2JG8A

Crystallographic structure of human c1q globular heads complexed to phosphatidyl-serine
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
133
structure length
133
Chain Sequence
QPRPAFSAIRRNPPMGGNVVIFDTVITNQEEPYQNHSGRFVCTVPGYYYFTFQVLSQWEICLSIVSSSRGQVRRSLGFCDTTNKGLFQVVSGGMVLQLQQGDQVWVEKDPKKGHIYQGSEADSVFSGFLIFPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Complement C1q subcomponent subunit A
publication title C1Q Binds Phosphatidylserine and Likely Acts as a Multiligand-Bridging Molecule in Apoptotic Cell Recognition.
pubmed doi rcsb
molecule tags Immune system
total genus 26
structure length 133
sequence length 133
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00386 C1q C1q domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2jg8A00
2Z5WA 1D4VB 2JG8B 4TWTA 4TSVA 2JG9C 5L36A 1DU3D 4G3YC 4DOUA 5CIRA 1PK6A 2Q1MA 4QPYA 1DG6A 1U5XA 2Q8OA 3TYJA 3QD6A 2WNVA 2O0OA 4KG8A 1XU1A 2HEYF 2AZ5A 5KC5A 1PK6B 4OUSA 3FC0A 4RSUA 4E4SA 1XU2A 4DB5A 2RE9A 1C28A 5KWRA 4QQPA 2WNVB 5L19A 1D2QA 2HEWF 4HT1T 1JH5A 2WNUA 2KA3A 2RJKA 2JG8C 3MI8A 4QQHA 4MSVA 2R6QA 1KD7A 4KGQA 4MXWA 4F3JA 1D0GA 4MXVA 1KXGA 1I9RA 1JTZX 5BNQA 2R32A 4OULA 1TNRA 3WD5A 1TNFA 4N90A 3URFA 2TNFA 5TSWA 1PK6C 3AB0A 3K51A 2TUNA 1O91A 1RJ7A 2WNVC 1A8MA 1OQDA 2E7AA 3B9IA 3L9JT 4E4DX 2QE3A 2R30A 2JG9A 4OUMA 4EN0A 2QDNA 2WNUB 4QQ2A 1U5ZA 3V56A 4MXWB 2WNUC 1S55A 1OSGA 2JG9B 2HEVF 1RJ8A 3LKJA 1IQAA 1ALYA 1WCKA 3TWIA 3B93A 2RJLA 4J6GA 4NN0A 4D7YA 4KGGA 4QQLA 2X29A 2ZJCA 4QQOA 3ALQA 5HBAA 3QBQA 1C3HA 1U5YA 1GR3A 2ZPXA 4GIQA 3IT8A 2JG8A 4G4FA 3K48A 2OIIA 3ME2A 3B94A 5KC6A 1OQEA
chains in the Genus database with same CATH superfamily
1R082 2UY9A 2C9KA 3AK0A 3AZXA 4AWDA 3V0BA 3RZHA 4QKDA 3ZN6B 1UXZA 1LECA 4YSFA 5A3TA 5J37A 1O4YA 2VH9A 4W6YA 4AI9A 4EJRA 3BTYA 3AKTA 1UKGA 3QCWA 1YFWA 2ZKLA 4A7ZA 3POEA 1VRBA 1XOYA 3W5NA 4WM8A 1PO22 5HPOA 5FY7A 5CFCA 1G9BA 3U78A 3MLKA 2DCZA 2Q8DA 3NJYA 4QHZA 3KB5A 1LODA 3RZGA 4AF9A 1LHVA 1GQHA 4BMEA 2UWBA 4IGOA 1ACCA 4RR3B 5CU1A 4ZZ5A 1WWYA 4E4SA 4LITA 2VMGA 4M01A 3U1XA 4QQPA 1P8JA 4AYUA 2LALA 3OY8B 3EB7A 5L9BA 3BU7A 2FCVA 1PO11 1MQTA 4LE3A 5FYCA 2PHDA 1AX2A 2HWC2 2WA3A 3MI8A 4WZFA 5T5PA 4YNIA 4Q1RA 1KD7A 1RVF2 2JEMA 1R092 2RDRA 3VDBA 1D0GA 1SPPA 2VZUA 5FZ4A 1CWPA 1PZ8A 2HH9A 5GZFA 1JBCA 5EV7A 4NE9A 5F9TA 1GQPA 2EXIA 4AGGA 3UJQA 3NKTA 4Q0VA 5FZMA 1E57A 2RHPA 2R32A 2D44A 4OULA 2J1SA 3C2UA 4HVQA 2Q4SA 3FFZA 1UYYA 1IG3A 1Q56A 1B35C 2ADEA 3SMHA 3VBHA 1JZ8A 1W6NA 4MLOA 4AHYA 1QOTA 1Q8QA 1YQCA 1N3PA 3TN93 3I2JA 4GKYA 2YPJA 2YBPA 4XIOA 3H8RA 5FY0A 2WLPA 1FPN3 3L9JT 1POV3 4XJ8A 5FREA 1W6QA 1PGSA 1O6UA 2FCUA 4AEKA 1N1SA 4NPMA 1W6OA 2V73A 5CNAA 1SG3A 1JODA 3VL9A 4CDXC 4DY5A 1AVBA 4P02B 3DXUA 4EN0A 2WNUB 2PLV2 3GXUA 3VHRA 1YXWA 1NOVA 1F4AA 2ZEWA 2EICA 3J26N 3IAQA 5CKMA 1H1AA 1NZCA 2DTWA 1GSLA 4KWJA 3WF1A 5A3UA 5FYYA 3Q8EA 5FUPA 1DP0A 3D8CA 5LA9A 4IEXA 1L3JA 3M3IA 5FYMA 1EUUA 3ZFEC 1ENQA 2WFPA 3J8F2 4NHMA 2ZCWA 4EN8B 1TME2 3MPBA 4NN0A 5IT6A 1DQ2A 4MOAA 3V65A 5DDJ1 5FYUA 4AQ2A 3TEYA 1OFSA 3ZOIA 4DEVA 2QVSB 5FZOA 2JDKA 3VUOA 1H8VA 2C9AA 5D8AC 3S30A 2WAOA 4CEYB 3VHPA 2HWB2 4HPKB 4FTBA 2ZX3A 2VNRA 5FMOS 3VN4A 1F8VA 4KU7A 1W2TA 1UMIA 3JBG3 3T2TA 1WMFA 2GNBA 2RS32 4BQXA 3NSTA 3LDKA 5A32A 3RNSA 2UYBA 3RZZA 1GMMA 1NLSA 1UPSA 2WO2A 4GAZA 1GWMA 1DLLA 2IVIB 5CB7A 4YVSC 2J1VA 2VL4A 2ZMKA 1FX5A 4N9IA 1S2KA 4DOUA 1W8HA 5CAZA 1B35A 5FPXA 2R063 4F83A 3OPTA 2WZR1 2VNOA 4IEQA 4CP9A 4O9GA 2AYHA 1QJU3 1VAKA 2HWD1 5I8SA 1LOAA 2F6BA 2VBDA 1ZZCA 2IXCA 4LOSA 4Q4W1 5LBFA 4LBQA 1O8PA 2J1TA 1UIKA 1EPZA 3AMPA 3VZLA 5CBLA 5BYNA 2B45X 3VL8A 1UD1A 2P3YA 3IMNA 3K4DA 4A7KA 1S0JA 3INAA 3AP5A 5APAA 2IFWA 2W0XA 1H6YA 4CDXA 2PQQA 4Z2AA 1G9CA 4YGDA 1JYIA 5FUIA 4FP2A 4XQ4A 5FAXA 1RUC1 4R4XA 4YW2A 2OQ6A 3ZSMA 1DF0A 4N53B 1RUJ3 4RS5C 4A6SA 2WNOA 3SH3A 2ZGQA 1YEWA 3FHQA 1DQ0A 4Y20B 4LKSA 5FPZA 3THPA 2W2IA 4XOGA 5HCBA 1W03A 2XONA 3HNBM 4ET7A 3OBAA 1GZ9A 2HWE1 4QU1A 1HN0A 2VOVA 4LOTA 3ZFEA 2J1RA 2E53A 3LE0A 2FHRA 2Y64A 3ZSEA 2D43A 1SFPA 3S6PA 4P9IA 5IVJA 2YC0A 1I5PA 2GC3A 1RITA 2Z79A 4PT6A 2A3YA 3POIA 4Y33A 1UY2A 1WBLA 3D0JA 5FPBA 4JGYC 1UYZA 1PK6C 1YFXA 5D8AA 3K51A 5BNNB 1KGYA 3ES4A 4UW4A 1KS5A 1BBT2 3GBGA 3ZFGB 2XWJB 5LBCA 3MGUA 1TE1B 3C8XA 4XHXA 1W8NA 4XETA 4WBBA 1GP4A 1LOCA 4JRAA 3ACLA 1ENSA 5IVVA 1G6NA 1JYCA 3KV9A 1AJKA 4YVSA 5IAXA 1ZBA1 1LR5A 2CWMA 4D8MA 1X9TA 2A3WA 2XLGA 4IEOA 2Z69A 1RUG1 1JYTA 1QJZA 1R1ZA 5F3EA 4PF5A 3SKVA 4GKXA 3VBRB 3MPPG 4JRLA 2ZGRA 1TQ5A 3MDPA 1YLLA 4QAWA 5FKCA 2RS53 5JSPA 1YIFA 4XF4A 3LWCA 2EXKA 1IQAA 3I2GA 3JQWA 1VMJA 3VGIA 5I8TA 3UKNA 4CP0A 2VTXJ 4AW7A 2VOXA 4QD2A 3VD3A 2WA4A 5IK5A 2PHTA 5C8CA 1R1A3 4XC9A 1V6JA 4FPKA 3CU7A 3I2KA 3DKWA 2DFCA 4M0HA 1GFF2 3ALQA 2WO3A 3MIDA 3P5BA 3W21A 3UETA 4LBQD 4RS5A 3VDCA 1KFXL 1A8DA 2QQMA 1LTEA 4IEVA 4Q5OA 3UKTA 3ZXLA 2ID4A 1JYXA 2JDZA 4HK8A 3B01A 1CR7A 4I02A 5H9SA 4I09A 4TLGA 2GNMA 2AUYA 1RUI2 5CA6A 4YM1A 2BOIA 1QHDA 1KFUL 1RUH1 4QX0A 3IB3A 4YW3A 4Q26A 2WWUA 2CHHA 1CONA 1S0IA 3OUHA 4XDOA 5IATA 4JGYA 2ZGUA 1PK6A 2P5BA 4QX8A 5DZEA 2D93A 2VVFA 2ZTNA 2Q8OA 5FZ8A 5FP9A 