 1KJQA 2WOJA 4XOIA 1RYFA 3A9VA 2A8YA 3R2JA 2H2FA 5H02A 4P7JA 5GP1A 1W85B 4J0IA 2I9PA 2A7QA 3EIOA 1CIPA 3D9QX 4EM6A 3FPAA 5CA1F 3EG9B 3H17A 3T8YA 1TKCA 2BF4A 5BQ3A 3USES 2PUHA 1YC5A 1CQJA 2EKLA 4KXLA 5LLDA 2PBLA 3S7TA 3H6GA 1VP3A 2HQRA 2FVXA 4EIWA 4EZBA 1XCOA 2GYUA 2X9VA 1WB9A 4TTSA 1NYLA 3QZUA 1SA0A 1P81A 1O5TA 2VYVA 1EFPA 1T5OA 2CFIA 3BK7A 1Y3CE 3JRWA 1RLTA 1X92A 2J6IA 2OCBA 3CXRA 3FMFA 3Q0TA 4MAFA 4MPDA 4OXRA 4RHFA 2AYYA 3GPCA 3TVYA 1R3UA 2GEUA 4JIMA 5EXSA 4BB9A 3MJSA 4NE7A 4MUJA 1Z2AA 2FMXA 4KREA 3KD2A 2E87A 5E6RA 3OD5A 3UT0A 1B23P 1OBVA 2FEKA 4UM7A 4QIHA 2IIQA 3KTAA 3D3QA 4WEQA 1J0DA 2LIPA 1WXQA 3T3EA 2NU7B 3FTEA 3TF5A 1U2QA 2N0SA 2VEDA 3DE7X 4X3PA 3H4MA 3PNPA 2CL6X 4DJ5X 2DFVA 3K6JA 5TJHA 4WOKA 1E4OA 5JWHA 3QMVA 2I67A 3HCDA 4KN6A 4CL8A 4LMPA 2N9UA 5C51B 1OVGA 1HC7A 1E1KA 1G0NA 3QM1A 4LHVA 4QDKA 3GAFA 4N4AA 3GFSA 4A3SA 1FVOA 1OFUX 2B35A 2GJ4A 4CI0B 4DDTA 5FLKA 1I6MA 3PNOA 3AW9A 3JQCA 4J7UA 5C80A 4XWOA 2HSWA 2JGRA 1JHRA 1KU0A 3S2ZA 3ZK7A 2IFTA 5ICEA 1FCJA 3CMMA 1UBUS 5ALDA 3I0MA 5ILQA 4OQLA 4ZEWA 3VZDA 5D1HA 2ZOSA 2W71A 4OBBA 1U1GA 5ARCA 5JD4A 4N48A 5F9FA 4ED9A 3CR8A 1KZ7B 1QAOA 4JLOA 4WZZA 5C52B 4RTJA 1RRCA 2VJKA 4L16A 4IDPA 5ALTA 4GLJA 3H2SA 1LC0A 2VPYA 3PS9A 2ZTVA 2DQSA 1F8GA 1RWXA 2LE0A 1RYZA 3OICA 4G1CA 3GD7A 2JI8A 3ZW7A 5K7SA 1WRBA 4IDNA 3PPIA 3GJ4A 4ZGBA 4HUTA 3AVUA 2PGLA 1OUMA 5JAQA 1TIBA 1C1DB 3IV7A 3KSUA 4IDCA 2OMEA 3DW3X 1J0AA 1D2EA 2HJWA 4FZ3A 3UT5B 5AKGA 2QRKA 3EXHB 4KJZA 3RVDA 4IIBA 4EW3A 5LKRA 4RTSA 3ZVLA 3BAFA 1XMXA 1EM6A 1JMVA 3FYUC 3RRYA 4NWIA 5AKKA 3GLGB 5B3JA 4LWOA 1NGSA 4YLGA 4ATNA 2QR2A 4S0ZA 1JDBB 4MWDA 3Q6NA 4OAQA 3HXKA 4R8SA 2O14A 3K9CA 3WWEA 4AZSA 1U63A 1BXKA 4KI7A 2GLUA 2WSSA 3VDQA 5BR8B 2PJRA 3OTHA 1FE8A 4RXUA 2R47A 4Q1EA 2C4HA 2CXSA 3PNMA 3QE4A 4C2BA 1ZCJA 1J23A 1SBZA 2GRJA 4IKEA 4AJOA 4YCCA 4WTOA 4RJ2A 1Y6FA 1ENPA 1HYQA 1OXXK 1KKMA 3GMDA 4I6EA 4UUQA 2X5XA 3FPJA 2FRVA 3H1GA 4XJVA 1DO8A 4EVIA 1JEAA 2QGZA 2QLFA 4KPUB 3RS4A 5CDYA 5DM60 4RLFA 