2JFUA

Crystal structure of enterococcus faecium glutamate racemase in complex with phosphate
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
271
structure length
271
Chain Sequence
MIRLTDNRPIGFIDSGVGGLTVVKEALKQLPNENILFVGDTARCPYGPRPAEQVIQYTWEMTDYLVEQGIKMLVIACNTATAVALEEIKAALSIPVIGVILPGTRAAVKKTQNKQVGIIGTIGTVKSQAYEKALKEKVPELTVTSLACPKFVSVVESNEYHSSVAKKIVAETLAPLTTKKIDTLILGCTHYPLLRPIIQNVMGENVQLIDSGAETVGEVSMLLDYFNLSNSPQNGRTLCQFYTTGSAKLFEEIAEDWLGIGHLNVEHIELG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Exploitation of Structural and Regulatory Diversity in Glutamate Racemases
pubmed doi rcsb
source organism Enterococcus faecium
molecule tags Isomerase
molecule keywords GLUTAMATE RACEMASE
total genus 94
structure length 271
sequence length 271
ec nomenclature ec 5.1.1.3: Glutamate racemase.
pdb deposition date 2007-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01177 Asp_Glu_race Asp/Glu/Hydantoin racemase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2jfuA02
3.40.50.1860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2jfuA01
2DGDA 1B74A 3ISTA 2W4IA 2JFPA 3S7ZA 5HJ7A 2OHVA 3UHOA 5ELMA 2JFQA 3S81A 2JFZA 1JFLA 2JFNA 2JFVA 2JFUA 3HFRA 3OUTA 2DWUA 5HRCA 2OHGA 2JFYA 2EQ5A 2JFOA 5HRAA 2DX7A 5HQTA 5ELLA 1ZUWA 3UHFA 1B73A 3ISVA 4B1FA 5IJWA 2VVTA 2OHOA 1IU9A 2JFXA 3OJCA 3UHPA 2JFWA 5EVCA 2GZMA 2ZSKA
chains in the Genus database with same CATH superfamily
3KJNA 3RYHA 4K0RA 4IV8A 2HPHA 4ND3A 4C4AA 1LY1A 3LUJA 1I7NA 3JWJA 2ZTVA 2OFWA 2WDZA 4UHKA 2ORYA 3C6ZA 4ZPJA 4ZVKA 4W5RA 1XELA 1ZVJA 2ETVA 1YACA 2GPTA 1LLFA 3KZ1E 2BKXA 1VRCA 4C0BA 1FRVA 4FGWA 1B0PA 4NARA 5CFNA 1TM1E 2X8AA 1TF2A 1QO7A 4IEIA 2QSUA 4Q1BA 1BE1A 2QAIA 2QAGA 1UPFA 2GJAA 1J0BA 4E22A 4Z6KA 2IYLD 3OE4A 3UJBA 1REQA 1DRJA 4C2BA 4YI3A 4QA9A 3FPJA 3A7DA 2QX8A 2FMUA 4KH0A 1XDGA 2CUZA 2ZBRA 3DQPA 3INYA 1TYBE 3L01A 4JGBA 5JI2E 1QFXA 2QUZA 2VCEA 3BHIA 1P7WA 3QXHA 1ND5A 4CM9D 1IL0A 3I52A 1SVLA 4GX0A 1Z4PX 3Q98A 4U4AA 4TKMA 1VI5A 3AF3A 3AB3A 1VHJA 4XYGA 3DQQA 3AZOA 3K9WA 3O4GA 5EHNA 3WYEA 3CONA 4JK3A 1JDUA 4EY5A 3PB3A 1NW4A 3QWAA 1BX1A 2A9JA 2BH9A 3AFGA 3IIJA 4K88A 4W82A 4B43A 4BHTA 3NYIA 2V6GA 4XH9B 4QWWA 4UTOA 3WDKA 2FZLA 3OQHA 1XVLA 4D4MA 5A4KA 2FE4A 1S01A 5LU9A 1P91A 3ACDA 3OU7A 2YRWA 2JAHA 1M1YE 3ML1A 5KCMA 4LJRA 1NZDA 1CJMA 4S12A 4PX2A 5GZ6A 1CQIA 3SLGA 2PZ8A 1Z6YA 4ND2A 3LBIA 4US1R 2FZKA 4GR9A 1N2GA 1DQRA 3CX4A 4O8ZA 5JARA 1KNQA 3BBPA 2MSEB 2WJ4A 1AK2A 1OREA 1UINA 2P6NA 4PQEA 4ZALA 4ZI2A 5GJBA 1LPOA 1F0KA 1KQOA 1LTQA 2W22A 3EEFA 1IQ0A 3T5TA 3G9XA 4GI5A 6PFKA 3KR9A 4W7IA 4WSOA 2LKCA 5GIPE 4AY5A 3WLJA 4Q1FA 3AXTA 2ROQA 3AG6A 2Y77A 5B53A 1I3MA 3AKYA 3LUPA 3D8SA 5CDTA 2QEQA 1CJTC 5C8YF 3PQEA 1MVLA 1V16A 4NJEB 1JDBB 2H16A 1ADFA 3OICA 4YGYA 2CZGA 3CF2A 1S2MA 5LMZA 1X7ZA 4I6EA 1OH7A 1JSLA 1O0CA 4JI2B 4AROA 3INTA 4Z53A 1GNLA 1G4AE 2BFFB 2JAWA 1ZPDA 2M98A 3CKKA 3OA0A 4QTUB 4WY5A 4CFZA 1QIEA 3QGMA 4KMSA 2Q46A 4LYHA 2R6HA 2AMVA 4KE9A 1SAYA 4HAWA 4NJOA 2NYRA 4JEUA 4CE6A 3KOUA 2ZR8A 3D3WA 1EUQA 4CEIB 2JCVA 3RT9A 2V7WA 1SULA 1M83A 3ESDA 5FCDA 1O08A 3RBZA 2ZSIA 1GUZA 3QUBA 2ZXEA 1UJ5A 4KMMA 1E1RD 4J03A 1ODJA 2JEZA 3OQIA 1N3BA 3BX1A 3IUSA 1NLFA 4JL5A 1KP9A 4HJXA 1SC3A 4M9SA 2ZRGA 4JI4B 3HB5X 3EPHA 4PLFA 3O7WA 4OCZA 2A78A 2G0TA 1ZOSA 2Q21A 1NYRA 4HG2A 3TQFA 5F1OA 3U5ZB 4JENA 4GM4A 1ECLA 1PV1A 2IYEA 4FFMA 5D3KA 1R8SA 1BE8A 2VYNA 2XNCA 3QPBA 4BP9A 2NUAB 4LW8A 3OX3A 4US2R 4TKZA 1T4BA 3TR0A 4RQTA 1DFHA 5CB0A 2VH1A 3VTZA 4EF6A 2HLNA 4EFDA 2CV0A 1K75A 2NX2A 3DM9B 1Z5VA 3N8IA 1ZQ1A 4GI1A 3T5CA 1NI4B 2C4UA 1IN5A 1S8OA 4KJZA 4UDYX 2XZLA 1YAJA 2F3QA 5JMWA 1Q0SA 4FP9A 2VHXA 1GDTA 3ISJA 2ZQZA 4J7UA 5F76A 2OA0A 3WA6A 1RTTA 3GBVA 4XWAA 1VCNA 5SICE 1ARZA 1RHJA 2IC5A 1XDZA 3AFNA 2UV8A 1SD1A 3FNGA 2PXHA 1I9GA 5FWAA 3BH7A 1L1QA 3BSWA 3GUHA 2V7TA 2WBLC 4H15A 2QRJA 4KGDA 1YR7A 4QAJA 2AN4A 2BFPA 1H2FA 3NAGA 4ZGBA 3LCMA 1UXOA 2GBPA 3C87A 3S2YA 2WNHA 4MV8A 4A0FA 2BKEA 9MHTA 3B6JA 4FUQA 4HB2A 2IWHA 3H5WA 1NTOA 5BURA 3DMYA 2XDQB 1NXSA 2NSHA 4Y0NA 5D01A 1Q0ZA 3UFXA 3HJBA 4RD2A 1ZKDA 3Q7RA 4BJ3A 1UT8A 3JZIA 3QWBA 3CF4G 4G67A 5G1PA 2Y0CA 2V1XA 3GDWA 3H8JA 2WWIA 1FVHA 3BERA 1H94A 1NW5A 1TQ8A 2AA3A 4EHNA 2ZETA 1AD2A 5T7BA 4FIDA 2JD0A 5BYAA 4QVIA 2CB9A 4IHKA 1QWOA 2VJMB 3BHMA 3FUUA 2JLZA 3G9ZA 1ZWKA 2H4HA 3WL3A 1U0BB 2FFHA 1E6UA 3BGIA 5LVAA 4MJ3A 1TJ3A 1ZGCA 2RK6A 5BMOA 1UBKS 4EX7A 1SUAA 2Q1TA 3AHFA 1NM5A 1JT2A 2H1OA 3RSSA 2ILTA 3SYRA 1W88A 5IP5A 4ZCIA 2FK7A 1G20B 2RI1A 3BS4A 3HV2A 2VK1A 3SAJA 3TRKA 3ZE0B 1QR2A 1WW3A 2WU8A 3NHFA 3QLEA 4IPTA 4E32A 1MO4A 4QULA 1E1KA 2H0QA 4I7EA 1Q0RA 3DAGA 2DPLA 5KHOC 1L7AA 5FH9A 4RELA 1AHNA 4K9NA 1ATZA 2LPMA 1JLMA 4NJEA 1WDWB 3G0HA 1ZSVA 3I23A 5LQDA 4ENWA 2C5SA 1CRLA 1DU4A 1XZNA 3PHGA 2RK4A 3T0GA 4WX2B 3AM5A 4O4HB 2A5FA 3SFVA 1KRWA 6REQB 1ZL2A 2B99A 2UZIR 1UJ2A 4GR5A 2X6TA 121PA 2ZOSA 4IVQA 3QX3A 3ROEA 5F64A 3UN1A 1X7HA 3IODA 3N7UA 2YOHA 3RFTA 5DLQC 1YCHA 4ENPA 2VDJA 4RTKA 2O7RA 4Q3CA 3FPKA 3OEWA 4ND8A 4YQYA 2PZKA 4KR6A 2O48X 1SCUB 4CEIA 2GEKA 1FB5A 2RHTA 3AL3A 4QX6A 4R5MA 3VR6A 5D7NA 1YVPA 1P80A 2H0AA 2F64A 4TRMA 1GU0A 2VP5A 1M1UA 1QVWA 