2JG8A

Crystallographic structure of human c1q globular heads complexed to phosphatidyl-serine
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
133
structure length
133
Chain Sequence
QPRPAFSAIRRNPPMGGNVVIFDTVITNQEEPYQNHSGRFVCTVPGYYYFTFQVLSQWEICLSIVSSSRGQVRRSLGFCDTTNKGLFQVVSGGMVLQLQQGDQVWVEKDPKKGHIYQGSEADSVFSGFLIFPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Complement C1q subcomponent subunit A
publication title C1Q Binds Phosphatidylserine and Likely Acts as a Multiligand-Bridging Molecule in Apoptotic Cell Recognition.
pubmed doi rcsb
molecule tags Immune system
total genus 26
structure length 133
sequence length 133
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00386 C1q C1q domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2jg8A00
4G4FA 5HBAA 5L19A 3LKJA 1GR3A 4KGGA 1D0GA 3ALQA 2JG9A 2HEYF 3K51A 1WCKA 1RJ7A 2R6QA 3FC0A 2JG8A 1C28A 4TWTA 2R32A 2RJKA 4N90A 4MXWA 4TSVA 4KG8A 2X29A 1PK6C 4RSUA 4G3YC 4E4DX 1C3HA 2WNVB 5KC6A 2HEVF 2HEWF 2Q8OA 1U5XA 3QD6A 2JG9C 2R30A 4HT1T 1IQAA 4F3JA 1U5YA 1RJ8A 4OUMA 4OULA 1TNFA 5TSWA 4QQOA 2JG8C 1KXGA 1JH5A 2AZ5A 2WNUA 5L36A 3IT8A 1I9RA 3B94A 4GIQA 4D7YA 2ZJCA 1A8MA 4QQPA 2OIIA 3QBQA 3WD5A 3TWIA 1DU3D 1PK6B 5KC5A 1S55A 1XU2A 2TUNA 4QQHA 1OQDA 3L9JT 1OSGA 4NN0A 2JG9B 4QQ2A 1XU1A 1OQEA 3B9IA 2WNUC 3MI8A 4KGQA 1D2QA 1D4VB 2JG8B 2WNVA 4MXWB 4QPYA 4QQLA 5BNQA 1TNRA 4DOUA 2O0OA 1ALYA 2QE3A 3TYJA 2QDNA 3URFA 2Z5WA 2KA3A 1DG6A 3ME2A 1U5ZA 4J6GA 4DB5A 1O91A 3AB0A 3V56A 1JTZX 4OUSA 2E7AA 1KD7A 4MXVA 4EN0A 2WNVC 2ZPXA 4E4SA 4MSVA 5KWRA 2Q1MA 2RE9A 2WNUB 1PK6A 5CIRA 2TNFA 3K48A 2RJLA 3B93A
chains in the Genus database with same CATH superfamily
2GMPA 2QQLA 4RQPA 3FUQA 1UXZA 1N1YA 2PHWA 4ZY9A 3WQBA 4NIIA 3VBSC 1WD3A 3WW3A 1DDLA 3I54A 2XB6C 2ES3A 1VP6A 2R49A 4Y24A 4YVWB 4YARA 1ND2B 2PLV2 4B3NA 4AAXA 3K4DA 3HBZA 2ARXA 1S0FA 2DU1A 2ZHKA 3JU9A 5JAXA 1ZM1A 1UOFA 4GKYA 3AYCA 4NOTA 3T2QA 4UF0A 3AFKA 5I0RA 3TB0A 5FOBB 1DQ6A 5IAVA 5AFEA 3IN9A 1BVP1 1YQCA 4MLOA 3SKJE 5A6ZA 4UT5A 1N1SA 3NW4A 2AREA 5DDJ2 2XLFA 3EXUA 3FFQA 2XUMA 2VJXA 4XF0A 5I8SA 4AI3A 3N7LA 3SC7X 3ZIWA 4CDXB 1KQRA 3WOGA 4Z07A 4QKFA 4CUGA 4CUAA 1QQP1 3LE0A 3VDCA 4IQPA 1BEV1 2WL1A 1D7PM 1QOTA 5L9VA 2XL9A 1H4HA 1QQP3 2VZTA 4CU9A 1BEV3 1ZA4A 3BOPA 1GNZA 5ANQA 4S2HA 3ZXGA 2VOWA 3HWJA 2WNUA 3J7MA 3GBWA 3LEMA 3WF0A 1C1LA 4IEZA 3VKMA 1X9PA 2VZUA 3ST7A 2PHFA 1RGSA 4NROA 1MS3A 3LCPA 2XBO2 2QTWB 3NJXA 2PELA 5FK7A 1GP4A 4CUCA 1R1A1 4XXAA 1OA4A 4S2GA 1K5MB 4RGAA 1G7YA 3Q9OA 4CP9B 1R1A3 3IWZA 4GKXA 4I0AA 2VW2A 1Q8QA 4N43C 1D2SA 3TN91 2WO2A 3AFGA 3WDYA 5FOJB 1GNHA 3POEA 4K20A 4XFHA 3TEYA 3ELNA 2XXZA 3WEZA 4XUTA 3TN93 3U14A 4XXPA 1CONA 2DU0A 2BEOA 2XHNA 2GNDA 4AFCA 1ASJ1 1VBD2 1DF0A 4YW2A 1RL3A 2XG3A 4GD4A 1XNKA 3TNPB 4C0HA 4LBKA 4TLGA 4JHTA 1ASJ3 5BNQA 4FPOB 2WWUA 3KV6A 4YZ4A 5AFBA 4FO9A 2P3KA 1YXWA 4HVOA 4YZ1A 2RMU1 1WW5A 2IVIB 3C3VA 5K7PA 5JPMB 3TYJA 1RUC1 4ISQA 1RUD1 4P9WA 3N9NA 4X6QB 4W6XA 4QKNA 5LCWL 4LLOA 4AI1A 1YFYA 1RUC3 2ZMKA 1UCXA 3EMRA 3NAPB 1RUD3 1NE6A 5FUNA 5T3NA 4N8MA 2VOTA 4V2WA 4OZOA 5I8TA 5DUVA 3LIHA 4W6YA 3OGJA 3D0JA 2J1AA 1YIPA 5A7OA 2ZEZA 4FCAA 3AP5A 4CEYC 3H8XA 3DUIA 1H4GA 2I07B 3ZFEA 4Y5SA 4QDSA 5CNAA 5CFDA 5IVFA 1PHMA 4DXZA 1UMIA 4YM0A 2BGOA 5FV3A 1LECA 1V9U2 3TEXA 4YYOA 2G1MA 2EIGA 3AVSA 3L2YA 2LROA 4EWAA 3VBFC 1Y9QA 3ALQA 3HQXA 4DFSA 2MPFA 2VBBA 2VMIA 3T08A 5DZEA 3KHBA 1KFXL 3POGA 3WR0A 2XJSA 5FO7B 2R6QA 4IV3A 4K21A 4QHBA 4ASLA 4DNYA 4FAHA 2Y6HA 2WQZC 1MZ5A 1SLLA 1S2BA 1SPPB 2JG8A 1AX0A 1OFSA 4AGVA 3GHMA 1UU5A 2W46A 4P9JA 2OX0A 4AFBA 4I2OA 3M4FA 4N53A 1MEC2 3D82A 1ZREA 1KITA 1D4M2 4RR3A 2VE1A 1WW4A 1NA1C 4QGNA 1XYNA 4BDVB 1AXZA 4UW5A 4COZA 1C3HA 2VUAA 4KI5M 5LWBA 2BNNA 1QGLA 5C4WC 5CEHA 1QNWA 5A1FA 4Q4Y1 1DZTA 5IFPA 1H8VA 3WF3A 5FY9A 4Q4Y3 5ACA3 1W8TA 3VBSB 3THDA 3VD9A 1DBNA 1TNFA 3HAGA 5HPOA 2VZOA 4ONUA 3ZYBA 1JOJA 3AKTA 4WM8C 5IK8A 1WWYA 1WUVA 2K2SA 2OVUA 5FYIA 3T0BA 4A42A 4FXGB 4DUWA 5L7OC 3FWEA 2ARCA 4S2DA 1CAVB 1HXS1 2FCTA 2QQMA 4XOGA 3W59A 4FFGA 1Y4WA 1YNAA 2IZWA 2VBPA 3VKFC 3WD5A 3J4UH 1HXS3 2Q0AA 1VBE1 4OI4A 1RIRA 1LTEA 3E6BA 2CL2A 2WN3A 1LULA 5FMBA 1VBE3 4QQHA 3OPWA 4H55A 4AVAA 2VL4A 1UZVA 4XAEA 2DUQA 2SLIA 2VZ3A 1E5HA 5IK4A 5E16A 2P3YA 3KCXA 3TEZA 1EPZA 3I59A 1URXA 2QDRA 5I0SA 1JOPA 5DAWA 1UL9A 3WG1A 2HWB3 4EROA 3ZYFA 3GZEA 4D8MA 1D2QA 2GH2A 1H1MA 1H8TC 2HYKA 3I2GA 2UU8A 1A8DA 1OF4A 3A0KA 2ZKNA 4CSWA 3SHRA 4A2UA 1SHWB 3POYA 3MICA 2BTVC 1UIJA 1X33A 3UKTA 3RZHA 3AP7A 3MHZA 1A78A 4XUOA 5FTTC 1DYOA 2PLV1 2J1UA 4RN5A 4MVTA 2WO1A 3ILNA 3NNMA 1MVQA 3TBDA 2B7YA 2PLV3 1BJQA 4LBMA 3N35A 4XF3A 2P4EA 3OEBA 2KA3A 3RYPA 5FZ3A 3HT1A 3PURA 1PZ9A 4QPIC 5D1IA 5LY2A 5IUQA 3CHXA 1JHJA 1WCUA 3DXTA 3FFZA 4A3ZA 4JDOA 4B7KA 4XAAA 1TME2 4KL1A 4N43B 4YGDA 4HONA 1KD7A 2BV4A 4IETA 5FZ9A 3BVCA 5JMOA 3M2MA 4PJYA 4DEQA 2A1XA 2JECA 2V4VA 2D40A 1V0AA 3AVRA 3EJKA 1GOGA 2WLQA 3PMEA 3GZUC 3I8TA 1W3VA 3B5LB 3ZM8A 2K0GA 4P08A 5H9RA 4S2FA 3UL2A 5K8SA 1I5PA 2FBEA 3K3OA 3ZKUA 2HWF2 2BZDA 1PZ8A 2NQYA 2IWGB 1W2UA 4QB2A 1MS4A 2HEYF 2XVGA 3KD4A 4XF4A 3VN4A 4LO8A 1SMVA 1CAXA 4OZXA 3UGFA 