8GPBA 1JDZA 5ITZA 3C3PA 1NX9A 2NU8B 1PGPA 1W7AA 1H3EA 1O89A 3TCXB 1OTYA 2XF2A 3AIOA 5DTMA 3BQ9A 2JLZA 2HQSA 1ZL0A 3ZU3A 3TGPA 2ZEJA 3KJXA 1U2DA 3VA7A 1VA5A 3PKIA 2FKAA 3T4XA 1G5PA 4IGIA 4OMDA 3KKPA 2I76A 1JIVA 3HABA 4FD3A 4XUGB 3VR2A 4EI9A 2Q7XA 1LRJA 3R0ZA 3LPCA 3IKLA 4H1HA 1WPRA 5HJ2A 2IWHA 5DHUA 1PW5A 2D2IA 2A9FA 1E79A 1MPTA 2ZZMA 5KOHB 5EG5A 5TSDA 2LKDA 2B1QA 1GPH1 5HIJA 2XMRA 3MTEA 1J8FA 1W0KA 3AY7A 4OP3A 4QODA 5FTJA 3K53A 4HEJA 4KV7A 3T4PA 1U7ZA 3TTVA 3VBCA 3WLRA 4OHCA 2YDXA 4MS4B 1MX5A 2WSYB 1Y34E 5FLEX 5KYWB 3UA3A 1JQ5A 2FG7C 3BXXA 4XLZA 3U19A 2Q4TA 4Q12A 1V5GA 2R5NA 2XMGA 3BRWD 4F8JA 4BNNA 4JVOA 3A3OA 5TR9A 3U4GA 1IM2A 1LS1A 4XH9B 4A0GA 4PYMA 1NIJA 2JLAA 2VSFA 4ZYVA 1IEXA 3IILA 4MAMA 4K2AA 4G1VA 4KWHA 1E7WA 1ONNA 2ZUBA 3SIWA 3GLGE 4HTFA 2PUAA 2XKAA 4B3HA 4ZIRB 1WB5A 2XT0A 3O1JC 1DDIA 2HNBA 2GSDA 1V7CA 1WHSA 3A4TA 2IW3A 3RD5A 4DCPA 3ESZA 3C7DB 3L1JA 1SULA 5ER6A 2PZ8A 1QF7A 4GPBA 1DAEA 3WYAA 5E6UB 1KI9A 1ISIA 1YRAA 3CN9A 4PC1A 4IDFA 4S1NA 3ZCUA 1PSZA 4UNSA 4CGYA 4K9MA 3NO4A 1PLKA 4FB5A 3IT1A 5J2TB 3H19A 1CIVA 1SC9A 3GRYA 1MNQA 4O6VA 2ODNA 1NVGA 4GI1A 5DRTA 3DMNA 3SY8A 3L49A 1GFIA 2VPXA 4GSYA 5IEBA 2A58A 4DADA 2ZCJA 2D0PB 4XIJA 3ZIAD 4E46A 3CKMA 3B3QA 1FMTA 3L8FA 4B3JA 5KC9A 4ZGGA 1Z5WA 3EHEA 1AKUA 4V0OA 4UJ3A 1UZMA 2I1QA 2UZ0A 3NKFA 5LXTB 1T2NA 2CJFA 4DRXA 5CCDA 2HHHB 4PG6A 4F85A 4QPCA 2ATIA 1YA8A 4AJPA 2W93A 2WFLA 1C2TA 4HI0E 5DIZA 3GP3A 1IUNA 3H5OA 5BQFA 1FJHA 5FNVA 3ZWCA 5MF6A 1CFZA 2J59A 2ZBEA 1QUEA 2F3UA 3G7NA 3QPDA 5IDWA 1U9IA 1D4AA 3CT4A 1HZJA 1ABEA 2R6AA 3EVFA 3GCXA 5TE9A 5KREA 1V8ZA 3VYSB 5ALVA 3MYYA 1FJ2A 2WNIA 3HWSA 1AZLA 3ANNA 2B83A 1ILEA 4ZI3A 1JHVA 1RWMA 1E0KA 2ZIWB 4KIJA 3EIQA 3DEHA 4X65B 4PX5A 1XSEA 2OYRA 2NQ8A 4IFIA 1LXCA 4TT3D 3LA8A 1KTIA 2VL7A 1Y6QA 3A6KA 2OC4A 4G25A 4RTPA 1MZVA 3CRMA 3LQKA 3U4HA 2YVLA 3WRWA 5K03A 4GAEA 3IUPA 1EVZA 2XQKA 2WJ3A 2O8VA 3B9PA 2DWUA 5KHAA 1QH9A 2NAFA 4KWCA 1BH2A 2YHSA 3I5YA 3ZZ1A 1CZRA 1JIXA 2DSTA 3GWZA 4OV6B 3KHSA 1FRZA 