5KXCA 1QGLA 4XHBA 3H1WA 1JZ5A 4MADA 3GF6A 4YG6A 3BCWA 4PLOA 5JVVA 3KVBA 1POV1 1Y7BA 5DDJ2 2OKXA 4Q29A 5FFOC 5IK8A 4JTNA 3RG0A 5J1XA 1WCDJ 4I0AA 3FC0A 3KZ4C 1O7FA 3WQBA 5K0UB 4TTGA 4QX1A 3MLLA 3LA2A 3LCPA 2VOTA 2BP6A 2VBBA 3WLUA 4RQPB 3WNNA 4FO9A 1ASJ3 3B02A 4MGTA 2UWCA 4U2AA 2KA3A 2Y26A 4LO8A 4MH0E 4ZONA 3CNAA 3VBSC 2JE7A 1NCRB 2DWRA 4LUKA 1KXGA 1ZBE1 1GOGA 1F35A 4FXKB 1GWKA 1KS4A 3OB8A 3CMGA 1JOPA 1VRH1 3MIBA 3ACHA 5D1IA 2P3JA 1VBE1 4LKFA 1JTZX 4V2WA 2CL2A 3ZPYA 1AR81 1YC61 4LULA 3WP5A 4FPHA 5FZAA 2IUWA 2O14A 3DL3A 4NAOA 5FYTA 3WD5A 2D3SA 2AH2A 1IKQA 4IE4A 4N90A 1ZNPA 1SFYA 1LHUA 3PUHA 2X10A 1V6KA 2WN3A 1UZ0A 2AGSA 4AOCA 3IN9A 2VOKA 2VZRA 4HLTA 3C7EA 4XZPA 4C8DA 3MW2A 4OQ8A 1OH3A 2DFBA 1XE8A 2Q5TA 1CZSA 4GWNA 2QQWA 4URTA 3WDYA 4QXBA 1HXS3 3C7FA 4MVTA 5C6CA 3MUY1 3LEKA 1RHI2 5I0SA 5CYYA 2VCCA 4R9CA 4LHKA 1XNBA 2R043 3SISA 2BWCA 1ND3B 4HSJA 2BNNA 4EN9B 3E1F1 4QQ2A 1QJU1 4XURA 3SEEA 3WDWA 4LLOA 3S57A 5LY2A 1RVF3 3PUIA 5JI9A 4R52A 4GMP0 2DURA 1OSGA 2VUJA 2NPIA 5FY9A 1RJ8A 5DAWA 4BHPA 1NCQB 2GC0A 2PA7A 5ERLA 4ARYA 4NROA 1LU1A 2ZGSA 5T50A 4JGZC 3S5QA 3N7MA 2VO5A 1H8TB 4EV0A 5KXEA 1BLZA 1POQA 3NWKA 4J6GA 4RFRB 1AR61 4LK6A 4FOWA 3NQHA 4JDNA 1QOSA 5A80A 2JIGA 4AR2A 2PMWB 2H0BA 1C3HA 4BLIA 3H42B 1FMD1 1OQ1A 2VW2A 4GH4B 3VBSA 3LFMA 4QB2A 2DCTA 2PELA 3AP4A 5CZKA 3VDDC 4BYYA 1ULCA 1K12A 3GDBA 2OIIA 3RVHA 4XBQA 1WLTA 5FPVA 3LF7A 1RUG2 2DVAA 2WZPP 4YPJA 5FO9B 5K9YA 1W6MB 4PF1A 3ASIA 1YUDA 3J4UH 4CUAA 1V9U3 4L92A 3GCXA 4QHBA 1JOBA 5SV5A 5A7WB 4IEZA 4JC1A 4DZGA 3ZYFA 3I3EA 2E31A 2Q0AA 5G04L 1QQP3 4IERA 1Z0HA 4FAHA 3Q8FA 2HYKA 5H9QA 5A3PA 1CGPA 4B4PA 2A6WA 4NR1A 4C90A 4GJYA 4N43C 2ZHLA 3U07A 1AX1A 4AZZA 2E7QA 5M0TA 1W0PA 2W92A 4QM8A 1HV1A 3UV9A 2LTNA 2BZDA 2HBUA 2WZEA 3HMYA 2A6VA 2R073 4ONUA 2QUOA 4ZU4A 4CU9A 4XW3A 5JXIA 1Q3EA 3N3HA 1C1FA 3E6DA 3OPWA 4IV3B 1YI7A 1XU2A 2RE9A 1NQJA 3MW4A 1SBDA 2Y38A 4MHRA 4QDSA 4Y1YA 1IS6A 1QXPA 2VMDA 3ILFA 3AM2A 4CP2A 2DCJA 1H1IA 1GV9A 3OGJA 3C7OA 4BOWA 2XVKA 5GLUA 3T2OA 4F3JA 5C3PA 5FRAA 1K5JA 1JN2P 1RUH2 1W6PA 2Z4FA 4XUNA 1CZVA 1KITA 4AK3A 4JGZA 1US2A 1EP0A 4XJUA 4QPIB 5AFEA 1HJFA 3TN92 1GU3A 4ZS3A 4KBZA 2H0VA 4LXLA 1PNGA 2EAAA 3HT1A 4AFDA 2VCAA 1NX9A 4XAAA 1CESA 3OEBA 3ZXGA 1FPN2 1VLNA 2WS91 5F1RA 1PGL2 1ULEA 1TEIA 4MGQA 4OMCA 4UF0B 2NLRA 1G9FA 3VDDA 4A3ZA 3N36A 4XF1A 3LZZA 5GZDA 3NNMA 1JZ7A 1VB4A 1W2OA 1XYNA 4FVVA 1QH7A 3ZXKA 1ONAA 4AEDC 3AXEA 3POSA 3H1MA 2BUKA 4HG6B 4QU2A 2W95A 5FK8A 3VBUB 1H9WA 4HMZA 3FLRA 5IVCA 2PHUA 4LR4A 5A6YA 2XBO3 4LBMA 4C0HA 2HJIA 1ZBE2 1QJX1 2QDRA 3K4AA 5EP9A 4HL0A 3AJYA 5IW0A 4AQ6A 2ORXA 4D69A 3NMBA 4XFGA 3A4UA 5FLIA 3FWEA 1E5RA 3KLSA 5DUWA 2WAAA 1NXD1 2X5IA 4N43A 2YROA 1QJEA 2JG9B 5DUVA 1HB2A 3KV4A 2VVDA 2ZS6B 1LOBA 2GC1A 3THDA 1YQ2A 2UURA 2XJTA 3ORJA 1GZWB 2R0HA 3RRDA 3PVBB 4JVAA 5LASA 4I2OA 1TMF1 2YGMA 4OI0A 1H30A 4FOQA 5JOYA 4XIKA 3JBG2 4COZA 1ASJ1 5B2GB 2JXAA 2VZQA 5IFPA 2F4LA 2RMU1 2VMFA 2ET7A 4QHOA 4D94A 5FYBA 3ZXFA 4XVHA 3MV01 5FBZA 3EMRA 3HQXA 1AYN3 4JDMA 4Q1PA 2D5HA 4Z92B 3MYXA 1ZX5A 2DVFA 1PO13 3K3OA 5KHHA 4E2SA 2R062 3B5LB 5A7NA 2K46A 5C3RA 4RYDA 1WUVA 3VD5A 1QWRA 1QJU2 3IDCB 5L73A 5T55A 2VR4A 1K5MC 1C5IA 1JW6A 1A3KA 1XRUA 4PCRA 4Q0SA 2RDSA 2XB6C 4PIXA 5BNOB 5FZ7A 1ST8A 2DBIA 5FQ0A 3K3NA 5F8PA 1POV0 2Y0OA 2RVAA 2J22A 3VBFC 3V0BB 4AEDA 1A78A 4L9BA 1RC6A 1ZM1A 1SBFA 1RUJ2 1IS3A 2X09A 4OFGA 1WMXA 3OOXA 5A3MA 2CDOA 2GN3A 1IHMA 4DB5A 5CFCB 2JX9A 5KWRA 2FDIA 1LULA 1OMIA 4M0NA 1S2EA 4K7JA 4FFGA 1CX4A 4IL7A 1F4HA 3R4SA 3UNPA 3E6CC 2YU1A 2JG8C 2NZ9A 2LS6A 5L9RA 1UY3A 1K3IA 1FI2A 3WNPA 1PX4A 4NMIA 1ULGA 3ZMOA 2E9QA 4YW4A 4BWOA 2XHKA 1I9RA 2OUHA 4EN7B 1CJPA 1W8UA 4HSLA 4URAA 5CFDC 2VQUA 5JXGA 2GNTA 1NXMA 1XBFA 2SLIA 3D6EA 2BVVA 4C0BA 2OXBA 2A70A 2XL9A 4JTOA 4JKMA 4Q2FA 4BQ1A 2Q1ZB 1OLRA 1UYPA 2ZZQA 4YRDA 3BIEA 3GNEA 5LEKA 1SPPB 2BJSA 2EALA 2FDKA 4Q8KA 2C4XA 1U0AA 1RMU1 3AJZA 3BODA 1LKNA 3CJIC 2A5ZA 3AB0A 3DXTA 4DXRA 5F37A 1RUOA 4BZ4A 4ISRA 5HI0A 2CY6A 1WD3A 4BPZA 5LY1A 4G9SB 4KH9A 4Y22A 1A34A 1J59A 5FIXA 1REEA 3FUOA 5DDJ3 1O3QA 3IDBB 3AKPA 1FOD1 1FT9A 3P6BA 4CUGA 3VBHB 3PJYA 4AG4A 4QX5A 3CKHA 2C1FA 1W6NB 1AXKA 2RS52 2VZTA 1BK0A 1K5MA 2WL1A 4RHV1 4FSJA 4DRVA 3CQOA 3PDQA 1H0BA 4AEJA 2QDNA 4M4PA 3W59A 3WNMA 4BQ5A 2Q8EA 2OX0A 4IE6A 4COWA 1LB2A 2D97A 2IXKA 4MXWB 4DXZA 3C7HA 3CZJA 1I1EA 2AENA 3VBFA 4AVBA 4CZSA 2WYFA 2VC9A 3D4KA 1W6OB 3UGFA 2HBTA 2WSVA 4Y26A 4NHKA 5F5IA 1EAH1 1JS9A 2D6OX 5FPLA 3A21A 3G6JB 3POGA 2N7GA 2IXLA 2WZR3 3ON7A 4DINB 5F6LB 3UGGA 3E97A 1Q5OA 3TWIA 2JB8A 2HWD3 3B93A 5HCFA 4BH9A 4AI1A 5LCWL 4Q4W3 1I6XA 3SNMA 3N7JA 3C7GA 3MW3A 4COUA 3CJXA 2AEYA 1VBA1 5JPMB 4LIVA 4KL1A 2JG8A 2OS2A 2Y6LA 3DUIA 2OQ7A 4PQQA 1ULDA 4BMBA 2CWSA 3N4MA 3M3OA 4AVVA 4CDUC 3A0NA 1XE0A 1QJX2 3ATGA 5FZLA 1FV2A 5CFDA 1NT0A 1RUC3 1OQEA 1WCSA 3N35A 2ZHKA 4O7XA 3TNQA 1N3OA 5FZOB 3TB0A 2EIDA 3USUB 3ZYGA 4HKLA 1REDA 3HQUA 2LW8A 2VZSA 5E8AA 5L36A 2ZEZA 1LOFC 3RI9A 3ZKYA 3ZYPA 2HKXA 3ZM8A 4GWMA 3WUCA 3M3QA 4CCEA 2HWE3 2QNKA 3CJIA 4LK7A 1PMHX 1U12A 5IWFA 5A32B 3HOBA 3T1LA 2ZOEB 5JDBA 2QCSB 1ZZ7A 2YHJA 5FMOL 1JU4A 2JE9A 1ASJ2 1H1MA 4Z82A 2XBO1 