1P8JA 3LZZA 2JDPA 1DYKA 1UZWA 2H6CA 4QDRA 4E4HA 3OUHA 5C3OA 3MF9A 3R4UA 1W6PA 3JBG2 4NMIA 5F1RA 3OJBA 5HCAA 3I2OA 2W39A 4BMBA 2FCVA 2XBO1 4IV1C 4XF1A 1LB2A 1OVPA 4AEKA 4UW6A 3WCRA 5J3UA 2GC0A 3I3DA 2A5ZA 1ND3C 2BBVA 3AK0A 3I3EA 2JICA 3USUB 2G9GA 4MO3M 3WINE 1HW5A 1I6XA 2UY8A 2WA3A 4LBQB 1UU4A 4CEYB 2HEVF 4LKSA 2J7MA 2HEWF 4IEVA 5CVRA 3PLQA 4PLMA 4XUNA 4QDQA 1FNZA 1UZZA 3POJA 2E9QA 1JBCA 1DQ1A 1RUF1 4IEQA 4JGZA 3OTFA 1JU4A 4PCRA 4ARYA 2XJPA 1MQTC 2VMEA 4O61A 3W20A 1RUF3 2JDNA 2MNGA 2WYSA 4FOWA 3D5OA 2Y0OA 4OULA 5GJ6A 5A7SA 3VBFB 5GZCA 4AFDA 1ZRRA 4CUBA 3U37A 2AZ5A 4P5HA 4CCMA 2VZPA 5A7NA 1IGOA 1LCLA 4BM8A 3VHNA 5FY5A 4ITCA 2ZJCA 4FPEA 3AX4A 1A8MA 1QJX1 1DHKB 2OIIA 3WP3A 1KDKA 1Z78A 3QBQA 4ET7A 5GZGA 1LU2A 1K5JA 1EAH2 1JI6A 1QJX3 4BQ3A 4JQTA 1DLLA 1NA1B 5BY5A 1XU2A 1OMIA 1SDWA 1NCRA 1S1AA 3H3LA 2R071 3LPGA 4JAAA 1VMJA 5C4WB 2X53S 4EYUA 3THCA 4W8JA 3ZSMA 1L7LA 2NLRA 1OSGA 4RS5A 2VNRA 2R073 1IQDC 1DQ0A 3DCQA 3GGLA 5FJKA 2JD9A 3DXUA 1MS0A 1W6MA 1FMD2 3KT7A 4J25A 3IPVB 5FZOA 5GLVA 3ITQA 3N9PA 5IWFA 2HH9A 2WDBA 4PQ9A 5FYTA 5FFOC 3SISA 4WM8B 2W47A 3ZXLA 4D94A 4JHZA 3VZNA 4Q2FA 1UKRA 1AR71 2O0OA 4BPZA 3VD4A 5FYHA 4OQ9A 1JODA 3PMSA 5IJRA 4INDA 3RZKA 5L7OB 1AR73 4O7XA 3CLPA 3RPQA 4JKLA 4YG6A 4XILA 4EWEA 2Y6JA 1ZNPA 2R0FA 2Z5WA 1XYOA 1GZWA 2EXKA 4BISA 2MEV2 2OPWA 1GQGA 3UGGA 1PVXA 1RXFA 2VW1A 5F37A 1DQ4A 2G4IA 5JVVA 4A3XA 4CCLA 1FATA 4DB5A 2GSYA 3VBUC 4MG2A 3GJBA 4JDNA 1D4M1 3HQRA 1A6CA 2EICA 3MFAA 4QHZA 3MZHA 1RUNA 1KGYA 2GH8A 3PVOA 1O8SA 2WABA 2ZA9A 5F9TA 1COV2 2BOJA 1V00A 4MGQA 5B2GB 4MZUA 2IXKA 4XIKA 3ZKYA 4BQ4A 3NKTA 5HI0A 3QOPA 1GMMA 5EJ3A 4AGGA 1O5UA 3ZXDA 5DZGA 3ZDVA 5FXZA 4HLTA 1UN1A 2NMOA 4QB1A 1AUYA 2ADDA 4ES9A 1H8TB 2Z79A 5LEKA 2DCJA 5A80A 4IE6A 2G19A 5AC91 3MIHA 1LHNA 4M01A 4KGGA 1S0IA 4P00B 4NIHA 2W1WA 5AC93 3SMHA 1AX1A 2DCZA 2WQ4A 3OEAA 4AW7A 3D3AA 1CESA 5FXXA 3C7FA 1LHUA 4OYUA 5BNNA 2WYFA 2D93A 4YVSA 2HLEA 2DYCA 4IDZA 3SH3A 4CA9A 3LOBA 4LOSA 2RJKA 4OHZA 5EPAA 2R042 5EWSA 3BOWA 4BU2A 4QPIB 3ZXFA 4CU7A 1BLZA 2BFUL 3VB9A 2Y6KA 4HKOA 1VRH2 2R062 1QJU1 1SLIA 3GCXA 3OPTA 4I02A 2A70A 5FYCA 5FYVA 2CGOA 4BB3A 3WHUA 3RZGA 2AEZA 3C7HA 3N9LA 3IIIA 1QJU3 3DECA 3RYRA 4LHSA 3RMYA 3WNMA 2WO3A 4CDWA 3BTYA 2E53A 4BIOA 2Q8OA 3B00A 3GJAA 4GALA 1NZCA 2GN3A 4XZUG 2GALA 1RJ8A 2FDJA 5JCTA 1UPIA 3N3HA 4QPGA 1O8PA 1SLTA 1W2AX 4KQ7A 4QKBA 4UXAA 3P3NA 1O3SA 5TSWA 4BK4A 5A3TA 5CFCA 4FOYA 2BNMA 5SV5A 3LA7A 2X5IA 2J42A 1X82A 5FZDA 2GC2A 4FFFA 3SCHA 1UIKA 2D6OX 2BGCA 3CL1A 4KG0A 2CY6A 1MS1A 3AYDA 2ZGTA 1HJGA 3GF6A 3RZLA 5FKBA 3NWKA 1AF9A 2C0ZA 4IV1B 1UD1A 3MIFA 4EQVA 1GFF2 2GC1A 5FP9A 1KDMA 4PBOA 3TWIA 1GOHA 1ND3B 1UO9A 2WBKA 5BNPC 2VZ1A 4W6WA 4AI2A 2RR11 4GB32 1NAEA 3H1YA 5FPBA 5A3OA 3L9JT 4AGRA 1YQ8A 3MW4A 2RR13 1QNYA 2W1QA 3H3UA 1XBFA 4LKEA 4Q0SA 2VR4A 4IE5A 4QQ2A 1AR83 1BK0A 1MQTB 5FZCA 2WT0A 5F5IA 5DUXA 1O3QA 1GP6A 2E26A 1RUG2 3JZVA 1H2KA 2I74A 4MXWB 5C9AC 2VZRA 1YLLA 4K7JA 3MYXA 1IG0A 5FPLA 4NPMA 2D97A 1PZ7A 3E5UA 3PVBB 2ZZJA 3G7DA 4XE9A 2VZQA 4PIYA 3SQOA 4D7SA 3POWA 4XQWA 2VNVA 3KV4A 4P9XA 3JBG1 1NCQA 2RM21 3IDCB 2EAKA 3C7EA 5JR2A 4GJZA 2YPDA 4NPRA 1CPMA 4YW5A 2WZR2 3HOBA 2RM23 1ZVFA 3R0RA 5DUWA 3V56A 2WO7A 1POQA 1PO22 4FQZA 4MXVA 5D8AA 1JZ7A 2C9KA 2YU1A 2ZPXA 1VBB1 3WDUA 2EIEA 2BYVE 2PAEA 2HWD1 3FL7A 2K9ZA 4HMZA 5DQ0A 1VBB3 2XKOA 2WFF1 2ZGNA 4M0HA 4Q5OA 2RJLA 2HWD3 5K4LA 3WP4A 3WX5A 2DVDA 2WFF3 2VECA 4PF1A 2ZAHA 3A4UA 4AHYA 4B1MA 3DEMA 2XOMA 4LO7A 2YMZA 4XJUA 4L99A 2BJSA 3WHTA 4BQ1A 1YJLA 3SEPA 1JZ8A 2YB7A 1H0BA 2DUPA 2QQOA 3PL0A 4XFAA 1ZZCA 2FDFA 1R64A 1G86A 1UX6A 1W6NA 3V65A 3LGRA 3VBUB 2WWJA 4NHKA 2FDIA 4QT6A 1PK6C 1UX7A 2LTNA 1UOBA 2YPJA 4FFIA 4H14A 3S7EA 3SNMA 1I5ZA 4UOJA 5DG2A 1SBDA 1FPN1 3POBA 5FUIA 3KVAA 3T0DA 4AVVA 5A32A 1U5XA 2XLAA 1OD5A 3ILFA 3VBHC 1LODA 4JRAA 1FPN3 2RDSA 3C2UA 2P2KA 4OUMA 4LBQD 4LBNA 2V73A 2XPJA 2A71A 2CAVA 1VIWB 4FQ4A 1FAYA 3H7YA 2B9VA 1KXGA 2ET1A 3NMBA 2Y38A 3MUZ1 3V0BB 2VULA 1ST8A 1AL21 3O14A 5FPVA 1C8NA 4MGIE 1K12A 4D7YA 1AL23 5JLVA 2CWMA 3G6JB 3OSDA 2NM1A 2UY9A 3U1XA 3I2JA 3NV2A 2D5FA 4YVWA 3WUCA 1LKNA 2RJ2A 3FHQA 3Q8CA 1ND2A 1H2NA 2OUJA 3LWCA 2A7AA 1O6UA 3RMXA 4HKWA 4CP2A 2OA2A 3AMMA 3BALA 1XE0A 1GU3A 4CDUB 3FUOA 1ZZ9A 4XZPA 2YXSA 2JDHA 3R05A 3WDXA 1LGBA 4UFHA 1UYXA 4QAWA 2QZ3A 3PNAA 5JSOA 4XIOA 4K9SA 1AYN3 1LOFC 5LA2A 3O0XA 4HSLA 3BGAA 4A7ZA 1MZ6A 1UY3A 1YJKA 2YFZA 2P17A 4D7TA 2KXLA 4CDXA 1BBT1 2DBIA 3JQWA 5DN2A 5FMDA 3VZJA 1A3KA 4RHV2 4OUEA 1BBT3 4ZPIA 2YG0A 2GMEA 1DGWX 4QGMA 3BTZA 2XDVA 3D8CA 1TVGA 3DN7A 3WT3A 2PAKA 3HJRA 3N9QA 5A1LA 2JD4A 3F2ZA 4LULA 1ODNA 3T3YA 5BNPB 3ME2A 1N47A 4LBJA 3I2FA 2NN8A 3AB0A 3SH5A 2IXCA 4E4ZA 4HVQA 1W9WA 4JZRA 1W39A 4LXLA 3FZ3A 2E51A 5A7WB 1R082 2P3IA 3WP6A 2HYXA 2NP0A 5GZFA 5KWRA 5A33B 2C1FA 1J3PA 4QX0A 4IEPA 4WVWA 5T54A 1K5MA 4ZZ8A 4CP9A 5FO8B 5J36A 5IK7A 1WA4A 2HWE2 5H9QA 4NHYA 4B1LA 3AKQA 5C9AB 1YWKA 2W5FA 4CTEA 2JE8A 4GMP0 1SEFA 1HB3A 3RI8A 4OHWA 4GAZA 1QJY1 4B4PA 5KXBA 4FI9A 3BU0A 4YNIA 1OH3A 2O1QA 1IHMA 3FC0A 3JQXA 1QJY3 3A22A 4AQSA 4XBNA 1X36A 4YZ2A 1HB1A 4KWJA 3RYKA 4WVVA 5FZLA 2WQ8A 2OW4A 3A21A 3RFRA 1WMFA 