2JFRA

Crystal structure of the ppm ser-thr phosphatase mspp from mycobacterium smegmatis in complex with phosphate at 0.83 a resolution
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
234
structure length
234
Chain Sequence
b'GMASVLSAATATDQGPVRENNQDACLADGILYAVADGFGARGHHASATALKTLSAGFAAAPDRDGLLEAVQQANLRVFELLGDEPTVSGTTLTAVAVFEPGQGGPLVVNIGDSPLYRIRDGHMEQLTDDHSVAGELVRMGEITRHEARWHPQRHLLTRALGIGPHIGPDVFGIDCGPGDRLLISSDGLFAAADEALIVDAATSPDPQVAVRRLVEVANDAGGSDNTTVVVIDLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SER-THR PHOSPHATASE MSPP
publication title Insights Into the Mechanism of Ppm Ser/Thr Phosphatases from the Atomic Resolution Structures of a Mycobacterial Enzyme
pubmed doi rcsb
source organism Mycobacterium smegmatis
molecule tags Hydrolase
total genus 76
structure length 234
sequence length 234
ec nomenclature
pdb deposition date 2007-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13672 PP2C_2 Protein phosphatase 2C
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.40.10 Alpha Beta 4-Layer Sandwich Phosphatase 2c; domain 1 PPM-type phosphatase domain 2jfrA00
3FXMA 3W45A 3W41A 3KB3B 3W44A 3ES2A 5F1MA 4N0GA 2JFSA 4RAFA 3F79A 3W42A 4DS8B 4YZHA 3UJLB 2Y09A 3PU9A 3W40A 3UJGB 3ZT9A 3NMNB 3FXJA 5JO1B 5ITIA 4LA7B 3KDJB 5D2UA 3T9QA 3ZVUB 3N3CA 2POPA 3MQ3A 2CM1A 3NMVB 2JFRA 2P8EA 2IQ1A 1TXOA 2I44A 4RAGA 4LG5B 1A6QA 2J82A 2J86A 3FXOA 2PK0A 5JO2B 2POMA 2ISNA 3QN1B 4YZGA 4WVOB 3NMTB 3KE6A 2I0OA 2J4OA 2IRMA 4JNDA 3FXKA 3RT0A 3W43A 2PNQA 3FXLA 4RA2A 4LGBB 4LGAB 3T91A 3JRQA 2V06A 3D8KA 4OICB 2JFTA 4DA1A 3RNRA 3UJKA 2XZVA 3EQ2A
chains in the Genus database with same CATH superfamily
3FXMA 3W45A 3W41A 3KB3B 3W44A 3ES2A 5F1MA 4N0GA 2JFSA 4RAFA 3F79A 3W42A 4DS8B 4YZHA 3UJLB 2Y09A 3PU9A 3W40A 3UJGB 3ZT9A 3NMNB 4IIKA 3FXJA 5JO1B 5ITIA 4LA7B 3KDJB 5D2UA 3T9QA 3ZVUB 3N3CA 2POPA 3MQ3A 2CM1A 3NMVB 2JFRA 2P8EA 2IQ1A 1TXOA 2I44A 4RAGA 4LG5B 1A6QA 2J82A 2J86A 3FXOA 2PK0A 5JO2B 2POMA 2ISNA 3QN1B 4YZGA 4WVOB 4IIPA 3NMTB 3KE6A 2I0OA 2J4OA 2IRMA 4JNDA 3FXKA 3RT0A 3W43A 2PNQA 3FXLA 4RA2A 4LGBB 4LGAB 3T91A 3JRQA 2V06A 3D8KA 4OICB 2JFTA 4DA1A 3RNRA 3UJKA 2XZVA 3EQ2A
chains in the Genus database with same CATH topology