1Z7S1 4CCLA 1MZFA 4H2AA 2YMZA 4DMIA 2C5DA 1X8EA 2IVJA 4CP9B 3SH5A 3KVAA 3N7KA 4BQYA 2FQPA 2OPWA 2B42B 1DGLA 1D2QA 1OBNA 4LBQB 1OF4A 2GAUA 4LO5B 4ITCA 4WVMA 4XQWA 1BXHA 4ZHNA 3THCA 4XPVA 5T5JA 3I7DA 4B7KA 1UX6A 1ZBA3 2P1BA 3AFGA 4LORA 5EJ1B 2DF7A 2VXJA 5EXOA 2ZA9A 2WO7A 1RUG3 1GOFA 3H7JA 3KF5A 3LIGA 3PNAA 3OUJA 4Q27A 4RGAA 5EFUA 2NQYA 4CDXB 5FXXA 3VD4A 2I45A 3MFAA 3MICA 3T08A 3HN1A 1N1VA 2QTWB 2B4KA 3KCXA 1F5FA 1N1TA 1SQ4A 2RM21 2XJUA 3DV8A 4XDPA 4BM8A 1HXS2 4EZHA 2TNFA 2K0GA 1BHGA 1AYN1 3K2OA 4IW3A 1W28A 2TUNA 3ZFEB 2R042 3POJA 1LOEA 1L7QA 3VZMA 3BPSA 2WLQA 4CDUA 1H6XA 2GH2A 1HLCA 1QIQA 2RS11 3KSCA 3WXPA 4E4DX 1AXYA 3O0VA 5GM0A 5D8AB 1H4HA 1W8FA 2NN8A 1ULOA 2EF6A 2YG0A 3R05A 1UN1A 2WNEA 4CYDA 1LOFA 4CDWC 4Y3OA 2C6SA 5FY4A 3HEIA 1F31A 3NV1A 3FHAA 4WV8A 4TXWA 2QQJA 3ZYIB 1SLTA 3PU3A 2K2SA 3RWKX 5ABJC 2R49A 5FYIA 1H4GA 1V6LA 2WQ8A 4P9GA 1JUHA 1RUH3 4UW5A 4W4ZA 4YVSB 5B4XA 3T4VA 4D0QA 3O1OA 3S7IA 2ARXA 1MZ5A 4AAPA 4NRPA 4B4RA 3AYEA 5AVPA 1X50A 4I3GA 1PM4A 5GLTA 4YVWC 2FD8A 4ZS2A 1RUD1 2ZGMA 2W1UA 1EY2A 2WINB 3AL6A 3LFIA 1Y9QA 5DZGA 4I0WB 3WP3A 1V9U2 1U5YA 1FOD2 2XG3A 3AYDA 4META 2DCKA 1V6NA 4N7IA 5A33A 2VECA 3O1MA 4HN1A 3ELNA 4XYXA 2QQNA 1MS3A 4GJZA 1MPXA 3GZTB 4QM9A 1W9TA 5A7QA 4HKWA 1QQP2 3IMMA 5C8CB 2WQZC 4P9LA 5A7PA 4F8AA 1WW5A 5JSRA 5FK7A 1IQDC 4YG3A 4BK4A 4O9EA 4XXPA 4RS5B 4XCAA 2GSYA 5DG1A 5LB6A 4IEPA 4SLIA 3D3AA 1ZBE3 3IPVA 4L97A 3GZEA 3LSDA 2R072 2CU5A 4FPOB 5DG2A 3RJRA 1HJGA 4C91A 2W94A 1VRH3 4FQ4A 4CXWA 1GNYA 2JDPA 4LBJA 5HV4A 3KHBA 1J83A 1VBE3 3WT3A 4PQ9A 1AR83 1ZZ8A 4QDRA 3H8OA 2DUPA 1HB3A 1VALA 5LWBA 3A7QA 5HV0A 3KQ4B 4LEJA 2GC2A 2JENA 5EYYA 1C57A 1HDKA 4GD4A 1VBA2 4H14A 4DPNA 4JZRA 4JGYB 3WOGA 1EPWA 1ND2B 1PK6B 2WC2A 4WM7C 1US3A 1XE7A 2CSGA 2VUDA 2W52A 3A22A 3FUQA 4A42A 3U4XA 2JKBA 4LNVA 2EXHA 3CZUA 1LHNA 3E5QA 2ADDA 2J42A 4NO4A 3AKSA 2HEWF 3EYPA 5FLJA 4B7EA 4HT1T 4BU2A 3ZXAC 2C24A 2CAVA 5FZHA 5ABJA 4MSVA 3O0XA 2AEZA 5ANQA 3GALA 3USSA 3BUCA 2E63A 2O8OA 5IK7A 4CP1A 5FZDA 4BXFA 3O1SA 2XUMA 4S2DA 2B46X 1MZEA 4XJWA 2VZPA 2C0ZA 4YVWA 5F3IA 3M3EA 1JMUB 5LRRA 3WCRA 1DGWA 1FATA 4NHLA 2PN5A 2YYOA 3AYAA 4CUCA 1ZRFA 4AVTA 1ODMA 1TNFA 4D7TA 2WT0A 3PVEA 1CX1A 3AZWA 1EV11 5L7OC 3IWZA 2QQUA 1Z7S2 1HN1A 2XBO2 1D2SA 1F9KA 4ARXA 4EN6B 1W90A 1O4TA 2WNVC 1AR63 4UT5A 2OYZA 4IGQA 1W2UA 4XJAA 3RGBA 4CA9A 4RGKA 5EHDA 4JQTA 1Q8SA 2GALA 1GKBA 2K9ZA 1FMD3 2VTXA 5T54A 1J3QA 2Y60A 5EYXA 1V0AA 2E6VA 2QE3A 1BJQA 4PHZA 4XF3A 1IGOA 3JD71 1UMZA 1VAMA 2YFZA 3AVSA 3ZN6A 3HWJA 4NIHA 5EIYB 3RZMA 3OCPA 5AFBA 2D7FA 4CXXA 1BMV1 1CIYA 3B00A 4B1MA 5GLZA 4AI2A 4QMAA 1D7PM 2WNUC 4WVVA 5LBBA 3WNKA 2FMYA 5FZFA 2I74A 4K1YA 3NKGA 4A41A 1T6GC 2UWAA 5A3WA 1XJAA 4U36A 4J1WA 1O4ZA 3KMHA 3VBOC 1OOPC 3FHIB 1GNZA 4Q4Y3 4WM7A 1HRV3 1AYN2 3SXWA 3ILNA 5I0TA 4YZ5A 1NY71 2BFUS 1PO12 4KWKA 1QNWA 1X82A 2VOWA 1APNA 3OD0A 4FOYA 3WQ0A 3FN9A 4NAMA 1V6IA 4L2NA 2WFF1 4MHUA 1NA1B 2RJ2A 4FFIA 4OHWA 1CD3G 1X33A 2J7MA 2JECA 3T3YA 1AX0A 3MIEA 4K8FA 1UMHA 4XJZA 5K7PA 4IGPA 4WZCA 3WDUA 3RS6A 5C7GA 1YYNA 5IAVA 3POFA 3HJRA 1YWKA 3K4ZA 4M3CE 4UFJA 4AHXA 2RDNA 2EIEA 3WG2A 4NIDA 5LA0A 2Z5WA 4MGZE 3VBSB 3LB9A 2BGCA 3ST7A 2VUCA 3OGRA 2WABA 2GU9A 2G1MA 4HONA 4P9WA 4HK9A 3NAPC 1DLCA 4G3YC 3NJZA 5CIRA 5CISA 2Q1MA 4QPYA 5L7OA 1K42A 3AMQA 2CDPA 3IM0A 1DG6A 1GP6A 1W9FA 4B8EA 2JICA 4E4ZA 5FDBA 1MR5A 1W9YA 2WNVA 2XL7A 2A3XA 1YQ5A 5F7UA 2WS93 2KM2A 5F3GA 1IS5A 3CL1A 4Z07A 4KI5M 4BDVB 2VG9A 5KC5A 4IDZA 4XBLA 3WQ1A 3PLQA 3LEIA 3OTFA 5BUVA 5JLVA 4KNCA 4OHYA 1LENA 1RUE1 4QDQA 1WBFA 5FR3A 2B8MA 4XABA 4YM3A 2ZACA 1Q8PA 3AFKA 3ZSKA 1N1YA 2HLEA 2Y6HA 4RL7A 3MIHA 1JH5A 2WNUA 1IZ3A 2HWF3 4DIQA 4ZPIA 3AC0A 1G9AA 4A7YA 2GH8A 1CJDA 1UZVA 4MXVA 5F6KA 4DUWA 1QJX3 1GANA 3JUUA 1HX6A 1OOPA 2WIIB 4HXCA 4JCKA 3VBOA 2JWPA 1XNAA 5FYZA 1NUKA 4DY3A 1IG0A 1DQ4A 5DAXA 5JMCA 5BNQA 3AVRA 1UZYA 1WW4A 2CNAA 3O1RA 2ZHMA 3MUZ1 3WUDA 1W6PB 2FDHA 2Z42A 1GOHA 2PTMA 4JGZB 1TMF3 4CDQC 2EIGA 3ABZA 2J1UA 4AGVA 4CEWC 2P6CA 2Y6FA 5FZ1A 1ZZ6A 2YXSA 1G8WA 4FPYA 4MG2A 4W6WA 1GBGA 2RMU3 3VZOA 1UAIA 1R64A 4QXHA 4AFAA 4IEUA 3AP9A 3RYKA 1YIPA 3VDDB 1UNBA 5K4LA 3RPQA 3O1PA 2YGLA 1RYYA 3MV11 4Y5Z0 1OA3A 1CAWA 5A7OA 5E89A 3VKNA 3NAPA 2VZOA 3UK9A 4DS0A 2WZR2 2EXJA 4YZ4A 2BYVE 2B9VA 2G9GA 1HRI1 4TZDA 5KBFA 2HWD2 2W1WA 2C26A 4INDA 1DGRA 3DYOA 4Q4W2 4LPLA 1FXZA 4CE8A 3VBRC 3KGZA 1DYOA 3LKJA 4I0BA 1KQRA 4MYEA 4XF9A 4Q0UA 1HQNA 2VMHA 3B3QE 2ZAAA 3OGSA 1OKOA 1JHJA 1XNCA 4GQ7A 5C9AC 2DU1A 2Z2SB 4BIFA 5JXJA 2VAUA 5K8SA 3FBYA 3V0AB 1FAYA 2X5IB 4N43B 4YGBA 2ZEXA 2DVDA 1XYPA 2B7YA 4K21A 2ZJCA 1RUC2 4BA6A 5CKNA 3QBQA 2ZPXA 4UFLA 2EA7A 4G4FA 4FPCA 4IE7A 4V2VA 4OHXA 3VKLA 4UWDA 3AMHA 1NLQA 1VE0A 4CU6A 2HWE2 1JHNA 1WW6A 3ILRA 4LHSA 5ACA1 1J3PA 1BMV2 4NIAA 3UL2A 4IUGA 4B29A 1NE4A 5LA1A 3QOPA 4I01A 5E16A 3CDZB 2WQ4A 2VZ3A 1DU3D 2ET1A 3ES1A 1OKQA 3N9QA 3O12A 1TG7A 4UOJA 4CDQA 3WG4A 3U75A 4CEWA 2PHLA 3IZOA 3KT7A 5C4WC 3QD6A 4B4QA 4FPLA 4LA3A 5T5LA 2DBNA 2O0OA 1GQGA 4KG8A 2AREA 4FTSA 1RMU3 5FQ0B 3VKFC 2YZ4A 5C5UA 2WFF2 3BGAA 2P6HA 1ZBA2 4RA0A 3ZDSA 3ZXEA 1AHSA 2RR11 4OUEA 4AEDB 2PHRA 2IZWA 1QJY1 2IXJA 1CAUB 3I59A 