1WQ4A 3MS4A 3L6BA 5ALPA 3AHHA 4BFZA 2UVDA 4RGVA 3HDYA 3RROA 2AIRA 2CXUA 2FRDA 3OFND 3TFWA 5H9WA 1DHTA 5A71A 3LXMA 1VMDA 1EHCA 3O03A 3H9EO 3PIDA 4RVCA 2FUKA 3SIRA 3NBMA 1GN9A 1KC1A 4ECAA 4YXWA 3TTWA 2VHJA 4L0DA 3RWOA 4COOA 3FYSA 4NFSA 2MYTA 2XDQA 4I5FA 1UBHS 2R8EA 1JVNA 1F5SA 1UJBA 1W75A 2VWQA 2WIBA 2I4IA 2O2ZA 3DEJA 2GT1A 1RKUA 3H99A 2LP4Y 5ETJA 3GEIA 1J33A 1DO0A 1LTQA 3ZIUA 1OH5A 4DIEA 4CM6A 1A76A 1PT8A 5H3LA 4OBWA 3DAFA 5BN3A 4I5IA 4R8LA 3L92A 5BO5A 2Q2QA 2OXFA 3KKNA 1EQUA 1UBSB 2ONYA 2R6R1 4F4IA 1BEZA 1U7TA 3CT6A 4KQJA 1U94A 3CZRA 5IYZB 1MIOB 1PT9A 4EGAA 4DC9A 2KJQA 1H2XA 4CXMA 1F51E 4XGNA 2J07A 2X2PA 2DJ5A 5F3WB 4EP1A 4HH1A 3H6KA 4R51A 1PZEA 2E4UA 2WP8J 2FH5B 2VXCA 3WICA 3ZDFA 2C82A 5HBRA 1QQBA 3E3MA 4EB0A 1N3YA 1X1RA 2DKOA 4FW8A 2IY9A 2OHXA 2QGFA 2RB5A 4QFCA 1YS2X 4QX6A 3CGWA 4YA6A 4A5SA 2EU8A 4DBLE 1WCV1 2ZITA 3PE4A 4YRIA 2B36A 2OO7A 2C29D 3N7UA 3UYLA 3O47A 2F3PA 2J9RA 1R5BA 4IEEA 4QTXA 4EVRA 2I7VA 2XXAA 3ZU6A 2O3QA 3PF9A 1CX9B 4XCXA 3BRQA 3HB5X 1FRVA 4UUBA 1WF3A 3C4JA 1UM8A 1W36B 5CK4A 2GNOA 4DNOA 1CZNA 1IN6A 5GOTA 4GW3A 5A06A 1SKBA 3LDHA 3L7CA 4NOJA 1U2EA 3T61A 4CRWB 3RVJA 2DETA 4UHCA 3HO1A 3VTKA 1GPDG 3QNWA 1LLCA 1YKSA 1PS8A 3F97A 1JSLA 3HRKA 3HZOA 4NE2A 4FX5A 4ZXFA 5KWVA 3PHJA 4YJ3B 3G5TA 3WL6A 4D9KA 2JZCA 3EC2A 1JDUA 2OZVA 4LRSB 3ZD7A 1PNQA 1DDOA 3EEOA 4PHHA 4UBKA 5HF5A 3AHEA 5IHPA 3BJEA 3AJ8A 3IUQA 4FYYA 4TMFA 3N58A 4G8JA 4PZAA 3T3IA 3TLEA 3TNFA 4NCIA 3ZY4A 2RBGA 4RZ3A 4ZV9A 4Q4JA 4EMSA 1V4VA 3WNDA 4RTLA 3GLUA 5ED0A 4J4BA 1LK0A 2SKCA 1HQKA 2VRNA 3BM5A 3I0NA 2ZYRA 1PV2A 4LSGA 5AVZA 2ZSDA 1GP2A 1LGYA 4C0HA 1L5WA 1BU5A 5DOZA 4BO5A 1AF4A 1E1RA 3L2OB 3ZW9A 3HUDA 3D1VA 1K9SA 3I5AA 4XDZA 4BV8A 4P0TA 3ZXSA 4NH4A 4D80A 3PHCA 3U7HB 3ZDEA 2XUPA 2P40A 4EUHA 1MRSA 4DABA 4TYPA 1UP6A 2FXVA 1T13A 1W5EA 3V1YA 1FFBA 2D5IA 3BMCB 4I1RA 1NQ5A 3IP8A 3H2HA 3P4YA 4BLQA 4UOZA 1RYYA 1QQTA 4ZREA 2IUUA 4F2PA 3QPVA 4EI8A 3AF6A 4N76A 1QF9A 2AZTA 1P9NA 2BKXA 4R41A 1Z5OA 3OFKA 4CZ2A 3IKTA 1BEEA