2JG9B

Crystallographic structure of human c1q globular heads (p1)
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
132
structure length
132
Chain Sequence
b'TQKIAFSATRTINVPLRRDQTIRFDHVITNMNNNYEPRSGKFTCKVPGLYYFTYHASSRGNLCVNLMRGRERAQKVVTFCDYAYNTFQVTTGGMVLKLEQGENVFLQATDKNSLLGMEGANSIFSGFLLFPD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Complement C1q subcomponent subunit A
publication title C1Q Binds Phosphatidylserine and Likely Acts as a Multiligand-Bridging Molecule in Apoptotic Cell Recognition.
pubmed doi rcsb
molecule tags Immune system
total genus 29
structure length 132
sequence length 132
chains with identical sequence E
ec nomenclature
pdb deposition date 2007-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00386 C1q C1q domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2jg9B00
2HEVF 1TNRA 2RJLA 4MXVA 3QBQA 3K48A 5KWRA 2E7AA 2TNFA 3B9IA 4QPYA 4GIQA 1GR3A 1JTZX 5KC6A 5KC5A 2WNUC 4E4SA 1XU1A 2WNUA 4TWTA 2HEYF 4TSVA 2Q8OA 4OUSA 1U5ZA 4HT1T 2RE9A 4N90A 3TWIA 3QD6A 2JG9A 4EN0A 2Q1MA 4DOUA 3IT8A 2WNVB 1PK6B 2AZ5A 2JG8B 2OIIA 2R6QA 3B94A 4G4FA 4MXWB 3B93A 4OULA 5TSWA 1OSGA 4QQHA 4KG8A 4QQPA 3LKJA 3V56A 1ALYA 1O91A 2KA3A 1WCKA 1OQEA 5BNQA 1C3HA 1OQDA 1KD7A 1S55A 2ZPXA 2WNUB 1DG6A 3FC0A 2Z5WA 2RJKA 2R30A 3ALQA 2QE3A 4KGGA 3TYJA 3ME2A 1D4VB 2TUNA 5HBAA 2JG8C 2JG9B 1C28A 4E4DX 1I9RA 2R32A 2X29A 4NN0A 4QQLA 4QQOA 4D7YA 1RJ7A 1JH5A 3MI8A 1IQAA 2O0OA 5L19A 1RJ8A 1U5YA 4QQ2A 1A8MA 1XU2A 3K51A 3L9JT 1D2QA 1DU3D 1KXGA 1U5XA 3URFA 4OUMA 2WNVC 3AB0A 5CIRA 2WNVA 1PK6C 5L36A 1PK6A 4KGQA 2JG8A 1D0GA 4G3YC 3WD5A 4RSUA 4J6GA 4MSVA 4MXWA 2HEWF 1TNFA 2QDNA 4F3JA 2ZJCA 2JG9C 4DB5A
chains in the Genus database with same CATH superfamily
2NMNA 2C4XA 3NO8A 3PVEA 5F5AA 3QBQA 4P5HA 5F39A 4B4PA 1RUNA 1POQA 4IEXA 4QHBA 2B39A 3C2UA 1RUG1 1C8M1 2XWBB 2E7AA 3BOPA 4YM2A 2ZGLA 3B9IA 4COUA 4ASKA 4JQTA 4YGDA 4WM8C 3AJYA 2VZTA 1W6QA 4PIXA 1VRH1 4X8PA 5LCWL 2V09A 2ZX4A 4Q4V2 4RS5B 4LKEA 4W6XA 4AAPA 2W46A 5EIYB 2PFWA 4TSVA 1X33A 5FIXA 5JXHA 2RM22 2W5FA 2XVKA 5IVVA 3KSCA 4HKLA 4K6BA 5EJ3A 4CP9B 1U5ZA 5IAXA 2BVVA 5F3IA 5DAQA 3LZZA 1HV1A 4KU8A 1OD5A 5F37A 5JI7A 2JG9A 5JZGC 1FPN1 3PURA 4FPKA 1UYZA 1YLLA 4OYUA 4HKOA 1KQRA 5A3UA 2H6CA 1VBA3 2OIIA 2YUEA 4W6WA 1W0NA 1NXD1 4JRLA 2WQ8A 1MZFA 4FXKB 4QU2A 1MR5A 1BBT1 3SXWA 4AEMA 2ZAAA 1UMZA 1XSRA 2SBAA 2AREA 2WAAA 3K3NA 4EWAA 4RQPB 5CISA 3ZMOA 2Q1FA 3N7MA 1LHWA 5LA0A 1ND2A 1LGBA 5CG9A 3OEBA 1O91A 2VH9A 1NOVA 1HW5A 1GBGA 2HWB1 3AX4A 2WINB 4AEKA 5JIUA 1C3HA 3ORJA 2XJTA 5FYYA 3FX3A 2AEZA 3KT1A 3RZJA 1YFUA 2JJ6A 3VBUB 1OA4A 2VNOA 3H42B 3CF6E 2BPA2 3O1SA 2C0ZA 4CA9A 4GA9A 1LGNA 1W8NA 2FMDA 3WG3A 3N9PA 1ZX5A 5F5IA 3HBKA 4C1WA 4IV1A 3ZKYA 2XDVA 5A7NA 4B1LA 1DYKA 2YFZA 3IPVA 4TYSA 1DP0A 1WW4A 4NVPA 3I3MA 3H1YA 3VB9A 4KBBA 4XBNA 1LEDA 2VZUA 3N9LA 5FPAA 1XC6A 1MEC1 5FYUA 5C7GA 3DYOA 3OPWA 1SLBA 4FFGA 3K75B 4EN6B 3VDDB 5JWPA 2EIEA 4OQ9A 1JH5A 4DMIA 4ONUA 1XOYA 5A3NA 2E51A 1LHOA 2XJSA 3KV4A 3VBFA 1SEFA 3ETPA 1FMD3 1QDCA 4UT5A 3ZFGB 4Q4W3 3FHAA 2VBBA 1YEWA 1UOFA 2ORZA 1IS3A 4GH4C 2DBNA 4XIKA 1O5UA 3ON7A 4A6OA 1LR5A 5A1LA 4HMZA 3W21A 3W59A 3MPBA 4CEYA 1KJLA 2JIJA 1F8VA 1P8JA 3ZXAC 1MS5A 2OKXA 4CUAA 4P9IA 4JGZA 4XYXA 5FP3A 3B00A 4MVTA 4ZU4A 4SLIA 1ZNPA 1RINA 2OW4A 1VALA 4I2OA 1JMUB 3DV8A 1S0JA 3ZSKA 3CU7A 5BNPC 4A7YA 2OZJA 4XUTA 3SNMA 2Y6LA 4BE3A 1ENRA 3ZYBA 1XPWA 1WZXA 3MIFA 4TLFA 4HBNA 2DTYA 4GD4A 4XZPA 3T1MA 2AR6A 4N43B 4Y22B 5FZ1A 4AE2A 2Y34A 4KWJA 2PAKA 5IWFA 4XCAA 4LR4A 2OUHA 4CSWA 1H2MA 2XJVA 2IFRA 1J3RA 3AJZA 4Y1UA 1WW5A 2BRTA 1JTZX 2YU2A 1GWKA 3ZFEC 2VUJA 4Z1VA 2WT1A 4Q4V1 4GMP0 5KC6A 1FT9A 4LA3A 2J42A 4TWTA 1QH6A 3WQBA 3MFAA 2FMYA 4QPGC 3J26N 2RM21 4UWDA 3P3PA 2RDRA 3KVBA 5FZCA 5JUVA 3C7EA 1V6JA 2HWF3 3USUB 3ST7A 1RVF3 3AK0A 1YI9A 3HBZA 1CIYA 3FE5A 1Y9QA 1WMEA 4GAZA 2DCTA 