2E7TA 4K20A 4QXKA 5L19A 3H0OA 1FOD3 3K46A 1RUNA 4OZOA 4ISQA 1CZTA 3H8UA 4RHV3 1D4M1 2R6QA 3VBRA 4PBPA 1W8ZA 5A1LA 1PVC1 2QQPA 1V6MA 4YW1A 3ACGA 4MGYE 4N9HA 1SLCA 4Q4Y1 1F5JA 1HRV1 5FO7B 1COV1 3WP6A 1W2AX 5GKAC 5FXWA 5EJZB 4CTEA 5C9AA 4FCAA 4UXAA 4NHYA 2YDEA 3GBWA 5LEJA 5LW9A 2XXZA 1WLCA 2OZ6A 5FZ3A 1W8WA 2CGOA 1J3RA 1OVSA 5CEHA 1EAH3 3VKMA 3M7AA 2TEPA 3FMGA 5KXBA 2MEV1 2WJSA 3ZMNA 2D6MA 4AEMA 5IK4A 2TBVA 2XQRA 5BNPB 1OLQA 4MV2A 5ANNA 5FYHA 1RUE2 4LBKA 2VQTA 4HETA 1VBA3 3QACA 1IKPA 2J1AA 3KGLA 4MUVA 4FQZA 5A6QA 1J1TA 3WW1A 2R30A 3WNLA 4BISA 3FX3A 5F2WA 1QJFA 1OH4A 2XUEA 4H7LA 4Y22B 3KCCA 1C4RA 4OVEA 1ZA7A 4NWWA 3AKQA 5FP4A 3WSOA 2ATFA 1PGW1 1ND3C 1JU3A 3M3CA 4JAAA 5C4WA 2YPDA 5DQ0A 2BU9A 3T1MA 1K5MB 1RUF3 3TAYA 5EZWA 2WUHA 1TZOA 1UY4A 1QDCA 3LA3A 4MZUA 2DCYA 2ORZA 5FZ6A 2PHXA 4OCTA 2DYCA 3A23A 4XMAA 2W87A 3VBFB 3LIHA 4NJ4A 1AL21 1L7RA 4GXLA 5FBJA 1AUYA 2JDAA 3ZFFB 4V1PA 2EVXA 1C5HA 4M3CF 2AR6A 2HWF1 1X8MA 3NJVA 1AYM1 2XH6A 4FI9A 4GIQA 1Z7S3 2D6LX 2JDMA 2R1BA 3AP7A 3OEAA 4K9SA 4YFWA 1DQ6A 5FOJB 2XR4A 1WD4A 4GH4C 1DYKA 3EJKA 3S5AA 1VBC1 1VRH2 3H1YA 1YO8A 2ZXQA 1VBE2 4ASMB 1HB1A 1AR82 5AC91 1D4VB 4IE0A 4NRMA 1HRI2 2JG8B 2VM9A 4CU7A 1UU6A 3I2DA 1AR71 3DGTA 4DXSA 1VMFA 1VBD1 1OF3A 3EHKA 4E8DA 4M00A 2WT2A 4HKOA 5CADA 4LJHA 5CFDB 1UOFA 1OLMA 1WKYA 4Z8BA 1DDLA 3DYMA 1GUIA 1WA6X 2OVUA 1EYBA 2D5FA 4AVSA 3RZLA 2RM23 4QGLA 1O59A 5FMCA 1VBB1 3ZKUA 2VCMA 5C71A 3RYRA 2X8KA 3LGRA 3E5UA 2AZ5A 1DQ5A 3CJIB 2ZGLA 2FMDA 4E2QA 1SLAA 4K3UA 4PDWC 1C28A 4GALA 2OPKA 3GGLA 4UW3A 4EROA 3RZKA 1V6OA 5FXVA 5C8WA 2RS13 3D5OA 3CIHA 2A71A 2VNGA 4P08A 1ND3A 2VJXA 2XWBB 5FY1A 4BLJA 1BK1A 3CF6E 5CVRA 5D2AA 1PIV1 3I3MA 4CCNA 4IESA 5GLVA 2BW8A 2UYAA 3J7LA 1T6BX 1S0FA 3PUAA 2B9UA 4KQ7A 2ZBJA 3M4FA 3I3QA 3VHOA 4UYBA 3ZR6A 3RJ2X 3I49A 3M8LA 2I2SA 4WVMB 1SACA 2W1SA 1AR62 1ENRA 1R081 2YC2A 3PJQA 3I2OA 5FYSA 3JXSA 1LNSA 1WLWA 3WX5A 1FMD2 4WM8B 3W58A 2LM3A 2A6ZA 1DZRA 4BQ3A 4O61A 1W8OA 2DUQA 2VQAA 4BIOA 2GMEA 1RUD3 4GH4A 4CPBA 4QX7A 4XJ9A 1CVNA 1UX7A 2WWJA 1KDKA 1RJ7A 2W91A 3AP6A 1FYUA 3SCFA 3PMSA 3BI3A 2YUEA 3KWVA 3H3ZA 1DGWX 2V4VA 4YW6A 4LQRA 1UZZA 1MQTB 1CQ9A 1ZYBA 1UZWA 4CDUB 2MHFA 3R6SA 1LHWA 2VW1A 1OHFA 1Y9GA 4P9YA 4Q4Y2 1HRV2 3BTAA 1LU2A 3PU8A 1H2KA 3ETPA 3I54A 3IBMA 1E5IA 3WF2A 1NQDA 2XJVA 1XNDA 2F4PA 4LA2A 1JZ4A 4FAGA 1Q8OA 2ILMA 2P37A 5FZ9A 1R091 1O5LA 2ARCA 2Q30A 5BPXA 4YZ2A 4IQPA 5FWJA 3GYDA 4CCJA 2GNDA 4QT6A 5FZIA 5SV8A 1QU0A 4XMIA 4PDWA 1L7LA 3BYWA 4Q4X3 4AAXA 2A7AA 2D6KA 2ZKNA 3HAGA 4OI1A 3OJBA 1OUXA 1GR3A 1Q8VA 1OI6A 3GJAA 3IT8A 3OYWA 4YG0A 5DABA 3OBZA 1AZDA 2GDFA 3MHZA 1CN1A 2JDYA 4XE9A 4Q0PA 3J7NA 1OFNA 4HANA 1Q43A 5IHRA 3B94A 4FTEA 1W6QB 1ZREA 3A0KA 4KWLA 4UFKA 4AI8A 5A33B 3GCWA 4UFIA 2WS92 4FXGB 1DBNA 1MZ6A 5E88A 3AXDA 5C5TA 2MNGA 1OA2A 4EWDA 1XNKA 4N8MA 4XFCA 2PLV1 3WQ7A 3ZSLA 5BNOC 3WEZA 3GZUC 2NM1A 3TYJA 4JKLA 2JD9A 3W20A 4XF0A 4LHLA 5BV6A 4HBNA 4E9KA 4XUPA 4M3CA 3S7EA 1SFNA 3RWNA 2HWF2 2HEYF 1EV13 5FJKA 3OBRA 2YBKA 3WW4A 4EWEA 2A6XA 2Y6GA 2AACA 4FT8A 1JYVA 2KXLA 4DXTA 5I91A 2GMMA 1URXA 2ZX4A 3ZLIA 2DVBA 4XUOA 5FP3A 3J8F1 1JOJA 1VIWB 4P9XA 1AJOA 1TME1 4X6RB 3HBZA 4D7SA 4Y4YA 3KV5A 4CPBD 2VGDA 3FE5A 5KHGA 1GZCA 1JUIA 5I0RA 3AKRA 2R7EB 1WCQA 2HYXA 2RJKA 1RUF1 3HD8B 3I8TA 2W3JA 1QF3A 2BERA 3JD73 3AZYA 2YU2A 2HWB1 3OBTA 3LPGA 1TMF2 2JKXA 4OYUA 4PIZA 3V64A 2GMPA 4FBFA 4FFHA 4UFHA 1GZWA 2VULA 3OD4A 4YWAA 4QPGC 3SHRA 5ABJB 2VQ0A 4RGGA 2RMU2 1KDMA 1DZQA 3CLPA 1B35B 4EZ4A 1F2NA 2VVEA 4P14A 5B4NA 1MVQA 4YVWB 2DV9A 4Y1ZA 4NIIA 2Q8CA 3N9NA 1HKDA 3Q9OA 1HV0A 2NMNA 1A8MA 1W3VA 2XJSA 2YC4A 3BPZA 4LO4B 4Y4RA 4K1ZA 1M06G 3F95A 1LEMA 3H8XA 2WFF3 4IV1C 1BYHA 1OD5A 2XJRA 5DAPA 5GALA 4ATFA 4BQWA 3NV4A 3ZIXA 2JB4A 3DECA 3HNMA 3I97A 3MIGA 3ROUA 1ZRDA 3LDRA 2VZ1A 3BVCA 3R4UA 1B09A 4Y5SA 5BNOA 4YM2A 3V56A 1YQ8A 2ZX2A 2JIJA 4P00B 1KJRA 5EWSA 1G86A 3PHMA 3J7HA 2XGXA 3ZYBA 1S0CA 1AR93 3O5SA 5JMOA 1F15A 4Q4V1 2QZ3A 2FBEA 4QPWA 4XFFA 1W04A 3TOJA 4CCMA 4CCCA 5JOZA 1T2XA 3MZHA 1O3RA 2QQIA 2QQLA 4LBOA 4GB31 4BK5A 4R9DA 1XXNA 3MO4A 2V72A 3KCYA 5C3SA 1YJLA 3NV2A 4LBLA 4LE4A 1GLHA 3U0ZA 4ATEA 4C1XA 4S2HA 3RMXA 4P5HA 3HVDA 1MACA 4WM7B 2LUWA 1IPKA 4R4ZA 1RUE3 4SBVA 1BBT1 3MEPA 1S0DA 3HT2A 1ZVFA 4MGSA 3RYPA 3LEGA 1BEV1 4JKKA 4FP3A 1UU4A 3ENRA 1CAXA 2BVBA 2YB7A 2ERFA 2CAUA 1LOGA 1NZIA 1VPHA 1U5IA 2EAKA 1UOJA 2MPFA 2VPVA 3HQRA 4L11A 4QPGA 3VLBB 2WSUA 3OGGA 2BFUL 4FPEA 3T2QA 4Z2WA 1YI9A 2V09A 1RMU2 4A4AA 1DFQA 2VTFA 1SCRA 3DPRC 3GM8A 4Z1VA 2Y6JA 4XFAA 4NPLA 4E4HA 1C8M1 2EIBA 1QXJA 2WDBA 2YFUA 1DCSA 4M4RA 4X8NA 1OLME 3VDAA 3KF3A 2XHNA 4NRQA 5I8YA 2VW0A 4IV1A 5JIUA 2PXJA 4RHV2 2ZGKA 5L7OB 3OUIA 3IIIA 2WNVB 5JR2A 5I0DA 1IPJA 5JZGC 3BB6A 4IEWA 2AC1A 3KQRA 1QOOA 5AVAA 4D3WA 3Q8CA 3IIAA 4NWVA 5J48A 4DRRA 1SMVA 3APBA 3TEWA 3O1VA 1W9WA 3PTRB 4H7MA 3MFCA 4MXWA 5DUUA 3X29B 3LQCA 3RQ0A 5IVEA 5FP8A 3RFRA 1ENXA 1PHMA 1EAH2 2UU8A 5JOWA 3AL5A 1JYNA 2WBKA 3OSDA 1HRI3 3ZDVA 2A1XA 1UU5A 2YY1A 3LPFA 4Q4X1 2O8QA 4FPFA 4EQVA 5DMYA 1JYWA 3N9OA 2PHFA 5ISLA 2P3KA 2W68A 4QX2A 3T0DA 4GWJA 1RUI1 1S0BA 2CTVA 4FPJA 4H3WA 4R8HA 5A6ZA 3VBOB 3URFA 1OOPB 2QQOA 