4QMAA 5FMCA 1YFUA 3CNAA 1V70A 2UWCA 3NL1A 3ZYJB 2WT1A 1MPXA 1H2LA 2YZ4A 4RL7A 3LA2A 3ZR6A 1Y9MA 3M8LA 4HXCA 4NPLA 1GWLA 1KS5A 3NAPA 5GLWA 2IXJA 4D6SA 1EPWA 1MZFA 2JDAA 2JWPA 2ORXA 2VW0A 3FBMA 1RVF2 3AMPA 4JX0A 5FZIA 1EUUA 4EZ4A 4YW3A 4ARXA 4JQRA 4KH9A 1XXNA 4P9IA 3WW2A 1RUH1 2VVDA 4LK6A 4Y1ZA 4JGYC 1O5LA 5BNOC 5A3NA 1W8UA 3FLRA 1JYIA 1RUH3 1V6JA 2DFBA 3HN1A 2LALA 1RUG1 2KM2A 4AHZA 1VBA1 1GSLA 2VMCA 4CCDA 5HCFA 2FDGA 1X8MA 3LEIA 1RUG3 3RJRA 3U11A 1VBA3 3WZ1A 1Q56A 3UJQA 2P6CA 4A6SA 1VR3A 2VC9A 5FZ8A 1LEDA 2VXRA 2VNGA 1SBEA 1NG0A 2CWSA 1C57A 3FLPA 1UMZA 5E88A 1RITA 1QWRA 2CGPA 4UWDA 4GULA 1HKDA 1CGPA 3T4VA 5C7GA 2ZX4A 1PK6B 2WJSA 5KC5A 1YQ5A 3S5QA 1HX6A 4NWVA 4B4RA 3N7JA 1S2KA 4QD2A 2TUNA 5JOXA 5A6XA 2H0VA 1SPPA 2OPKA 4RFRB 5EJ1B 1AR62 1PMJX 1W8NA 1OQDA 5FXWA 1UNBA 4K6BA 4P14A 4DINB 1PO21 3VBHB 4IEOA 1LR5A 3WP5A 3AL5A 3AZWA 1UPSA 1CIYA 1YUDA 4KMQA 5FZAA 1QH7A 3ECQA 4J1XA 4FPJA 3ACLA 1KJLA 1R092 3DV8A 3PVNA 4CCOA 3NNLA 4X8PA 2LRPA 1F5FA 3RI9A 3H1WA 5F3CA 2Q8EA 1JOBA 4AFMA 5KHIA 3W5MA 5FPUA 1DZQA 1ENRA 1SFYA 3K77A 1HIXA 3OG2A 4H3WA 5F6KA 1Q8SA 5CAZA 1JYNA 4OHXA 2ZGMA 1TZOA 4K1ZA 2IXLA 4NVPA 2RG4A 2FDKA 3OY8B 3VBSA 1OLME 5IHRA 2VMFA 2I45A 4COVA 4R8HA 2VUDA 4P02B 5KHHA 2JKXA 4LIUA 2J1SA 4M00A 3ENRA 3K46A 5HV0A 5K0UC 2E33A 3B7MA 1V6IA 1R1ZA 3KT4A 4FP3A 1CAVA 2BUKA 3KGLA 3LAGA 4XHBA 2Y64A 3LFMA 1G9DA 1ZBE2 1DGLA 2QQJA 3USSA 4MSVA 4E4SA 5SV8A 5C6CA 4QX2A 2D3RA 4F8AA 2UYAA 2TNFA 3D0SA 4META 4W4ZA 2FHRA 1F15A 3LPFA 5FY7A 3RQ0A 2YUEA 5HBAA 5LRRA 3WNPA 3VZOA 2VQUA 5C8CC 1OD3A 5FPZA 4OQ8A 2RMU3 2A6ZA 4DO0A 4ZU5A 2F4LA 4ISRA 3JB8A 5FZBA 1XNBA 2NYYA 4Y1YA 1ENSA 1UU6A 1KJRA 4CP0A 5FO9B 3TOJA 4NAOA 3GCWA 4E2SA 1NXD1 4YW6A 3J7HA 3UKVA 1VLNA 2RDRA 1AZDA 2E7TA 3ZLIA 3ATGA 4LIVA 3AP4A 2JDMA 1GWMA 3H1MA 3PUQA 3LD8A 1RUE2 2PQQA 4M4RA 1JUHA 4Q29A 3ZXAC 4AVBA 1TMF2 4FPGA 4OMCA 5H9SA 3SITA 1XE7A 3WXPA 5ABJC 4Q4X2 1UYYA 3GBFA 3AP9A 1DZRA 1YYNA 2CGNA 4I09A 4QGLA 2R1DA 4M3CB 5FY4A 1QJFA 1U5YA 4AAPA 1VB4A 1YQ2A 2E6VA 3ES4A 2NZ9A 4N43A 1FI2A 1DQ5A 2VXJA 3HN3A 2VCCA 4L97A 1PGSA 1FNYA 2H0BA 2PHRA 3JUUA 1TG7A 3OBTA 4IERA 2P6HA 3BIWE 3LQCA 1CD3G 3WW4A 4CU6A 2WS92 1J58A 3OUIA 4QQPA 3W5NA 3LSDA 1SLCA 3ZMOA 1ACCA 5CADA 5C8WA 2ZX0A 2VOXA 4GMP1 3VZLA 1ZZ7A 1REDA 2X10A 4LPLA 1LGCA 5A3LA 1KEXA 1W05A 3KS7A 4GMP3 4JVAA 3RG0A 1ENXA 3MIDA 5ISLA 4CP1A 2BDRA 2QKDA 3DYPA 3J7LA 4KBZA 4OI0A 1UZYA 1S0GA 1R081 3AKPA 4PQQA 4WVZA 2P37A 2WN2A 3RZZA 4NRMA 1R083 3USUA 1NZIA 4JGYB 3A7QA 4LBQA 4R4ZA 5BNOB 3VD5A 5JDBA 4CEYA 1B35C 1TQ5A 4MGZE 3BI3A 2GNTA 2PTMA 3IBMA 2QBXA 5FZ7A 2A6XA 1DGRN 1JUIA 3O5SA 2VOVA 4A7YA 2PFWA 1PGW1 4MV2A 4LKDA 5IVBA 4ZU4A 4DZGA 4BE3A 1VPHA 4UFIA 3VBFA 2XVKA 3KLSA 4JTOA 3URFA 1YHFA 2PAMA 2RS12 2VCMA 2W92A 3ZFGC 1DGRA 1U12A 4DRRA 2YC2A 1ULDA 4J6GA 5JWPA 2UYBA 3WNLA 2BWAA 3AZZA 5KHGA 1LESA 2G9ZA 2RS31 2BBAA 4LORA 1W6OB 3BCWA 2RS33 3N7MA 3O1TA 3D4KA 3VZMA 1CJPA 4HETA 5B4NA 4RYDA 5F2SA 5IVEA 1KFUL 2WR9A 1NA1A 3OUJA 1PVC2 4WBBA 1UW8A 3B93A 4XPVA 3IIAA 5JI9A 5JOYA 5C4WA 3AZYA 2AACA 3VBOC 3M3EA 2XJRA 3EQEA 2P3JA 1WKYA 4RGKA 4YZ3A 4C8DA 3S57A 4M3CE 4Y4YA 3ROUA 1C4RA 1E5IA 1AR92 1RHI2 3MO4A 3IPVA 1ULOA 3KGZA 1S0BA 1FX5A 4I0WB 3P6BA 2BP6A 2X8KA 3B9CA 5DAPA 5I0TA 3TNQA 4AFAA 5EFUA 5LRSA 2VO5A 2QUOA 2V5YA 4WM8A 5IVYA 1UOGA 3ZN4A 3MIBA 5DDJ1 3E97A 5BPXA 1ZZ6A 1CZTA 4MGTA 2QZ2A 5E89A 4HKLA 5K0UB 5DDJ3 1W2TA 5L7OA 1OI6A 2B9UA 3AC0A 5A3WA 2W1SA 1DCSA 4ORFA 2UWBA 1IKQA 5A3UA 4AWDA 3IB3A 4I0BA 2QQUA 4XFCA 1W3XA 1OFNA 3UESA 2A3YA 1NYWA 1PM7A 3WCSA 2VG9A 4XFFA 4ZZ5A 5C8CB 1JH5A 2PHDA 4E27A 4NIDA 1BMV1 1VMHA 2ZEYA 5LK5A 3UGHA 1VBC2 3MGUA 3C8XA 3M3OA 1E5RA 2ZX1A 5CZKA 3MW2A 1H8TA 2FCUA 1HV0A 1RUJ2 2AENA 2DVGA 4FP2A 4HZFA 2IVJA 1AVBA 2NMNA 4IGPA 2XBO3 2VD7A 5K9YA 3ETPA 1Y7BA 3HVDA 3MLKA 2D5HA 4XDPA 4Y22B 3ZX7A 3LA3A 5CU1A 5FWEA 1YFXA 3T0AA 2O8OA 1S55A 3NV4A 4Y5Z0 5ABJB 2V09A 3UYJA 2VU9A 2WZPP 2D7FA 5H9PA 3HMYA 4COYA 3DKWA 1XYPA 1ZRIA 5FJHA 3LEGA 2ZHLA 3VDDC 2Q5TA 3C7OA 4PI0A 5GZDA 3R6SA 3OBZA 4QPIA 3I2HA 2XQRA 3KVBA 1HJFA 1HB4A 5FYSA 5EYXA 3O1RA 3B9IA 4I01A 1VBD1 1GZTA 2D6KA 5J98B 3KM5A 3QCWA 5FYUA 1VBD3 5HCBA 5KR7A 2EALA 2EXHA 4YGBA 3M3IA 3LB9A 1GNYA 3WY6A 4XF9A 1O4ZA 4XHXA 1RYYA 1TNRA 3IMMA 1W9FA 2GAUA 1RUI2 4ZHNA 5F32A 5E1RA 1WW7A 1ALYA 5DAVA 4ZONA 5F39A 5FZ4A 5EQUA 3V64A 1GV9A 1X8EA 5FR3A 4MADA 1UQXA 2QQKA 4Z92B 4WZFA 3R4SA 4COWA 3ES1A 2ILMA 2QFEA 5LATA 4A41A 3DPRC 3IAQA 4Y5TA 1ZYBA 1IKPA 4IV1A 2WNVC 2CDPA 2D6NA 4IGQA 4CEWC 5FRAA 1JU3A 5B4XA 3FJSA 5J1XA 1ND3A 1V9U1 5D21A 5C3SA 2W94A 1S0CA 4CRQA 4PIZA 2XR4A 1IS4A 1V9U3 3HPNA 3NNGA 1B35B 3W58A 1GKBA 1MS8A 1N1VA 5EV7A 4BIFA 2VMDA 3ACGA 4MGYE 1S0DA 5CYYA 2A3WA 1SCRA 4XJ8A 4BHPA 1V6MA 1UMHA 5FWJA 3AMNA 3O1SA 1MQTA 1RJ7A 3H8OA 3O0WA 1MEC1 2VUJA 3P1IA 4N90A 1JW6A 4QX1A 4MXWA 4XQDA 1JN2P 1GQPA 5FP7A 3ZFGB 5C5TA 3H50A 1MEC3 3IDBB 3J9SA 5GLTA 2XJTA 1W28A 1D4M3 2Y0IA 3P3PA 4KBBA 1QDOA 4FPKA 2E31A 1LOEA 5LBBA 1IG3A 4OHVA 4XEZA 1EV12 4XFBA 4CYDA 2W87A 2JDUA 3N9OA 1F8VA 1W9YA 3ZFFC 3ZN6B 4SLIA 2CSGA 3KT1A 2ZBJA 2C9AA 2JG9C 1UZ0A 3T4HB 2ZX2A 2GNBA 4Y1XA 1C8M2 1DIWA 1CPNA 4EE2A 1AJKA 