3FXMA 3W45A 3W41A 3KB3B 3W44A 3ES2A 5F1MA 4N0GA 2JFSA 4RAFA 3F79A 3W42A 4DS8B 4YZHA 3UJLB 2Y09A 3PU9A 3W40A 3UJGB 3ZT9A 3NMNB 3FXJA 5JO1B 5ITIA 4LA7B 3KDJB 5D2UA 3T9QA 3ZVUB 3N3CA 2POPA 3MQ3A 2CM1A 3NMVB 2JFRA 2P8EA 2IQ1A 1TXOA 2I44A 4RAGA 4LG5B 1A6QA 2J82A 2J86A 3FXOA 2PK0A 5JO2B 2POMA 2ISNA 3QN1B 4YZGA 4WVOB 3NMTB 3KE6A 2I0OA 2J4OA 2IRMA 4JNDA 3FXKA 3RT0A 3W43A 2PNQA 3FXLA 4RA2A 4LGBB 4LGAB 3T91A 3JRQA 2V06A 3D8KA 4OICB 2JFTA 4DA1A 3RNRA 3UJKA 2XZVA 3EQ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FXM A;  3W45 A;  3W41 A;  3KB3 B;  3W44 A;  3ES2 A;  5F1M A;  4N0G A;  2JFS A;  4RAF A;  3F79 A;  3W42 A;  4DS8 B;  4YZH A;  3UJL B;  2Y09 A;  3PU9 A;  3W40 A;  3UJG B;  3ZT9 A;  3NMN B;  3FXJ A;  5JO1 B;  5ITI A;  4LA7 B;  3KDJ B;  5D2U A;  3T9Q A;  3ZVU B;  3N3C A;  2POP A;  3MQ3 A;  2CM1 A;  3NMV B;  2JFR A;  2P8E A;  2IQ1 A;  1TXO A;  2I44 A;  4RAG A;  4LG5 B;  1A6Q A;  2J82 A;  2J86 A;  3FXO A;  2PK0 A;  5JO2 B;  2POM A;  2ISN A;  3QN1 B;  4YZG A;  4WVO B;  3NMT B;  3KE6 A;  2I0O A;  2J4O A;  2IRM A;  4JND A;  3FXK A;  3RT0 A;  3W43 A;  2PNQ A;  3FXL A;  4RA2 A;  4LGB B;  4LGA B;  3T91 A;  3JRQ A;  2V06 A;  3D8K A;  4OIC B;  2JFT A;  4DA1 A;  3RNR A;  3UJK A;  2XZV A;  3EQ2 A; 
#chains in the Genus database with same CATH topology
 3FXM A;  3W45 A;  3W41 A;  3KB3 B;  3W44 A;  3ES2 A;  5F1M A;  4N0G A;  2JFS A;  4RAF A;  3F79 A;  3W42 A;  4DS8 B;  4YZH A;  3UJL B;  2Y09 A;  3PU9 A;  3W40 A;  3UJG B;  3ZT9 A;  3NMN B;  4IIK A;  3FXJ A;  5JO1 B;  5ITI A;  4LA7 B;  3KDJ B;  5D2U A;  3T9Q A;  3ZVU B;  3N3C A;  2POP A;  3MQ3 A;  2CM1 A;  3NMV B;  2JFR A;  2P8E A;  2IQ1 A;  1TXO A;  2I44 A;  4RAG A;  4LG5 B;  1A6Q A;  2J82 A;  2J86 A;  3FXO A;  2PK0 A;  5JO2 B;  2POM A;  2ISN A;  3QN1 B;  4YZG A;  4WVO B;  4IIP A;  3NMT B;  3KE6 A;  2I0O A;  2J4O A;  2IRM A;  4JND A;  3FXK A;  3RT0 A;  3W43 A;  2PNQ A;  3FXL A;  4RA2 A;  4LGB B;  4LGA B;  3T91 A;  3JRQ A;  2V06 A;  3D8K A;  4OIC B;  2JFT A;  4DA1 A;  3RNR A;  3UJK A;  2XZV A;  3EQ2 A; 
#chains in the Genus database with same CATH homology
 3FXM A;  3W45 A;  3W41 A;  3KB3 B;  3W44 A;  3ES2 A;  5F1M A;  4N0G A;  2JFS A;  4RAF A;  3F79 A;  3W42 A;  4DS8 B;  4YZH A;  3UJL B;  2Y09 A;  3PU9 A;  3W40 A;  3UJG B;  3ZT9 A;  3NMN B;  3FXJ A;  5JO1 B;  5ITI A;  4LA7 B;  3KDJ B;  5D2U A;  3T9Q A;  3ZVU B;  3N3C A;  2POP A;  3MQ3 A;  2CM1 A;  3NMV B;  2JFR A;  2P8E A;  2IQ1 A;  1TXO A;  2I44 A;  4RAG A;  4LG5 B;  1A6Q A;  2J82 A;  2J86 A;  3FXO A;  2PK0 A;  5JO2 B;  2POM A;  2ISN A;  3QN1 B;  4YZG A;  4WVO B;  3NMT B;  3KE6 A;  2I0O A;  2J4O A;  2IRM A;  4JND A;  3FXK A;  3RT0 A;  3W43 A;  2PNQ A;  3FXL A;  4RA2 A;  4LGB B;  4LGA B;  3T91 A;  3JRQ A;  2V06 A;  3D8K A;  4OIC B;  2JFT A;  4DA1 A;  3RNR A;  3UJK A;  2XZV A;  3EQ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...