3QH7A 5IVYA 4CDWA 4RR3C 1XQNA 1AL0G 1S1AA 3WZ1A 2D98A 4XFIA 5E6HA 4GMP1 4AFMA 5BXXA 3O1TA 1O3TA 1O91A 4LHNA 3GZAA 2CYFA 2W9XA 4L0PA 1QXRA 1MS9A 1VP6A 2E7AA 5FXZA 2QKDA 4GA9A 3AX4A 2WR9A 4LMFA 4XBNA 5H9RA 3AZVA 1RUF2 3USUA 1IOAA 4AVCA 3NO8A 3FBMA 1KEXA 1S4CA 1UCXA 5FUNA 1UY1A 1X9PA 2D6PA 2QZ2A 5GZGA 3WCSA 1NKGA 1SLIA 2ZEYA 3DPRA 4E27A 5ACA3 4CU8A 3ZO0B 2E33A 1XYOA 1YRZA 4HN0A 1W05A 1UO9A 4RN5A 5FY5A 3T0BA 3JB8A 4QWNA 1DQ1A 3PL0A 2XJPA 1WA4A 1UXXX 1CAWB 2Q1FA 4PLNA 2ZGOA 4Y1VA 4AI3A 2B5HA 3NAPB 3T0AA 3P1IA 2R0FA 1ALYA 4ORFA 2YBSA 5A3OA 5IVFA 4GZ9A 2W46A 1JZ6A 2H6BA 1W0OA 1CAVA 2ZGTA 1PM7A 3M70A 5I93A 1OVPA 4LO7A 3LOBA 4DO0A 1DIWA 4D7YA 3B9CA 4CCKA 5JZGA 2X29A 4DUXA 2GP5A 4CRQA 4K40A 3NNGA 1W06A 4AXOA 2RR13 4XDQA 3QH6A 2E32A 1SCSA 1RL3A 4E2GA 1QJY3 1BVVA 2YV8A 2SBAA 4Q0QA 3KT4A 5HCHA 3H9AA 5C8CC 5A7SA 2BOJA 3I2FA 3J9SA 4RFT0 1H2MA 1OPMA 1D4M3 2RM22 2ARAA 2Y34A 4IE5A 5J98B 5J36A 1RHI1 1PVC3 1CPNA 1HW5A 1OPOA 5C70A 4O65A 4Q4V2 1COV3 5A3LA 4OMDA 2FZ1A 2QFEA 4RR3A 1OXCA 1UY0A 2VD7A 4GB32 3BIWE 3W5MA 1HB4A 2FDJA 3IAPA 3OY8A 3VZNA 2BQPA 5FWEA 1SZBA 2ZAHA 5T5OA 2BV4A 3UYJA 2RS12 5IFTA 3BOWA 4D6SA 3O1UA 1N47A 4S2GA 4AI0A 4CDQB 2MEV3 3JQXA 4X6QB 4CEYC 4LKDA 3EXUA 3BALA 4CEWB 2X53S 3NNJA 2BBVA 1ND2C 4RD7A 3NV3A 1MEC1 4YGEA 1NG0A 2PAKA 2DU0A 2ETEA 3I2HA 4S2FA 4YW7A 4PI2A 1BEV2 4CCOA 4N7UA 4QGMA 4ASKA 1AR91 2JDUA 2JDHA 3E5XA 1DHKB 1VMHA 3JCIA 2FCTA 3LAGA 1GNHA 3FFQA 1KJLA 3WR0A 3PUSA 2IFRA 4H55A 1RTVA 3I59B 4TYSA 5GZEA 4YGCA 3UGHA 2XLFA 2B39A 3RMYA 5IUQA 1AXZA 1UW8A 2BTVC 3P3PA 1RUD2 4KBBA 5DAQA 4B1LA 3IKWA 4YW5A 1FNZA 2ZX0A 5FTTC 3FZ3A 1C8M2 2ES3A 3U14A 1LHOA 2ZABA 4NIGA 4LO6B 1ZZBA 4DFSA 3FLTA 5J3UA 1H2LA 1MS0A 4KMQA 1SEFA 4AQSA 3WVJA 1UL9A 4UW6A 5C9AB 3OGVA 2VCBA 3O0WA 1AL23 4OZXA 4XILA 3ZVXA 2VE1A 3AMNA 5FP7A 3SKJE 3U4SA 1PVXA 1AYM3 2H6CA 1YNAA 1SDDB 4B3NA 1REFA 2BGOA 2PFWA 4QGNA 2ZMLA 3RSJA 4N53C 5HXVA 5BY5A 3IDAA 5E1RA 5LRSA 4XFBA 5DPNA 3QLQA 1OA4A 2VMEA 3MIFA 1QMJA 1VBC3 1UKRA 4L99A 2W39A 1MS4A 4W50A 2E51A 4X8PA 3W9AA 4EWAA 4NPRA 2XQXA 4I30A 3VZKA 3WNXA 4CSWA 3LOIA 5AC93 1SLLA 2A6YA 1S55A 5GZCA 5FZEA 1AR73 5FYVA 1QKQA 3K77A 4Q4X2 2VUAA 1A6CA 2HEVF 4OLLA 4KWUA 1VBD3 2QQVA 5DZFA 1GWLA 3WDTA 4BXSV 1AF9A 3WG1A 3Q8BA 1BVP1 1UYXA 1VB2A 1C8NA 2L9LA 5FZGA 5EPAA 3WNOA 4OI2A 4P5YA 4HPKA 4CEYA 4YFZA 3ZFGC 1ND2A 1NYWA 5C4WB 4A44A 3TN91 3LSEA 1VBB3 2WWSA 1GYKA 1VJ2A 4C1WA 1RXGA 1XNTA 4WVZA 3RZJA 3T2PA 5HBAA 1E5HA 5JWPA 1FPN1 1PGL1 2CGNA 2GN7A 4A45A 1E5SA 1ZRRA 5FZBA 1NA1C 2LROA 3O7OA 3PIJA 3B69A 4OHZA 1HQWA 3POBA 4XFHA 2IC1A 5KR7A 3ETQA 1LGBA 5KC6A 5DUXA 5FPAA 5FCCA 3ZIWA 3WF3A 2OW4A 2PYTA 1PIV3 1W8TA 1WMEA 5FY8A 4AGRA 5DXDA 2WYSA 2BGPA 1EV12 5IJRA 5F5QA 3PVOA 3AZZA 2XDVA 4PI0A 2CGPA 2VZVA 1PNFA 5FZ0A 4TLFA 1R083 3WHUA 2NMOA 3HN3A 4HVRA 1BKZA 2WKKA 1G9DA 4BJ0A 2NYYA 2ZGNA 5FJHA 1PZ9A 1LGNA 4Y5TA 4OHVA 1XU1A 4LTAA 3DYPA 1YQ6A 2XPJA 4CCDA 2XOMA 4N53A 5FO8B 2VBPA 3JD72 1SHWB 1PO23 1GICA 2O1QA 3JZVA 3N9PA 4HFSA 3MBWA 2JD4A 4Y20A 5GJ6A 4XUTA 3JBG1 3NNFA 3SCHA 4A3XA 3WF4A 1RIRA 2JE8A 3OPZA 3POWA 2OT7A 2D40A 3ECQA 3GJBA 4QQHA 3WDVA 2XVLA 1DYPA 1EUTA 3PVNA 1J84A 3RDIA 3NNLA 1Y3TA 2LRPA 5L9VA 1JZ3A 2P3IA 4ZU7A 2BEOA 2XKPA 2BBAA 3EBRA 2RV9A 5FKBA 4BB3A 5T3NA 5BNNA 3E6BA 1NY72 2R061 4W65A 4LUMA 2HWC3 4F7ZA 1OUSA 3VKOA 3ZFGA 2KR2A 3I2IA 3I4IA 1R093 4PJYA 1TNRA 2Y6KA 3C3VA 1IPSA 2G4IA 3LA7A 4NUBA 4PLMA 1NAEA 2BWAA 1RINA 1UF2C 3TEZA 1PMIA 1NA1A 1W0NA 5K0UC 1FNYA 3CO2A 3VV1A 3SEPA 3ZN5A 1O3SA 1I3HA 3THTA 1MEC2 4YZ3A 4RQPC 3U37A 5A1FA 1CIWA 1OQDA 3SITA 5GLWA 3J7MA 4COVA 2A73B 3S0MA 1QEXA 3ACIA 3WP4A 1RUJ1 1AR92 2D6NA 1NCRC 3TNPB 1S0GA 4OUMA 3ZXDA 4UBHA 4UI9L 3PMEA 1LRHA 2VXRA 1U5ZA 3H50A 3WINE 4MX3A 4GWIA 4AQTA 2PHWA 1D0HA 5F32A 1QH6A 1WLDA 2BNMA 5LZ6A 1RGSA 3MLJA 2KD7A 2GP3A 2PLV3 3KS7A 2VY0A 4D6QA 4ES9A 2XJQA 4JV4A 3EO6A 3N7LA 4BE3A 5FOBB 2V5YA 2PQSA 3OG2A 2RJLA 3ZYJB 3WHTA 3MF6A 2X5IC 1ZRCA 3H3LA 1GP5A 2W5FA 2WT1A 1G7YA 4IETA 4W8JA 4YARA 5A3NA 4R9AA 4J1XA 2P34A 2XMLA 4PDWB 2R16A 3J8F3 1JI6A 3M2MA 3ZPOA 1TME3 4AL9A 1QDOA 1UQXA 5DN2A 2VMIA 4AFBA 4UAPA 2ZHNA 2X05A 4QB6A 3KHCA 1UIJA 1W9SA 2VU9A 3OYWB 4UFMA 2E26A 5F39A 4TWTA 4DUVA 4AHWA 5T52A 1BQPA 3DCQA 5EQUA 4BCUA 2HWB3 1NCQC 2RS51 3R4DB 4QB1A 3HNYM 5G05L 2RG4A 2RS33 1H8TC 4XUQA 5K0UA 1UOGA 4CUBA 2VNVA 4ZXEA 3HPNA 4XEZA 4LIUA 1R1A1 1S2BA 2BPA2 1MS8A 4RQPA 4EYUA 1VR3A 4XAEA 3FL7A 1O8SA 4MGKE 2GZWA 3F2ZA 2DUOA 4W6XA 1I5ZA 2DVGA 2R1DA 3GBFA 4OUSA 3WV6A 3D0SA 4LT5A 1NCRA 1SBEA 2ARBA 2JJ6A 4XACA 3UJOA 4FOVA 2ZMNA 1WMDA 3DN7A 4JHTA 1KRIA 4MO3M 4OI4A 2QQKA 1WCUA 3HBKA 3NJXA 3SLIA 4M3CB 3BTXA 5KXDA 2UY8A 2WZ8A 1X7NA 3LDBA 1O5UA 3KD4A 1FV3A 4KGQA 3ZYRA 1W99A 4YLZA 2J1EA 3JB4C 1IS4A 4K8RB 3OF1A 1CPMA 2VMCA 2Y8KA 1MVEA 4LLFA 4QKBA 4AE2A 4NVPA 5DAVA 4QKFA 3HR9A 4ES8A 3V0AA 2XVGA 4OQ9A 5FMBA 1JXNA 2WO1A 4Q4V3 1LEDA 2W47A 1YFYA 4COYA 5A6XA 1W39A 4UBGA 1LESA 3FLPA 4GB33 2XLAA 5TSWA 4IV3C 3NVCA 4Y1UA 4EE2A 5CKQA 2WN2A 2ZZJA 2G19A 3KM5A 1OT5A 5ACA2 2DTYA 5LATA 4XQDA 3WF0A 3NRUA 4BQ4A 5BNPC 1W2NA 3T30A 3B9IA 3H7YA 3Q8AA 4CVUA 2WRAA 3BOPA 1ULPA 3N9LA 1BBT3 1NCQA 1BEV3 