1R5NA 1N34B 3EIXA 2FPIA 1UWVA 2FMHA 4B3XA 4DAEA 2D0OB 1SXIA 2JW5A 1H23A 3DLAA 3RTDA 4PVDA 3TUZC 1K5HA 5EC8A 4RZ3A 4BMCA 1JG7A 2VP2A 2DWPA 1Q74A 1WSAA 1RJEA 3I39X 1JG6A 1Z62A 2CXRA 3PRYA 1OC2A 3IOCA 4GI3A 4RNDB 1N2CE 2AXEA 2C2YA 2WWHA 3AG5A 1IQPA 2WJIA 1XA3A 3H9BA 4BGEA 2AEFA 3HA3A 4MRNA 3ONVA 2V8OA 2NO9A 3L4EA 3SQXA 4LYAA 5CLIA 4NFHA 1HE3A 2G4CA 4YV7A 3EEOA 2FQWA 2PUCA 3RC7A 3PHJA 4DQDA 1P9RA 4Z2YA 4KITB 2EG5A 3SEFA 3COWA 5IYZA 3R6WA 4LZLA 4IUDS 3X43A 4BX0A 2REXB 5L4LA 4OQQA 2H2AA 5LQUA 4LYDA 1E9SA 1TZMA 1VP3A 5JH7A 4OHRA 2D7DA 4K9OA 4WVLA 5PGMA 4QJ3A 4LFCB 1H2ZA 4ZQBA 5IARA 1QYCA 1U31A 4IS3A 3G8YA 4XKJA 2AZXA 4HDNB 4MA0A 3VR6D 2ODPA 5KOJA 1H0SA 3FCUB 3HLYA 2IZ5A 3TEFA 5F12A 3CKLA 4KDCA 3OPYA 4EF4A 2Q4DA 4FBMA 1XL1A 4UCFA 1ZM9A 4W9NA 5G41A 5HGJA 4FM9A 4IFBA 2KE5A 3GAMA 5C8ZA 3HVIA 1O6ZA 3RC2A 4XB2A 2PGNA 1NVXQ 2B0CA 4AU1A 1RVV1 5JRDS 4DVGA 2XDQA 5JJIA 1GCUA 5JDIA 3F1LA 4HWRA 3ZZMA 1PR2A 4G9EA 2HK9A 4HV4A 4P7FA 2A14A 1E6CA 1YKSA 2O2YA 1QRUA 2R25B 4G0PA 3SC3A 3RWBA 1ZKMA 4IG9A 4P7BA 1PJRA 3OPQA 3AV3A 1YZFA 1B7GO 5B1IA 2GXQA 2JK1A 4EKYA 2VJMA 3RGGA 4GPEA 5GOTA 3LX6A 2NSYA 2JAPA 2QRHA 4JODA 4HNVA 1K7SN 1MC4A 3E03A 6Q21A 4F04A 3P9SA 1ZICA 3IFSA 3DYBA 3ILVA 2Q4TA 2AE1A 2W8BB 1SU8A 3D5EA 3QENA 3SE0A 2HEGA 1D7AA 1BMFD 4JLSA 3DLHA 3AP1A 2IP4A 1A7UA 5DWQA 2I55A 1G20A 4I3FA 2ON6A 5LSAA 1GUYA 2OV6A 5KO2A 4BNNA 3K09C 3WGMA 3BJMA 3ONDA 3QQ5A 3MMPA 4IQ0A 5FWNA 2G77B 1TEHA 2RH9B 4UULA 5GY7A 2OV3A 5F1KA 1T6ZA 1J9GA 3TW0A 3W04A 2JI8A 4EI8A 5FLYA 1UXIA 1WB4A 2IPMA 4Q82A 4INZA 5FOXA 5IM5A 4J1SA 5LM3A 5G3ZA 3E7WA 1YK1A 1JMKC 4AP6A 1FMCA 1KAHA 3ZNNA 1KJ9A 4N65A 1U5CA 5JI3E 4H1VA 3F8WA 1AO3A 1M8FA 3IEXA 4WOCA 3EH1A 3HA7A 5CDFA 1XLTC 3H2KA 4P58A 1LPAB 2FUG1 3U40A 5DX8A 1NNEA 2OC4A 2WWWA 1CY7A 1SVMA 1JKMA 2XIQA 5EJAA 4DAOA 2FQXA 1ORVA 4E12A 4F5DA 5FPSA 2YW2A 3GR6A 1JNYA 4QRIA 4P5EA 3R23A 3A4NA 4TKUB 4W9MC 1WU7A 3KIPA 3OSZA 1MB2A 4P83A 5AI8A 3TQRA 4F38A 4R69A 1B26A 1EXVA 1GPUA 3OF3A 2XITA 3OE5A 1PJ8A 3CBGA 2A57A 3KQWA 2NTEA 4GYWA 3VXKA 3A6HA 1F14A 2OILA 3PUIA 2XOKA 5PNTA 4XFJA 4KPEC 2B2CA 3T9CA 5B4TA 4GGOA 2X0FA 2VDMB 3GRYA 3RKUA 3C5VA 3OQPA 4S1TA 2EGGA 4D9JA 4X93A 2ZIXA 3MS2A 1MEOA 4MLDA 4AZVA 4FW9A 2BTQB 2ZP1A 2IUEA 4L8WB 5EGSA 4MV0A 4Z5XA 1XCGB 3BICA 1YQGA 1RW4A 3MJHA 3QBVA 1CJVC 1K9VF 2GERA 2I6SA 2QTMA 3NHLA 2J4CA 3HCOA 4LK3A 2IY7A 2HU8A 5E4JA 4Q05A 1N8NA 2VJCA 1KEWA 4MRVA 1QANA 1A69A 1RWVA 1VBKA 4OL0A 4S2EA 3ZDEA 3DCYA 4WINA 4WNCA 1X1TA 4LF5B 5FADA 3AX6A 3KEGA 1RAFA 3VGPA 1KOFA 3HPRA 2FEPA 2Y1EA 3K9QO 2I4OA 3J81k 4IRUB 3NUQA 3ZE7A 5JPCA 4L4SA 3IUNA 1VA4A 4HXFB 1OROA 1KQFA 3E8MA 5JY1A 2IPXA 3UAGA 1MQSA 2P3QA 1W49A 3W78A 3K92A 5FPPA 3ZGXA 4NQRA 4Y9RA 3DCNA 2BRUC 3T1NA 1NC3A 2QV7A 3KVOA 2P79A 3KZXA 4REMA 3I6BA 4Z54A 2UZ4A 3KRTA 4KWIA 4PX9A 5HKBA 2QIOA 3T1OA 1E3JA 2VNAA 3VZQA 4DKJA 1T5HX 2HU2A 1TCAA 2QJWA 4G41A 2BJWA 2J5BA 3H8VA 2FPKA 3EXG2 1J8YF 3IOBA 3NBQA 1K6JA 4GBJA 4MMXB 5GPBA 4HEHA 3ZNPA 3FRIA 4NV0A 5FPKA 2V5VA 3CINA 2DC1A 3L5OA 2YVKA 4LBVA 4RKEA 2L42A 3IOYA 1A72A 1DO2A 4AMVA 1R8YA 5EINA 2ZUTA 1TAUA 3MWKA 4M3NA 3ZVKA 2YS6A 4RADA 3AM4A 5D2CA 4UATA 2KMLA 1PJ3A 2ESRA 1Z0KA 1SOAA 2YCLA 1GEEA 3EGEA 1KS9A 3RODA 2GM4A 4NFLA 4YT5A 1RWMA 2HDHA 2Z5GA 3ZW8A 3EN0A 1YT5A 3Q6NA 2VZ9A 1M67A 3CJQA 4DGSA 4HZUA 1Z6QA 4DLSA 5JAHA 3BWVA 3HB7A 5FBLB 3VH3A 4P36A 2FSHA 5D3MB 3RT1A 4LQDA 4BJ6A 3EUEA 1A9TA 1EK6A 4FZRA 4KMRA 4B2YA 1AKEA 1N2ZA 3ROMA 3W4IA 5DU2A 2NU9B 4YAGA 1ND6A 2EWWA 3KX2A 1C8BA 1P2SA 2FPWA 5FJIA 1N6HA 3NW9A 1GN9A 4N47A 3ILXA 4IZ6A 5B12A 3KB1A 3W4JA 5BOVA 1WCWA 2D1SA 3P0HA 4PIMA 4LVNA 4AJJA 4MZDA 2OCLA 2V6JA 1DT5A 1V1RA 4WCDA 5AI5A 4EG1A 2VTVA 1NVWQ 3BE5A 5KNBH 2DLCX 3IDSA 3GJYA 5H3HA 4DBZA 2B5OA 4Y9SA 5CA1A 3IP7A 4LX0A 1U0EA 1JYFA 3QNMA 1E1DA 3UTDA 2A9VA 3AINA 5G53C 1GLVA 3DVQX 4Q03A 3LQ4A 2ADOA 4DLVA 3P9PA 2AFIB 5TARA 1JEOA 5DNCA 1PR5A 3UEOA 2CDBA 1H8ED 3R40A 2F00A 2QN7A 2V9ZA 1TUEA 5CG1A 1NG1A 1DQSA 3NU1A 2UZ3A 3IJ5A 4DYVA 3ZHOA 3A4MA 1CDEA 2PKQO 2OO5C 2ZRJA 1E1LA 1YL5A 3D0RA 5A9TA 1WZIA 4DLZA 4S04A 3EXEB 1C9MA 1PWYE 2FUEA 2WJ6A 1FNNA 1QB8A 3MT7A 4OHWA 1U4NA 4Y6RA 3U1VA 2GM3A 2FQ1A 4G85A 1E66A 1MD9A 1PZMA 1Z7YA 2BFOA 3CWCA 3OP4A 3QVGB 5IULC 1K5GA 4RGYA 2Y0PA 1Y7HA 5G0UA 4J76A 4QUDA 3A9TA 3CLRD 1AGYA 1DXQA 3DOFA 4DTIA 3VSDA 2OR3A 5G0VA 4XWWA 1KAEA 3UJ7A 4AS2A 4QXPA 4LY6A 2R87A 2AH5A 4EM6A 4JYBA 4ZQGA 1FFGA 3QKTA 4C78A 3QG1A 2JA2A 1XOIA 3COYA 2R96A 1RXUA 2JNWA 4O6VA 3FKSA 2XGMA 3MGBA 3SVZA 4EHKA 3STHA 3H2GA 3DGEC 4XUEA 3ZE6A 3FDIA 3WS7A 2LV8A 5M29A 1PJSA 3I2HA 2CHEA 4G25A 3K16A 1MH1A 1ZNWA 1LUAA 2IUSA 4CV0A 1R6AA 3IPXA 5I7FA 4C4RA 5IDWA 4FXPA 4R2JA 2P1ZA 3NWJA 5JWHA 2YHIB 3SBOA 4RTRA 4HR7A 3RSQA 3VI3B 4L2IB 4D9HA 4NOKA 1JSZA 1N2BA 4KQ2A 1GTMA 4J8PA 4Z1MA 3TM5A 2B1GA 4MPJA 3NFRA 4AIIA 3DEYX 3JQAB 3FMGA 1NIJA 3D0KA 3L7MA 1QGAA 2PGAA 1N5DA 3PNMA 5ALGA 1N5MA 4GQBA 4LHXA 3ES9A 2H07A 4DC9A 2GEJA 2RCNA 4IIBA 1QHYA 5REQA 2HSDA 1ZH0A 2A0WA 4ASUA 1N78A 3WMWA 5HE9A 4B3RB 4JFAA 4BLPA 4WQMA 3W3ZB 1DAFA 1RYHA 2EJUA 3I0NA 3K70B 1Y81A 3M6VA 3G02A 4FJ1A 3ZDCA 4QYIB 2XCTB 4TL8A 2ET6A 5E2BA 3S2ZA 5FNVB 2XEXA 1BU5A 1FZQA 3NTRA 4E5PA 3JR3A 