3GZEA 3VBOA 3OEAA 4QPIA 3U37A 2RE9A 2WZR3 3LA3A 1RC6A 4ZU7A 3CZJA 1LHNA 4FFFA 5H9RA 2RVAA 5FOJB 1QNWA 1TME3 1XYNA 4AGRA 4D7TA 2P4EA 4IEPA 2AC1A 1UIKA 2FDIA 1ZBE2 5LRRA 5L7OB 3LOBA 2YC0A 3B94A 4XIOA 1AUYA 2XBO2 2WWUA 2CHHA 3NJYA 4L99A 5TSWA 1Y4WA 4CPBD 3OBTA 3RSJA 2VBDA 3VUOA 3WF0A 3JBG2 3ACIA 1TVGA 1J58A 4Q2FA 4NJ4A 2E9QA 3PLQA 5A33B 1ODMA 2ZMLA 4X6QB 4S2FA 4R9BA 1QQP3 2PHRA 2R042 3WNKA 4D7SA 4QAWA 5L9VA 4XQ4A 2L9LA 5HPOA 4D69A 2DCYA 1VBA1 2JDUA 5FPUA 5J7MA 2XQRA 4IE4A 1MZ5A 2BFUL 3CJIA 4AFBA 3KV5A 2BUKA 3RZMA 2YC4A 1O3RA 1ZZ6A 4BOWA 4M3CF 5AC92 5DUWA 4META 1UYPA 5FY9A 4AF9A 4BXFA 1OFNA 3ME2A 1WLTA 1I1EA 2YGMA 4IEUA 4Y26A 5FPVA 4YWAA 2NMOA 4NIGA 1Q8VA 2GU9A 4LLFA 3SISA 4P9GA 1J1TA 2ZHLA 3OUJA 5FRAA 3DF0A 1UMHA 2J22A 5JSPA 2PHUA 4Y20B 5D8AC 2WZEA 2X5IB 4FOQA 1ZRFA 3LEMA 5BNNC 2ZA9A 3HD8B 4YFWA 1RGSA 1U5YA 1LHUA 3EYPA 1W2NA 5CKQA 1JU4A 4G9SB 4ZZ5A 5F2SA 5JCTA 1HQLA 2ZTNA 1QF3A 4Q0VA 4Z2AA 4ZPIA 5FR3A 1SDDB 5A1FA 1LOFC 3SH5A 1M4WA 4CCEA 5LY2A 3SEPA 3AB0A 4GB32 4IEWA 1DLLA 4W65A 2NZ9A 4AVVA 1PK6C 4CDQA 4FFIA 4JRAA 4HSJA 2D5HA 4UW5A 4BXSV 1GZ9A 2CGPA 3A21A 4M3CB 1AR72 1UY0A 2RS13 3IN9A 4WM7C 1HRV3 4QU1A 2ZEWA 3I2IA 1KS4A 4YW3A 3WG1A 2BBVA 3ES4A 4Q5OA 2JD4A 5C33A 2D6MA 2WZ8A 2JDHA 3KT7A 5T54A 3THCA 2FCUA 3MF9A 4H14A 3UGHA 3N7KA 1W6OA 4IEZA 4AEDB 4CDWC 4RN5A 1APNA 4OHZA 4QB1A 1ZYBA 2NP0A 2DUOA 4XEZA 5CFDA 1GR3A 3LEIA 2WZPP 4KWKA 5IVBA 5IK7A 3H50A 3LDRA 1RUD3 1Y43B 4FPGA 5L9RA 5IVFA 1B35B 2VCMA 1VLNA 5CKMA 2VE1A 4P14A 1ULPA 1QJY2 5SV5A 1KFUL 1JXNA 4MHRA 1BQPA 3KV6A 5K0UA 3NMBA 1AR93 4MGIE 1WCUA 3F95A 4CEWA 5J96B 1BMV2 4NHMA 2E63A 4AK3A 1W04A 4UFIA 1S0CA 4DOUA 4DXZA 1UY2A 1NA1A 1JODA 3JD73 4QKBA 3MW4A 1ZBE1 3HIFA 1ZRCA 3V64A 2PLV2 2GDFA 2H0BA 2XBO1 2PHLA 4MYEA 5I0TA 2W1WA 2W95A 3KHBA 5A3WA 3WR0A 3JBG1 1GNYA 1YUDA 4LOSA 2HWF1 5JSRA 1V9U3 2IXIA 5FZLA 1DFQA 2O1QA 4QDSA 1AXZA 2WZR1 1QJX3 3EBRA 2VNGA 2R041 3H1WA 5KBFA 3WDVA 5CFCB 3O0XA 5FP4A 4NOTA 2WYSA 2BW8A 5FMDA 4B8EA 3O0WA 2ZACA 4IETA 3VD5A 1UQXA 5FY8A 4UFLA 5EFUA 5LBFA 4UW3A 1PMIA 4C0HA 3C7HA 1AVBA 2WC2A 3FUOA 3KQRA 3VL8A 1W9SA 1S0GA 3ALQA 4DUVA 5C5TA 3OGGA 5F2WA 4B4QA 1F4HA 1HXS3 5G05L 4M00A 2QBXA 1COV3 4QX7A 1V6KA 3E1F1 2FCVA 3VZOA 4LUKA 1QQP1 2MPFA 4QMAA 2FCTA 3RYKA 2VUDA 4IEYA 5JI9A 2MEV2 2VZRA 1BHGA 2DYCA 4I3GA 2VVEA 3B3QE 3WDWA 1AYN3 2ADDA 4RS5A 5FO7B 2YV8A 4Y33A 2V4VA 1HIXA 3ATGA 2WA4A 4M0NA 4E27A 4ES9A 5JXGA 1GNZA 2OX0A 4FBFA 2C26A 4OI2A 4CP9A 4E2SA 1US2A 2XWJB 4LE3A 4FO9A 1DU3D 4FPFA 3ZKUA 3I59B 1MQTB 4GULA 3BB6A 1BEV2 4LO5B 1MZ6A 4AGGA 5JOXA 1OLQA 1U5XA 3AP4A 3B9CA 3GBFA 2HWE2 3OGSA 4PF5A 5E16A 4NIAA 5CIRA 3G7DA 1HB3A 2XHNA 1W28A 1H2LA 1NKGA 4JTNA 2DBIA 4A42A 3O12A 1YRZA 4QDRA 4FTEA 3QACA 4YVWC 1CJDA 1LGCA 3PUSA 4RQPA 4DB5A 2VECA 4ZXEA 3VLBB 5HCFA 5JPNB 4UW6A 1ND3C 4LUMA 2A70A 2A6VA 3JB8A 2CSGA 1WLWA 3I97A 4COVA 3KGLA 2QKDA 2WKKA 3V0AB 2BNOA 2EXIA 2XLFA 4GIQA 3OBZA 5FYZA 4BK5A 2CU5A 1RUI2 5C9AB 2WNUC 1Y9MA 3M3QA 3VBUA 2JE9A 1QJY1 4LNVA 4K1YA 1HRV1 3KCXA 3J7LA 4OQ8A 1W8OA 5FZ0A 1YO8A 3MICA 5E88A 2RJ2A 4K1ZA 4OUSA 2QQPA 2WQ4A 1CWPA 1J83A 5I0SA 1F35A 4UFJA 1NXMA 2DVFA 2VU9A 3EMRA 3ITQA 2A5ZA 2FQPA 2QQLA 4GXLA 3D5OA 5CZKA 5A80A 3K77A 3O5SA 1EYBA 5GLZA 5LEKA 2BOIA 1JW6A 4KWUA 2PLV1 3AZYA 4HL0A 2VMGA 2A3YA 5HCHA 4IL7A 2W87A 4H7LA 4M01A 3VDDA 5J36A 3DPRC 1CAWB 3LB9A 1RUH3 4XUPA 2QQMA 4OULA 5A3OA 3ZXJA 2K9ZA 1KRIA 3BOWA 2W1QA 4M3CE 1E5HA 1VBE3 2ID4A 3OJBA 3ZFGA 5EZWA 5FFOC 3H7JA 4FPJA 5FYSA 2RDSA 4NE9A 4KU7A 2VM9A 4JDMA 4URTA 2VQ0A 3ZSLA 2IXHA 4Y5Z0 4GWJA 4BU2A 3MHZA 2QTWB 5T3NA 3P6BA 4XE9A 4Y1YA 5C3SA 2OA2A 4WM8B 4HANA 2F6BA 1UX7A 3NJZA 2C1FA 3J7HA 1SFPA 2XL9A 1F5FA 1V00A 1XRUA 2VQUA 3J8F3 2J7MA 2R072 3LDBA 5FQ0B 2UU8A 5FZEA 4XFAA 2ZMNA 5T55A 4CDUC 3WF3A 2JD9A 2YC2A 2ZEZA 2XGXA 3DL3A 5FY7A 3L2YA 2PHFA 3TNQA 5HBAA 2VUAA 4N43A 4Y22A 4LO6B 2YU1A 1EAH3 5JZGB 