1X36A 1STMA 3R0RA 4QKNA 4AFCA 3ZXJA 1H8TA 4Y1XA 4AVAA 4QPIC 3PIGA 1DZTA 2D3RA 2W08A 5JI7A 1JZ2A 4YM0A 4K6BA 2OUJA 4PIYA 1ZZ9A 3LEMA 2IXIA 3U10A 5FZCA 3GHMA 4MGIE 3NW4A 1GZTA 1PO21 1Y43B 1ZA4A 3CEWA 5C3OA 1M4WA 2FZ2A 3G7DA 2RR12 3BTZA 2CV6A 1C8M3 3CBNA 3ZSJA 1QJY2 5KHJA 2FDFA 5F5AA 1C1LA 5H9PA 4LBNA 3ACFA 3PTYA 5LK7B 4KGGA 5CG8A 4QQOA 1UOBA 1W6MA 5HXMA 3BN6A 5FV3A 3VHNA 4ZU5A 1WGPA 2IWGB 1CAUA 1K45A 2JDNA 1D4M2 2OA2A 2Y0IA 1HXS1 3VBUC 3ZFFC 1H9PA 3ZR5A 1PVC2 4XXAA 5A7WA 1SLBA 3POYA 1ZRIA 1XSRA 2R041 1COV2 3ITQA 4P9JA 1Z78A 3NL1A 3PUQA 4DEQA 3VB9A 4LKEA 2HWC1 5EJ3A 2P17A 1XSQA 1RVF1 1W3XA 3SCGA 4TSVA 2JG9C 1YJKA 4YZ1A 4DNYA 3N9MA 4XZUG 5LK5A 5J09A 1PX3A 5F5CA 1PMJX 2ZX1A 2MEV2 3VZJA 1CAXB 3CHXA 4IV3A 4L8QA 3HIFA 3UT0A 3AMMA 1U5XA 4QPGB 4XCBA 4CXYA 3LD8A 4DQAA 1DGRN 5HCAA 2D3PA 2A75A 4QX3A 3UESA 4R9BA 1TVGA 1RUI3 3IDEA 1NE6A 5BNPA 3ZX7A 3T4HB 3MF9A 5J96B 3PURA 3VD9A 4NOTA 1UPIA 4AHZA 3JU9A 1J58A 1Y9MA 4HZFA 4ZXKA 3U11A 5F3CA 1RB8G 1HIXA 4TN7A 1YCIA 4RSUA 2V4AA 2BDRA 5J7MA 4GMP3 2DDUA 5FPUA 5A70A 3BKZA 1WW7A 5JCTA 3B7MA 1PGW2 5F2SA 4IEYA 3TEXA 1RXFA 3ZYHA 1YHFA 4IV1B 4QPIA 1V9U1 1XB9A 4QXCA 2G9ZA 4ZKTB 3L2YA 4NHXA 5FLHA 3GHNA 3P3NA 2P2KA 2BNOA 4Y24A 5JOXA 4UF0A 3WW2A 4FFFA 1QQP1 2PAMA 5JAXA 3D82A 1VAVA 3KV6A 5I0UA 1AL22 3WW3A 3ZN4A 4KU8A 3IPVB 4WVWA 4XTPA 4FPGA 3RI8A 5BNNC 2Y33A 5JPNB 1LCLA 1AYM2 1R1A2 2RDQA 1XPWA 3EQEA 4Q8LA 3KT1A 2G9FA 3VBUA 3ZFFA 1V70A 3M1HA 3VD7A 5LA2A 2R071 3TRSB 2XKOA 4E8CA 4WM8C 5KHKA 5CG9A 3WG3A 2IXHA 4A2UA 4JDOA 5CFCC 5IVBA 2P4EA 4JHZA 5JXHA 1VBC2 1MS5A 5A1AA 5C33A 1H2NA 3UKVA 5AC92 4IXLA 4HVOA 1OC1A 1Y4WA 2OZJA 3DEMA 1AR72 1BCXA 3I3BA 3TBDA 3L2HA 3SC7X 4CDWB 2NP0A 4KG0A 1VBD2 2JG9A 3SH4A 2BRTA 2V5DA 5KHIA 3WY6A 2RS31 3SQOA 1MQTC 2W1QA 5JUVA 5JIAA 2FDGA 1UWWA 2QBXA 5LBEA 3WDXA 4ZY9A 2I07B 5IYYA 1VBB2 1RHI3 4JQRA 3K75B 1LAJA 4PBOA 5FZKA 1SDWA 1HQLA 1S0EA 1ODNA 1ULFA 2ZGPA 5FMDA 3T09A 4A6OA 3DPRB 4JX0A 1OURA 2ENRA 4ASLA 1N3QA 1OD3A 1QNYA 5D21A 3BU0A 1LGCA 1QY4A 1BZWA 1WCKA 2PAEA 4I3PA 1LJ7A 1PZ7A 4ZZ8A 3DKQA 3FJSA 4HOOA 4QQLA 2QJVA 3I3DA 1YFUA 4J25A 1XC6A 3AYCA 1PIV2 4BQ2A 4XTMA 4D6RA 5JR7B 5JSOA 5C3QA 1MS1A 3VBHC 3K48A 3O14A 1NLRA 3ME2A 1CAVB 1MEC3 3DF0A 3H3UA 4YYOA 1WZXA 5JZGB 1V00A 4GULA 2F17A 1J1LA
chains in the Genus database with same CATH topology
1R082 2UY9A 3AK0A 3AZXA 4AWDA 3V0BA 3ZN6B 1LECA 4YSFA 5J37A 1O4YA 2VH9A 4W6YA 4EJRA 3AKTA 1UKGA 3QCWA 1YFWA 2ZKLA 4A7ZA 4WM8A 1PO22 5CFCA 1G9BA 3MLKA 2DCZA 3KB5A 1LODA 4AF9A 1LHVA 1GQHA 4BMEA 2UWBA 4RR3B 5CU1A 4E4SA 2VMGA 4M01A 4QQPA 4AYUA 2LALA 3OY8B 3BU7A 4LE3A 1PO11 1MQTA 2PHDA 1AX2A 2HWC2 2WA3A 3MI8A 4WZFA 5T5PA 4YNIA 4Q1RA 1KD7A 1RVF2 2JEMA 1R092 1D0GA 1PZ8A 5GZFA 1JBCA 5EV7A 5F9TA 2EXIA 4AGGA 3UJQA 3NKTA 4Q0VA 1E57A 2RHPA 2R32A 2D44A 4OULA 3C2UA 4HVQA 2Q4SA 3FFZA 3SMHA 1Q56A 1B35C 3VBHA 1W6NA 4MLOA 4AHYA 1QOTA 1Q8QA 1N3PA 3TN93 4GKYA 2YPJA 4XIOA 2WLPA 1FPN3 3L9JT 1POV3 4XJ8A 5FREA 1W6QA 1PGSA 4AEKA 1N1SA 1W6OA 2V73A 5CNAA 4CDXC 3VL9A 4DY5A 1AVBA 4EN0A 2WNUB 2PLV2 3VHRA 1YXWA 1NOVA 3J26N 1H1AA 1NZCA 2DTWA 1GSLA 4KWJA 3D8CA 4IEXA 1L3JA 3M3IA 3ZFEC 1ENQA 2WFPA 3J8F2 4NHMA 2ZCWA 4EN8B 1TME2 3MPBA 4NN0A 5IT6A 1DQ2A 3V65A 5DDJ1 4AQ2A 1OFSA 3VUOA 2QVSB 1H8VA 2C9AA 5D8AC 3S30A 4CEYB 3VHPA 2HWB2 4HPKB 4FTBA 2ZX3A 2VNRA 5FMOS 3VN4A 1F8VA 4KU7A 3JBG3 3T2TA 1WMFA 2GNBA 2RS32 3NSTA 5A32A 3RNSA 2UYBA 3RZZA 1NLSA 1UPSA 1DLLA 5CB7A 4YVSC 2ZMKA 1FX5A 4N9IA 1S2KA 4DOUA 5CAZA 1B35A 5FPXA 2R063 4F83A 2WZR1 2VNOA 4IEQA 4O9GA 2AYHA 1QJU3 1VAKA 2HWD1 5I8SA 1LOAA 2F6BA 1ZZCA 2IXCA 4Q4W1 4LBQA 1UIKA 1EPZA 3AMPA 3VZLA 5CBLA 5BYNA 2B45X 3VL8A 1UD1A 3IMNA 4A7KA 1S0JA 3INAA 3AP5A 4CDXA 2IFWA 2W0XA 1G9CA 2PQQA 4YGDA 1JYIA 4FP2A 4XQ4A 5FAXA 1RUC1 4R4XA 4YW2A 3ZSMA 1DF0A 4N53B 1RUJ3 4RS5C 3SH3A 2ZGQA 1DQ0A 4Y20B 5FPZA 3THPA 4XOGA 5HCBA 1GZ9A 2HWE1 2VOVA 3ZFEA 2E53A 2FHRA 3ZSEA 2D43A 3S6PA 4P9IA 2YC0A 2GC3A 1RITA 2Z79A 2A3YA 1WBLA 3D0JA 4JGYC 1YFXA 1PK6C 5D8AA 3K51A 5BNNB 3ES4A 4UW4A 1KS5A 1BBT2 3GBGA 3ZFGB 2XWJB 3MGUA 1TE1B 4XHXA 4XETA 4WBBA 1LOCA 4JRAA 3ACLA 1ENSA 1G6NA 1JYCA 1AJKA 4YVSA 1ZBA1 1LR5A 2CWMA 4IEOA 2A3WA 2XLGA 2Z69A 1RUG1 1QJZA 1R1ZA 4PF5A 4GKXA 3VBRB 3MPPG 4JRLA 2ZGRA 1TQ5A 3MDPA 1YLLA 2RS53 5JSPA 1YIFA 4XF4A 3LWCA 2EXKA 1IQAA 3JQWA 3VGIA 5I8TA 3UKNA 4CP0A 4AW7A 2VOXA 4QD2A 2WA4A 5IK5A 2PHTA 5C8CA 1R1A3 1V6JA 4FPKA 3CU7A 4M0HA 3DKWA 2DFCA 1GFF2 3ALQA 3MIDA 4LBQD 4RS5A 1KFXL 1A8DA 4IEVA 1LTEA 3UKTA 3ZXLA 2JDZA 4HK8A 3B01A 1CR7A 4I02A 5H9SA 4I09A 2GNMA 2AUYA 1RUI2 5CA6A 4YM1A 1QHDA 1KFUL 1RUH1 4YW3A 4Q26A 1CONA 1S0IA 4JGYA 2ZGUA 1PK6A 5DZEA 2D93A 2VVFA 2ZTNA 2Q8OA 5KXCA 1QGLA 4XHBA 3H1WA 3GF6A 4YG6A 3BCWA 4PLOA 5JVVA 1POV1 1Y7BA 5DDJ2 4Q29A 5FFOC 5IK8A 4JTNA 3RG0A 1WCDJ 4I0AA 3FC0A 3KZ4C 1O7FA 5K0UB 3MLLA 3LA2A 3LCPA 3WLUA 4RQPB 4FO9A 1ASJ3 3B02A 2UWCA 4U2AA 2KA3A 2Y26A 4LO8A 4MH0E 3VBSC 3CNAA 2JE7A 1NCRB 2DWRA 4LUKA 1KXGA 1ZBE1 4FXKB 1KS4A 1VRH1 3MIBA 5D1IA 2P3JA 1VBE1 1JTZX 3ZPYA 2CL2A 1AR81 4LULA 3WP5A 4FPHA 3DL3A 3WD5A 2D3SA 2AH2A 1IKQA 4N90A 1ZNPA 1SFYA 1LHUA 1V6KA 2AGSA 3IN9A 2VOKA 4HLTA 4XZPA 3MW2A 2DFBA 