1XNTA 3VBOB 4LE4A 1NE4A 1XNDA 2WUHA 4YFWA 4XETA 3O1PA 3H8RA 2XJUA 3NSTA 2Y6FA 3PU3A 3JD72 1VAVA 1CX4A 1H6XA 4AEDC 3VKNA 3ACIA 2GN7A 2W08A 2XL7A 4R9DA 3THPA 4YM2A 1L7RA 4HOOA 3NV1A 2V5DA 2IXIA 1GUIA 2A6YA 1HDKA 2DF7A 2DVAA 4QKDA 2ORZA 1SACA 5JI7A 5IVJA 4I3GA 3KWVA 4NE9A 4EN8B 1FOD2 4L92A 3WVJA 2YBKA 2BFUS 3RJ2X 2XMLA 1U0AA 1XPWA 2YC4A 1DQ2A 4AF9A 4HSJA 3NQHA 4URAA 1JYTA 2GU9A 3T09A 4NN0A 1HRV2 3MLLA 2XQXA 4Y3OA 2B42B 3IAPA 4J1WA 1LEMA 1GWKA 2AGSA 2IUWA 2WRAA 3VBUA 1RINA 3ZPOA 4TZDA 1CX1A 1FXZA 1JYWA 4L9BA 5T5PA 1NXMA 5FZGA 1LGNA 1V6NA 2GP5A 4HPKB 5T55A 3VKLA 3CMGA 4CZSA 5IK5A 3DYMA 3PUIA 1OA3A 1AYM2 3WNXA 1E5SA 4LE3A 4ZXEA 1NOVA 3SEEA 4FPYA 4PLOA 1RMU2 5FYBA 3VV1A 1O59A 2B8MA 2VQAA 3KF5A 3RZMA 4IW3A 1UOJA 1OOPC 1JZ6A 3V0BA 2D6MA 2J1RA 1TME1 1JMUB 3M70A 3PTRB 3AYEA 1NQJA 1J3RA 4QU2A 1TME3 2YGMA 3R4DB 3VDDB 4OHYA 1Z7S2 4OUSA 2CHHA 2AR6A 4YPJA 4A4AA 4LO6B 4KNCA 4BQXA 3GYDA 4NJ4A 2A75A 5LBFA 2HWF1 4YGEA 5FQ0B 1UY4A 3CJIC 4R4XA 3WF2A 3FHAA 4CDUA 3VLBB 1WMDA 2YY1A 2HWF3 2FQPA 2ZHMA 4L0PA 5KXEA 3H0OA 1X9TA 1HQWA 1UY1A 2ZKLA 4RD7A 4IEXA 3ZMNA 5CG8A 2ATFA 3LEKA 3CKHA 3OGGA 1C28A 4Y4RA 2VM9A 3JBG3 3OPZA 5C71A 4WM7C 4H7LA 3EO6A 5FAXA 4DUVA 4KG8A 3IZOA 3ZXJA 1QXRA 3VBRC 1ZRFA 1CZSA 4TN7A 4IE0A 1QXPA 2CNAA 2OZJA 3DPRB 4E4DX 3ZPYA 5FBZA 3IDEA 4XJWA 2VH9A 2WNVB 4CEWB 3POFA 2QNKA 3H8UA 1X50A 5F3IA 3T2TA 3NO8A 1H2MA 5BNPA 1VAKA 5C3PA 4F3JA 3PVEA 5JZGC 4Z82A 4Q27A 2QJVA 3CF6E 1YFWA 1W9TA 4OFGA 1QQP2 5A7WA 5CKQA 4D6QA 1BEV2 3I2DA 3U4SA 4CDUC 2R0HA 4Z2WA 5A33A 4O65A 5C70A 2GMMA 2JB4A 2FD8A 3V0AB 3FMGA 2N7GA 1I9RA 4U2AA 1T2XA 4GIQA 5CKMA 1LJ7A 4PDWC 1PX3A 5FIXA 1EAH1 2F17A 5C9AA 4MGKE 4LT5A 2Z42A 4FXKB 4UBHA 2HJIA 4NIAA 3VGIA 3INAA 1EAH3 4DXTA 1QEXA 4QXKA 2ZCWA 4GXLA 3F95A 3LSEA 4DXSA 5JXGA 3S30A 3IKWA 1R1A2 5J7MA 4LITA 2C24A 4DY3A 4IEUA 1YI9A 5GLZA 3ZFFB 5FZMA 1FMD1 2WSUA 1GZCA 1X7NA 2JG9B 4BMEA 1DFQA 4Q4V2 2DV9A 1W99A 1FMD3 3KCCA 3TN92 4BCUA 1YCIA 1MZEA 5LY1A 3BTAA 2Q4SA 4Y20B 5FP3A 4CDQC 4P9YA 2PYTA 4HFSA 3RSJA 2VMGA 4AEDB 4CCEA 4DXRA 3U0ZA 4QQLA 1ASJ2 2WWSA 4XACA 3RWNA 1LHWA 3O0VA 2IFWA 2P1BA 1UY0A 2DVBA 1Q8PA 2QE3A 2MEV1 1UXXX 4LA3A 1B09A 2W95A 5I91A 1RC6A 2B46X 1OH4A 3AJZA 1NT0A 4IESA 1O4TA 4IE7A 2ZMLA 1D0HA 1RUC2 2MEV3 2VCAA 1RUD2 3VD7A 2JJ6A 1QH6A 3VL8A 1VE0A 2YGLA 3GBGA 1PX4A 3MDPA 3A23A 4GH4C 4YGCA 1COV1 5JR7B 2ZEWA 4QX3A 3AJYA 4XMIA 4EN0A 1COV3 2EXIA 1NLRA 4XVHA 1PM4A 1EV11 2D43A 2KR2A 1W0OA 2WC2A 4K8RB 4PI2A 4X6RB 1MS9A 1PK6A 1LENA 5CIRA 3VZKA 2LUWA 1YQ6A 2ZOEB 4LO4B 1W8WA 3MV11 4Q1RA 1OXCA 1C8M1 5DUUA 1ENQA 3PIJA 4PIXA 1JZ4A 4BQ5A 1C8M3 1PIV2 2R7EB 2W0XA 1NY72 3VBHA 5CISA 1LOCA 5IVCA 1J83A 3ZSKA 3CZUA 2B4KA 2ZGLA 4IEYA 4F83A 2PQSA 2RDQA 4E2QA 4EZHA 3HD8B 4JRLA 2WSVA 4E2GA 5JSRA 2R041 5JSPA 5JPNB 3KSCA 3MUY1 3UJOA 4TWTA 4XURA 2VCBA 1OOPB 4LHLA 2R043 2ZZQA 3MLJA 4K40A 4XCBA 1XOYA 1VRH1 2OQ7A 2R061 1H6YA 4DS0A 1ULPA 5JIUA 4HANA 1FOD1 1VRH3 2R063 2ZGPA 3OY8A 1HRI2 4RA0A 4QHOA 4LOTA 1CZVA 3I3BA 2VMHA 4RQPC 5LW9A 1WLCA 1FOD3 2YBSA 1DGWA 4CPBD 5FLHA 3LIGA 5E6HA 4IGOA 3HNYM 1G9BA 1G9CA 2WNEA 1HRV1 3BN6A 3CJIB 4HN1A 1S2EA 4Q4Y2 5ACA2 4BWOA 4WVMB 1F5JA 1HRV3 5JUVA 3UETA 2YV8A 1J84A 5IYYA 1BKZA 4QQOA 3I2IA 1J1LA 1QF3A 1XSRA 4V2VA 2HBUA 5J96B 2JDZA 2Z69A 4UFJA 4GWNA 1OKQA 5DABA 2AUYA 4CU8A 4K1YA 1A34A 4DY5A 4P9GA 3MIGA 4WM7B 1MR5A 2C26A 2Z2SB 1N3QA 4UFKA 1BHGA 5FZEA 1IZ3A 1O4YA 4R9AA 4XBLA 3ZO0B 3K75B 3VBRB 5FZFA 1DU3D 2E63A 1F2NA 1HXS2 1SZBA 4FPHA 4O9GA 5EYYA 5JXHA 4GB31 5G05L 1CQ9A 3WDTA 4GJYA 3THTA 4GB33 3BIEA 3AM2A 3I4IA 1Z7S1 2I2SA 5JZGB 1GQHA 1HQNA 3M3CA 1OURA 2WNUC 1QOOA 1Z7S3 4XTPA 3U10A 2JE7A 2ZXQA 4QXCA 2HWB2 3NNFA 4YM1A 3DYOA 1UYPA 2YBPA 3MI8A 4YW4A 1ZRCA 3Q8AA 3FE5A 3OYWB 3E5XA 1SDDB 2PHUA 3J8F2 2OYZA 2WZEA 4M3CA 1N3OA 2Z4FA 5HXMA 2OXBA 4ASMB 3ZIXA 5FPAA 4PDWB 4HK9A 2Y26A 4YM3A 2UURA 2QDNA 4BK5A 3RRDA 3ACFA 3KQRA 2WZR1 3PHMA 2ZHNA 2XONA 3RGBA 1S4CA 2JXAA 2WZR3 1UAIA 2F6BA 1W90A 2ZGUA 1JZ5A 1PO23 1AX2A 3DGTA 2B45X 2MHFA 4JCKA 2BVVA 2EXJA 5FP4A 1Q8OA 3RWKX 4PHZA 4BZ4A 3GM8A 4AI8A 1H30A 1WMXA 2D44A 4AI9A 2GP3A 1BZWA 3H9AA 5GALA 2PHTA 3T30A 4CDQB 1OBNA 1W03A 3LKJA 1W9SA 2IFRA 2YYOA 4UFMA 4EV0A 1IPJA 3M1HA 2G9FA 2EAAA 4Q8LA 1W04A 3GHNA 5F6LB 2Q8CA 2ADEA 3WLUA 2JX9A 5JOZA 5APAA 5I0DA 1OUXA 1LHVA 1Y43B 1H1AA 4JGYA 2VTXJ 4TYSA 2C5DA 5BNOA 1XNCA 1K42A 1FV3A 2ZGSA 5CKNA 2DCYA 3SKVA 1GOFA 2ZGRA 2XUEA 4LBLA 1C1FA 3AKSA 4FVVA 1UF2C 4AI0A 1XRUA 1ZA7A 3N4MA 4AVSA 4GH4B 4JC1A 2VTXA 4MHUA 2CU5A 3ZFEC 1F4HA 2X29A 5CFDC 1W6QB 4BH9A 4LTAA 3N7KA 4QWNA 2UWAA 2ZACA 4DIQA 1SG3A 5E8AA 5A3PA 4UBGA 2HBTA 2JE9A 1V6KA 3OB8A 4P5YA 2ZAAA 3QD6A 1CAUB 4ZXKA 1H9PA 2E32A 4Q4V1 3ZSLA 2FDHA 2OZ6A 4IV3C 1RUF2 2FZ1A 4JKMA 4Q4V3 1W6OA 3ZYHA 2JG8C 3E5QA 2CYFA 4NR1A 3S0MA 3TEWA 4GWJA 3JXSA 5L36A 1CAWB 3IM0A 5I0UA 3BU7A 4N53C 1LU1A 3ZYRA 5IVVA 2CTVA 1WLDA 2RS52 2BWCA 5L73A 4HK8A 4RR3C 4BQ2A 5KXCA 1ZZ8A 2TEPA 1WCQA 1XE8A 2ZTNA 3BUCA 3CDZB 4D69A 5LZ6A 3ON7A 1OLRA 3HBKA 1H9WA 1QJX2 2O8QA 3KZ4C 5A6QA 1HB2A 1C5HA 3MF6A 4AOCA 3CZJA 5LA9A 2BRTA 5LK7B 4Z1VA 1MACA 2AYHA 3DKQA 3PJYA 4RQPB 2A6VA 3Q8FA 3E6CC 4CCJA 3FLTA 4OI2A 