1JUHA 2MEV1 4H7MA 4MUVA 3BIEA 3R4SA 3GM8A 1FOD2 1WGPA 1HQNA 4A41A 2J1UA 3UT0A 2QQJA 1AR62 1BXHA 2UY8A 2ZBJA 3WP6A 2KR2A 2O0OA 4QXHA 3NNLA 2ARAA 5A6QA 1OA2A 1VAKA 1POV1 1ZM1A 3TAYA 1RUE3 5CBLA 3USUA 2E32A 5FREA 5I0UA 4AHWA 2X10A 1EUTA 1C4RA 4I01A 3SKVA 1BEV1 3MYXA 3ACHA 4XQWA 3H1MA 1O4ZA 2Z4FA 3OPZA 3BI3A 1W9YA 4YGBA 3NKTA 5IVJA 4CP2A 1UIJA 2DCZA 1SMVA 2YPDA 4FPHA 4R4ZA 5IK5A 1NG0A 3FBYA 4J1XA 2Q5TA 1EY2A 1X82A 3H3LA 4GQ7A 2P6CA 4JHZA 4P5YA 1C1FA 4NRMA 4ASMB 5A3PA 5JR7B 2PHDA 3BTAA 5L7OA 4MSVA 3PVBB 3T30A 2QDNA 4F3JA 5DG1A 1FI2A 4LK6A 2D44A 2VZQA 3AYCA 4M4PA 2E26A 2W1UA 5FQ0A 4LO4B 2A1XA 5DQ0A 2JWPA 3PTRB 4YGEA 3RMXA 1C5IA 1GV9A 5A33A 5DXDA 5EXOA 3Q8FA 4GWIA 2ZGQA 3WINE 4DRVA 1X9TA 5LBCA 5LBEA 5J3UA 2VOWA 2FBEA 1RUI1 4XTPA 4W8JA 4JKMA 3CDZB 1RUG3 4CUGA 4K40A 2XJRA 5FJKA 4JVAA 1C8M3 4PBPA 1ZZ9A 2RS52 1JBCA 3VZLA 5CG8A 1XNDA 2EVXA 4DQAA 5E8AA 2XH6A 1VRH3 4DZGA 5C3QA 4AQTA 5HV0A 2NN8A 5EP9A 1PIV2 1DGWX 2D6LX 4YM0A 4Y1VA 3WLUA 1IG3A 5DPNA 3WP5A 2CDPA 3IAQA 4GH4B 1IPJA 2QQIA 1CAVB 1YQ5A 4ISQA 5FWJA 1BCXA 4IE5A 4HLTA 1VB2A 1UO9A 1TZOA 1OVSA 3WNOA 1CR7A 4A4AA 4AI0A 4AI9A 1FPN3 4Y20A 2X5IA 3VKNA 4FPCA 4G4FA 2RHPA 5FO8B 4UFKA 1VAMA 3B93A 3I3BA 4D6QA 2VOVA 4RR3B 3WDYA 4BM8A 5BNPB 1JOPA 2A6ZA 1H4GA 3O1MA 3O0VA 1LU2A 1BBT3 1XYOA 3FLRA 2LROA 5JXIA 4TN7A 5FZKA 5KR7A 4FTSA 2KA3A 1NE4A 4HFSA 2HLEA 2O14A 4NHYA 3ELNA 1OQEA 3JU9A 4J1WA 4R8HA 1VMJA 4CU7A 2Q0AA 5ACA2 3VHRA 1KD7A 2HWB3 4EN8B 2IXCA 2VNVA 2WFPA 5IVEA 3ZFEB 1D4M2 2YYOA 1A8DA 3IIAA 4M3CA 3AZWA 1PM7A 2Y8KA 1K12A 3NNFA 5DAWA 3ZXLA 4E9KA 4OI0A 1W8UA 3ZM8A 4I09A 4N53C 5C3PA 1RUH1 2XQXA 1W39A 4QPGB 2VTFA 5LWBA 1LENA 4MGZE 4QX5A 1VBE1 4FQZA 5A32B 1UZYA 1WLCA 4XJAA 4D6SA 1DGWA 4F83A 2QCSB 3ZSJA 3AP6A 4LBKA 2W92A 4AEDA 1FOD1 2ATFA 2VW2A 3MF6A 3DGTA 4IXLA 1AR61 4Y3OA 4NIIA 3WW1A 4O61A 3VBRC 1AL0G 1GZWB 3MIGA 3A7QA 1B35A 5L19A 1WD4A 1MEC3 4LE4A 5BNOC 5A1AA 5LW9A 1UYYA 1GP5A 2EF6A 3GZAA 5F32A 1H8TB 1REDA 3ZDVA 3AVRA 2QFEA 4H3WA 3ZYHA 2QQOA 3LSEA 4IV3C 4Y5TA 4RYDA 4GWNA 1UZ0A 4JGYC 4AL9A 4LMFA 2IWGB 1UL9A 4EN9B 3O1VA 2DWRA 3MV11 2WNVC 1EAH1 3NAPC 3WDXA 3NV3A 2MHFA 2E7TA 4DO0A 5J48A 5FZ8A 5L36A 1JU3A 3BU0A 3C3VA 1W6MB 2C5DA 3WHTA 2QJVA 2BVBA 2V72A 4X6RB 2RMU2 1UXXX 4PJYA 4QD2A 2JG9C 5FUPA 1K5MC 1RUE1 3USSA 3ILNA 4QKNA 4U36A 2Z2SB 4K3UA 4N7IA 3ZYJB 1WW7A 3LQCA 1UN1A 3KS7A 3AP9A 3KHCA 4BQWA 1RYYA 3CLPA 5CFCA 4YW5A 2Z79A 2RS51 4IEVA 5FTTC 3JB4C 3ZX7A 1Q8SA 4IUGA 4FTBA 5D8AB 5EHDA 1C1LA 2GMEA 3A4UA 4F8AA 1K42A 5BNNB 4RFRB 2W3JA 1HRI2 4Z2WA 2A3XA 1PIV1 3MLJA 4Q4V3 4BK4A 5FMCA 4IERA 3ZYFA 2HWD2 5GM0A 4WVMB 4UI9L 2RM23 5AVPA 1EPWA 2OYZA 4DEVA 2VOXA 5L9BA 1ZZCA 1MS3A 3QOPA 1ULEA 3PHMA 2YG0A 3NV4A 1KEXA 3LPFA 4JKLA 3X29B 4BQYA 3AVSA 1PK6B 4H55A 4PI0A 2DVAA 2DURA 2Y0OA 2ARBA 4UW4A 4WM7B 3KZ4C 3KF3A 2VTXA 1UX6A 1XE7A 2WSVA 1ZA4A 3JZVA 5FLIA 3IAPA 4J25A 3ZXEA 2JE8A 3KT4A 5FP9A 5J09A 5C8CB 1KDMA 3LKJA 3V56A 2FDGA 5F3EA 2FZ2A 2YBSA 5FXVA 1GWLA 3N9OA 1NLSA 3I59A 1MQTA 1WCKA 3Q8EA 5ACA1 5T5OA 4QWNA 4P00B 4HONA 1QOSA 1XXNA 5FP8A 4AGVA 4AVAA 1DBNA 4CDWB 3NQHA 3C7GA 2XVLA 4OMDA 3S0MA 1OPOA 2Y6KA 3T4HB 4LBLA 2ZMKA 3ZFFB 5KHKA 2GAUA 2LTNA 5E89A 3WF2A 1EV12 4E4ZA 3IB3A 4OZOA 4DIQA 1JZ7A 1OHFA 2C9AA 2Q4SA 2W2IA 4FCAA 4EYUA 3H8OA 4IDZA 1S2EA 1XNKA 2TEPA 2Y6GA 3I2HA 4BPZA 2ZGTA 4YW7A 2QQUA 3WXPA 2A7AA 3ZYRA 2DDUA 4H2AA 4UBHA 1RIRA 3V0AA 1VBB2 1EPZA 1WMFA 2R062 3WNNA 5C9AA 4BISA 1YNAA 3BVCA 3ZIXA 1UU6A 4A6SA 3HNMA 3LE0A 2JDAA 2PAMA 4AW7A 2LW8A 5F6KA 3ILFA 3NJVA 2KM2A 2DUPA 4CCLA 4KBZA 4QGNA 4OHVA 3MW2A 1G9DA 1PO22 1DHKB 5IATA 1H6XA 2VCAA 2UYBA 4LBOA 1IKPA 4YVSB 1O5LA 3PJYA 1GOHA 2W39A 3RZLA 3RZHA 5DMYA 4YZ3A 3TEWA 4L92A 2RMU1 3DEMA 4GJZA 2W47A 2EA7A 1CESA 3ZXKA 2D6NA 1O3TA 1CAWA 1BJQA 4B7EA 1TNFA 3S5QA 4A3XA 1SFYA 2JEMA 1DDLA 4IGOA 1OXCA 4B4RA 2VTXJ 4KNCA 1U12A 3M4FA 1NYWA 5KWRA 4OHWA 3M1HA 