5F4ZA 3C4JA 2G5TA 1TT7A 3PQFA 5ARDA 4TVSA 1WQ3A 2K4MA 3QUQA 3EWIA 4FWIB 3UGQA 1T0IA 3G68A 3N8NA 3F5MA 3KWFA 5FF9A 2HSGA 4XSVA 2D2IA 2D06A 2GZSA 1LLUA 2P5YA 2XNKA 3AFIA 1H9AA 1V7PC 1IEQA 1NBHA 2FQYA 3DP7A 1U80A 2SKCA 3EQ8A 3DJFA 4LCEA 4X1OA 2ZS8A 4RY2A 3ZWBA 2ASEA 1AG9A 4XWYA 4CQLB 3KQQA 2I62A 1X1QA 1O2DA 4BGUA 4FFWA 3U6BA 4AS3A 1HBJA 2IFTA 3R6LA 5JW6A 1SNYA 3I76A 5KJFA 4ISCA 3QTTA 5AHXA 3V4ZA 4U39A 5HZGA 3GB9A 4JA2A 4RD0A 1IB0A 4BNKA 2E49A 1JDVA 1OR8A 4JLNA 5EUMA 4F7WA 1R0WA 5HWSA 1D5WA 3NFYA 4KU4A 2VSXA 4RKYA 4AKHA 1IWPB 4C6TA 1QOQB 2OZEA 1SH7A 4ZXPA 3ZLJA 2W4IA 2CZCA 1OTXA 1JRLA 2IUUA 3IAS6 1DEXA 3U2QA 3AR9A 5A5GA 1HYGA 2KQUA 1JQEA 4AO8A 5KKNB 2C3OA 2GJKA 5CA1B 4D2IA 2YNMC 2V9CA 1NXQA 5CFLA 3GZJA 1B00A 4HGZA 3A3YA 4FZ3A 2D7CA 1ULBA 4HMPA 4MTCA 1AUVA 5AVRA 1NOJA 2WILA 1O95A 2I2AA 1HYBA 3A3OA 4ZI5A 4Z9AA 1A0OA 1YR1A 1AHHA 1N25A 2ECFA 2GM5A 5DHPA 4BVLA 1RKVA 3GUCA 3AF0A 4Y6GB 2QRLA 1HL7A 1UDCA 4LUCA 4WPGA 1LK5A 1SURA 3IEVA 4CT5A 2JCSA 4BJHB 5JD4A 2PUGA 4UMEA 1ZIDA 4B9AA 3ROPA 4B6GA 4DPKA 4NZZA 1ZEMA 4U2KA 3QVGA 4C76A 1E5TA 1D5CA 2R5WA 3GIDA 4P4SB 2VA8A 2FHPA 1ID1A 4RNCA 3JSXA 2GHIA 3BEDA 3V8RA 2J5RA 2PSFA 3NBUA 1A4UA 3TTTA 3PNSA 4OEHA 1XVUA 4G0MA 2IYYA 4Q4HA 3W2FA 1HV8A 2XWBF 2ZYRA 1DAHA 3D2LA 3VISA 3WGZA 3S0JA 3WMFA 2E85A 4A0GA 5IKMA 1Z0UA 1QPZA 4O4JA 4J94A 1U4SA 4OM7A 2WW8A 2G82A 4CCYB 3EF1A 1YRAA 3HLKA 3HUUA 4IIJB 1E7SA 3ZWMA 4IO1A 3W79A 4GNKA 1ZRHA 5EFZA 1OBFO 5C5EA 3ZV6A 1B41A 5DI3A 5DHTA 1OWMA 3RROA 1PDVA 3W6UA 3M1LA 4IKPA 1DNPA 1QIDA 3QYFA 4TN1A 3ZJ4A 4R1TA 2VT7A 3AZQA 4JUFA 1Q2UA 1WW8A 2HGSA 2IE8A 1WUIS 2DGDA 2PJUA 4MYSA 4RMJA 4YI5A 4HDKB 1G3RA 5BN4A 5C51B 1QQ5A 3LLMA 3ZHUA 1RD4A 4CMEA 4HB4A 4D79A 4BZPA 4QM6A 4OLAA 3QLVC 3ASVA 4OQEA 3DONA 3WLMA 2FR8C 4X6LA 2QM8A 5BV7A 4LYEA 4HDRB 4U7JA 4Y9DA 3NTXA 1Q11A 3GZNA 4PFKA 3M2TA 3LKBA 5CUQA 3SD7A 4FDLA 1T2DA 1E20A 2WMOB 2Q0HA 3AIOA 3S55A 3PXUA 4PIPA 4D9FA 4NV1A 4XUDA 1UQRA 2CJFA 4ZU1X 1SB9A 4PN7A 2WFMA 5FNVA 1PFQA 4UHDA 4C87A 4ZGWA 2C82A 2WJPA 3HJTA 3TLCA 3PX3A 3T7SA 2C5LA 3NTQA 4EF5A 2IIQA 1G42A 3BMNB 2GJ9A 3CLTD 3D7KA 4LV8B 4Z8XA 3SZLA 5BXYA 1F0YA 5F77A 3N0RA 3H3JA 1RC8A 3DEJA 1CP2A 3O82A 1UOOA 4PZZA 5G1NA 1O6FA 1YQUA 1MIOA 4JCOA 1NN5A 3RR2A 4OGGA 2HWYA 3ZBUA 1PGOA 3PNKA 2PKRA 4HGYA 2JZOA 2QI9F 5FV7A 5EJ7A 1YZKA 3TBFA 6YASA 3MCWA 2AW5A 3QUSA 2I4MA 2CW5A 2IOYA 2ZCVA 3JR7A 3RHSA 1JA1A 2VF4X 3EYAA 1EEHA 3BHJA 3BREA 5IBPA 2Q27A 4JB8A 3CX3A 2X4LA 4REQA 1CBUA 3FUXA 4KDEA 3IUEA 3VV2A 1W73A 1U7UA 1LTHR 2LD4A 2YZNA 4JJ8A 4LV5B 1J2EA 3SZUA 4MV9A 1CDOA 3DHVA 1U9CA 3EXHC 5IASA 2FB9A 3PKIA 3SKXA 4EHBA 1Q84A 5K0CA 4QTXA 3KWLA 4MQFB 2ZDQA 2B4RO 3W9BA 4M53A 3ZVLA 1X9IA 1WCYA 2VO1A 5AKGA 2G40A 1HE1C 3NIDB 3VKGA 3A4TA 4MWCA 1O96A 1NW9B 1VIYA 3OCUA 1QYVA 4OQXA 1Z2DA 2Z2ZA 5EIFA 1ZMRA 1JI3A 1UWLA 3RC9A 4BU1A 3L6EA 1EUDA 3U37A 3WJAA 1Q83A 4YRLA 2EFYA 1F4VA 4OJMX 3C2QA 4XEHA 4FYMA 4BV3A 3EPLA 2G9VA 4NE7A 5BWOA 2GHTA 1GDDA 3GC6A 5HSGA 4OUKX 2EOAA 3HNOA 5EXEA 4WDQA 3JVEA 2QVXX 4KNYA 1H1TA 2NZYA 2Z1NA 4TWAA 4DT1B 5K7SA 1WUYA 2UAGA 3O2QB 2IOFA 1MX1A 4L27A 4R01A 5DXFA 4D8XA 5K4GA 1D04A 1TLLA 1NRXA 2UYCA 5EKSA 3OCYA 4KYUA 1ZXXA 1XMQB 4Q01A 2X0EA 4Z7JA 2C0CA 1GCIA 5A7HA 1AMOA 1CNMA 3Q0IA 5TS2A 1YQWA 4QOEA 1PZXA 3WLFA 2R4UA 1L7NA 5JQWA 1XP5A 1TW3A 3CEMA 5GWXA 4GUDA 3SHVA 5LUBA 3QYPA 4PR3A 2V74B 3GGDA 3PHCA 2TRSB 3OU2A 3EE6A 1GFZA 2BI8A 2CLDX 1U0RA 2O7NA 2QT0A 3IR5A 3PXAA 4HL6A 3RF6A 4RD1A 4DMGA 1EXWA 3PGA1 4PY2A 3UV6A 5C1BA 3F73A 2RSLA 2HOQA 5F33A 4N12A 3DHWC 1A88A 1BGXT 1USWA 4X60A 3BMCB 4FD3A 4O0MA 3URKA 5KYVA 2P3LA 2CXQA 1XU4A 4MIYA 1SCBA 3N58A 5KVVA 2NPFA 4MP3A 4P33A 1LGYA 1US8A 1CUUA 2AK2A 5B3KA 1VOTA 5JFOA 1B1CA 2F3RA 1E3TA 2B35A 5IC6A 4URWR 4NBKA 3TTSA 1ILEA 3JWGA 3CNQS 5BWCA 1P3Y1 2Z3ZA 2Y4OA 1HF3A 1VSVA 2HJGA 3SP1A 1BW9B 3EBLA 1SB8A 3AHDA 4OVKA 4TQAA 2ZUBA 5KVAA 1W29A 4KXMA 2QLTA 3VGJA 5A06A 4H4EA 2NZWA 5YASA 1IZ7A 5AI0A 4CIYA 5IAEA 4GC9A 1U8CB 1RYDA 2P9JA 4L6AA 1LJ8A 3C8ZA 2ZE7A 4NDZA 1E6EA 3P2KA 5ICEA 1I36A 1BFDA 1J25A 1D1TA 3NT4A 3FWZA 2MMCA 2AOTA 1TD9A 1TUIA 4QJIA 4HPJB 5DBIA 3MRSA 2F8SA 2NUTA 4YMWA 4RS4A 3VC2A 1JTEA 2RONA 3MSXA 1MQAA 3ANSA 3LYLA 4IDOA 1XNHA 3ZZ1A 3MB8A 1YBMA 1ZSYA 1O9HA 4JJAA 2DKNA 2AKYA 2VVTA 1YDMA 3C7KA 2J9ZB 2OZPA 5HKLA 1G0NA 2O50A 2VZLA 3HWRA 2IIVA 2WWTA 3RDPA 1PBTA 4U9UA 1SXJE 4NI5A 1UBFA 5CMLA 3BZUA 1BD3A 1KJYA 1R0CA 1LB1B 3LHKA 5DEOA 2BGTA 3I9MA 2YW9A 5K1ZA 4F85A 3T7JA 1NVGA 1JE1A 4UEWA 3O4HA 4X24A 2OAEA 4I1UA 4I55A 2XA1A 1I1QB 4WFJA 1TU4A 4Y0VA 5FFNA 3AEKB 4PU0A 4G0NA 2YMQA 2GVZC 5HHTA 2F3TA 3W5BA 3OCXA 4JBLA 3CNLA 3UF0A 2YQ4A 5I9SA 2D00A 2QTHA 2FN9A 2NUPA 1EP2B 3EXFB 3L07A 5T5QA 4E46A 3UMVA 3RJMA 4ZJPA 5KPJA 1IHUA 2YMPA 5KMGB 2GO7A 1W4RA 3OLZA 5DCYA 4JLOA 3CVXA 1LI7A 3MAAC 1CT9A 5KNBD 2QXTA 1LC3A 1VI2A 1ZGZA 5KDLA 3F3YA 1RE0A 3T12A 5BR1A 4EEXA 2AMJA 5DISB 4L02A 2IT1A 2WMDA 2I22A 3AUFA 2H11A 2VBIA 3DVLA 4MXDA 3B5JA 3IVCA 4Q1DA 5LOVF 1ZD4A 3L6UA 4XYEA 3WK7A 5FWXB 2WOOA 3UHOA 4I9HA 2OHXA 4HDAA 2IU0A 1GGFA 3EFBA 1XMPA 2HREA 3CPEA 3KL2A 3K35A 5I7SA 4JX9A 1NSYA 1Q7EA 1XYYA 2IEDA 3HVJA 3NANA 1ZHFA 2YC4C 4F9TA 1C3VA 5CBPA 2I6UA 2QBYA 