2C6SA 3HNMA 5T52A 2BPA2 3WF1A 3WNKA 4BJ0A 2YFUA 1N3PA 2R072 2ZS6B 5BYNA 3AXEA 5IT6A 1UKGA 4E9KA 3I3MA 5LB6A 5K0UA 2D3PA 2EA7A 2HKXA 2WFPA 4AHXA 1EP0A 1YEWA 2WZ8A 2XWBB 1HV1A 3LOIA 4UF0B 4GWMA 3KV9A 5FYMA 3LDBA 5GKAC 4RHV1 5C3QA 1PIV1 4FFHA 1NY71 4DOUA 2D6PA 4YW1A 4RHV3 4CCNA 1WLTA 1PIV3 1UY2A 3ACHA 1NX9A 1O3TA 5IAXA 4OVEA 1AHSA 1AR72 5C8CA 3ZXKA 5LASA 1SQ4A 4QXHA 1QJZA 3AMHA 3PJQA 4FOQA 4BLJA 5FPXA 3CU7A 2OQ6A 2EF6A 1WZXA 2ZMNA 4MH0E 4ZS3A 1U5ZA 4LHNA 3O12A 2DTYA 1W2OA 3MIEA 5D2AA 5F5QA 4R9CA 2BQPA 2GDFA 1WD4A 3FHIB 3ZR5A 4C90A 5JMCA 1HRI1 5FCCA 3IMNA 1YO8A 4Y22A 2A3XA 1HRI3 3O1MA 2WNUB 3K3NA 5FZHA 2HWE1 5FDBA 4Q4W2 2Y8KA 4YLZA 5ABJA 2Y6GA 3MPPG 3SLIA 2HWE3 5L19A 5FREA 5ACA1 3FX3A 4M0NA 4YWAA 1HN0A 1D0GA 4OI1A 1SLBA 4NUBA 2W2IA 3KV5A 5AC92 4EWDA 4NHLA 3WQ0A 3K4ZA 3D6EA 4LBOA 4O9EA 3I2KA 3QACA 3IDAA 1W8FA 3HQUA 1ZBA2 4FT8A 1NUKA 1MS5A 1YC61 2WKKA 3BPSA 2X05A 4D0QA 2Y60A 2ZGQA 4YZ5A 4ZU7A 2KD7A 4M3CF 4KWKA 4XC9A 3T1MA 3BODA 4RGGA 1VRBA 4AQ2A 4DRVA 4UI9L 5LA1A 1LHOA 2ID4A 2RV9A 3CJXA 2W68A 2O14A 4XABA 2XWJB 3NJVA 3NJYA 2WINB 1SLAA 1RVF1 4AQTA 4B7EA 1GYKA 1QJU2 1G9AA 3BTXA 2ZGKA 2P34A 1RVF3 1YI7A 3NVCA 4HT1T 3UKNA 4LKFA 5G04L 3NRUA 4LNVA 5T5JA 5HCHA 2BNOA 2DDUA 1SFNA 2VPVA 1CN1A 2HWB1 2QQVA 1V6OA 3EYPA 1Q3EA 5KHJA 5ANNA 3ZOIA 4AYUA 5JXIA 1PNFA 3J8F1 3IT8A 4UW4A 5FUPA 1QKQA 1WCDJ 1SCSA 4HBNA 4DUXA 4YG3A 3J8F3 2ET7A 3ORJA 1B35A 4FTSA 5FKCA 3ZYPA 5I93A 3APBA 5BV6A 1I3HA 1XB9A 4LEJA 5KHKA 3ZFEB 2XVLA 5CFDB 1AR61 3N9MA 4H2AA 4JGZC 3ABZA 1JXNA 1AR63 1T6BX 3B01A 4UW3A 4CXXA 3ZFGA 4Y26A 3S6PA 1FYUA 4IXLA 4CPBA 5A1AA 1WMEA 2RR12 1R091 1JS9A 2XJQA 1FV2A 1OQEA 1AR82 1QJEA 4PLNA 1G8WA 4LLFA 1R093 2DCTA 4UFLA 5FYZA 4IV3B 4PBPA 3O1UA 1BXHA 1CJDA 2JG8B 4DPNA 3ZN6A 4XCAA 2JB8A 4MUVA 5CBLA 4N53B 1IS6A 3S7IA 4FTBA 2ENRA 1GP5A 1LOAA 4LK7A 4AL9A 2LS6A 4NHMA 1J1TA 2HWC2 2JIJA 2Y6LA 4RR3B 4WZCA 1TE1B 2J1EA 4GQ7A 4PF5A 5F7UA 4I30A 3EHKA 3VBOA 3AZVA 1NCRC 2JENA 2PA7A 3CQOA 1UWWA 2C4XA 2WIIB 3Q8EA 1LRHA 1SFPA 4RS5C 3BYWA 4OMDA 5FY0A 3WNOA 4AVCA 2GC3A 3SCFA 4A45A 3HT2A 5EZWA 4ASKA 2B39A 2RM22 1ZBE1 1Q8VA 2VGDA 4Z8BA 2J22A 4B8EA 4NRQA 1O3RA 4TLFA 2BGPA 3NNJA 1ZBE3 1CVNA 2JEMA 2X09A 1WLWA 5DG1A 4YFZA 2DURA 2Q1MA 5EIYB 3DF0A 4OLLA 5F3EA 1PO12 1F9KA 1Q5OA 1VBB2 2ARAA 2A6WA 3K48A 1JYXA 1PMHX 4IL7A 3WSOA 4C0BA 1F4AA 4HN0A 2HWD2 1OHFA 2WFF2 3T2OA 3UT0A 5A3MA 4XMAA 1KRIA 5JXJA 1XQNA 4Q0VA 2VVEA 2ZGOA 3A0NA 3RNSA 3VUOA 3NKGA 3QH6A 1WCKA 4N9HA 5FK8A 5HV4A 2W9XA 2DBNA 4QX8A 3W9AA 4R52A 3WF4A 4EN9B 5KBFA 4M4PA 2RS51 2WLPA 5CB7A 5C5UA 5CA6A 3ASIA 3MEPA 4NIGA 4BLIA 4AXOA 1QIQA 5I8YA 4HPKA 2RS53 1RUE1 3I59B 3OF1A 1AXYA 1TMF1 1BQPA 3WW1A 3PIGA 2WT2A 1LOGA 4Q4X1 1BMV2 1NLSA 1APNA 3OBAA 1RUE3 5C3RA 3WG2A 2VVFA 2D6LX 4V1PA 1TEIA 1TMF3 4G3YC 1PGL2 2P5BA 4XYXA 2D98A 4Q4X3 4YRDA 4PT6A 5KC6A 2TBVA 5EXOA 3W21A 2NPIA 2PXJA 4ZS2A 2J1VA 3LDRA 1N1TA 4BA6A 1WW6A 1BK1A 3VDBA 2XJVA 1YRZA 2JKBA 3KQ4B 1L3JA 4Q1PA 1HLCA 2W52A 3AP6A 1FPN2 1VJ2A 1G9FA 1V6LA 4IEWA 3T2PA 2CDOA 1OUSA 3VDDA 3BB6A 5BNNC 4YVSC 1PNGA 1L7QA 4YW7A 1OQ1A 5L9BA 2D3SA 2EIDA 2YU2A 4GWIA 3ZYGA 1CWPA 4EJRA 1YIFA 1WA6X 1LAJA 2WS91 3ZDSA 5EJZB 4G9SB 5FQ0A 2E7QA 1EY2A 3WDVA 3B3QE 4OCTA 4Y1VA 2WS93 1AL22 3ILRA 5LA0A 4MX3A 4KU8A 1HQLA 4Y1UA 5GM0A 3GZAA 4CCKA 1K45A 1ULFA 2DWRA 3MV01 3AYAA 2VNOA 2Y34A 3WG4A 1LNSA 5KXDA 1OPOA 1QHDA 4JKKA 2CAUA 4CDWC 2XKPA 2QCSB 2L9LA 4C91A 4FTEA 3EBRA 2Y33A 1WBFA 3POIA 3RDIA 4QM8A 4QPGC 3JCIA 3NJZA 5FLJA 2CV6A 3H3ZA 4N9IA 4FPLA 3AXDA 5CFCC 4U36A 2X5IC 3FBYA 4Q0QA 1EYBA 1CAXB 4JTNA 4A6OA 3DPRA 1OA2A 4Q4W1 1AYN2 3LDKA 4QX7A 4AK3A 1FT9A 3ZSJA 2LM3A 1W8ZA 3WG3A 1NKGA 2WNVA 5IFTA 3UNPA 5F2WA 4CEWA 1W6PB 4Q4W3 1IPSA 5L9RA 4D3WA 1E57A 2DFCA 4MGSA 4AR2A 1I1EA 2J1TA 1W8HA 1OKOA 1Q43A 2SBAA 1ZX5A 5AVPA 2RS11 3PUHA 1F35A 1BBT2 4AG4A 2BOIA 1ZBA1 2Q8DA 1U5IA 2YHJA 2RS13 4L11A 2W91A 1W8OA 4GA9A 1DG6A 1JHNA 1ZBA3 4BXSV 3UV9A 3V0AA 3OCPA 3O1VA 3SH4A 4A7KA 4JGZB 4ES8A 4FBFA 1JYVA 1W06A 1BCXA 3O7OA 3LFIA 3LF7A 1SBFA 1T6GC 2VZSA 3CEWA 1PVC1 1F31A 2JDKA 1POV0 2BU9A 3U07A 1ODMA 4EN6B 5JOWA 1PVC3 2VTFA 1VALA 4GZ9A 3X29B 1WCSA 1K3IA 5DXDA 2H6BA 1M06G 1C5IA 2ZABA 3S5AA 3ZFFA 3QH7A 2Q1FA 1AR91 1RHI1 1JZ3A 3HR9A 1QXJA 2JG9A 1GBGA 5FZ6A 4L8QA 5F3GA 1RTVA 1Z0HA 1NQDA 1US3A 4AZZA 1DP0A 1AR93 1NCQC 1RHI3 4IUGA 5AVAA 1ZRDA 2DVFA 2XHKA 3ETQA 1NCRB 4Y20A 1QJY2 1Y3TA 2R32A 2DUOA 3U75A 4AEDA 3OBRA 4XUPA 4AEMA 4NHXA 4RS5B 5D8AC 5J09A 4FSJA 1ONAA 4QM9A 5FLIA 2OKXA 1PMIA 2VQ0A 4CXWA 2YROA 1XSQA 1W6MB 2BVBA 1GLHA 4RSUA 5FZOB 1W0NA 5DAXA 3U78A 4R9BA 4SBVA 2ZEXA 3PU8A 2AEYA 4MOAA 2XLGA 2R30A 1IQAA 2VZVA 2ZX3A 1IOAA 1AR81 3I7DA 2FZ2A 1Y9GA 4LQRA 1VB2A 1VBC1 4TTGA 1OC1A 3GDBA 2F4PA 3OGRA 3VHRA 1DLCA 1GZWB 1RUH2 1STMA 1VMFA 4N7IA 3ZSEA 4EN7B 4Z2AA 2VQTA 1VBC3 1RUJ1 1HN1A 1ULGA 3GXUA 4MYEA 5FMOL 3VHOA 3VHPA 4AEJA 4URTA 1VBA2 2VOKA 5DPNA 1RUJ3 3TRSB 2HWC1 4X8NA 3PUSA 2FMYA 2XH6A 2VUCA 1XC6A 3BPZA 2WA4A 5FYYA 2HWC3 5FMOS 4HL0A 4XTMA 4YG0A 3Q8BA 1O7FA 3ZYIB 1J59A 2RVAA 1XJAA 3MBWA 2PHLA 3WNNA 4FAGA 2IXHA 2JDYA 1OOPA 4XDOA 2FMDA 2B5HA 3EB7A 4BQYA 4LJHA 2AC1A 3CO2A 3PDQA 5LBEA 2R1BA 