1ZRDA 1T6BX 1KGYA 1J59A 2HH9A 5FY5A 3ZPOA 3MGUA 3E5XA 5FP7A 3LDKA 3AZVA 4BB3A 3MBWA 4WM8A 3AL6A 5FJHA 2PHWA 1GANA 4QX2A 4YPJA 1GOFA 1HRI1 2CL2A 1OKOA 3O7OA 5JLVA 2JDMA 1S2BA 2HBUA 3APBA 1W06A 2D93A 1TE1B 4Y5SA 1MS1A 4Q0QA 4KG0A 1QXRA 5FBZA 1OLME 3E6BA 4XCBA 3EXUA 4XHXA 1YXWA 2Q8OA 5T5JA 4XMIA 2Y64A 4AYUA 1IZ3A 2K46A 1CGPA 4D8MA 3CBNA 4A7ZA 2XR4A 2JE7A 2WBKA 2XKPA 3I2OA 3VKMA 2LALA 1ZZ8A 5EQUA 3RI8A 1AR82 2ETEA 3ZYIB 3FFZA 5JZGA 3IT8A 4BDVB 4XDPA 4CRQA 2VZVA 3H8UA 2P5BA 4DY3A 3W20A 1NAEA 4HOOA 1G9CA 2XMLA 4AAXA 4DNYA 2R6QA 3ZXGA 1MPXA 3CNAA 3NV1A 2PHXA 4L97A 2JX9A 1ZBE3 3FLTA 3CQOA 3R4DB 4IEOA 4UFMA 2XBO3 4WZFA 3VHOA 4YVWB 2I07B 2BYVE 4LT5A 1G8WA 3N3HA 1ND3B 1RUOA 3JBG3 3POWA 3T2PA 5K7PA 3I2KA 3DECA 2VZSA 2WS92 4QX3A 4CTEA 4UBGA 3TEXA 2CWSA 5IYYA 3PUQA 4LBJA 3RNSA 3AMMA 1OPMA 2R043 5FZ7A 3SC7X 2W94A 3MPPG 2WNUB 1EV11 2P37A 1UMIA 4XFCA 4S2GA 2R30A 3H3UA 3KD4A 5FY1A 3OPTA 1H8VA 1BKZA 5I0RA 2XL7A 1VMHA 4EROA 1T2XA 4NAOA 5A6YA 5AC93 2XJPA 4NR1A 4QPWA 1N3OA 2EAAA 2GC1A 3OYWB 3PMEA 3WNPA 3HN1A 2WWSA 3M3IA 1C28A 1U0AA 1VBB1 1UNBA 5FO9B 1W2OA 5KXDA 2R061 3N9NA 1ZVFA 1JZ2A 3AYDA 1QWRA 1VE0A 1PO12 1IPSA 1RJ7A 1Z7S2 2ORXA 1LOGA 5C8WA 3BTYA 4QB2A 1Y7BA 3DPRB 2JDNA 3AMQA 4A2UA 1W8ZA 5D1IA 4FQ4A 3UV9A 1GQPA 1GZTA 3N36A 4CDXC 5FYHA 1RMU2 1MS9A 2ZGPA 4PT6A 5FLJA 2SLIA 2VNRA 3CMGA 4V2VA 3UKNA 4GH4A 5GLUA 5F9TA 1CAVA 2XJUA 1CX4A 3ASIA 4MV2A 2WJSA 1TG7A 5D21A 4ARYA 4XXAA 1G9BA 5CYYA 3KCCA 4GB33 3WW4A 3ZDSA 1LOCA 4XXPA 2B9VA 4IQPA 5DAXA 1AR73 3AMPA 4XF3A 1NZCA 3WDTA 1VBC2 4HK8A 1US3A 2BTVC 3RVHA 4RR3A 3WF4A 1S2KA 1SLCA 1H9PA 3A0KA 3KLSA 4XFGA 2A75A 3EO6A 5BNPA 1NA1C 5FPXA 1NCRC 4MOAA 4X8NA 4LO7A 1ZBA2 3I3EA 1LOAA 3HQUA 2QQVA 3VDCA 2TNFA 2VOKA 4PBOA 2DCKA 5FXXA 3HT2A 1FNYA 3OBRA 3U78A 2R16A 1OMIA 2WT2A 1EUUA 4L0PA 1A78A 3JCIA 1NZIA 4UXAA 5JPMB 3ZFEA 3NNGA 4QKFA 1K3IA 1QKQA 3LOIA 5FYTA 3EB7A 3GCXA 3VGIA 5FMOS 3LEGA 1AYM2 1BK0A 2FDJA 2OXBA 3UKTA 4XETA 2AUYA 2VJXA 4QPGA 4XF1A 1PZ9A 3U1XA 4DS0A 2YROA 1QJY3 1JYTA 1DGRN 3AMNA 3D0SA 3ZSMA 2DVDA 5A32A 1DZQA 1UKRA 2YFUA 3MFCA 2IXJA 4UF0B 3ZXDA 4B3NA 4XAAA 3O1UA 1YQ8A 1FXZA 2BEOA 1RHI2 3QH6A 4S2DA 2P3YA 1YIFA 3NNJA 1W2AX 3MUZ1 4NUBA 2JG8B 5B2GB 2H0VA 5FYBA 1OLMA 1ZA7A 2VR4A 4V1PA 2JB8A 1GZWA 2EXHA 1JZ6A 2E33A 2PLV3 1YQCA 3BPZA 1Q56A 1QOTA 1Y9GA 2DF7A 2HWC2 2OQ7A 3QH7A 4HK9A 5EPAA 4CVUA 3AKSA 5E1RA 1DGLA 1H8TA 4RD7A 4INDA 3VBSB 2G19A 1CVNA 5IVCA 2VO5A 4FPLA 1F5JA 2KD7A 3INAA 4OUEA 4CP0A 3UJQA 3BUCA 2WS91 2WWJA 5KHJA 4LHNA 1JI6A 2VZ3A 4KI5M 1DZTA 2OS2A 4HN1A 3ZVXA 5IJRA 1CD3G 1OQDA 2Y0IA 2CDOA 3WHUA 2Y6JA 3K2OA 2EALA 2D3SA 5EJ1B 2WYFA 4AFDA 5KHGA 1W6MA 4EWEA 5J37A 2PN5A 3D82A 3NV2A 2C24A 2D98A 3FC0A 4PQ9A 3WV6A 5ABJC 1T6GC 5FYMA 4OVEA 2CGOA 4W6YA 4XJUA 3I49A 1I6XA 2V73A 2Y26A 1YJLA 3VD3A 4FAHA 1HV0A 2C6SA 1DQ0A 1CQ9A 3TN92 3U4XA 1V70A 4E4DX 4FVVA 1PGW2 3GHNA 3ZN4A 1W9TA 4DUXA 1PO11 1CIWA 2K0GA 3ACGA 1GQHA 5FY0A 1MACA 2G4IA 1LESA 1HJFA 1XNTA 2MEV3 3OUHA 4JKKA 4LTAA 2A6XA 3AKPA 5D8AA 5BNNA 4GMP1 1PX3A 3O1OA 4NHKA 1RMU1 4NWVA 4XVHA 3TRSB 3AKTA 4UOJA 5AC91 4WVMA 1A34A 1SFNA 5LZ6A 1POV3 2G9GA 4JQRA 3PIGA 1IOAA 4LOTA 4RGGA 3BU7A 1PMJX 1LOFA 4HVOA 1R092 4QX8A 5LB6A 1RXFA 3CEWA 1BEV3 1MS8A 1BVP1 3WSOA 2HWE3 4XDOA 4ZS2A 3UESA 1RUC2 1PK6A 3M3EA 2VW0A 4FFHA 4G3YC 2BGOA 1CAUB 2GNMA 1VBC1 3U11A 4WM7A 3B7MA 2BQPA 4JZRA 1HN0A 4N53B 1CX1A 3WVJA 1WW6A 1OH4A 1V6NA 4Q4Y2 1WCSA 4MLOA 3ES1A 5C4WC 5FYCA 3THPA 1ZBA1 5C8CA 1WA6X 2JDYA 4FXGB 1JUIA 1VR3A 2RS32 5F3CA 5AFEA 1XQNA 4AHXA 4CCDA 4ZY9A 2J1EA 2E53A 4CDWA 2EICA 1QOOA 3I2GA 4GB31 2ENRA 4XOGA 3VBRB 1AYM1 3ZFFA 1RUI3 2GMMA 3JQXA 5CAZA 3BCWA 3S7IA 2H6BA 1AR71 1AJOA 4B29A 1YQ2A 3POYA 5BNOB 4BZ4A 3LPGA 1UD1A 3NWKA 2AH2A 1LCLA 2V5DA 3S7EA 3WNMA 4IV3B 1L7RA 2X8KA 4NRPA 4YG3A 1GU3A 1I5ZA 1GZCA 2QUOA 1JHNA 1K5JA 1RHI1 1WUVA 2B46X 3RFRA 3T2TA 3QD6A 4JGYB 2NPIA 