2VEDA 1ZP6A 3DFMA 3FD8A 4XVQA 3RYIB 4BNYA 2Z2XA 3HB1A 3GEBA 1GUDA 2QVBA 3IIEA 3SMVA 5HS4A 1UAAA 2YNMD 2BFAA 3MGKA 5CM8B 2CXXA 2CMKA 1WXGA 2FHSA 4RA9B 5DSZA 5TF0A 3RUHA 1GPBA 5A3QA 4LF9B 1VBMA 2I7TA 3IELA 2IQIA 4OUDB 4ECEA 1V5FA 3SDSA 4I19A 5DDIP 3WVNA 2WJZB 5LR6A 3AW8A 3WNVA 2Q7XA 2HXYA 3SHWA 5KTKA 5BWLA 2X0JA 3GEMA 3TSZA 1U8XX 2DT5A 2ZJ6A 4BVJA 4Q7QA 3BXOA 5B7QA 3L4JA 3JVUA 4NZOA 1DZ3A 3Q72A 3M1YA 2PH3A 3D59A 3MT9A 5FBZA 3DOEA 1YC2A 1G5FA 1S1MA 1SA0A 5EJ8A 1QIFA 2EKBA 2YC2C 4YYZA 1Z74A 1J9EA 3JY6A 3R1IA 4X66B 4FEEA 4FOTA 5SYAA 2GMWA 3L9WA 4WGGA 1YRLA 4BJ1A 4R9UC 3SE7A 2Z98A 4IQGA 2DP4E 2HSJA 1ETHA 1QLJA 3GYGA 4GRAA 4J90A 2MINA 5GAJA 4ABYA 4Q1EA 1D2GA 2I3ZA 2NZJA 3ZVMA 3IE0A 2IBSA 2Y66A 5B6IA 3JATB 2XVMA 3CLSC 4KPFC 4ARUA 1IM8A 3NM5A 1NNLA 3QKIA 3IQFA 4OHKA 3ORSA 2HZ7A 1ZEJA 3RFXA 1Z5GA 1SXJC 2JATA 4OJQA 5IK2A 1HL3A 2G9ZA 4K1LA 4YJGA 4E5KA 4WNAB 1E2KA 2R7LA 4DMHA 2YHBA 1UR5A 3QOFA 1LQUA 3RM3A 1JYEA 3I92A 1KEEA 2FF7A 4XASA 5I9LA 3V8MA 2AFHB 3TO5A 4RZ2A 1NSTA 2NUTB 3CRW1 3IMEA 5CH8A 1FW6A 1GT91 3OM9A 4DM7A 2FR0A 2GKGA 5ER9A 4C6HA 4OOFA 3GLFE 4XIIA 4OG2A 5TT0A 2WHYA 4G8CA 4CVNA 2XLBA 5HOQA 4J4BA 1CY0A 4HAIA 4ZMRA 4TSRA 4BE4A 4TLAA 3HSSA 4X91A 5KYGA 2PLRA 3TW6A 3LPCA 1AU9A 1QGED 1V9SA 2I76A 2G5CA 3K8OE 3R75A 4JJGA 421PA 4MHTA 1P1HA 2TMGA 3ITDA 3NHJA 1M75A 3AJEA 2OC9A 5FUXA 3DPIA 4TSFD 3OOEA 1YRQA 5KMGA 3TLGA 3E7DA 2RD2A 1TZBA 2FUKA 2HL6A 1TUBA 2ENWA 5F51A 2YINC 3SEZA 4CTNA 1E2DA 2CNLA 1O58A 2P0EA 4W8OA 1L5FA 4NZNA 2HMTA 2V65A 4AAYA 5AFSA 1MV5A 4F2PA 3T3DA 2G1AA 1ZZEA 1EFPA 5U4XA 2VYVA 2QZJA 3OCCA 5BSFA 4UXHA 4G07A 2PFGA 3PIDA 4IVRA 1RKUA 5IJ9B 3LG2A 2G1UA 2Z8YA 4DIBA 4OK3A 1CG6A 4R1LA 2BGKA 3IDAA 3DZGA 3O0DA 3R3UA 2DERA 1PFKA 1AMUA 1J97A 3LVQE 4PYQA 3DBIA 3IV7A 1GV1A 2PZLA 3OP1A 1U5BB 3K05A 5EVJA 3X2FA 3ZWQA 3U4MA 4IXNA 1OX4B 4X64B 4G1CA 4ZOAA 2W2LD 3CW2A 2IU3A 1M2VA 1W59A 3F6YA 3TX2A 3U4IA 2Q9BA 1U1FA 5KWSA 3NHKA 4O4HF 3E5RA 3JYNA 3OJWA 4TWZA 3AI2A 1XQVA 4NK4A 1TU3A 5DNEA 4L5JA 5KDDA 1G0OA 1HDZA 4RDHA 2Z6QA 1YOBA 4PGAA 2V7QA 1N4DA 1XZBA 4U1RA 4EHIA 1NQTA 2YJTD 3I04A 2JAXA 3K4HA 5EIBC 4EPYA 4RK0A 1R37A 2VHJA 3BXXA 2OCGA 1H2WA 2M6LA 2YXPX 2R00C 1SIBE 3TI9A 3G23A 3TL2A 1R1DA 3UB4A 7REQA 5SZJA 3NJRA 1THZA 1IG3A 3GFSA 3IEIA 4AN0A 2CNKA 4MDHA 1GFSA 1GGMA 4F72A 1YI1A 1DTEA 4N3BA 2DMRA 2SCUA 2OO5A 2XMGA 4JVSB 4AF7A 2PH5A 1XC7A 4NE9A 5LD2C 3NBZC 2Q2QA 4RM2A 4XCQA 3C85A 1T9AA 3RFUA 3RYCA 2YWBA 1BVUA 3HEMA 1AS2A 2A33A 3PNVA 2FPSA 1YUMA 2A0FA 2PL5A 3O3OB 1G8JA 3QLVA 1Z29A 4N0PA 4R9RA 5TC4A 4RULA 3S81A 2FRDC 4OJTA 2FVYA 2MINB 1YJ5A 1S5PA 4YDSA 3L5KA 2J3LA 3BXEA 3W1VA 5HRAA 3O93A 1QH8B 4WERA 4RQUA 3ECCA 5C34B 2QA5A 3CSUA 3OHSX 1FDUA 1W85B 4IQ8A 3AGPA 2E4UA 1PNVA 3D0QA 1P8AA 4RS3A 4M6WA 1Y8QB 3QXJA 1EKXA 1R4ZA 2FW0A 1JJVA 4MDYA 1YMUA 4EO7A 4N1AA 2RCYA 1QR6A 1DCKA 2PYZA 4UHCA 2ZXUA 2XUKA 1CZNA 2ATEA 3PC6A 4MWBA 4BCDA 4CM6A 5K0FA 1DWOA 3AK4A 5H59A 4P22A 2XWQA 5L6LB 3OT5A 4J4HA 4IDCA 2ATIA 4BQSA 4YT8A 4YT2A 3GJTA 4K26A 2EFCB 4LRSB 1KBQA 1KKUA 1L5OA 5BUSA 1Z7WA 2PUFA 3W9UA 4K2HA 5EUQB 4R0MA 5J4VA 1LZLA 1MA0A 1IUKA 5KU7A 5K2MA 1SHUX 1Y9JA 1JZQA 3W8RA 4G4SO 3AVXA 5B64A 2AJTA 1SQ0A 1KAOA 3EK2A 3NWEA 1AE1A 5KAPA 1I6WA 3RYFB 3TCXB 1P2FA 1QLHA 2JJ2A 3GUYA 4I9FA 2FPMA 3I9NA 2I9PA 5IJZA 3GRRA 3PDWA 1MZPA 1HKUA 2H7XA 2G4LA 2GT1A 2P27A 4L51A 4YQEA 4K1XA 3MTAA 2J48A 3UK1A 3ZHYA 1E2IA 1SVIA 2BMWA 5LLTA 1TUBB 2QX7A 4FB4A 5E7IA 3I42A 1MABA 3L93A 4CF7A 3QJGA 1RP7A 2P1DA 4E03A 4BMXA 5FWYB 4H4CA 2ZCUA 5K3AA 3WP0A 1SUBA 4MAAA 2CXSA 4CKEA 1KFKB 4DMUB 4G2TA 1UP4A 1BXGB 1YRWA 4MR7B 1RBYA 1DWQA 4HNAA 4J4TA 2P6RA 5F7OA 1D09A 2NXJA 2VTDA 3QVJA 4P5PA 2HYIC 1UJ4A 4DQLA 4EPVA 2A86A 1PKXA 4RQAA 5T41A 3SIXA 1RHKA 5EN4A 1PW7A 4FFNA 5FUMA 2O2DA 4WKGA 4FOSA 4KV7A 4KKVA 4ARZA 5LYJF 1CFZA 2WM2A 1Y7PA 1PGNA 1X1BA 1RYBA 4KIFA 1K6XA 1Z22A 3B70A 3WWZA 5KYXB 5JXGA 5LYJA 4LZJA 4EK9A 3WL7A 1QIMA 2WIBA 1JQLB 2Z57A 3HWX1 2JARA 1PQ4A 4LMBA 4QARA 2OAGA 4UEOA 3RC8A 2XLCA 4OHBA 1EHCA 3M81A 2G4VA 2WM8A 1Y6RA 3L0PA 3U9TA 1RFGE 1ATIA 5K3FA 3IMGA 1P5RA 1UXJA 1P3JA 4XWGA 1A9ZA 4YDQA 1PK8A 1Q6YA 3O95A 3C5WP 3KTFA 3SYMA 4EELA 5IZ4A 3LUKA 5KQRA 1L5KA 3R6TA 3BMXA 1PI3A 5D00A 1TVKB 1BMQA 3CZ4A 3QLUC 2IYQA 2OKCA 2R6ZA 2Y9MB 3L1IA 3Q6MA 5E6UB 2Z3WA 4AP5A 2DR3A 3FVQA 1NG9A 2B4TO 3QBDA 4FYVA 5IT5A 4BX9A 4X0EA 3IVMA 1XTBA 1ZIXA 5CCDA 4M99A 3B13B 1OFTA 5EKDA 4JBYA 4F4HA 1KDOA 1KEUA 3NEJA 1N0WA 4ZKEA 5GM2A 4UAJA 1II8A 2E4VA 1ACMA 3DO5A 3I0ZA 4OF4A 3OTHA 5D6OA 1SQFA 4EFKA 2BFEB 4YQZA 3N1UA 3R3WA 4EJMA 5KC8A 4YLGA 3TNJA 3T5GA 5G4KA 3G5LA 1HC7A 1DAOA 2E0IA 2E6KA 1F20A 1TMGE 1VLLA 3FNRA 4UUMA 4D4KA 3DTVB 4QOHA 5ETJA 1AF4A 1DEAA 1Z0AA 4WA8A 1VLJA 1PO7A 3H4TA 5BP7A 2YJ3A 1U04A 3I2IA 1JIVA 4R4JA 2P4SA 1XNGA 2GJ8A 1TD1A 2FMFA 2FGKA 4GLFA 2GXSA 3H4VA 3K09A 2CUNA 5TMBA 3SXPA 2X9LA 3T6KA 1TVCA 2BGWA 2ZU6A 4BNMA 3RGWS 2QQ5A 4YPFA 1GPYA 1ZWLA 1I2MA 2I7CA 1C1XA 3KQUA 2EBHX 3PXDA 2PKXA 2JCBA 5G40A 2N0SA 3AJ8A 5ALMA 3HC7A 2YVQA 3E0QA 4ESVA 1V25A 1KIAA 3TLYA 4N82A 3KLBA 5JHHB 1ID8A 3AERA 1E96A 3R5TA 2EC5A 2X42A 3M5DA 2YJ6A 3C24A 1JFFB 3HFGA 4UXIA 3B52X 4CI0B 4DMKA 3W9SA 1XYGA 4EMSA 5JSKA 4I0WB 