1XE8A 2Q5TA 4GWNA 3WDYA 4URTA 1HXS3 4MVTA 5C6CA 1RHI2 5I0SA 4R9CA 4LHKA 1XNBA 2R043 3SISA 2BWCA 1ND3B 4HSJA 2BNNA 4EN9B 4QQ2A 1QJU1 3WDWA 4LLOA 1RVF3 5JI9A 4R52A 4GMP0 2DURA 1OSGA 2VUJA 2NPIA 1RJ8A 4BHPA 1NCQB 2GC0A 2PA7A 1LU1A 2ZGSA 5T50A 4JGZC 3N7MA 4EV0A 1H8TB 5KXEA 3NWKA 4J6GA 1AR61 4FOWA 4JDNA 1QOSA 4BLIA 2H0BA 1C3HA 1FMD1 1OQ1A 2VW2A 4GH4B 3VBSA 3VDDC 2DCTA 2PELA 3AP4A 4BYYA 1ULCA 2OIIA 4XBQA 1WLTA 1RUG2 2DVAA 2WZPP 5FO9B 5K9YA 1W6MB 3ASIA 1YUDA 3J4UH 1V9U3 4L92A 4QHBA 5SV5A 4IEZA 4JC1A 4DZGA 2Q0AA 1QQP3 4IERA 1Z0HA 4FAHA 1CGPA 2HYKA 5H9QA 4B4PA 2A6WA 4NR1A 4C90A 4N43C 2ZHLA 3U07A 1AX1A 2E7QA 1W0PA 4QM8A 1HV1A 3UV9A 2LTNA 3HMYA 2A6VA 2R073 4ONUA 2QUOA 4ZU4A 4XW3A 1Q3EA 3N3HA 1C1FA 3E6DA 4IV3B 1YI7A 1XU2A 2RE9A 1NQJA 3MW4A 1SBDA 2Y38A 4Y1YA 1IS6A 1QXPA 3ILFA 3AM2A 4CP2A 2DCJA 1H1IA 1GV9A 3OGJA 4BOWA 2XVKA 5GLUA 4F3JA 5FRAA 1JN2P 1RUH2 1W6PA 1KITA 4AK3A 4JGZA 1EP0A 4XJUA 4QPIB 5AFEA 3TN92 2H0VA 1PNGA 2EAAA 3HT1A 4AFDA 3ZXGA 1CESA 5F1RA 1FPN2 1VLNA 2WS91 1PGL2 1ULEA 1TEIA 2NLRA 1G9FA 3VDDA 3N36A 4XF1A 3LZZA 5GZDA 1VB4A 1XYNA 4FVVA 3ZXKA 1QH7A 1ONAA 4AEDC 3AXEA 3POSA 3H1MA 2BUKA 4QU2A 3VBUB 1H9WA 4HMZA 3FLRA 2PHUA 4LR4A 2XBO3 4LBMA 4C0HA 2HJIA 1ZBE2 1QJX1 2QDRA 4D69A 4HL0A 3AJYA 4AQ6A 4XFGA 3A4UA 5FLIA 3FWEA 3KLSA 1NXD1 2X5IA 4N43A 2YROA 2JG9B 5DUVA 2VVDA 2ZS6B 1LOBA 2GC1A 2XJTA 2UURA 1GZWB 2R0HA 3RRDA 3PVBB 4JVAA 4I2OA 1TMF1 2YGMA 4OI0A 1H30A 4FOQA 5JOYA 4XIKA 3JBG2 4COZA 1ASJ1 5B2GB 2JXAA 2RMU1 2ET7A 4D94A 3ZXFA 5FBZA 3HQXA 1AYN3 4JDMA 4Q1PA 2D5HA 4Z92B 3MYXA 1ZX5A 2DVFA 1PO13 5KHHA 4E2SA 2R062 3B5LB 1WUVA 1QWRA 1QJU2 3IDCB 5L73A 5T55A 1K5MC 1C5IA 1JW6A 1A3KA 1XRUA 4PCRA 4Q0SA 5BNOB 2XB6C 4PIXA 5FQ0A 1POV0 2Y0OA 3VBFC 3V0BB 4AEDA 1A78A 4L9BA 1RC6A 1ZM1A 1SBFA 1RUJ2 1IS3A 4OFGA 5A3MA 2GN3A 1IHMA 4DB5A 5CFCB 2JX9A 5KWRA 1LULA 1OMIA 4M0NA 4K7JA 1CX4A 4IL7A 3R4SA 3E6CC 2JG8C 2NZ9A 1FI2A 1ULGA 3ZMOA 2E9QA 4YW4A 4BWOA 2XHKA 1I9RA 2OUHA 4EN7B 1CJPA 4HSLA 5CFDC 2GNTA 1NXMA 2SLIA 3D6EA 2BVVA 4C0BA 2A70A 2XL9A 4JTOA 4Q2FA 4BQ1A 2Q1ZB 1OLRA 2ZZQA 4YRDA 3GNEA 5LEKA 2EALA 4Q8KA 1U0AA 1RMU1 3AJZA 3BODA 1LKNA 3CJIC 2A5ZA 3AB0A 1RUOA 4BZ4A 4ISRA 5HI0A 2CY6A 1WD3A 4BPZA 4G9SB 4KH9A 4Y22A 1J59A 1REEA 3FUOA 5DDJ3 1O3QA 3IDBB 3AKPA 1FOD1 1FT9A 3VBHB 3PJYA 4AG4A 4QX5A 4RHV1 2C1FA 1W6NB 1AXKA 2RS52 2WL1A 1K5MA 4XF9A 3SLIA 4FSJA 4DRVA 1H0BA 4AEJA 2QDNA 3W59A 4COWA 1LB2A 2D97A 2IXKA 4MXWB 4DXZA 1I1EA 2AENA 3VBFA 4AVBA 4CZSA 3D4KA 1W6OB 2WSVA 4Y26A 4NHKA 1EAH1 2D6OX 3G6JB 2N7GA 2IXLA 2WZR3 4DINB 5F6LB 3E97A 1Q5OA 3TWIA 4BH9A 2HWD3 3B93A 5HCFA 4AI1A 4Q4W3 1I6XA 3SNMA 3N7JA 3MW3A 4COUA 3CJXA 1VBA1 5JPMB 4KL1A 2JG8A 3DUIA 1ULDA 4BMBA 2CWSA 3N4MA 3M3OA 4AVVA 4CDUC 3A0NA 1QJX2 3ATGA 1FV2A 5CFDA 1RUC3 1WCSA 1OQEA 3N35A 3TNQA 2ZHKA 3ZYGA 1N3OA 3TB0A 3USUB 4HKLA 1REDA 5E8AA 5L36A 1LOFC 3RI9A 3ZYPA 2HKXA 4GWMA 3WUCA 3M3QA 2HWE3 2QNKA 3CJIA 1U12A 3T1LA 5A32B 5JDBA 2ZOEB 2QCSB 1ZZ7A 2YHJA 5FMOL 2JE9A 1ASJ2 1H1MA 4Z82A 2XBO1 1Z7S1 1MZFA 2YMZA 4DMIA 2C5DA 1X8EA 3SH5A 3N7KA 2FQPA 2B42B 1DGLA 1D2QA 4LBQB 2GAUA 4LO5B 4ITCA 4WVMA 4XQWA 1BXHA 4XPVA 5T5JA 3I7DA 4B7KA 1UX6A 1ZBA3 3AFGA 2DF7A 5EXOA 2ZA9A 3H7JA 1RUG3 4YW5A 3PNAA 4CDXB 4Q27A 5EFUA 4RGAA 2NQYA 2I45A 3MFAA 3MICA 3HN1A 1N1VA 3KCXA 1F5FA 1N1TA 1SQ4A 2RM21 2XJUA 3DV8A 4BM8A 1HXS2 2TNFA 2K0GA 1AYN1 2TUNA 3ZFEB 2R042 3VZMA 1LOEA 2WLQA 4CDUA 2GH2A 1HLCA 2RS11 3KSCA 3WXPA 4E4DX 1AXYA 3O0VA 5GM0A 5D8AB 1H4HA 2NN8A 2EF6A 4CYDA 3R05A 2WNEA 1UN1A 1LOFA 4CDWC 3NV1A 1F31A 4WV8A 3ZYIB 1SLTA 2K2SA 5ABJC 2R49A 1H4GA 1V6LA 4P9GA 1JUHA 1RUH3 4UW5A 4YVSB 3S7IA 2ARXA 1MZ5A 4B4RA 3AYEA 5AVPA 1X50A 4I3GA 5GLTA 4YVWC 1RUD1 2ZGMA 1EY2A 2WINB 1Y9QA 5DZGA 4I0WB 3WP3A 1V9U2 1U5YA 1FOD2 2XG3A 3AYDA 4META 2DCKA 1V6NA 4N7IA 5A33A 2VECA 4HN1A 3ELNA 4XYXA 1MS3A 4QM9A 3GZTB 5C8CB 4HKWA 1QQP2 2WQZC 4P9LA 4F8AA 1WW5A 5JSRA 4YG3A 4O9EA 4XXPA 4RS5B 5DG1A 2GSYA 4IEPA 4SLIA 1ZBE3 3IPVA 4L97A 3LSDA 2R072 4FPOB 5DG2A 3RJRA 4C91A 1VRH3 4FQ4A 4LBJA 1VBE3 3WT3A 4PQ9A 1AR83 1ZZ8A 2DUPA 1VALA 4LEJA 2GC2A 2JENA 5EYYA 1C57A 1HDKA 4H14A 1VBA2 4DPNA 4JGYB 3WOGA 1EPWA 1ND2B 1PK6B 2WC2A 4WM7C 1XE7A 3FUQA 2W52A 3U4XA 2JKBA 4LNVA 2EXHA 1LHNA 3E5QA 4NO4A 3AKSA 2HEWF 5FLJA 4B7EA 4HT1T 3ZXAC 2CAVA 5ABJA 4MSVA 3O0XA 3GALA 3USSA 2E63A 2O8OA 5IK7A 4CP1A 2XUMA 4S2DA 2B46X 1MZEA 4XJWA 4YVWA 2C0ZA 3M3EA 5LRRA 3WCRA 1DGWA 1FATA 4NHLA 2PN5A 2YYOA 3AYAA 1ZRFA 4AVTA 1TNFA 4D7TA 2WT0A 3PVEA 3AZWA 1EV11 5L7OC 3IWZA 2XBO2 1Z7S2 1D2SA 1F9KA 4EN6B 1O4TA 2WNVC 1AR63 2OYZA 1W2UA 4XJAA 1Q8SA 2GALA 1GKBA 2K9ZA 1FMD3 5T54A 1J3QA 5EYXA 2E6VA 2QE3A 1BJQA 4XF3A 1IGOA 3JD71 1UMZA 1VAMA 3ZN6A 3HWJA 3OCPA 5AFBA 2D7FA 1BMV1 3B00A 5GLZA 4AI2A 4QMAA 2WNUC 4WVVA 2FMYA 2I74A 4K1YA 3NKGA 1T6GC 2UWAA 4U36A 4J1WA 1O4ZA 3KMHA 3VBOC 1OOPC 3FHIB 1GNZA 4Q4Y3 4WM7A 1HRV3 1AYN2 3SXWA 3ILNA 5I0TA 4YZ5A 1NY71 2BFUS 1PO12 4KWKA 1QNWA 1X82A 2VOWA 1APNA 3OD0A 4FOYA 3WQ0A 1V6IA 4L2NA 2WFF1 1NA1B 4OHWA 1CD3G 1X33A 2JECA 1AX0A 3MIEA 4K8FA 4XJZA 5K7PA 4WZCA 3WDUA 3RS6A 1YYNA 1YWKA 4M3CE 4AHXA 3WG2A 2Z5WA 4MGZE 3VBSB 3LB9A 2BGCA 3ST7A 2GU9A 4P9WA 