2ZAHA 3AYAA 4IE7A 1PM4A 5FZIA 2OPWA 5GLWA 5IK8A 2WNVB 4YW2A 4OCTA 2Z42A 1MVQA 1H0BA 2X09A 3NAPB 1N47A 1UY4A 4R4XA 5FUIA 4CCKA 5ISLA 1AXYA 2WN3A 2CNAA 1NQJA 2ZX0A 4XURA 2HWC1 1AX2A 1GP6A 4CUCA 5DG2A 3OTFA 2DUQA 2DFCA 3ZO0B 4QQHA 3IDAA 4JDNA 4K8FA 4GKYA 1D0HA 1TMF2 1K5MB 1OD3A 3GJBA 4FPOB 5A7SA 4CP1A 1PZ8A 4ES8A 5CKNA 4OLLA 1D7PM 3AP5A 2J1VA 2E6VA 1R082 5A6ZA 4AZZA 5LK7B 1BMV1 1U5IA 1NLQA 2WUHA 5D2AA 2B42B 5KHHA 4YVSA 3ZPYA 3HOBA 3AKQA 3LFIA 4BHPA 2GNTA 1N3PA 5FZDA 5GZCA 1UOBA 3N7LA 3UETA 4XFIA 2UY9A 4XUOA 5FKBA 5CEHA 2ZX1A 2R073 4CPBA 1RB8G 1W05A 2PAEA 5F1RA 5FZMA 4LQRA 5I8TA 1GYKA 1YCIA 1UWWA 4OHXA 3VKOA 5KXBA 2JB4A 1W2UA 1W8WA 1DQ4A 4KQ7A 2FDHA 2EIBA 3ZSEA 1BVVA 3AFGA 2GMPA 4PDWC 4LJHA 5C5UA 5IVYA 4XDQA 1FOD3 4CXXA 3K4ZA 1AR63 3PIJA 1YFYA 1OOPC 4AOCA 1LULA 5H9QA 3HQRA 3HVDA 4MO3M 1BLZA 1XU2A 3K51A 5F3GA 3WQ7A 3VD7A 4C8DA 3POGA 5B4NA 1REEA 1S0BA 2MNGA 3PUHA 3OY8B 1R091 1QIQA 2BU9A 3FUQA 1KITA 3O1TA 4BIOA 2WO3A 1ULGA 4IW3A 3VHNA 1K45A 1RUC1 1ZRIA 3ACLA 4MG2A 2V4AA 4HKWA 3LCPA 4EE2A 4COWA 2WDBA 4EZHA 4XACA 5FPZA 4F7ZA 3JUUA 1JOBA 3DYMA 4JCKA 1H2KA 4Q4Y1 5IUQA 3VZMA 5F6LB 4JC1A 5A7WB 3MIEA 3O1RA 3E6DA 1F31A 2FHRA 4ZXKA 5BUVA 4YVWA 1Q5OA 2RJLA 4YW4A 1JZ5A 2VMHA 5FK7A 1J1LA 1G9FA 4YW1A 1ND3A 2X5IC 1OUXA 3ACFA 1FV3A 4Q27A 4QDQA 4XF4A 4BQ3A 3R0RA 4Z92B 1PHMA 2IFWA 4PHZA 2JXAA 1W8HA 2V5YA 5CVRA 2HWE1 4LBQB 3U4SA 1NUKA 1VBD2 4C91A 5A3LA 3RI9A 4DY5A 3HEIA 2WNUA 3K4AA 2YY1A 4L11A 2RS53 5ERLA 2ZHNA 4QX0A 5GLTA 2QZ2A 5IT6A 5FMOL 1OQ1A 3VBHC 3VDAA 1PIV3 1YC61 1DZRA 2ZZQA 4YM3A 3OYWA 1IGOA 2LM3A 1UU4A 1AL22 3S57A 2D43A 3RJ2X 1JHJA 4EZ4A 3CIHA 2BOJA 2D6KA 4K7JA 1PX4A 5HXMA 1KFXL 2WNOA 4ZZ8A 3DPRA 4RFT0 3HT1A 5I0DA 2JDZA 3KGZA 1TMF1 2AGSA 1Z78A 3T2OA 3FHQA 2GZWA 4AEDC 1GMMA 4K9SA 1CAXB 4FT8A 1NCQC 2VCCA 3PMSA 3VKFC 3FLPA 4E8DA 2JDKA 2QQKA 4JDOA 5BNQA 1O4YA 4LPLA 1LOBA 3W5NA 1O3QA 2Y38A 2UWBA 2F4LA 4EJRA 1O3SA 5ACA3 2ES3A 1RUF2 3V0BB 1RUJ2 1VJ2A 3POFA 1D4M3 1WCDJ 2IVJA 2QNKA 2RJKA 4DXRA 2XJQA 1ODNA 2JIGA 5J98B 4BQ2A 1R1A2 2OVUA 1UPIA 4IGQA 4UYBA 1DIWA 4E2QA 3ABZA 2TUNA 3GYDA 5LA9A 3A0NA 5APAA 3DCQA 4CYDA 4CXWA 2VZOA 3GHMA 4O9EA 3TEYA 3AFKA 2R32A 1HN1A 4LHKA 4P02B 4IE0A 3V65A 1W6NB 1W6PB 2AYHA 1XE8A 1WA4A 3KB5A 1H4HA 3NJXA 2BWCA 3NRUA 5JIAA 2VMCA 1LRHA 2ZGSA 3FBMA 3PVOA 5A7PA 1O8SA 1X36A 4NHLA 3T4VA 2WFF2 5LASA 4YFZA 2GALA 1YIPA 2RV9A 2ZGMA 5FZAA 5ANNA 2R7EB 2R071 2VG9A 5FYVA 2W1SA 4P9YA 5CFCC 4ZKTB 1QJFA 4DFSA 4HVQA 4UF0A 2B45X 4FOWA 3CO2A 3WUCA 5HV4A 2DV9A 4LHSA 1O8PA 3K4DA 1OI6A 1PVC2 2VC9A 4L2NA 5FLHA 3M70A 1VAVA 1E5IA 4LEJA 3ZR5A 3T0DA 1GLHA 3NVCA 1UOJA 3H8XA 1OURA 1B09A 3B01A 1QJU2 4IE6A 3IWZA 2JG8A 4ARXA 3UGGA 4I0WB 4DUWA 3BPSA 3RMYA 1GSLA 4FSJA 3NNMA 4OI1A 2Q30A 1Q43A 3GF6A 2RMU3 3Q8AA 5GJ6A 2R49A 3VBSA 1W9WA 1CONA 5K9YA 1W8TA 2RR12 2EIGA 1NX9A 2WIIB 3OUIA 4XABA 1GWMA 2IXKA 2P6HA 3POJA 2AACA 4P08A 4N8MA 3LFMA 4QPYA 1VBD1 3MW3A 3SLIA 4Q4X2 1VPHA 2GN3A 5HI0A 2XXZA 4NPMA 1YI7A 1R1ZA 3EQEA 3HWJA 3MV01 4R9AA 3GXUA 2XPJA 1HRI3 1G9AA 2XUMA 3DKQA 4CDXB 1R64A 1SLAA 3B69A 5JMOA 4LA2A 1VRBA 2HWD3 1W8FA 3TWIA 3I54A 3MO4A 3TBDA 1J3QA 1GFF2 3MIBA 2Q1MA 3FWEA 1O6UA 2EIDA 2B5HA 1N1VA 3SHRA 1FX5A 1F4AA 1O7FA 1D2SA 2WL1A 3PUIA 4RHV2 5FY4A 1QY4A 3FMGA 2VULA 1QGLA 2Y33A 5KXCA 4BLJA 3I7DA 1QU0A 1JYCA 3SITA 3D6EA 3K3OA 4E4HA 3LD8A 1OSGA 3M8LA 1ND2C 4FI9A 1OLRA 2PTMA 2ZX3A 1Q3EA 5DDJ2 4KG8A 2J1TA 1MZEA 5A70A 3P5BA 1NCRB 2ET1A 3P3NA 4ITCA 3L2HA 1SZBA 3GNEA 3GBWA 3WOGA 2YPJA 3UNPA 2UWCA 4CUBA 1XNAA 2YDEA 3KMHA 3WF1A 5C71A 1RUF1 4XHBA 3UJOA 3R6SA 1MS4A 4E8CA 1CAUA 5J1XA 2FD8A 1R1A1 1HQWA 3C8XA 3KM5A 4Q1RA 4N53A 5DUXA 4KGGA 1N1SA 3WEZA 3WW2A 1EV13 4IV1C 1JYNA 1ASJ2 3RZKA 3TYJA 2CV6A 2ZX2A 4C1XA 1D4VB 2ET7A 4A3ZA 3RDIA 4AVTA 1MVEA 4Q0PA 4N9IA 3H3ZA 1LODA 4BMBA 2AENA 2X29A 4I02A 5LRSA 1SHWB 1ST8A 1LTEA 3UL2A 3HR9A 4XUQA 4TXWA 3M3CA 