5M0TA 2QQNA 2IC1A 1PO11 5BNNB 1DYPA 5FBJA 4XUQA 1D4VB 2W1UA 4YVSB 5DMYA 1PO13 1RUI1 4AE2A 2K46A 4QPYA 1OLMA 4W50A 4YVWC 1GANA 1KS4A 1MVEA 1RUI3 1OLQA 1ND2C 3CJIA 3AL6A 3HEIA 2PHXA 2QQWA 2YDEA 3DL3A 4Q0UA 5FY1A 1AXKA 3KF3A 4L2NA 4WVMA 5T5LA 4BQWA 3JB4C 5FZ1A 4QPWA 4TXWA 4XJZA 5FP8A 1J3QA 4JDMA 4NO4A 4CDWB 1QY4A 4CCCA 5HXVA 3KCYA 1H1IA 4BXFA 4XFGA 3OGVA 1GICA 1O91A 3CBNA 2V4AA 2WAOA 3H7JA 1EUTA 3PTYA 4LO5B 4NWWA 4BYYA 4QPGB 4XDQA 4AQ6A 4WM7A 4XFIA 1PGL1 2E7AA 4H7MA 2WAAA 4E8DA 3J26N 5CFCB 3VBRA 3WQ1A 2V72A 2X5IB 2RE9A 1QMJA 4HG6B 2VY0A 1OF3A 4CDXC 4CXYA 4KWLA 4C1WA 3P5BA 4G4FA 3RS6A 2JIGA 1S0EA 4QXBA 5DZFA 3RZJA 4AHWA 1W0PA 1GR3A 1AJOA 2ETEA 3I97A 3M7AA 3MW3A 5GLUA 1CIWA 1BVVA 4XJAA 4ATFA 3J7NA 5JZGA 2RMU2 3GNEA 3OD4A 3K51A 2AH2A 1IS3A 1RXGA 3ZVXA 4D6RA 3OD0A 1OPMA 4KWUA 4QX5A 2EIBA 2VBDA 4Q0PA 3K2OA 4W65A 4NRPA 4UAPA 4QB6A 2LW8A 3T1LA 3I49A 1JYCA 1AL0G 3OYWA 4QU1A 4Y33A 4TSVA 3AZXA 3VKOA 5A70A 1CR7A 3UK9A 2PN5A 2VAUA 4XJ9A 3MPBA 3BKZA 5FXVA 3N36A 4COUA 1RB8G 4PDWA 2RDNA 2GNMA 3CIHA 1K5MC 4B29A 5J37A 1W2NA 4LR4A 1EV13 3VDAA 1WBLA 5IW0A 5J48A 4FPCA 3HIFA 5IATA 1S0JA 4DQAA 5A6YA 2BW8A 3E6DA 5LEJA 3E1F1 3TAYA 3GZTB 1UYZA 2YC0A 2Q30A 2A73B 1QOSA 4UYBA 3JD71 5ERLA 1IS5A 1AYN1 4DEVA 3JD73 4Q8KA 1ULEA 3AKRA 5F5AA 1NCQB 3KHCA 1GZ9A 3L2HA 1POV1 3B94A 1G6NA 4XQ4A 1XNAA 4Q26A 5EHDA 4CDQA 3HNBM 3SCGA 3VL9A 1POV3 5FY8A 3ZXEA 4CE8A 4CVUA 4B4QA 5FZ0A 2DTWA 5D8AB 3B69A 3NAPC 1OT5A 4LUMA 5GZEA 3WV6A 3RVHA 4A44A 1JZ2A 4FOVA 1ZZBA 3OGSA 4BOWA 2XGXA 2PMWB 2QVSB 2GZWA 2OUHA 4IE4A 1M4WA 3VD3A 1ULCA 3KB5A 3OOXA 4P9LA 4RFT0 1IPKA 3GALA 3ZN5A 4F7ZA 3B02A 5A7PA 5LBCA 1WGPA 4KU7A 2OS2A 4WV8A 4MHRA 1NLQA 1XU1A 4GH4A 3MFCA 5C33A 3U4XA 2ARBA 1W6QA 3AMQA 4KGQA 2WNOA 1QU0A 3C7GA 1LOFA 2RHPA 5F8PA 1AYM1 1BYHA 2BERA 4LMFA 2EVXA 4ATEA 4E8CA 1LOBA 4N7UA 3NV3A 1CAUA 1W6NB 2QQPA 1AYM3 3WQ7A 1RMU1 3I3QA 4JV4A 1OVSA 4FPFA 5T5OA 4AVTA 1QDCA 2W3JA 1RMU3 4NAMA 3M3QA 3POSA 4LA2A 1PGW2 5A7QA 3KMHA 4K3UA 4ZKTB 5BUVA 4C1XA 5CG9A 4I3PA 1VBE2 5JIAA 1REEA 5DAQA 4LHKA 1CAWA 2DCKA 5A32B 1VAMA 5T50A 2R16A 3O1OA 3PUAA 2QQIA 3H42B 3K4AA 1US2A 4LUKA 2ERFA 3WDWA 4YSFA 2OT7A 3QLQA 5BXXA 5EP9A 1JTZX 4HVRA 2Q1ZB 4K8FA 5FZKA 3FN9A 4DMIA 2RS32 4XBQA 4XW3A 5F5CA 3SXWA 3WUDA 1RUOA 1REFA
chains in the Genus database with same CATH topology
2GMPA 4RQPA 3FUQA 2PHWA 1N1YA 1DDLA 3VBSC 1WD3A 3WW3A 3I54A 2XB6C 2ES3A 1VP6A 2R49A 4Y24A 4YVWB 4YARA 1ND2B 2PLV2 4B3NA 5JAXA 3HBZA 2ARXA 1S0FA 2DU1A 2ZHKA 3JU9A 1ZM1A 4GKYA 4NOTA 3AYCA 3AFKA 5I0RA 3TB0A 5FOBB 1DQ6A 5AFEA 3IN9A 1BVP1 4MLOA 1N1SA 3NW4A 2AREA 5DDJ2 2XLFA 3EXUA 3FFQA 2XUMA 4XF0A 5I8SA 4AI3A 3N7LA 3ZIWA 4CDXB 1KQRA 3WOGA 4Z07A 1QQP1 4IQPA 1BEV1 2WL1A 1QOTA 2XL9A 1H4HA 1QQP3 1BEV3 1ZA4A 3BOPA 1GNZA 4S2HA 3ZXGA 2VOWA 3HWJA 2WNUA 3GBWA 1C1LA 4IEZA 3VKMA 3ST7A 2PHFA 1RGSA 1MS3A 3LCPA 2XBO2 2PELA 1R1A1 4XXAA 1OA4A 4S2GA 1K5MB 4RGAA 1G7YA 3Q9OA 1R1A3 3IWZA 4GKXA 4I0AA 2VW2A 1Q8QA 4N43C 1D2SA 3TN91 3WDYA 3AFGA 5FOJB 1GNHA 4K20A 4XFHA 3ELNA 3TN93 4XXPA 1CONA 2DU0A 2BEOA 2GNDA 4AFCA 1ASJ1 1VBD2 1DF0A 4YW2A 1RL3A 2XG3A 1XNKA 3TNPB 4C0HA 4LBKA 1ASJ3 5BNQA 4FPOB 4YZ4A 5AFBA 4FO9A 2P3KA 1YXWA 4HVOA 4YZ1A 2RMU1 1WW5A 3C3VA 5K7PA 5JPMB 3TYJA 1RUC1 4ISQA 1RUD1 4P9WA 4X6QB 4W6XA 4LLOA 4AI1A 1YFYA 1RUC3 2ZMKA 1UCXA 3NAPB 1RUD3 1NE6A 5I8TA 5DUVA 4W6YA 3OGJA 3D0JA 1YIPA 4FCAA 3AP5A 4CEYC 3DUIA 1H4GA 2I07B 3ZFEA 5CNAA 5CFDA 1PHMA 4DXZA 4YM0A 1LECA 1V9U2 4YYOA 2EIGA 3L2YA 4EWAA 3VBFC 1Y9QA 3ALQA 3HQXA 4DFSA 2MPFA 2VMIA 5DZEA 1KFXL 3WR0A 2XJSA 5FO7B 2R6QA 4IV3A 4K21A 4QHBA 4ASLA 4DNYA 4FAHA 4AGVA 2WQZC 1MZ5A 1SLLA 1S2BA 2JG8A 1AX0A 1OFSA 3GHMA 1UU5A 4P9JA 4AFBA 4I2OA 3M4FA 4N53A 1MEC2 3D82A 1ZREA 1KITA 1D4M2 4RR3A 1WW4A 1NA1C 4QGNA 1XYNA 1AXZA 4UW5A 4COZA 1C3HA 2VUAA 2BNNA 1QGLA 5C4WC 1QNWA 4Q4Y1 1DZTA 1H8VA 4Q4Y3 5ACA3 3VBSB 1DBNA 1TNFA 3HAGA 4ONUA 1JOJA 3AKTA 4WM8C 5IK8A 1WUVA 2K2SA 2OVUA 4FXGB 5L7OC 3FWEA 4S2DA 1CAVB 1HXS1 4XOGA 3W59A 1YNAA 2IZWA 3VKFC 3WD5A 3J4UH 1HXS3 2Q0AA 1VBE1 4OI4A 1RIRA 1LTEA 3E6BA 2CL2A 1LULA 1VBE3 4QQHA 4H55A 4AVAA 2DUQA 2SLIA 5IK4A 5E16A 3KCXA 1EPZA 3I59A 1URXA 2QDRA 5I0SA 1UL9A 3WG1A 2HWB3 4EROA 1D2QA 2GH2A 1H1MA 1H8TC 2HYKA 2UU8A 1A8DA 3A0KA 2ZKNA 3SHRA 4A2UA 3POYA 3UKTA 3MICA 2BTVC 1UIJA 1X33A 3AP7A 5FTTC 1A78A 2PLV1 4MVTA 3ILNA 1MVQA 3TBDA 2B7YA 2PLV3 1BJQA 4LBMA 3N35A 4XF3A 2KA3A 3RYPA 3HT1A 1PZ9A 4QPIC 5D1IA 5IUQA 3FFZA 4JDOA 4B7KA 1TME2 4KL1A 4N43B 4YGDA 1KD7A 4IETA 3M2MA 4PJYA 2JECA 2D40A 3EJKA 2WLQA 3PMEA 3GZUC 3I8TA 3B5LB 2K0GA 5H9RA 4S2FA 3UL2A 5K8SA 2FBEA 2HWF2 1PZ8A 2NQYA 2IWGB 1W2UA 1MS4A 2HEYF 2XVGA 3KD4A 4XF4A 3VN4A 4LO8A 1SMVA 1CAXA 4OZXA 3LZZA 1DYKA 2H6CA 5HCAA 3MF9A 3R4UA 1W6PA 3JBG2 5F1RA 3OJBA 2W39A 4BMBA 2XBO1 4IV1C 1LB2A 4XF1A 4AEKA 4UW6A 3WCRA 5J3UA 2GC0A 2A5ZA 1ND3C 2BBVA 3AK0A 2JICA 3USUB 2G9GA 3WINE 1HW5A 1I6XA 2UY8A 2WA3A 4LBQB 1UU4A 4CEYB 2HEVF 2HEWF 4IEVA 5CVRA 3PLQA 4PLMA 1FNZA 1UZZA 2E9QA 1JBCA 1DQ1A 1RUF1 4IEQA 4JGZA 3OTFA 4PCRA 2XJPA 1MQTC 1RUF3 4OULA 2MNGA 5GJ6A 4FOWA 3D5OA 2Y0OA 3VBFB 5GZCA 4AFDA 1ZRRA 2AZ5A 4P5HA 1IGOA 1LCLA 4BM8A 3VHNA 4ITCA 