3EGWA 2Y05A 3RSLA 4DQXA 1O6BA 1N36B 4OHPA 2GZRA 1KHTA 3AJ9A 1O0SA 1XRRA 4LY3A 1JDTA 4HAYA 1OGYA 1W87A 1EUZA 1CZRA 2PX6A 1W47A 2QQFA 3EIQA 4MUHA 2Y1WA 2JLXA 4Z9YA 3AQIA 1EVEA 2MR5A 2H9IA 4EGAA 1G8SA 2H59A 3ZHQA 5AR1A 1E3WA 4F8JA 1NU8A 1MNAA 1N9ZA 3UYLA 3VR3A 5KTNA 3R5KA 1CKEA 1MABB 2ZUDA 4Q19A 1JQ5A 3ECSA 3L8CA 5DXJA 4MVJE 3QFTA 4FBGA 1FZTA 1YI0A 3M3HA 3R77A 4CFYA 3EB9A 3DDWA 1EJBA 2BM0A 3EHEA 3KYBA 3RFFA 3GV0A 3QKWA 1BE0A 2QOEA 2OUIA 1PTKA 4CF5A 1RJ9B 2XKJE 3TTVA 1P5ZB 2XGJA 1O94C 3VPDA 5FUBA 4BFYA 2JA1A 4QDJA 3G2QA 2ZSBA 1U7WA 4JY7A 1G6OA 4OFBA 3WJ7A 1YQDA 3M1AA 1P8JA 1NQUA 2HA2A 5ICGA 3CUSA 4M86A 3IALA 5HR5A 2P9TA 3JQRA 2BZSA 3EW9A 3JYLA 1BMTA 1C7EA 3TZ6A 3LXXA 1MHPA 1QRAA 5LWQA 2I7XA 3RRYA 3VZCA 4G26A 1VGQA 1E3SA 1P18A 2VDPB 4S35A 4NV3A 4U3JA 3IESA 3EQ9A 4TYQA 2X1HA 2WF6A 2WSSD 1E9VA 1HEUA 2XAAA 3TLEA 4CF6A 4P9NA 2CVPA 4MPTA 4R2LA 1FP1D 1AN0A 2BFNA 2GAIA 5CFMA 3QUAA 5KSWB 1K7CA 3C7AA 3G5MA 4W5QA 2B2NA 2PZFA 1SCQA 3LPDA 1TZCA 1DHRA 1W6UA 2CCJA 2ISSD 2PSSA 4XWTA 1N1MA 3UKJA 3MJ4A 2JANA 2GN0A 2WZDA 3JASB 4U6SA 2J59A 4V1CI 1FP4B 1M7BA 5HTKA 1NXPA 5FO1A 4DILA 3LI2A 3NTVA 2WVAA 3II6X 4IOKA 1T4CA 3D7MA 5IJXA 3HJGA 5ES3A 3ROGA 2IELA 1TVKA 2HHCA 4ZD6A 1GZHB 4X97A 3C7CB 5D1HA 3T7CA 2XCSB 4WZBE 4PN3A 5CG2A 5LNK1 3CF0A 1U7DA 3NETA 2AI3A 4OQLA 3QPDA 5P8WA 1B8NA 2RGUA 3H7IA 3KJZA 1K6IA 2H7YA 3S99A 4Z3DA 1XQ6A 2EZTA 3AFMA 1CSEE 3MWLA 1IBSA 4UCQA 3L8YA 5AK0A 5KYUB 3DE0X 1C0LA 4IIYA 2EJCA 1N2CB 3C43A 1JJBA 3JRWA 4C06A 1UMDA 3KSZO 1XF9A 4CM5A 4Q1CA 2H18A 3O8LA 3ZNOA 3PEFA 1QGDA 2QR2A 3PD7A 1GGKA 1THMA 2FGJA 5BT8A 1L8XA 2H7CA 4LJSA 4MWDA 1GZSA 3BIOA 4NNJA 2GUGA 4BDTA 3NS7A 4MO2A 3P2EA 4TMWA 1CS0B 4Y2TA 5CT8A 1AK9A 2XGSA 1PVVA 1ISSA 1T0JB 4XVCA 1BOOA 3CXRA 1SEVA 3W4KA 2PWBA 2Q6IA 4CV3A 1VL6A 4CM4B 4JZKA 4TS3A 2OYRA 5GV8A 4S3MA 5EIHA 2NVUB 3CEPB 3A6EA 1EAMA 3JQ8A 2H0RA 4MVJG 1QZZA 2HV8A 3Q3CA 4A6EA 4DIUA 1DMRA 5F73A 3UBTA 2Y99A 3DH0A 3KTDA 2Q7OE 4MNTA 4C05A 4NMHA 4QGGA 1T3GA 1Y3CE 4K05A 5HYVA 2VYFA 1CR2A 1WHSA 1TFUA 1V47A 1VRVA 3CWQA 3B2EA 5A7GA 1JEJA 2IZOA 3R7AA 2C1XA 2M9MA 3PEUA 4OL9A 4JBHA 2VP6A 4G81A 2VHVA 1BJRE 4DMLA 4Y1RB 1XDSA 2GHQA 3VPXA 1F8UA 4PZAA 4BLOA 4POAA 2H2HA 3DMGA 1U7PA 1K8YB 1XIVA 4A7PA 5TMPA 4B33A 3VNSA 3BMOA 2VYCA 3AC0A 1T9DA 3G2LA 3P71T 3O90A 3NOQA 4LNUA 3S8MA 2Q8NA 1HY3A 1T91A 4Q7JB 4KR9A 2X77A 5K8IA 3QVMA 2VJAA 1XPUA 2Q6LA 5TV2A 2DCMA 2VDVE 3G0BA 2ZI6A 4O5OA 1J09A 1UPCA 3EC7A 4BFXA 4WBNA 4HDOB 2IX3A 2V58A 4GWLA 3N3AC 4G5HA 5T6MA 3G49A 1GPWB 4IXWA 4EHHA 1N32B 3B20A 1Y3AA 4AO7A 5KJCA 3F74A 5KSOA 1EP3B 4X61A 4BDSA 3TOSA 1TOAA 2GEDA 4U7WA 3PDCA 2QJFA 2R97A 1FXWF 4HHEA 4P0PB 1BFKA 3H86A 3JQ7B 1PFGA 3PJRA 1ENZA 1RABA 1GQFA 4CG1A 4BU0A 4S1WA 4TOIA 1XEAA 4UQPA 2IOFK 3EMBA 3FHOA 1F6BA 1EK1A 2I1LA 3EA4A 4D74A 4E14A 5AVKA 1QO9A 3ILHA 4KPGA 4O4IB 5EY5B 4DSNA 4BATA 3ZYZA 1IBKB 5F98A 2VPPA 1QONA 5JATA 3D02A 4OB7A 4WLFA 4FFBA 4ZVTA 1YQ9A 1FP4A 4U6QA 2C2OA 1DX9A 2ZAYA 2ZJ5A 5ESDA 2ID7A 1NVKA 3FMVA 2BR5A 2REQA 2GGSA 1T4CB 4GG1A 4PTYA 5H7XA 2H31A 3RTEA 2ZPAA 3EBPA 4DIMA 4EB6B 3PDHA 1QP0A 3QPWA 4YNBA 3QNWA 3STYA 3ZCPA 4KWHA 1TC2A 4C08A 4C0JA 2O2XA 3P9XA 1OXTA 4DXAA 1L5MA 1KO7A 1LTKA 4RXTA 4QDTA 1B73A 2F3UA 2H4WA 2W5UA 3VYRB 5HFAA 1PFUA 2G1JA 2VPIA 4RX1A 5BUQA 4IJVA 3O9MA 3PQ3A 2JCXA 5DPMA 2AJLI 2B61A 1PSZA 1SKYB 3D0OA 1C0EA 4PO1A 5IYZF 3SZRA 4AMZA 3MD0A 2RH8A 3UAWA 3KQYA 4DOMA 3I1YA 4YMUA 3UHJA 4X92A 3GLHB 4YRBA 2C3MA 1N2CA 3GA0A 3HA5A 4Q16A 4QBIA 4Y6OA 3WGGA 1XRNA 4BFZA 3NKVA 4OJYA 2F90A 2WYIA 3SX2A 4DG9A 721PA 3LOQA 5FBHA 5ERYA 3IYLW 3IGFA 2AUTA 4J3FA 2I6QA 4DWOA 3WL8A 2HXSA 3CW9A 1B4DA 3ND8A 1MCZA 2DQYA 5H70A 4J9VA 2V6FA 4AY3A 3BKXA 4UQOA 2Q3EA 3VC1A 4NF2A 4LWZA 4ZV7A 4MW1A 3ZJUA 2NYAA 3HSKA 2VKQA 2EW2A 1YS1X 2AZMA 4ZEVA 1AXRA 3JARA 2IYNA 2BKUA 2P78A 1ZUNB 3GYBA 2AS0A 2Y27A 2CK3A 3GFBA 3HG7A 1M34E 4JLKA 4M8NE 1QRDA 3LQQA 1P4GA 3RC3A 1YHYA 4L4YA 2IH2A 1JR3D 2WTNA 3V32A 1EB8A 4ITUA 1RZRA 3FBTA 3EZFA 3TVDA 3MTJA 4ZAXA 1QCYA 1S2OA 2GBLA 2Q5HA 3BMQB 3F6RA 3GMSA 2FW1A 3BSYA 3JQBA 1RBQA 2HX1A 2YOFA 3OLYA 4RACA 4R3WA 3GLUA 3VSEA 3K72B 4V0NA 1VZ3A 2XT9A 2J7KA 3OCVA 5TRTA 2WI8A 3V00A 4DM4A 4EHFA 1NGSA 1XYVA 1TMYA 1CP3A 1GSOA 2JJMA 3M4ZA 4H3HB 3ZIAD 4R7TA 1DV1A 3BMOB 3DD1A 2IHYA 3L0ZA 4DJTA 1V6AA 4J0KA 1EU1A 4PTZA 3PDUA 1YR3A 2PN1A 1DJQA 1F2DA 1NOIA 2ODAA 5AI9A 4CL0A 4B32A 3U44A 4U7PB 4MVCA 3EIOA 1ZUD1 3EIWA 2X3UA 3OFNA 5MHTA 4B2IA 4KN5A 3U4AA 2C0PA 1IUPA 2VG8A 3CH5A 3O0TA 4OBEA 4KHPB 1ML4A 2QE7D 5AW8A 3D6NB 1AS3A 2CGEA 3F4BA 3EDQA 1VIDA 1RR6A 3R3SA 5EQFA 3C8UA 3LQ2A 1OB5A 1SXHA 5EPOA 2I2BA 3CH4B 1M76A 1SBTA 3NZEA 3WBJA 4J1QA 2P40A 3PD1A 1TNDA 2C58A 3Q8WA 1JEYA 2EDAA 4I4TF 4I55F 3P2OA 3BK2A 1FNCA 1QC5B 2KM1A 2ZVJA 4PE5B 4ZOBA 1KWKA 1YA6A 3CMCO 4MS1A 2IXDA 3DC7A 2GPYA 3PA8A 2WF9A 1ESZA 2ZSKA 2WZCA 4XDYA 1LPBB 2ZRKA 2WFZA 3EQ6A 3CUKA 3NG1A 2DFNA 5D87A 4I36A 1INLA 4I2NA 4ND4A 4CT4B 1ESNA 1XZ8A 2MIIA 2V4MA 2H48A 5LP6B 2EW8A 5JE8A 1K97A 4MVXA 3GLIA 1OX5A 5IH3A 1Y7LA 2JBHA 3IA2A 1PJTA 2QX6A 3L7IA 4AJIA 2W2LA 4CM8B 2FRDA 2XSZA 1UKBA 1NYQA 3I01A 3NOOA 3AILA 4MVJH 3QX9A 3ZE1B 1DTWB 4E1AA 4HNQA 1L7DA 1XQWA 5CW1A 3USES 