3OD4A 3SCFA 1VBB3 3WNLA 4AR2A 3VBRA 3RZGA 4BJ0A 4JHTA 4KH9A 1VB4A 2R063 3THDA 3VBFC 4BCUA 4BIFA 1D4M1 4WVVA 2D7FA 4LXLA 5BNOA 5JAXA 1ENXA 1RITA 1GNHA 2IZWA 2J1AA 1A8MA 1UZVA 3E5UA 2WLQA 4IV3A 4COYA 3HJRA 4NRQA 1PVC1 4WZCA 5DZEA 1KXGA 1DYOA 4Q8LA 5E6HA 1CZSA 2K2SA 3SMHA 4ORFA 4CEYC 2ZEYA 5M0TA 3LGRA 3FHIB 1QMJA 3AMHA 1PO23 4JGYA 4OUMA 4QT6A 5FWEA 5CA6A 1QJU1 2WNVA 4JGZC 3NAPA 4AI2A 5JR2A 5FOBB 1D0GA 3T0AA 3RJRA 2XUEA 4S2HA 4J6GA 2D40A 1N1YA 3NL1A 4GWMA 1JZ4A 2NM1A 2WAOA 4NMIA 1F9KA 2ZJCA 5ABJB 1H2NA 1N1TA 1KDKA 1OUSA 1TNRA 1K5MA 2HEVF 2RR11 5LA2A 1YQ6A 4PLMA 3ROUA 3UKVA 3K48A 4XF0A 2BBAA 4WV8A 1OA3A 4AI1A 1QJEA 1IS5A 4Q4X1 4XBQA 4YM1A 4MGSA 3E6CC 4AQSA 2GH8A 3DKWA 1W2TA 1WKYA 1DGRA 5FPLA 4BA6A 5SV8A 3NSTA 3ECQA 3VD9A 5H9PA 2IVIB 1YJKA 3AZZA 1F15A 4FP2A 4IEQA 4EV0A 4LITA 3VBOC 3WNXA 1OBNA 4QPIC 2TBVA 3U07A 3D0JA 1GQGA 3U0ZA 1E5RA 4I0BA 4AXOA 4JTOA 3M3OA 2GN7A 1GUIA 1PVXA 4N90A 4EN0A 2Y60A 3RWKX 3OOXA 1VBA2 4TLGA 4RHV1 4U2AA 1AR83 4BMEA 1V6IA 2XVGA 5EJZB 5CNAA 3CHXA 3DUIA 2WSUA 3CJXA 2XKOA 5T5LA 3OGRA 2ARXA 5DDJ1 3AXDA 4Q8KA 2CAVA 4O65A 5ANQA 1AHSA 3O1PA 3KCYA 4PQQA 4OZXA 4ZHNA 1SDWA 5C4WB 3QLQA 4M0HA 4Z82A 1UCXA 4LBMA 1S0EA 2RG4A 3PU3A 1LOEA 2HWD1 3OY8A 4BQ4A 3VHPA 3AZXA 4W50A 4PF1A 5GZGA 4Q26A 1LNSA 2VQAA 2OPKA 2VVDA 2WS93 4ATFA 1QXJA 4WBBA 1SBFA 4B7KA 4EN7B 2BZDA 1IHMA 1S55A 2ZPXA 3CJIC 4K20A 1AZDA 2QQNA 4XAEA 4V2WA 5GLVA 2BNNA 3SH4A 1JN2P 4C0BA 4K8RB 3M7AA 2CWMA 3K46A 1ASJ1 2VZPA 4TZDA 5A7WA 4JAAA 5DAPA 1UOGA 3ZN6B 2VOTA 5LBBA 3BKZA 2ZGRA 4O9GA 3I2JA 3OB8A 1S1AA 2XB6C 5JDBA 3P1IA 4XFFA 4P9LA 5JOZA 5F7UA 1JYVA 5LATA 2ZGUA 4RR3C 3HMYA 4D3WA 4YARA 3BODA 2WO7A 4LBQA 3WG4A 3MDPA 5T5PA 4BQXA 4HSLA 1FMD2 2Q8EA 1IQAA 1ZZBA 3VD4A 1XB9A 1PO13 2ZABA 1Z7S3 4Q4W2 2R1DA 3LAGA 1STMA 1X7NA 3H9AA 4A7KA 4D6RA 4GMP3 1RMU3 1Q8QA 1JOJA 4YSFA 3DXTA 3D8CA 3URFA 2JKXA 2KXLA 3DYPA 3RPQA 4CDQC 1IS6A 3POIA 3WG2A 2QQWA 3RYPA 4MGYE 1C5HA 3HN3A 2DU1A 4RSUA 5A6XA 3S5AA 1JYXA 4LIUA 3RYRA 5I91A 1UKGA 3J7MA 3PUAA 1Q8PA 3ETQA 3PU8A 1VBC3 5FZBA 1URXA 5JOYA 1LKNA 2X05A 1CAXA 2ILMA 4OHYA 3WW3A 4YZ1A 2CTVA 3MUY1 1WD3A 4GZ9A 5C3OA 5DUVA 4RL7A 4GJYA 3RQ0A 4A45A 1ZBA3 1PO21 5CFDC 5I8YA 3BTXA 2DFBA 4QGLA 1ONAA 2XOMA 3GDBA 3BALA 5G04L 1H8TC 2ZHMA 5KC5A 2NQYA 4PDWB 3ZOIA 3V0BA 4XFHA 4L8QA 2WT0A 4OMCA 2HWF2 4EWDA 3ENRA 4MX3A 2BJSA 1RVF2 1CJPA 5FMBA 1OOPB 3SQOA 5K0UC 1AYM3 2JECA 5FXWA 1DF0A 3GALA 3TEZA 1DLCA 5FV3A 4CEWC 2WZR2 4MH0E 3EHKA 2QZ3A 3ZYGA 3I2FA 4FPYA 4XF9A 2HBTA 4CDUB 3IDCB 2AEYA 3PJQA 1HB1A 5BPXA 1TME2 3GGLA 4XW3A 1UXZA 4ASLA 3OSDA 1UY1A 3IBMA 4HPKB 2G9ZA 4NHXA 3WCRA 5BYNA 2P1BA 1RHI3 1W6PA 1W6NA 2VPVA 4WVWA 5AVAA 1OC1A 4KMQA 4Y4RA 5FZFA 3RRDA 1EP0A 3IDEA 2VVFA 4ATEA 2JKBA 1LAJA 1H1AA 4XUNA 1OF4A 4YZ2A 4JV4A 5FCCA 3C7FA 3AP7A 3LSDA 3T2QA 4HN0A 1W0PA 3RS6A 1JYIA 4AEJA 4AVSA 2HWC3 2J1RA 1SPPB 4QGMA 4QQPA 3J4UH 1OVPA 2GNDA 1QQP2 2YHJA 2W52A 1HLCA 4FPEA 1WMDA 4XTMA 5GKAC 5KHIA 4XQDA 1W90A 3PL0A 1L7QA 4URAA 3FJSA 1GICA 4N7UA 4AI3A 4MGTA 3Q8BA 1AR81 3T09A 5HCAA 1UZZA 4RGKA 2HJIA 3HAGA 1A6CA 1ULOA 4Z07A 1OH3A 3H0OA 2WN2A 2QE3A 4Y1XA 3FFQA 1HJGA 2F17A 1C8NA 3BN6A 3MLLA 2ADEA 1SLTA 3VBHB 4YNIA 4QX1A 1ULCA 1QXPA 2B8MA 1H1MA 5DABA 3TNPB 2VMDA 3TN93 4QM8A 2BWAA 2XG3A 1FMD1 4B1MA 1LU1A 3J9SA 1C57A 3MLKA 4RS5C 4FAGA 3T3YA 4C90A 5C8CC 4RGAA 4Q4W1 1OFSA 5F8PA 1RJ8A 2A71A 2VCBA 4QQ2A 5EV7A 2D6PA 1GKBA 1UY3A 4CXYA 3L9JT 1HKDA 4CDXA 3BYWA 3CZUA 2B9UA 4PIYA 5FZ3A 1NCQB 2O8OA 1OF3A 3I3DA 2VD7A 5FXZA 4D94A 3IM0A 4WVZA 3GCWA 3GZTB 4NO4A 4BYYA 5FZGA 5LK5A 3ZFFC 1JYWA 1G86A 3WDUA 3IDBB 2FDKA 1L7LA 1R093 2RS12 2JENA 3IZOA 4XILA 4XJWA 3U75A 1HRV2 4JX0A 3NW4A 4SBVA 4AVBA 1RUC3 1X8EA 2HEWF 1V6OA 1Z7S1 4CE8A 2PA7A 4RQPC 1SLIA 5FZ6A 5C3RA 4Q4Y3 1S0DA 4MXVA 1JS9A 4MGKE 1NCRA 1IQDC 2LUWA 2FDFA 2WO1A 4LLOA 5EYYA 2PMWB 2GNBA 2D6OX 2RS33 4YW6A 1RUD2 1CPNA 1DCSA 3UK9A 