2ZJCA 4FPEA 3AX4A 1A8MA 1QJX1 1DHKB 2OIIA 3WP3A 1KDKA 1Z78A 3QBQA 5GZGA 1LU2A 1QJX3 1EAH2 1DLLA 1NA1B 5BY5A 1XU2A 1OMIA 1SDWA 1NCRA 1S1AA 2R071 4JAAA 5C4WB 2X53S 3ZSMA 2NLRA 1OSGA 4RS5A 2VNRA 2R073 1DQ0A 1MS0A 1W6MA 1FMD2 3KT7A 3IPVB 5GLVA 4PQ9A 3SISA 5FFOC 4WM8B 3ZXLA 4D94A 3VZNA 4Q2FA 1UKRA 1AR71 2O0OA 4BPZA 3PMSA 4INDA 5L7OB 1AR73 3CLPA 3RPQA 4YG6A 4XILA 4EWEA 1ZNPA 2R0FA 2Z5WA 1XYOA 1GZWA 2EXKA 2MEV2 1GQGA 1PVXA 2VW1A 1DQ4A 2G4IA 5JVVA 4A3XA 4DB5A 1FATA 2GSYA 3VBUC 4JDNA 1RUNA 1D4M1 1A6CA 3MFAA 3MZHA 2GH8A 3PVOA 2ZA9A 5F9TA 1COV2 1V00A 5B2GB 4MZUA 2IXKA 4XIKA 5HI0A 3NKTA 3QOPA 5EJ3A 4AGGA 1O5UA 3ZXDA 5DZGA 4HLTA 1UN1A 2NMOA 1AUYA 4ES9A 1H8TB 2Z79A 5LEKA 2DCJA 5AC91 3MIHA 1LHNA 4M01A 4KGGA 1S0IA 5AC93 3SMHA 1AX1A 2DCZA 2WQ4A 4AW7A 1CESA 1LHUA 5BNNA 2D93A 4YVSA 2DYCA 3SH3A 3LOBA 2RJKA 4OHZA 2R042 5EWSA 3BOWA 4QPIB 3ZXFA 2BFUL 4HKOA 1VRH2 2R062 1QJU1 1SLIA 4I02A 2A70A 2CGOA 3WHUA 4CDUC 3RYRA 1QJU3 3RMYA 4CDWA 2E53A 4BIOA 2Q8OA 3B00A 4GALA 1NZCA 2GN3A 2GALA 1RJ8A 5JCTA 1UPIA 3N3HA 4QPGA 1SLTA 4KQ7A 4UXAA 3P3NA 1O3SA 5TSWA 5CFCA 4FOYA 2BNMA 5SV5A 3LA7A 2X5IA 1X82A 2GC2A 3SCHA 1UIKA 2D6OX 2BGCA 3CL1A 4KG0A 2CY6A 1MS1A 3AYDA 2ZGTA 3GF6A 3NWKA 1AF9A 2C0ZA 4IV1B 1UD1A 3MIFA 1GFF2 2GC1A 3TWIA 1KDMA 4PBOA 1ND3B 5BNPC 4W6WA 4AI2A 2RR11 4GB32 3H1YA 4AGRA 3L9JT 3MW4A 2RR13 1QNYA 3H3UA 4AHXA 4QQ2A 4Q0SA 1AR83 1MQTB 2WT0A 5DUXA 1O3QA 1RUG2 3JZVA 1H2KA 2I74A 4MXWB 5C9AC 1YLLA 4K7JA 3MYXA 2D97A 1PZ7A 3E5UA 3PVBB 2ZZJA 3G7DA 4XE9A 4PIYA 4D7SA 3POWA 4XQWA 4P9XA 3JBG1 1NCQA 2RM21 3IDCB 2EAKA 4NPRA 1CPMA 4YW5A 2WZR2 2RM23 1ZVFA 3R0RA 5DUWA 3V56A 1PO22 4FQZA 4MXVA 5D8AA 2ZPXA 1VBB1 3WDUA 2BYVE 2PAEA 2HWD1 2K9ZA 4HMZA 1VBB3 2XKOA 2WFF1 2ZGNA 4M0HA 2RJLA 2HWD3 3WP4A 3WX5A 2DVDA 2WFF3 2VECA 2ZAHA 3A4UA 4AHYA 4LO7A 2YMZA 4XJUA 4L99A 3WHTA 4BQ1A 1YJLA 1H0BA 2DUPA 4XFAA 1ZZCA 1G86A 1UX6A 1W6NA 3V65A 3LGRA 3VBUB 4NHKA 4QT6A 1PK6C 2LTNA 2YPJA 3S7EA 4H14A 3SNMA 1I5ZA 5DG2A 1SBDA 1FPN1 4AVVA 5A32A 1U5XA 2XLAA 1OD5A 3ILFA 3VBHC 1LODA 4JRAA 1FPN3 3C2UA 2P2KA 4OUMA 4LBQD 4LBNA 2V73A 2XPJA 2A71A 2CAVA 1VIWB 4FQ4A 1FAYA 3H7YA 1KXGA 2ET1A 2Y38A 3V0BB 2VULA 1AL21 3O14A 1C8NA 4MGIE 4D7YA 1AL23 5JLVA 2CWMA 3G6JB 2NM1A 2UY9A 3NV2A 2D5FA 4YVWA 3WUCA 1LKNA 1ND2A 1H2NA 2OUJA 3LWCA 2A7AA 3RMXA 4HKWA 4CP2A 2OA2A 3AMMA 3BALA 4CDUB 3FUOA 1ZZ9A 4XZPA 2YXSA 3R05A 3WDXA 1LGBA 2QZ3A 3PNAA 5JSOA 4XIOA 4K9SA 1AYN3 1LOFC 3O0XA 4HSLA 4A7ZA 1MZ6A 1YJKA 4D7TA 2P17A 2KXLA 4CDXA 1BBT1 3JQWA 3VZJA 1A3KA 4RHV2 1BBT3 2GMEA 1DGWX 4QGMA 3D8CA 3DN7A 3WT3A 2PAKA 2JD4A 4LULA 5BNPB 3ME2A 1N47A 4LBJA 2NN8A 3AB0A 3SH5A 2IXCA 4E4ZA 4HVQA 1W39A 3FZ3A 2E51A 1R082 2P3IA 3WP6A 5GZFA 5KWRA 5A33B 2C1FA 1J3PA 4IEPA 4WVWA 5T54A 1K5MA 5FO8B 5IK7A 5J36A 1WA4A 2HWE2 5H9QA 3AKQA 5C9AB 1YWKA 4CTEA 4GMP0 1SEFA 3RI8A 4OHWA 4B4PA 1QJY1 5KXBA 4YNIA 2O1QA 1IHMA 3FC0A 3JQXA 1QJY3 4AQSA 4XBNA 1X36A 4YZ2A 4KWJA 3RYKA 4WVVA 2OW4A 1WMFA 4QMAA 1YFUA 3CNAA 1V70A 2UWCA 3NL1A 3ZYJB 2WT1A 1H2LA 2YZ4A 4RL7A 3LA2A 3M8LA 1KS5A 3NAPA 5GLWA 2IXJA 1EPWA 1MZFA 2VW0A 3FBMA 1RVF2 3AMPA 4YW3A 4JQRA 4KH9A 1XXNA 4P9IA 3WW2A 1RUH1 2VVDA 4Y1ZA 4JGYC 1O5LA 5BNOC 3FLRA 1JYIA 1RUH3 1V6JA 2DFBA 3HN1A 2LALA 1RUG1 2KM2A 4AHZA 1VBA1 1GSLA 5HCFA 1X8MA 3RJRA 1RUG3 3U11A 3WZ1A 1VBA3 1Q56A 3UJQA 1VR3A 1LEDA 2VXRA 2VNGA 1SBEA 1NG0A 2CWSA 1C57A 3FLPA 1UMZA 5E88A 1RITA 1QWRA 2CGPA 1CGPA 4GULA 1HKDA 2ZX4A 1PK6B 2WJSA 5KC5A 1HX6A 4NWVA 4B4RA 3N7JA 1S2KA 4QD2A 2TUNA 5JOXA 2H0VA 2OPKA 1AR62 1OQDA 4K6BA 4P14A 4DINB 1PO21 3VBHB 4IEOA 1LR5A 3WP5A 3AZWA 1UPSA 1YUDA 1QH7A 3ECQA 4J1XA 4FPJA 3ACLA 1KJLA 1R092 3DV8A 3PVNA 4X8PA 3RI9A 1F5FA 3H1WA 4AFMA 1BMV2 5KHIA 1DZQA 1ENRA 1SFYA 1HIXA 4H3WA 5F6KA 1Q8SA 5CAZA 4OHXA 2ZGMA 4K1ZA 2IXLA 4NVPA 3OY8B 3VBSA 2I45A 4COVA 4R8HA 5KHHA 4M00A 3ENRA 5K0UC 3B7MA 1V6IA 1R1ZA 3KT4A 4FP3A 1CAVA 2BUKA 3KGLA 3LAGA 4XHBA 1G9DA 1ZBE2 1DGLA 3USSA 4E4SA 4MSVA 5SV8A 5C6CA 2D3RA 4F8AA 2UYAA 2TNFA 3D0SA 4META 2FHRA 3RQ0A 2YUEA 5HBAA 5LRRA 3VZOA 5C8CC 5FPZA 2RMU3 2A6ZA 4ZU5A 4ISRA 3JB8A 1XNBA 2NYYA 4Y1YA 1ENSA 1UU6A 1KJRA 4CP0A 5FO9B 3TOJA 4E2SA 1NXD1 3UKVA 1VLNA 1AZDA 2E7TA 3ATGA 3AP4A 3H1MA 1RUE2 2PQQA 4Q29A 1JUHA 3ZXAC 5ABJC 4AVBA 1TMF2 4FPGA 5H9SA 3SITA 3WXPA 1XE7A 4Q4X2 3GBFA 3AP9A 1DZRA 1YYNA 2CGNA 4I09A 4QGLA 2R1DA 4M3CB 1U5YA 1VB4A 2E6VA 3ES4A 2NZ9A 4N43A 1FI2A 1DQ5A 4L97A 1PGSA 1FNYA 2H0BA 2PHRA 3JUUA 3OBTA 4IERA 3BIWE 1CD3G 3WW4A 2WS92 1J58A 4QQPA 3LSDA 1SLCA 3ZMOA 5CADA 5C8WA 2ZX0A 2VOXA 4GMP1 3VZLA 1ZZ7A 1REDA 5A3LA 1LGCA 3KS7A 4GMP3 4JVAA 3RG0A 1ENXA 3MIDA 4CP1A 2QKDA 4OI0A 1UZYA 1S0GA 1R081 3AKPA 4WVZA 2P37A 3RZZA 1R083 3USUA 4JGYB 4LBQA 4R4ZA 5JDBA 5BNOB 4CEYA 1B35C 1TQ5A 4MGZE 2GNTA 2PTMA 3IBMA 2A6XA 1DGRN 1JUIA 3O5SA 2VOVA 4A7YA 2PFWA 1PGW1 4MV2A 4ZU4A 4DZGA 4BE3A 3VBFA 2XVKA 3KLSA 4JTOA 3URFA 1YHFA 2PAMA 2RS12 3ZFGC 1DGRA 1U12A 4DRRA 1ULDA 4J6GA 5JWPA 2UYBA 2BWAA 3AZZA 1LESA 2RS31 1W6OB 3BCWA 2RS33 3N7MA 3D4KA 3VZMA 1CJPA 4HETA 1KFUL 1NA1A 1PVC2 4WBBA 1UW8A 3B93A 4XPVA 3IIAA 5JI9A 5JOYA 5C4WA 3AZYA 3VBOC 3M3EA 2XJRA 3EQEA 2P3JA 4YZ3A 4M3CE 4Y4YA 3ROUA 1C4RA 