4HK9A 3NAPC 4G3YC 3NJZA 5CIRA 5L7OA 2Q1MA 4QPYA 3AMQA 3IM0A 1DG6A 4B8EA 2JICA 4E4ZA 5FDBA 1MR5A 2WNVA 2XL7A 2A3XA 2WS93 2KM2A 1IS5A 3CL1A 4Z07A 5KC5A 2VG9A 4XBLA 3WQ1A 3PLQA 3OTFA 5BUVA 5JLVA 4KNCA 4OHYA 1LENA 1RUE1 1WBFA 2B8MA 4YM3A 2ZACA 1Q8PA 3AFKA 3ZSKA 1N1YA 4RL7A 3MIHA 1JH5A 2WNUA 1IZ3A 2HWF3 1G9AA 4A7YA 2GH8A 1CJDA 4MXVA 5F6KA 1QJX3 1GANA 3JUUA 1HX6A 1OOPA 2WIIB 4JCKA 3VBOA 4DY3A 1DQ4A 5JMCA 5BNQA 1UZYA 1WW4A 2CNAA 2ZHMA 3WUDA 1W6PB 2Z42A 2PTMA 4JGZB 1TMF3 4CDQC 2EIGA 4AGVA 4CEWC 1ZZ6A 2YXSA 1G8WA 4FPYA 4W6WA 1GBGA 2RMU3 3VZOA 1UAIA 4AFAA 4IEUA 3AP9A 3RYKA 1YIPA 3VDDB 3RPQA 2YGLA 4Y5Z0 1OA3A 1CAWA 5E89A 3VKNA 3NAPA 3UK9A 4DS0A 2WZR2 2EXJA 4YZ4A 2BYVE 2G9GA 1HRI1 4TZDA 5KBFA 2HWD2 4INDA 1DGRA 4Q4W2 1FXZA 3VBRC 3KGZA 3LKJA 4I0BA 1KQRA 4MYEA 4Q0UA 1HQNA 2VMHA 3B3QE 2ZAAA 5K8SA 1XNCA 4GQ7A 5C9AC 2DU1A 2Z2SB 4BIFA 3V0AB 3FBYA 1FAYA 2X5IB 4N43B 4YGBA 2DVDA 1XYPA 2B7YA 4K21A 2ZJCA 1RUC2 4BA6A 3QBQA 2ZPXA 2EA7A 4G4FA 4FPCA 4OHXA 3VKLA 3AMHA 2HWE2 1JHNA 1WW6A 3ILRA 5ACA1 1J3PA 1BMV2 3UL2A 4B29A 1NE4A 3QOPA 4I01A 5E16A 2WQ4A 1DU3D 2ET1A 3ES1A 1OKQA 3O12A 4CDQA 3WG4A 4CEWA 2PHLA 3KT7A 5C4WC 3QD6A 4B4QA 4FPLA 4LA3A 5T5LA 2O0OA 1GQGA 4KG8A 2AREA 4FTSA 1RMU3 5FQ0B 3VKFC 2YZ4A 2WFF2 1ZBA2 4RA0A 3ZDSA 3ZXEA 1AHSA 2RR11 4AEDB 2PHRA 2IZWA 1QJY1 2IXJA 1CAUB 3I59A 2E7TA 4K20A 4QXKA 5L19A 3H0OA 1FOD3 1RUNA 4ISQA 3H8UA 4RHV3 1D4M1 2R6QA 3VBRA 4PBPA 1PVC1 2QQPA 1V6MA 4YW1A 4MGYE 4N9HA 1SLCA 4Q4Y1 1F5JA 1HRV1 5FO7B 1COV1 3WP6A 5GKAC 4CTEA 5C9AA 4FCAA 4UXAA 2YDEA 3GBWA 5LEJA 1WLCA 2OZ6A 2CGOA 1J3RA 1EAH3 3VKMA 3M7AA 2TEPA 3FMGA 2MEV1 2WJSA 3ZMNA 2D6MA 4AEMA 5IK4A 2TBVA 5BNPB 1OLQA 4MV2A 1RUE2 4LBKA 4HETA 1VBA3 3QACA 1IKPA 3KGLA 4MUVA 4FQZA 1J1TA 3WW1A 2R30A 3FX3A 4H7LA 4Y22B 3KCCA 1C4RA 4OVEA 4NWWA 3AKQA 2ATFA 1PGW1 1ND3C 3M3CA 4JAAA 5C4WA 3T1MA 1K5MB 1RUF3 3TAYA 5EZWA 3LA3A 1QDCA 4MZUA 2DCYA 2PHXA 2DYCA 4XMAA 3VBFB 1AL21 4GXLA 1AUYA 3ZFFB 4V1PA 2EVXA 1C5HA 4M3CF 2AR6A 2HWF1 1X8MA 1AYM1 2XH6A 4GIQA 5DUWA 1Z7S3 2D6LX 3AP7A 2R1BA 4K9SA 4YFWA 1DQ6A 5FOJB 1WD4A 4GH4C 1DYKA 3EJKA 1VBC1 1VRH2 3H1YA 1YO8A 1VBE2 4ASMB 5AC91 1AR82 1D4VB 1HRI2 2JG8B 1UU6A 3I2DA 1AR71 3DGTA 1VBD1 3EHKA 4M00A 2WT2A 4HKOA 5CADA 5CFDB 4Z8BA 1DDLA 2OVUA 1EYBA 2D5FA 4AVSA 2RM23 4QGLA 1VBB1 3RYRA 2X8KA 3LGRA 3E5UA 2AZ5A 1DQ5A 3CJIB 2ZGLA 2FMDA 4E2QA 1SLAA 4K3UA 4PDWC 1C28A 4GALA 2OPKA 4EROA 4UW3A 1V6OA 5C8WA 2RS13 3D5OA 2A71A 2VNGA 1ND3A 4BLJA 2XWBB 1BK1A 3CF6E 5CVRA 1PIV1 4IESA 5GLVA 2BW8A 2UYAA 1S0FA 4KQ7A 2B9UA 2ZBJA 3M4FA 3VHOA 3RJ2X 3M8LA 2I2SA 4WVMB 1SACA 1AR62 1ENRA 1R081 3PJQA 1WLWA 3WX5A 1FMD2 4WM8B 3W58A 2LM3A 2A6ZA 1DZRA 2VQAA 2DUQA 4BIOA 2GMEA 1RUD3 4GH4A 4XJ9A 3SCFA 1CVNA 5KXBA 1KDKA 1RJ7A 3AP6A 1FYUA 3PMSA 2YUEA 3H3ZA 1DGWX 1UZZA 1MQTB 1CQ9A 1ZYBA 4CDUB 2MHFA 3R6SA 1LHWA 2VW1A 1OHFA 4P9YA 4Q4Y2 1HRV2 3BTAA 1LU2A 1H2KA 3I54A 3IBMA 1NQDA 2XJVA 1XNDA 2F4PA 4LA2A 4FAGA 1Q8OA 2ILMA 2P37A 1R091 1O5LA 2Q30A 5BPXA 4YZ2A 4IQPA 3GYDA 2GNDA 4QT6A 5SV8A 1QU0A 4XMIA 4PDWA 4Q4X3 2A7AA 2D6KA 2ZKNA 3HAGA 4OI1A 3OJBA 4YG0A 1GR3A 1Q8VA 1OI6A 3OYWA 3IT8A 1AZDA 2GDFA 1CN1A 4XE9A 4Q0PA 1OFNA 4HANA 1Q43A 4FTEA 3B94A 1W6QB 1ZREA 3A0KA 4KWLA 4AI8A 5A33B 2WS92 4FXGB 1DBNA 1MZ6A 5E88A 3AXDA 2MNGA 1OA2A 4EWDA 1XNKA 4XFCA 2PLV1 3WQ7A 3ZSLA 5BNOC 3GZUC 2NM1A 3TYJA 4XF0A 4LHLA 5BV6A 4HBNA 4E9KA 4M3CA 3S7EA 1SFNA 3RWNA 2HWF2 2HEYF 1EV13 3OBRA 3WW4A 4EWEA 2A6XA 4FT8A 2KXLA 5I91A 2GMMA 1URXA 2ZX4A 2DVBA 3J8F1 1JOJA 1VIWB 4P9XA 1AJOA 1TME1 4X6RB 3HBZA 4D7SA 4Y4YA 2VGDA 3FE5A 5KHGA 1GZCA 1JUIA 5I0RA 3AKRA 2RJKA 1RUF1 3HD8B 3I8TA 1QF3A 3JD73 3AZYA 2HWB1 3OBTA 1TMF2 4PIZA 3V64A 2GMPA 4FBFA 1GZWA 2VULA 3OD4A 4QPGC 3SHRA 5ABJB 2VQ0A 4RGGA 2RMU2 1KDMA 1DZQA 3CLPA 1B35B 1F2NA 2VVEA 4P14A 1MVQA 4YVWB 2DV9A 4Y1ZA 1HKDA 3Q9OA 1HV0A 2NMNA 1A8MA 2XJSA 3BPZA 4LO4B 4K1ZA 1M06G 1LEMA 2WFF3 4IV1C 1BYHA 1OD5A 2XJRA 5GALA 4ATFA 3NV4A 3ZIXA 3MIGA 3ROUA 1ZRDA 3R4UA 1B09A 5BNOA 4YM2A 3V56A 2ZX2A 1KJRA 5EWSA 1G86A 3PHMA 2XGXA 1S0CA 1AR93 3O5SA 4Q4V1 2QZ3A 2FBEA 4XFFA 3TOJA 5JOZA 3MZHA 1O3RA 4LBOA 4GB31 4R9DA 1XXNA 3KCYA 1YJLA 3NV2A 4LBLA 4LE4A 1GLHA 3U0ZA 4ATEA 4C1XA 4S2HA 3RMXA 4P5HA 1MACA 4WM7B 2LUWA 1IPKA 4R4ZA 1RUE3 4SBVA 1BBT1 3MEPA 1S0DA 3HT2A 1ZVFA 3RYPA 1BEV1 4FP3A 1UU4A 3ENRA 1CAXA 2BVBA 2ERFA 2CAUA 1LOGA 2MPFA 2EAKA 1U5IA 2VPVA 4QPGA 4L11A 3VLBB 2WSUA 3OGGA 2BFUL 4FPEA 4Z2WA 1YI9A 2V09A 1RMU2 1DFQA 1SCRA 3DPRC 4Z1VA 4XFAA 1C8M1 1QXJA 4X8NA 5I8YA 2VW0A 4IV1A 5JIUA 4RHV2 2ZGKA 5L7OB 2WNVB 1IPJA 5JZGC 3BB6A 4IEWA 3KQRA 1QOOA 5AVAA 4D3WA 3IIAA 4NWVA 5J48A 4DRRA 1SMVA 3APBA 4H7MA 3MFCA 4MXWA 5DUUA 3X29B 3RQ0A 2UU8A 1ENXA 1EAH2 1PHMA 5JOWA 1HRI3 1UU5A 2YY1A 4Q4X1 2O8QA 4FPFA 2PHFA 2P3KA 2W68A 4H3WA 1RUI1 1S0BA 2CTVA 4FPJA 4R8HA 3VBOB 3URFA 1OOPB 3QH7A 4CDWA 4RR3C 1XQNA 1AL0G 1S1AA 3WZ1A 2D98A 4XFIA 4AFMA 4GMP1 1O3TA 5BXXA 1O91A 4LHNA 3GZAA 2CYFA 1QXRA 1MS9A 1VP6A 2E7AA 2QKDA 4GA9A 3AX4A 4XBNA 5H9RA 3AZVA 1RUF2 3USUA 1IOAA 4AVCA 3NO8A 3FBMA 1UCXA 2D6PA 5GZGA 2QZ2A 3WCSA 5ACA3 1SLIA 3DPRA 4E27A 3ZO0B 1XYOA 1YRZA 4HN0A 3JB8A 1DQ1A 2XJPA 1WA4A 1CAWB 4PLNA