3VBUC 5F5CA 4DPNA 2A6WA 1RVF1 1POV0 1YWKA 2VGDA 1H9WA 5LEJA 1AR92 1LEMA 3ZXFA 1ZREA 5T52A 1X50A 4YRDA 1QJZA 4YVSC 2OQ6A 2YZ4A 1FNZA 3PNAA 4AVCA 1IG0A 1TME1 5FZOB 2WABA 5JXJA 5IHRA 1W3VA 3JD72 3KVAA 5C70A 3T0BA 3W9AA 3T08A 1HX6A 3N9MA 2BGPA 3HNBM 3MEPA 4NIHA 2ZXQA 5IAVA 2AZ5A 1SQ4A 1WMXA 5F5QA 3VDDC 4BQ1A 1DYPA 1WBLA 4NPLA 4MXWB 3WT3A 2ARCA 1XSQA 4NWWA 1KS5A 1V9U2 2O8QA 1UW8A 2VBPA 2W08A 1PZ7A 3IMNA 3R4UA 3ZFGC 5KXEA 3GZUC 1WBFA 2VW1A 4IGPA 3KF5A 2LRPA 4HXCA 1S4CA 1QJX2 1NLRA 1TMF3 3WCSA 1BK1A 1E5SA 4QKDA 1ACCA 4XJZA 3I8TA 3E97A 3KV9A 3D4KA 4D0QA 4DXSA 1R083 3U10A 4AQ6A 2GH2A 3OGJA 1W6QB 5GZEA 1Y3TA 2PQSA 2VQTA 5JVVA 3M2MA 1QEXA 4ZU5A 4CU6A 1DG6A 2D97A 3JQWA 4W4ZA 3ZYPA 1Q8OA 2VL4A 3POSA 1ZZ7A 2EXJA 5ABJA 1HXS2 5EYXA 2ZZJA 4FOVA 1COV2 1CZVA 2OZ6A 4XFBA 2E31A 4N43C 2JICA 2JG9B 2D3RA 1I9RA 4NN0A 5A7OA 1FYUA 3WP4A 2R0FA 4QQLA 4YG0A 3FN9A 1LHVA 4N9HA 2ZOEB 1A3KA 1AYN2 4HVRA 4AG4A 3W5MA 4YYOA 4CCCA 3C7OA 2B4KA 1RTVA 2XLGA 3ZN5A 2GP5A 3ZIWA 2HYXA 1V6MA 3ILRA 3LEKA 2Q8DA 2XLAA 5IFPA 1FV2A 2ZEXA 1ND2B 1UZWA 1YYNA 1E57A 1SACA 1AJKA 1CZTA 2YBPA 3MIHA 1WCQA 3GBGA 4P9JA 2RS11 1FATA 4MADA 3RZZA 5A3MA 4ZS3A 5FPBA 5IFTA 1XBFA 1PGL2 3TN91 1PNGA 3MIDA 2R0HA 4YGCA 1DQ1A 1QHDA 1PGW1 2GC3A 5L7OC 3N9QA 5HXVA 4YZ4A 3W58A 3I2DA 1CPMA 2ZKNA 5C6CA 3R05A 1YFXA 5I8SA 2Y6FA 4KWLA 3E5QA 1O4TA 1ZRRA 3H8RA 5CU1A 2PXJA 3DXUA 4IV1B 3WUDA 3AXEA 2N7GA 5C4WA 1TQ5A 4AFCA 1SBEA 1XNBA 3IPVB 4YG6A 1J84A 1BYHA 1X9PA 2WQZC 4KL1A 5L73A 4CU9A 1RUD1 2HKXA 4OFGA 3VZKA 3VZNA 2GC2A 5DUUA 1AXKA 1H6YA 3TB0A 4LK7A 1NE6A 1SLLA 4MGQA 3F2ZA 3CL1A 4CCJA 5FDBA 1AR91 1DQ6A 1VBD3 4Y24A 3AKRA 5FBJA 2P34A 3GJAA 3VBFB 2CAUA 2IC1A 2HEYF 1RXGA 2VUCA 2Q8CA 2DVBA 4LHLA 2EAKA 5JMCA 4UAPA 2CY6A 5FUNA 4HG6B 4LORA 2BGCA 3ZN6A 4HT1T 3N35A 4XZUG 5BY5A 3OCPA 4PI2A 1ENQA 5FZHA 3JD71 2WNEA 4ET7A 3SCGA 1SBDA 1V0AA 1V6LA 2JDPA 4CEYB 2PQQA 2PYTA 1I3HA 1DQ5A 2RS31 3OGVA 4K21A 5IW0A 4JGZB 1QNYA 4LO8A 3WX5A 3QCWA 1AL23 1RUH2 1WLDA 2RDQA 4LKFA 1V9U1 5DAVA 1LECA 1UAIA 1VBE2 1YFWA 2DTWA 2G1MA 2W9XA 4PCRA 5DZFA 3KQ4B 2YBKA 1VP6A 2G9FA 2QDRA 3WZ1A 1AF9A 5EWSA 1QJX1 1VMFA 4AHZA 3B02A 4BQ5A 1X8MA 1UPSA 1ALYA 2C9KA 5AFBA 4A44A 5A3TA 1HB4A 2DCJA 2BERA 2PELA 4R9DA 4P9WA 4PLNA 1SG3A 4NIDA 4DRRA 1W3XA 3N7JA 2VMEA 2YB7A 2ZCWA 2WLPA 2CGNA 3OBAA 3HPNA 4XJ8A 3J8F2 5GZFA 3VV1A 3N4MA 5CADA 1VIWB 5T50A 1HXS1 1PNFA 5BV6A 4M4RA 1RUF3 1COV1 1REFA 1RUJ3 2F4PA 3VKLA 2NYYA 3AM2A 2YMZA 3TOJA 3LA7A 3RWNA 3WQ0A 3VBOB 3G6JB 1HDKA 4TTGA 1JZ3A 1R1A3 4Q29A 4MHUA 4QPIB 3I4IA 1KJRA 4O7XA 1EAH2 2JG8C 4ZONA 3BTZA 5JOWA 3DN7A 4QM9A 2Z69A 1O59A 3Q9OA 2I2SA 2A73B 2ZGNA 4QQOA 4COZA 1AYN1 1R081 1S0FA 4AQ2A 4ISRA 4D7YA 1M06G 4UFHA 1LJ7A 1FAYA 3AL5A 3WP3A 4XJ9A 3VBSC 1B35C 4E2GA 4NAMA 1BZWA 4PDWA 3MI8A 5FZ9A 4IESA 1OKQA 1RUE2 4FOYA 1IPKA 4LKDA 1IKQA 1OOPA 4GKXA 2BP6A 2WFF3 3JXSA 3SKJE 2YXSA 2ZGOA 5I93A 3U14A 2VY0A 1D2QA 4PLOA 3IKWA 4PIZA 4GALA 4CDUA 2I74A 4MZUA 1HB2A 1PGL1 5FKCA 3AYEA 3RG0A 4LIVA 4HPKA 1PVC3 1NY72 3NKGA 4FP3A 2WO2A 3S6PA 2D5FA 3WD5A 1L3JA 2BDRA 2P3JA 3CJIB 3OG2A 4XC9A 1QJU3 3S30A 3LWCA 1YHFA 2W68A 1S0IA 4HZFA 2FZ1A 4OI4A 4I0AA 3AC0A 4CU8A 1SPPA 2VXJA 2XONA 2VMFA 1GP4A 1ULDA 1UYXA 2VXRA 5H9SA 4Q0SA 5GALA 5FK8A 4DEQA 2P3KA 2RR13 1ULFA 5CB7A 1RUG2 2CYFA 2HYKA 1C8M2 1ENSA 4CZSA 1IS4A 2ERFA 1XE0A 4E4SA 3BIWE 4L9BA 5BXXA 5LY1A 3UGFA 4P9XA 1XU1A 3VDBA 4Q4X3 5K4LA 1VRH2 2RDNA 1CN1A 4NPRA 2P2KA 5GZDA 3FZ3A 4CCOA 3D3AA 1W03A 1SCSA 1QH7A 2B7YA 4Y1ZA 1GOGA 3VZJA 2PHTA 2UYAA 2ZS6B 4QXKA 4AHYA 1SCRA 1I5PA 3VBHA 3B5LB 4LBQD 3POEA 1UU5A 2DVGA 2VMIA 4QB6A 4CCNA 3POBA 5FYIA 1G7YA 4R9CA 1FPN2 3THTA 1W0OA 4CDQB 1AX0A 3J7NA 3WY6A 2VAUA 4AFAA 2NLRA 5FZ4A 2ZGKA 1XYPA 4RHV3 4QHOA 5JSOA 3A23A 3KWVA 1JZ8A 4XPVA 4AWDA 2WRAA 1BBT2 4YLZA 3IIIA 2UURA 2XHKA 1N3QA 5DN2A 5FAXA 3ZMNA 5IK4A 2BV4A 1PMHX 5DDJ3 3T1LA 4DXTA 2X53S 1MQTC 