1AR92 1RHI2 3IPVA 3KGZA 1S0BA 1FX5A 4I0WB 2X8KA 3B9CA 5I0TA 3TNQA 4AFAA 5EFUA 5LRSA 3ZN4A 2QUOA 2V5YA 4WM8A 3MIBA 5DDJ1 3E97A 5BPXA 1ZZ6A 2QZ2A 5E89A 4HKLA 5K0UB 5DDJ3 5L7OA 1OI6A 2B9UA 4ORFA 2UWBA 1IKQA 4AWDA 4I0BA 4XFCA 1OFNA 2A3YA 1NYWA 1PM7A 3WCSA 2VG9A 4XFFA 5C8CB 1JH5A 2PHDA 4E27A 1BMV1 5LK5A 1VBC2 3MGUA 3M3OA 2ZX1A 3MW2A 1H8TA 1HV0A 1RUJ2 2AENA 2DVGA 4FP2A 4HZFA 4YLZA 1AVBA 2NMNA 2XBO3 5K9YA 1Y7BA 3MLKA 2D5HA 4Y22B 3ZX7A 3LA3A 5CU1A 1YFXA 2O8OA 1S55A 3NV4A 4Y5Z0 5ABJB 2V09A 2VU9A 2WZPP 2D7FA 5H9PA 3HMYA 4COYA 3DKWA 1XYPA 3VDDC 2ZHLA 2Q5TA 5GZDA 4QPIA 5EYXA 3B9IA 4I01A 1VBD1 2D6KA 5J98B 3KM5A 3QCWA 1VBD3 5HCBA 2EALA 2EXHA 4YGBA 3M3IA 3LB9A 3WY6A 4XF9A 1O4ZA 4XHXA 1TNRA 2GAUA 1RUI2 5E1RA 1WW7A 1ALYA 3V64A 1GV9A 1X8EA 4Z92B 4WZFA 3R4SA 4COWA 3ES1A 2ILMA 2QFEA 3DPRC 1ZYBA 1IKPA 4IV1A 2WNVC 2D6NA 4CEWC 5FRAA 3FJSA 1ND3A 1V9U1 1S0CA 4CRQA 4PIZA 1IS4A 1V9U3 3W58A 1B35B 1GKBA 1MS8A 1N1VA 5EV7A 4BIFA 4MGYE 1S0DA 2A3WA 1SCRA 4XJ8A 4BHPA 1V6MA 3AMNA 1MQTA 1RJ7A 3O0WA 1MEC1 2VUJA 4N90A 1JW6A 4XQDA 4MXWA 3ZFGB 1JN2P 3H50A 1MEC3 3IDBB 3J9SA 5GLTA 2XJTA 1D4M3 2Y0IA 3P3PA 4KBBA 1QDOA 4FPKA 1LOEA 4OHVA 4XEZA 1EV12 4XFBA 4CYDA 1F8VA 3ZFFC 3ZN6B 4SLIA 3KT1A 2ZBJA 2C9AA 2JG9C 2ZX2A 2GNBA 4Y1XA 1C8M2 1DIWA 1CPNA 1AJKA 3VBOB 4LE4A 1NE4A 1XNDA 4YFWA 4XETA 2XJUA 3NSTA 3JD72 1VAVA 1CX4A 4AEDC 3VKNA 2GN7A 2W08A 2XL7A 4R9DA 3THPA 4YM2A 3NV1A 2IXIA 2A6YA 1HDKA 2DF7A 2DVAA 1SACA 5JI7A 4I3GA 4EN8B 1FOD2 4L92A 3WVJA 2BFUS 3RJ2X 1U0AA 4AF9A 1DQ2A 4HSJA 2GU9A 4NN0A 1HRV2 3MLLA 2B42B 4J1WA 1LEMA 2AGSA 3VBUA 4TZDA 1RINA 1FXZA 4L9BA 5T5PA 1NXMA 3VKLA 1LGNA 1V6NA 4CZSA 4HPKB 5T55A 5IK5A 1OA3A 1AYM2 3WNXA 4LE3A 1NOVA 4FPYA 4PLOA 1RMU2 3VV1A 2B8MA 2VQAA 1OOPC 3V0BA 2D6MA 1TME1 3M70A 3AYEA 1NQJA 1J3RA 4QU2A 1TME3 2YGMA 3R4DB 3VDDB 4OHYA 1Z7S2 4OUSA 2AR6A 4LO6B 4KNCA 3GYDA 2A75A 2HWF1 4YGEA 5FQ0B 4R4XA 3CJIC 4CDUA 3VLBB 1WMDA 2YY1A 2HWF3 2FQPA 2ZHMA 5KXEA 3H0OA 1HQWA 2ZKLA 4RD7A 4IEXA 3ZMNA 5CG8A 2ATFA 3OGGA 1C28A 3OPZA 3JBG3 4WM7C 4H7LA 3EO6A 5FAXA 4KG8A 3ZXJA 1QXRA 3VBRC 1ZRFA 1QXPA 2CNAA 2OZJA 3DPRB 4E4DX 3ZPYA 5FBZA 3IDEA 4XJWA 2VH9A 2WNVB 4CEWB 2QNKA 3H8UA 1X50A 3T2TA 3NO8A 1H2MA 5BNPA 1VAKA 4F3JA 3PVEA 5JZGC 4Z82A 4Q27A 2QJVA 3CF6E 1YFWA 4OFGA 1QQP2 1BEV2 3I2DA 4Z2WA 2R0HA 5A33A 2GMMA 3V0AB 3FMGA 2N7GA 1I9RA 4U2AA 4GIQA 1LJ7A 4PDWC 1EAH1 4LT5A 5C9AA 4MGKE 2Z42A 4FXKB 4UBHA 2HJIA 3VGIA 3INAA 1EAH3 4QXKA 2ZCWA 4GXLA 3LSEA 3S30A 3IKWA 1R1A2 5J7MA 4DY3A 4IEUA 1YI9A 5GLZA 3ZFFB 1FMD1 2WSUA 1GZCA 1X7NA 2JG9B 4BMEA 1DFQA 4Q4V2 2DV9A 3KCCA 1FMD3 3TN92 4BCUA 1YCIA 1MZEA 3BTAA 2Q4SA 4Y20B 4CDQC 4P9YA 2PYTA 4HFSA 3RSJA 2VMGA 4AEDB 3U0ZA 4QQLA 1ASJ2 2WWSA 3RWNA 1LHWA 3O0VA 2IFWA 2DVBA 1Q8PA 2QE3A 2MEV1 4LA3A 1B09A 5I91A 1RC6A 2B46X 3AJZA 4IESA 1O4TA 2ZMLA 1D0HA 1RUC2 2MEV3 1RUD2 2JJ6A 1QH6A 3VL8A 2YGLA 3GBGA 3MDPA 4GH4C 4YGCA 1COV1 5JR7B 3AJYA 4XMIA 4EN0A 1COV3 2EXIA 1NLRA 1EV11 2D43A 1W0OA 2WC2A 4X6RB 1MS9A 1PK6A 1LENA 5CIRA 3VZKA 2LUWA 2ZOEB 4LO4B 4Q1RA 5DUUA 1C8M1 1ENQA 4PIXA 1C8M3 1PIV2 2W0XA 1NY72 3VBHA 1LOCA 3ZSKA 4IEYA 2ZGLA 4F83A 4E2QA 3HD8B 4JRLA 2WSVA 4E2GA 5JSRA 2R041 5JSPA 5JPNB 3KSCA 3UJOA 4TWTA 4LHLA 1OOPB 2R043 2ZZQA 3MLJA 4K40A 1VRH1 2R061 4DS0A 5JIUA 4HANA 1FOD1 1VRH3 2R063 2ZGPA 3OY8A 1HRI2 4RA0A 2VMHA 4RQPC 1WLCA 1FOD3 1DGWA 5FLHA 1G9BA 1G9CA 2WNEA 1HRV1 3CJIB 4HN1A 4Q4Y2 5ACA2 4BWOA 4WVMB 1F5JA 1HRV3 2YV8A 1BKZA 4QQOA 1J1LA 1QF3A 5J96B 2JDZA 2Z69A 4GWNA 1OKQA 2AUYA 4K1YA 4DY5A 4P9GA 3MIGA 4WM7B 1MR5A 2Z2SB 1N3QA 1IZ3A 1O4YA 4R9AA 4XBLA 3ZO0B 3VBRB 1DU3D 1F2NA 2E63A 1HXS2 4FPHA 4O9GA 5EYYA 4GB31 1CQ9A 3WDTA 3THTA 4GB33 3AM2A 3I4IA 1Z7S1 2I2SA 5JZGB 1GQHA 1HQNA 3M3CA 2WNUC 1QOOA 1Z7S3 4XTPA 3U10A 2JE7A 3R6SA 4YM1A 2HWB2 1ZRCA 3MI8A 4YW4A 3FE5A 3OYWB 3E5XA 2PHUA 3J8F2 2OYZA 4M3CA 1N3OA 4ASMB 3ZIXA 4PDWB 4HK9A 2Y26A 4YM3A 2UURA 2QDNA 3RRDA 3KQRA 2WZR1 3PHMA 2ZHNA 2JXAA 2WZR3 1UAIA 2F6BA 2ZGUA 1PO23 1AX2A 3DGTA 2B45X 2MHFA 4JCKA 2BVVA 2EXJA 1Q8OA 4BZ4A 4AI8A 1H30A 2D44A 1BZWA 3H9AA 5GALA 2PHTA 4CDQB 3LKJA 2IFRA 2YYOA 4EV0A 1IPJA 3M1HA 2G9FA 2EAAA 4Q8LA 3GHNA 5F6LB 3WLUA 2JX9A 5JOZA 1LHVA 1Y43B 1H1AA 4JGYA 4TYSA 2C5DA 5BNOA 1XNCA 1FV3A 2ZGSA 2DCYA 2ZGRA 4LBLA 4AI0A 1C1FA 3AKSA 4FVVA 1UF2C 3N4MA 1XRUA 4AVSA 4GH4B 4JC1A 3ZFEC 2X29A 5CFDC 1W6QB 4BH9A 4LTAA 3N7KA 2UWAA 2ZACA 5E8AA 4UBGA 2JE9A 1V6KA 2ZAAA 3QD6A 1CAUB 4ZXKA 1H9PA 4Q4V1 3ZSLA 2OZ6A 4IV3C 1RUF2 2FZ1A 4Q4V3 1W6OA 2JG8C 3E5QA 2CYFA 4NR1A 3S0MA 5L36A 1CAWB 3IM0A 5I0UA 3BU7A 4N53C 1LU1A 3ZYRA 2CTVA 1WLDA 2RS52 2BWCA 5L73A 4HK8A 4RR3C 5KXCA 1ZZ8A 2TEPA 1XE8A 2ZTNA 4D69A 1OLRA 1H9WA 1QJX2 2O8QA 3KZ4C 1C5HA 3MF6A 5LK7B 4Z1VA 1MACA 2AYHA 4RQPB 3PJYA 2A6VA 3E6CC 3FLTA 4OI2A 5T52A 2BPA2 1N3PA 2R072 2ZS6B 5BYNA 3AXEA 5IT6A 1UKGA 4E9KA 5K0UA 2D3PA 2EA7A 2HKXA 2WFPA 1EP0A 2XWBB 1HV1A 3LOIA 4GWMA 5GKAC 4RHV1 1PIV1 4DOUA 1NY71 2D6PA 4YW1A 4RHV3 1WLTA 1PIV3 1O3TA 4OVEA 1AHSA 1AR72 5C8CA 3ZXKA 1SQ4A 1QJZA 3AMHA 3PJQA 4FOQA 4BLJA 5FPXA 3CU7A 2EF6A 4MH0E 2ZMNA 1U5ZA 4LHNA 3O12A 2DTYA 3MIEA 5F5QA 4C90A 4R9CA 2BQPA 2GDFA 1WD4A 3FHIB 5JMCA 1HRI1 5FCCA