5K6AA 3HP7A 1CVRA 4WGFA 5CM2Z 1OLUA 2HBQA 4FFBB 1RWOA 2P11A 2GRUA 4TKLA 4B3JA 3A1DA 4UM9B 5A4AA 5C8DA 2Z6VA 2HNKA 3OX4A 1LLCA 1IM5A 3H42B 3IP3A 3UJHA 5K3CA 4A16A 1GWNA 1RZ3A 1P9OA 1PD0A 5CCEA 3AF6A 3MA0A 3QVWA 2NP6A 4BQRA 2N1BA 3D3JA 4Y2PA 1UMCB 2ASVA 1M1XB 3MTEA 2XVZA 3TF5A 1NJ6A 3ZPXA 1PHRA 1T4GA 1UPBA 1JJIA 4V38A 5DGDA 4HTFA 1LD3A 4QBKA 4ZC1A 3OZCA 5TXGA 4D8WA 1HQDA 3RLIA 1LSUA 2H17A 4NJMA 3ZS9A 4WK2B 4B34A 1I33A 2G3YA 4KLZA 4JC5A 4HNGA 1XVIA 1KFCB 1ZRMA 4HS9A 4YDRA 1NW7A 4RV4A 4YMLA 2DWCA 5FPYA 3DAYA 4OLHA 4Q12A 2ZJOA 2OFPA 1Z2PX 1O4WA 2ZWPA 1RE1A 5CX1B 4WLEA 5DMHA 3DKPA 2BBTA 4DC1A 4M8SA 4TWRA 1OXVA 3CV3A 1KWGA 3M82A 2I7VA 3LX5A 1NW6A 4FYYA 3THYA 4FDUA 2X3YA 5L3RA 4R1SA 3JXEA 2ZDGA 3DZIA 4TQGA 3T1YB 3V8BA 1GCGA 1IY8A 1C7JA 2VHQA 1DG1G 4ARIA 1Q21A 3L1KA 2ZIEA 4GQIA 4QGFA 4C3OB 3TDNA 2PM8A 4XLZA 3QKRA 4PAWA 1CUBA 1NATA 3A25A 5GQSA 1NJGA 1MT0A 1OZ0A 2OXCA 2UZ0A 3ZTYA 3TRFA 3GAFA 3KB6A 1A8HA 5KYWB 4HKTA 1HOXA 4YO7A 3ZCVA 1T6YA 5JSZB 2VJKA 3B2QA 3MN1A 5FOVA 4LJ4A 5ALSA 3QVKA 1G59A 4HP8A 3ENWA 2YRFA 3SGLA 3HXOA 4CDNA 3KKOA 2D5BA 4A27A 3ADBA 1XHEA 4NBLA 1T8RA 4P34A 4AYTA 3LTNC 5EWLB 4UU0A 2QSZA 1X86B 3H5RA 1DB3A 1J8VA 1WSBA 2C7QA 3GJRA 1SZJG 4MQUA 1K89A 5IEJA 3HHEA 1GILA 2QN8A 4JKYA 2CMDA 2XYPA 5AM1A 5SV2A 3O8RA 3GT4A 2Q6VA 3KWMA 1FK8A 2QNBA 1YTUA 5JVDF 1LZKA 1DC5A 4NL4H 5B57C 2BFDA 1X1AA 1F9EA 1XWIA 3LQYA 3S4YA 1CDZA 1JHOA 2GETA 2FZCA 1Y63A 3B1FA 1KC3A 1Z4LA 4IDGA 4EY8A 5BY2A 4DV4B 1ZRSA 1X42A 2XKBA 3SMQA 1Q77A 3KT6A 3MILA 4HWOA 1C0KA 2WKQA 2J6BA 3K3PA 4YH1A 4RTOA 2D2FA 5DI9A 3FYCA 2GZHA 3EIFA 4TZKA 4WZAE 1DDOA 5B1HA 4B8YA 1LBTA 4EGJA 1KVQA 4ZOQI 4DCUA 5TDHA 3D3EA 3ELWA 2ZUWA 4Q47A 1Q19A 3KP1A 2FI1A 3K53A 2Q45A 2V45A 3FCAA 2W37A 3L8MA 3NCTA 1NXVA 2ZE8A 1Z47A 2P3OA 3PUHA 1BDBA 4H6WA 1J23A 1YB1A 2PGDA 2VAVA 2HMYB 2YUIA 3MMNA 1Q44A 4TTQA 1C9YA 3IAHA 3QKSA 2Q1YA 3H6HA 1T4MA 3THOA 4E21A 1TIKA 3C74A 4DS3A 5JZVA 4HUQB 1K0UA 4CM8A 2PKWA 3H5VA 3PSAA 3ESAA 2VHEA 2XMCA 1EVJA 3LS2A 4LDNA 1TKRA 1VL0A 3RVQA 1NN0A 3FCEA 4C4TA 2QZ9A 5IDXA 1BU8A 5DEIA 4UAUA 2MCFA 4HFNA 1E32A 4B6EA 1DP4A 3EMVA 4ZJZA 4LVCA 2WE7A 4OGWA 5LP1A 1FCJA 4DIEA 4EKNB 5A02A 5KYNA 3EXHB 5HG0A 2Y1LA 3KLPX 3CLHA 3OIFA 3RW9A 10MHA 1KIFA 3QFCA 4X3OA 1DCFA 2XYGA 1QB7A 4ZQFA 1RLOA 3QLUA 3WGQA 4LHEA 3CX6A 2WT4A 4YCDA 1HKHA 4GP7A 1YIAA 2RGRA 1U0OC 2FA9A 5ALHA 3ZGNA 1M9NA 1PFYA 2HCTA 4UVEA 4M76B 3IQHX 4HX5A 1DEOA 4TMTA 1PK7A 4CMEC 3E23A 1ISGA 2O5CA 1CUZA 1XGKA 1IZ0A 1H8EA 2J0UB 2OAQ1 3K2EA 1PS9A 4EW2A 3MJVA 4AX4A 4UOEA 4BUZA 1X7ZB 3O4JA 2PSHA 2ST1A 3HKEA 1T29A 1AKTA 1E3MA 4TTPA 3PTZA 4KHZA 1C1DA 2LKDA 3V7WA 1NLUA 1A3CA 3QNUA 1DDIA 2W6OA 5TX7A 3OQMA 5T57A 4D8TA 2TMKA 5A0VA 2WPDD 3U1TA 5IANA 2VQ6A 4O25A 3OIWA 3K7EA 3GJSA 3A2NA 4Y2VA 1RMYA 3GLGB 2XNSA 2B94A 3IB3A 1T9CA 3LY9A 1B8PA 2OYSA 4O02B 1V5EA 2C2GA 3U26A 2IXBA 1TO1E 3HLTA 4KXUA 5ITZB 3E22A 3GOHA 2KJQA 3PKZA 1Q3KA 3UA3A 2OZLB 3ZD9A 4EAQA 5CDFE 3QW2A 3UT0A 1GSAA 3GJ3A 3N0WA 3FHJA 2P9EA 2XMSA 1U11A 3QSYA 1YI8A 1UKCA 2VSNA 1QDLB 2RB5A 2VSOA 2PJZA 5ITSA 2DAPA 3M8KA 1G2QA 4LNAA 4JHLA 2EL9A 1Z3CA 4GLJA 1WVIA 1SN7A 1YKGA 2FSVA 3O9VA 4X7MA 3SDBA 2PUVA 5KYYA 3ZDYB 3L4SO 3K0AA 1TCVA 1IATA 1E1YA 3ED5A 2ZM5A 4Z7NB 4FCCA 2CFSA 1YS2X 5LFAA 3MWGA 4UTPA 4OK6A 1LEHA 4A82A 3AUTA 3NRCA 4JLJA 1L7RA 1JBQA 3WLEA 3AHCA 4X1IB 2VQDA 2L2QA 4IQFA 4RD6A 5KJEA 1UC4B 2XH8A 2F8TA 4HRYA 2CXTA 2WU1A 4NBSA 5E4TA 3UNXA 3EPJA 3COJA 3VZDA 1KSHA 4P7GA 1OLXA 4DEYA 1YU6A 4FT2A 2A94A 2WG1A 2O8EB 5CNJA 3LKDA 4DWVA 2Y2VA 3FR7A 3VR0A 1TJYA 4BN4A 4KFTA 1DJPA 1KYXA 3VBCA 3U7IA 4YRMA 5IM4F 1YNOA 3AVPA 1TEXA 2RBEA 3EVGA 3FMFA 3QHAA 2QTBA 4EA8A 2YIMA 5TMEA 1Z7GA 2Z9CA 2VKTA 1NAHA 1U2PA 5IFKA 5JCXA 3CGGA 2TSYB 1T1JA 2HQ1A 1F1JA 3LY5A 5ALYA 2VDQB 3UJ8A 3VR2D 3P94A 3UAYA 3GQBA 2OXRA 1OY1A 3RAGA 5JLJA 3NWPA 1J0AA 3O91A 2PE5A 1I8TA 3ZLTA 5JS2A 2I67A 1YD7A 2AKEA 4H08A 5K0NA 2YR0A 5HGXA 4KV9A 2GXAA 2RH4A 1MN6A 4OMCA 2AT1A 5AKZA 3CH6A 4RV5A 1AZWA 1HLPA 3ADOA 3FJYA 5L3VA 1FSZA 2IRWA 2R84A 1IEWA 1SD2A 4OA5A 1DAKA 2GN8A 5LIPA 4BVGA 3PFFA 3SSOA 3PPYA 4QU5A 2CKDA 4ES6A 5FV4A 3WYGA 4IIDA 3FGNA 5LOVA 1UOQA 1XRJA 5E6RA 2AXQA 5FTJA 3CLRC 3Q7PA 4D6XA 2NU7B 1Q0HA 2Q8QA 2VLIA 1IQUA 3L0SA 4GC5A 3RUAA 3RVBA 4DJJA 2ZYGA 4IX1A 2VRWA 3T0IA 3M6FA 5ABPA 1FFYA 2PX8A 1THGA 2C59A 3MMSA 4CMBA 1DEHA 2FPPB 3FETA 2PT5A 5A2GA 3HDQA 1G6Q1 3HDTA 2OEPA 3TZHA 1JSXA 3Q85A 4R2MA 1UQTA 5AK6A 1Q12A 3U7QB 3TX6A 1Z45A 2F17A 2QG6A 3UTCA 4F5WA 2VYND 5C4IA 3FLAA 1ZR2A 3HCBA 4H7IA 1H5UA 3RVKA 3ESBA 4DEVA 2ALJA 1L6RA 1T9GR 2QENA 3DAOA 1OD6A 3ANXA 1RQXA 2QL6A 2GZ3A 3NPAA 1XMOB 1N57A 4TL9A 4KOEC 3F5QA 3L3BA 1GARA 3LT4A 3FUCA 4ONEA 5E0OA 1E9BA 1Q1GA 1X94A 3W2TA 5JOQA 3L43A 2WHXA 4MLZA 1V48A 1M3SA 2WOJA 5AUOB 1U0FA 2CDRA 4IIXA 5FFMA 3GCWA 4FOOA 3TDMA 3WQSB 5HX7A 4LDQA 1TJ5A 2B8JA 1G5QA 1ETUA 4CMGA 4UOQA 4F1KA 2ZJ0A 2FEKA 3IXMA 3PR3A 2RAPA 1ESCA 2QW8A 4WXPA 5AJTA 4DCPA 1OILA 3EF3A 3ONFA 5JSYA 1PG0A 1Y37A 4QUAA 2FPIB 4Y2HA 4JMLA 1H8HA 4RSMA 5CXXA 2VNHA 3WG9A 1E18A 4EG0A 2JKYA 2OHVA 4M83A 3O8CA 1WBDA 1NW3A 2M32A 4H17A 4E5SA 2GJ4A 2OBBA 3L7DA 1N1DA 3PGKA 4XB6B 1EWVA 2P62A 4V0OA 2Q4BA 2LXNA 4K8RB 2XUDA 4CLDA 1QU2A 1J39A 1KSFX 3DMPA 1EHYA 3B1KA 2AHRA 2H00A 4ROTA 3N2GA 5SY4A 5EHZA 2XVAA 2GXUA 3D4OA 1UIRA 1J1ZA 1ZCJA 4Y3UA 3ZCTA 1U3VA 1USKA 4F71A 1WS6A 2IOQA 1QS0B 4KFRA 4D92A 3HCPA 4OA8A 4PFSA 1OWLA 3R5XA 4OMUA 5JADA 2ODEA 4EVSA 2EIXA 3RI3A 3V7FA 2VQEB 1K06A 1Y98A 2O4CA 2FG6C 1MT3A 2C5BA 3PP8A 1S3SA 4PHTA 5CA0F 1KMIY 4Q6WA 1DINA 3KPUA 3Q88A 3UAXA 4NY1A 2DPGA 1B43A 2X86A 2XNHA 4YASA 4Y1EA 5LZ5A 1GKYA 1Z6XA 4MRRA 4CUKA 2O8EA 4QNRA 3RK1A 3UH1A 1YCDA 2ZJ3A 3REGA 5AM0A 3OPYB 1GAQA 1UZNA 1BO6A 4D4LA 3EGXA 1ZH8A 5DTEA 1QCDA 4L16A 1NVTA 5HCIA 2GOYA 3GJ4A 4G1EB 3N70A 1IZZA 3EOBI 5ALKA 3Q40A 2ZVPX 5JVDA 3FNFA 3NDIA 4OQNA 4WKOA 4M9ZA 3GQBB 3AIIA 1TCCA 4P98A 1BYUA 1ICIA 3RIMA 4L5CA 4URHA 2BMFA 1FJHA 1Q91A 2FVXA 4I5GA 1IMOA 2B1JA 2NAPA 4JQZA 3PPXA 4MHSA 5AXBA 3N2KA 3REQB 2ZAGA 3DSRA 5E9WA 4J7AA 2IWRA 1GTZA 3EFOA 3G7SA 3IMFA 4MAFA 1YJQA 3OQ1A 4V0KA 1EX7A 3ZJYA 3FM9A 1ZD1A 2FKNA 4BC1A 5BR4A 5JTUA 4GOKA 5GGXA 1HOTA 5FA8A 3NTLA 4E11A 5KNBA 1J2YA 1Z4KA 1ZD3A 2WICA 3QFRA 4P92A 4D4IA 2IITA 1QX3A 2Q3LA 4Y8VA 1D2HA 1SUPA 1YHNA 4PYJA 4OV6B 3QI2A 5BORA 3LL7A 2X2OA 4UDXX 4X5OA 3EZNA 3TKLA 3ZZUA 3G82C 3MSCA 4I9GA 4D4HA 4DCVA 1O03A 1UZAA 3ZI4A 2RKWA 3WLAA 3W2IA 2ZJ7A 3W1EA 5JYEA 1Z15A 3Q12A 1DUIA 1DO0A 5I5EA 2O3QA 4M88A 5A0FA 3FUVA 3LDHA 4TSKA 3GPLA 3DV0B 3CF6R 3GCGA 4QOFA 4EH1A 4XQCA 4Q4JA 5ICMA 5E1MA 3OQJA 4XWKA 3TECE 1I1OA 1R15A 3GEGA 5THKA 1WP9A 2XYHA 2ZUEA 1I6KA 3SYTA 1SXJD 3AR7A 4OHVA 2QHXA 1QYIA 1YB7A 1PLLA 2WV9A 3VR4A 3UXMA 3SJ7A 1M2NA 1V2HE 5L6MB 1EFAA 1GT6A 2WK1A 1IE3A 4IDFA 4LPKA 3ZDDA 4PLZA 4BFCA 4IINA 5TVKA 1FW8A 1W0JA 4H7FA 5KQGA 3PNQA 4IRXA 5EKTA 2NXEA 1UT5A 2PGXA 2PVPA 3D4LA 2QGZA 3IAEA 4GWGA 1NOKA 3UZUA 3RV3A 2OO7A 4YJ2A 3AL0C 3P0FA 1GLGA 1W35A 3STVA 2Z09A 2D5IA 4ER7A 2YWDA 1W8IA 2G07A 2G83A 3HEBA 1P81A 2JBWA 1FS5A 3AF5A 3NBMA 2COEA 2HQBA 4HCJA 1ADGA 4JI1B 5B3JC 1LVHA 8OHMA 5BSKA 1XROA 4JXJA 4QO8A 5FNZA 3LJKA 4PC2A 1RU3A 1UK8A 2ZIXB 4QSHA 1V26A 2CVOA 2PZJA 4J0CA 3WWEA 2I2CA 2GBCA 4LJ9A 1M0WA 4JL8A 1WKVA 1JLKA 2GFIA 3W2EA 3FX2A 3GNTA 1RJFA 2PQ6A 1D2MA 3SHTA 2R6AA 3KE9A 4D45A 4DLWA 5KX5B 1UMBB 2YBDA 1YE3A 4GNRA 1MU0A 3C1OA 3AF1A 4TXJA 4ZJYA 2NPOA 1ULHA 4C0KA 4MI3A 3WDSA 2ACEA 4BXOB 3QRWA 3OPMA 3NASA 4L15A 4UBLA 5IVDA 2YZKA 2VAMA 1PCXA 4KYIB 4DIKA 1XVVA 1VPEA 4K6OA 2FPXA 2PCJA 5FPTA 4Y6LA 2C20A 2BF4A 4QUIA 4U02A 3TBKA 4KREA 3ZUPA 4CMHA 3DL4A 4E88A 5A5DA 4NE2A 3H9EO 1NAIA 2C42A 3PUVA 3PNPA 3CVJA 5A5VA 3QIVA 4QDKA 3LLCA 4O1MA 1U2EA 4CM3A 2Z83A 3CZMA 3TI7A 2QTCA 3OCWA 1K2VN 1KO5A 5FA5A 1ZD2P 3FOWA 3WMXA 1WRBA 3EZLA 4GWKA 2MT9A 3DUFA 3HBJA 1F38A 3IUPA 1CCWA 3K32A 4RDIA 2QRVA 1MORA 4EKDA 5EXTA 2DBVO 4LMPA 3OZWA 1RAHA 4EYEA 5AVXA 3HCWA 4JIMA 3NC0C 2DFKB 3OE7A 4BE9A 3VU1A 1SWWA 3KPYA 4FGZA 3WKBA 2ZJZA 1C8LA 1LXCA 2PKQP 2PU5A 4ZRNA 1L4YA 4AJLA 1E6WA 3FZGA 1ONSA 3LO8A 4N48A 1XEWX 1MRZA 1T2CA 1U2GC 2RHGB 3D4IA 4ENQA 2JHCA 4J0EA 3N8HA 1ONNA 4HZUB 1PEKE 3EXAA 4X90A 3VKWA 4HO1X 2OTCA 2QVCA 1V35A 3HCEA 3LCUA 3RVNA 2GVNA 4IBOA 1KJJA 2RHHA 1J1UA 3K5WA 2XD9A 4OHUA 2A9KA 1QZUA 1UBNA 3UW1A 1I30A 1LBIA 4J0HA 1NKTA 1CPYA 4OKIA 4RCYA 1EVYA 2OBYA 4WEOA 3NVKI 2VWQA 3K9NA 4JELA 4EKEA 1ZK2A 1GL9B 1NF9A 1NIPA 1QAOA 4TRJA 1Y3HA 1WIWA 3FDZA 4P3KA 4WIAA 2F48A 5B1SA 3TQQA 2JGLA 1KI7A 1ZCFA 1JHRA 2V98A 2GO1A 1N7HA 1ZHHA 1GKKA 2B69A 1AZLA 4LKOA 1KDRA 4TMFA 3I8XA 4M0FA 3P9ZA 4L22A 3R7WA 4C07A 1GNQA 3A1NA 3AXSA 5JMOA 1MDBA 5I8WA 2W2KB 1Z33A 5FLXA 4O2AB 3C97A 1IU9A 4MUBA 4H35A 3N8GA 5F7ZA 5L9AA 1ZRNA 2NNWB 5BSVA 1NF8A 2O2JA 5EVCA 4AUEA 1T9BA 3LF2A 4BBPA 1NFFA 3NDJA 2DXIA 3OQBA 3UJAA 3JX9A 1LV8A 2Q62A 3M83A 3CLTC 3IEPA 1MZVA 3IQEA 1Z5ZA 4IIUA 2I8CA 2IW1A 2XJ9A 1I3CA 4DZRA 4M9XA 1R9JA 2CLFB 3LFTA 3ZIUA 7GPBA 3J7AC 1PEAA 2PBLA 3WHPA 1OAKA 2BEWA 1CUGA 1ECBA 2HA6A 2BSQA 1YRHA 1SG9A 3M70A 4BZWA 1XPRA 1Z4QA 2DFPA 2PRJA 2AMYA 1Z0DA 4KBFA 2C03A 2XXAB 4XDHA 3WO1A 2B7BA 2PRIA 4OP3A 1E1CB 4W9NC 3WISA 3E9CA 2O1WA 4AN1A 3WRYA 1GQQA 3TSAA 1LFAA 3T4UA 3WB2A 5HJEA 4NPHA 2AWOA 3B8HA 2WFLB 4PICA 3NQ41 1COZA 2EF0A 3EFHA 3P32A 1DC6A 3VHQA 5AVYA 3MWYW 1VYUA 2GK3A 4ZCPA 3THRA 5KX5A 4RZSA 2PYIA 2J32A 1HTBA 2RJOA 3LRXA 1LDGA 1HE5A 1QYDA 1CZOA 1Q1ZA 2HWKA 2KB0A 3VSBA 5BSWA 1ZQ9A 4D56A 5A4FS 4TTVA 2EQBA 3FRJA 3CJRA 4G09A 1WBBA 5LNK6 4W7SA 4BN0A 4BNWA 4CNQA 3H75A 2Y1DA 5ALFA 5AVWA 4R1OA 1A71A 2QRUA 3R9IA 4F92B 4EENA 5ECGC 3EZYA 4KXYA 3G88A 1RLUA 4G6ZA 2QU8A 1P60A 3R24A 4KBGA 3GF4A 5AOVA 5C1DA 3OOSA 3ETCA 5HKKD 3TMYA 4GL4A 3K0CC 5A03A 2WAAA 4ACAA 2HIAA 4Q3DA 4L3VA 1QHSA 4NPCA 1P0PA 4P82A 3R7BA 4YLYA 1VKOA 1Z13A 2WIKA 3G8BA 5C46F 1DBVO 3ADKA 1N0HA 1XMXA 1VSUA 3GVHA 1KERA 3BWCA 4UE6A 2PSDA 5KTMA 1M2WA 4FNAA 4LQCA 4IL5A 2VJOA 4WBNF 1AT1A 1QKIA 2RGYA 2ZB7A 1HH4A 2HDNB 2L0XA 2H5LA 2X58A 3FZEA 3H9QA 5EERA 1LPPA 3Q3VA 4AJ9A 3HKBA 4AS1A 5C3UA 2X8WA 1JECA 1VMDA 1QO0D 2JVIA 4XGIA 3STXA 3HJHA 2M2IA 1P1IA 2WNSA 3W5JA 2PUJA 1Z75A 1C30A 2KHZA 3OKAA 3QEJA 4DJEC 2OXEA 1JTVA 1PL6A 1M6NA 3ANTA 3PA6A 2BGGA 5C52B 2O7VA 1Z8HA 1YMVA 4QUBA 2NZXA 3A10A 1D2NA 2GM9A 3AUAA 3CUYA 4MEAA 2SECE 3O74A 4XYMA 3ZQ6A 1V39A 3IVGA 2LTAA 3NGMA 1E9RA 1GKLA 1NONA 2R6CA 2VUSA 1QQBA 2JFPA 3LCJA 3OU6A 2OP1A 4QVKA 2GD1O 1U63A 3ID6C 4JUDX 4CLRB 5FOUA 3OUTA 3WQBA 2VAXA 1L8AA 2FSFA 3W6PA 1Z6PA 2YZGA 1UXKA 3H2JA 4RGVA 4R71A 4NCHA 5G4LA 3MS4A 3QV2A 1ZOPA 4AICA 1LLDA 1OI4A 3WRVA 4JU8A 1P0CA 1P2GA 4EI7A 1KBOA 2A5GA 1SBYA 2HSEA 2QWXA 4ON9A 4Q1VA 2Q5IA 2F1KA 2ZSJA 4X3PA 5GJWC 5BW4A 3OOJA 1E7WA 4RH1A 2EGUA 4MMYB 4KLRA 1RJWA 2OV2A 1A9QA 2NNLD 4YJHA 5ALTA 2P2YA 2JLCA 2W2KA 4CTMA 4ZP1A 4DANA 1FQWA 4NDAA 3TOZA 2VCYA 1V37A 4BIMA 4F21A 5CIWA 5K3EA 2CNDA 4G36A 2II6A 1GUFA 4A10A 3H2HA 5EJGA 1T2UA 2HT6A 3M7IA 4AN4A 1VPLA 4PPNA 5FD8A 3TAUA 4DWJA 4IF4A 5IT0A 4TMYA 4XQEA 1DKUA 3ENQA 2ZJ1A 1JHVA 3HGTA 3A28A 3EEBA 3KKQA 1E58A 4FZVA 1UXHA 3DWGA 5KNLA 1G66A 1OWPA 2AI1A 2PWPA 3PHHA 4L5IA 3C3BA 3KSAC 4NENA 3UGTA 3F71A 1XTIA 4OAQA 1F2UA 1T3TA 2E82A 5GTDA 4RIEA 4ZAZA 1FLVA 3S1SA 2H06A 5BV2P 3FPAA 4FX5A 1A76A 1XHFA 3DCJA 4CDMA 4YUYA 1XX6A 2BIFA 1D2AA 2H4JA 2C7OA 1ZIOA 1DZIA 2BI7A 3F6PA 1D1SA 1D0IA 2AEJA 4QC2A 3GLQA 4LC0A 4NWIA 4UCXA 1BXKA 2B1QA 1FQJA 4Q3KA 4QOSA 3M6WA 3VJMA 2R7KA 3WTCA 1FTSA 5KNDD 1EFLA 5JAZA 4TWIA 2WQ7A 1JP7A 3U6KA 5DI3B 2VUIB 1RAGA 4WK0B 5FI3A 5H9VA 1TI7A 1W2WB 2JIRA 3DMHA 3RRBA 4BMOB 4AB1A 4F5EA 1B76A 2ODNA 3GGSA 2BGJA 1IBLB 1LPSA 1EJ2A 2NU6B 1DBPA 3WLLA 1AF7A 2OLEA 3MOGA 1NHGA 4GXRA 4P86A 3L6DA 4BLRA 1SO8A 4NH0A 2RB4A 5FAXA 3GZNB 1T1RA 2TYSB 4P84A 1GR1A 1OXSC 1W1IA 2FXVA 5HM8A 4DNOA 3KWJA 5B5SA 2OCYC 4AJPA 3GGPA 3LP8A 4A6PA 4DLYA 2WU0A 1C0PA 4LJYA 4N5MA 1ECPA 4CM1A 3ZU5A 1DX6A 2VDWA 1PWZA 4KQJA 2FP4B 5ALOA 2FFAA 2JASA 2WNIA 1K88A 3NTOA 2F7SA 4R1QA 4H6XA 5JSHA 4W5NA 1GXSA 3GEPA 5C9ZA 5AXCA 5JR3A 2GFQA 3IHKA 2VK4A 2BGIA 3AVUA 1B0AA 1C4OA 1DPGA 2H4XA 3TXXA 1XKLA 5GMOA 2Y9PB 2WC1A 2D1QA 1OHHD 3A1FA 2AQIA 4LSWA 4KO4S 1ABEA 1Z56C 3D8BA 2IS4A 3IUJA 1Y1KE 4AXBA 3GPBA 2AG8A 5THQA 4XSGA 1BDHA 1DCTA 4Q39A 2W98A 5J4HA 2J5KA 3OUZA 3L8GA 4JLPA 5E9JA 5K6RA 1GM5A 3DAHA 2GKOA 1K8ZB 4LY0A 1RQRA 2VRCD 2ZG6A 2YHSA 1VCOA 1IZYA 1PQUA 4FCWA 1AM4D 3ZN2A 1KEPA 4NMLA 1D3AA 4AXXA 4DCOA 3QKUA 3NMUF 2CSUA 4L4RA 4P7KA 1N5JA 5G0WA 3R76A 4Y18A 3TZEA 3WICA 2YYSA 3F2VA 1G3UA 4N39A 4KX5A 3ELYA 1Q0TA 4BP8A 5K8LA 1PNQA 1A8PA 3EEQA 1KZHA 3NTUA 2WUVA 5EG5A 2ZANA 2PZMA 1KKMA 3EQ7A 4RETA 4IJ5A 3UW3A 3GG2A 4YJ3A 2PX4A 4ZDJA 4U8GA 2VWPA 5HIJA 1RM4A 2IDJA 4C7XA 2BWJA 1X13A 3DT6A 3I9V1 4Z0HO 1N6PA 5D3ZA 4EGCB 2ZM6B 3ZVNA 3OTGA 2BBSA 2YWCA 2HIHA 4Y67A 4XI9A 4GYJA 2ZR7A 3H5TA 3BFKA 3IRVA 1PD1A 2BT4A 5JNWA 1A9RA 1UFKA 2B8WA 4ZJUA 3K30A 4PZUA 1UFRA 1AQIA 3CKYA 4PC3A 2PUTA 4NZ9A 5LDHA 4N8SA 2OZVA 2RGDA 4XTCS 5CYGA 3E2MA 2PRYA 3G89A 3UICA 2J3EA 1SHKA 1YUNA 3WZ2A 1VLQA 5AESA 3UB3A 1QH1B 2PMBA 5L40A 2WPDA 1FTYA 1PJZA 3PJDA 4ZVNA 621PA 3LUGA 3QJ5A 2G08A 1CQJB 3CN7A 1TPYA 4AULA 1YJXA 4DHEA 3OQVA 5BRNA 1SOWA 2CFRA 2OQ2A 1HEIA 1LF5A 2CFIA 1U6IA 3CFYA 4I5FA 2IDMA 4DMRA 3DDHA 4GFDA 4Y2UA 3E9QA 4D9IA 4K6KA 2CF5A 1JQDA 5CIQA 3RAFC 2C0QA 2XZPA 2I78A 2C2XA 4JVLA 1QAMA 3D3KA 1LSJA 2R1TB 4GOLD 2RI6A 3MG9A 2D59A 4P3PA 5CK4A 3ITNA 5K8UA 3G85A 1M54A 1TVEA 4K6CA 5AHOA 2WWGA 2A3RA 4JP5A 5BSRA 1SBNE 1RSZA 1NVVR 5L45A 2C83A 3L79A 1O1YA 1BW9A 1JHZA 1MGOA 1JEYB 1LRLA 3E3OA 1YKFA 3OG9A 1R4MA 3B3QA 3IXLA 3A9CA 1TK3A 4AG5A 4KIWA 4CTOA 4F8EA 2YTZA 5KHLB 1OZHA 3H1FA 4YAWA 3G0DA 1OSNA 3ZLBA 5IHXA 6GPBA 3DZFA 5EXSA 1UBSB 5TQ0A 1XZCA 2UYQA 5JZSA 3VVMA 1CS4C 2KS6A 2X76A 3EA0A 3HFJA 2GTIA 2AOTB 4DREA 3KLMX 4GPTA 5D3QA 3WGKA 4D9NA 2HO4A 4X94A 4F56A 1IEVA 5AW6A 4V1CA 2JI4A 4ER0A 1EZ1A 1QQTA 3KOWA 1T8SA 2ZTSA 3ICWA 2HA7A 1VSBA 1P5FA 1MB3A 2NV6A 3BQ9A 1ZBQA 3D2BA 2WTBA 1JHPA 3R44A 3L7BA 5AI4A 3TL6A 2GD0A 3ZTWA 5JBIA 3R2JA 3OTIA 4MW9A 3ZCUA 4NYJQ 1Q7CA 2UYYA 2V7VA 2YN2A 1UKVY 2FZWA 3CLUD 4N5NA 1YR8A 3GMDA 1K2WA 2WD7B 4IWNA 4V24A 5CH5A 2JJ1A 1BGVA 1TYDE 2FWBA 3WBFA 4EHLA 4Z4FA 5FHQA 4I55B 1PJ4A 2V4UA 1CR0A 4HVTA 4BVAA 2IPOA 2BMJA 2W83A 3Q9LA 4Q3LA 1WEHA 4ND8B 4UVDA 1DGQA 3QXXA 2NUPB 3EXFA 4J0GA 5HF8A 4ER3A 1RAIA 1MH9A 5BNZA 1BX3A 3IAUA 2WLTA 3BUSA 1NV8A 2TECE 1PSDA 1F0PA 3VNVA 5K5EA 1B2LA 3HY6A 1EVKA 3IMCA 3WYCA 4CMCA 4D3FA 5HZKA 1TA9A 2PKCA 4FZ5A 1ZK0A 2MSWA 2J85A 4YB8A 4OK5A 3VVLA 1Y3DE 4YJ3B 4ZI7A 3PFGA 2VTBA 3IAM6 2EYUA 3LMKA 1D0SA 4PG5A 4B35A 2CKMA 1BN7A 1DIAA 4C7JA 4AQYB 1S3IA 5JCOC 4DR7B 3C3DA 3VR4D 4JEMA 2I6TA 4F06A 1J4AA 3GDHA 1NVVQ 1AH2A 3MS7A 2OGUA 3OM1A 2CL7X 2VK8A 3BWYA 2FV8A 4WLNA 4UFPA 1JJAA 2RHMA 1XZLA 2FZ5A 2AOWA 1ZGBA 3CZ9A 2QD2A 3EF0A 2O2EA 3IQXA 4OGKA 5DT2A 3SJCA 1O97C 3RYIA 2C98A 3STUA 1QCCA 2O5RA 2UUCB 3DFZA 4KI7A 2CF6A 2XQFA 1VXOA 4B73A 5HEKA 4BAZA 1JG4A 1ZFNA 4RA9A 3RAJA 3QEBZ 1G21E 2R8RA 3LM8A 1JDSA 3NR2A 3VU9B 4WOKA 3L8FA 1AV7A 3I9KA 4XJXA 4JUBA 1AZSC 2QAJA 2IZ0A 4N03A 1Z0FA 4RFSA 3IQWA 1CQJA 1LJUA 3E81A 4YYEA 1JWLA 3V6MA 1F6WA 4ESEA 5DM60 1A4IA 1OPRA 4IMPA 1Y1SA 2EHDA 4XRRA 2CVZA 4JIGA 4KRFA 1GAXA 3T52A 2VF5X 3N0TA 4N9QA 5J4KA 3CNOA 4JX8A 4UDNA 5LL6P 2JLRA 4NK5A 1W5FA 4UHFA 3T4PA 5AO9A 3JWIA 4OHCA 3VH2A 3T06B 1XKXA 5HZHA 2WT9A 4WADA 4Y1FA 1TRHA 3R5SA 5JG7A 3RK4A 4XR9A 3V1NA 2PY6A 2RKOA 4L76A 4GU5A 4H3VA 3W8FA 3BWBA 3HU5A 4WCFC 5MGBA 5JMTA 5HBRA 2CYBA 3H19A 4MPRA 2OB2A 4UM5A 2HRZA 3MM4A 2CK3D 5BN3A 2C4WA 5HNKA 3F46A 2R1VA 1NZJA 1Y0BA 2O2GA 1CTQA 3UK6A 4V2UA 3T9FA 1IY1A