1NCQA 1W99A 4LBNA 1OT5A 4NROA 3SEEA 1W6OB 2P3IA 1RL3A 2HWB2 3PDQA 2BNMA 2UWAA 2BFUS 2J1SA 3RGBA 5CFDB 3J8F1 3EJKA 3SH3A 4DINB 2IUWA 2OT7A 3LIHA 4AI8A 4YZ5A 4QXBA 2D3PA 1AL21 1DQ2A 1XJAA 2Z5WA 3IMMA 2Y6HA 4BLIA 2P17A 1AX1A 3VN4A 1NT0A 5K0UB 3MZHA 1G6NA 1H30A 4XBLA 3VL9A 4CEWB 2OUJA 1XNCA 3SCHA 3LA2A 1ASJ3 1QDOA 3O14A 4Y4YA 1NA1B 2QVSB 5A7QA 3ZLIA 5DZGA 4XMAA 2A3WA 2WR9A 3CKHA 1UF2C 2LS6A 5C9AC 2ZHKA 2I45A 3LIGA 3BGAA 1MEC2 2EXKA 3FL7A 4BWOA 5K8SA 3UYJA 5LA1A 4Z8BA 4HETA 1TEIA 2ZKLA 1H1IA 1RUJ1 5HCBA 1Z0HA 1PGSA 4EQVA 3PTYA 1MS0A 2GC0A 2IXLA 4CCMA 1F2NA 3WQ1A 1NQDA 3I3QA 5FZOA 2R1BA 4RA0A 2W91A 3Q8CA 2DU0A 4Q0UA 4LKSA 3LF7A 4BH9A 3HQXA 1NY71 3HNYM 5B4XA 2A6YA 3ZR6A 3A22A 1LB2A 1W9FA 4KGQA 2YGLA 3PVNA 1J3PA 2Q1ZB 3H7YA 4I3PA 2WA3A 4I30A 4QXCA 3OF1A 4AFMA 3OD0A 4MXWA 2W0XA 4QHZA 4R52A 1WWYA 2VZ1A 2GP3A 2GSYA 2WFF1 4LULA 4Q1PA 2E7QA
chains in the Genus database with same CATH topology
2NMNA 3NO8A 3PVEA 3QBQA 4P5HA 4B4PA 1RUNA 4IEXA 4QHBA 2B39A 3C2UA 1RUG1 1C8M1 2XWBB 2E7AA 3BOPA 4YM2A 2ZGLA 3B9IA 4COUA 4YGDA 4WM8C 3AJYA 1W6QA 4PIXA 1VRH1 4X8PA 2V09A 2ZX4A 4Q4V2 4RS5B 4W6XA 2PFWA 4TSVA 1X33A 2RM22 2XVKA 3KSCA 4HKLA 4K6BA 5EJ3A 1U5ZA 2BVVA 3LZZA 1HV1A 4KU8A 1OD5A 5JI7A 2JG9A 5JZGC 1FPN1 4FPKA 1YLLA 4HKOA 1KQRA 2H6CA 1VBA3 2OIIA 2YUEA 4W6WA 1NXD1 4JRLA 1MZFA 4FXKB 4QU2A 1MR5A 1BBT1 3SXWA 4AEMA 2ZAAA 1UMZA 2SBAA 2AREA 4EWAA 4RQPB 3ZMOA 3N7MA 1LHWA 1ND2A 1LGBA 5CG9A 1O91A 2VH9A 1NOVA 1HW5A 1GBGA 2HWB1 3AX4A 2WINB 4AEKA 5JIUA 1C3HA 2XJTA 3FX3A 3KT1A 1YFUA 2JJ6A 3VBUB 1OA4A 2VNOA 2BPA2 3CF6E 2C0ZA 4GA9A 1LGNA 2FMDA 3WG3A 1ZX5A 4C1WA 4IV1A 1DYKA 4TYSA 3IPVA 4NVPA 1WW4A 3H1YA 4KBBA 4XBNA 1LEDA 1MEC1 1SLBA 4EN6B 5JWPA 3VDDB 1JH5A 4DMIA 4ONUA 2E51A 1LHOA 2XJSA 3VBFA 1SEFA 1FMD3 1QDCA 3ZFGB 4Q4W3 1IS3A 4GH4C 4XIKA 1O5UA 1LR5A 4HMZA 3W59A 3MPBA 4CEYA 1KJLA 1F8VA 3ZXAC 1MS5A 4P9IA 4JGZA 4XYXA 3B00A 4MVTA 4ZU4A 4SLIA 1ZNPA 1RINA 2OW4A 1VALA 4I2OA 3DV8A 1S0JA 3ZSKA 3CU7A 5BNPC 4A7YA 2OZJA 1ENRA 3MIFA 4TLFA 4HBNA 2DTYA 4XZPA 3T1MA 2AR6A 4N43B 4Y22B 4AE2A 4KWJA 2PAKA 4LR4A 2OUHA 1H2MA 2XJVA 2IFRA 1J3RA 3AJZA 4Y1UA 1WW5A 4Z1VA 1JTZX 3ZFEC 2VUJA 5KC6A 2WT1A 4Q4V1 4GMP0 1FT9A 4LA3A 4TWTA 1QH6A 3MFAA 2FMYA 4QPGC 3J26N 2RM21 3P3PA 1V6JA 2HWF3 3USUB 3ST7A 1RVF3 3AK0A 1YI9A 3HBZA 3FE5A 1Y9QA 1WMEA 3VBOA 2DCTA 4QPIA 2RE9A 2WZR3 3LA3A 1RC6A 4ZU7A 1LHNA 5H9RA 5FOJB 1QNWA 1TME3 1XYNA 4AGRA 4D7TA 4IEPA 1UIKA 1ZBE2 5LRRA 5L7OB 3LOBA 2YC0A 3B94A 4XIOA 1AUYA 2XBO2 4L99A 5TSWA 3OBTA 3RSJA 3VUOA 3JBG2 1J58A 4Q2FA 2E9QA 3PLQA 5A33B 2ZMLA 4X6QB 4S2FA 4R9BA 1QQP3 2PHRA 2R042 4D7SA 4XQ4A 4D69A 2DCYA 1VBA1 5J7MA 1MZ5A 2BFUL 3CJIA 4AFBA 1O3RA 2BUKA 1ZZ6A 4BOWA 4M3CF 5AC92 5DUWA 4META 4AF9A 1OFNA 3ME2A 1WLTA 1I1EA 2YGMA 4IEUA 4Y26A 2NMOA 1Q8VA 2GU9A 4LLFA 3SISA 4P9GA 1J1TA 2ZHLA 5FRAA 3DF0A 5JSPA 2PHUA 4Y20B 5D8AC 2X5IB 4FOQA 1ZRFA 5BNNC 2ZA9A 3HD8B 4YFWA 1RGSA 1U5YA 1LHUA 4G9SB 5JCTA 1HQLA 2ZTNA 1QF3A 4Q0VA 1LOFC 3SH5A 1M4WA 3AB0A 4GB32 4IEWA 1DLLA 4W65A 2NZ9A 4AVVA 1PK6C 4CDQA 4UW5A 4JRAA 4HSJA 2D5HA 2CGPA 1GZ9A 4M3CB 1AR72 2RS13 3IN9A 4WM7C 1HRV3 1KS4A 4YW3A 3WG1A 2BBVA 3ES4A 2JD4A 5C33A 2D6MA 3KT7A 5T54A 3MF9A 4H14A 3N7KA 1W6OA 4IEZA 4AEDB 4CDWC 1APNA 4OHZA 1ZYBA 2NP0A 2DUOA 4XEZA 5CFDA 1GR3A 2WZPP 4KWKA 5IK7A 3H50A 1RUD3 1Y43B 4FPGA 1B35B 1VLNA 4P14A 1QJY2 5SV5A 1KFUL 1JXNA 1BQPA 5K0UA 1AR93 4MGIE 4CEWA 1BMV2 5J96B 4NHMA 2E63A 4AK3A 1S0CA 4DOUA 4DXZA 1NA1A 3JD73 3MW4A 1ZBE1 3HIFA 1ZRCA 3V64A 2PLV2 2GDFA 2H0BA 2XBO1 2PHLA 4MYEA 5I0TA 3WR0A 3JBG1 1YUDA 2HWF1 5JSRA 1V9U3 2IXIA 1DFQA 2O1QA 1AXZA 2WZR1 1QJX3 3EBRA 2VNGA 2R041 3H1WA 5KBFA 3WDVA 5CFCB 3O0XA 4NOTA 2BW8A 4B8EA 3O0WA 2ZACA 4IETA 5EFUA 4UW3A 1PMIA 4C0HA 1AVBA 2WC2A 3FUOA 3KQRA 3VL8A 1S0GA 3ALQA 3OGGA 4B4QA 1HXS3 4M00A 1COV3 1V6KA 3VZOA 4LUKA 1QQP1 2MPFA 4QMAA 3RYKA 4IEYA 5JI9A 2MEV2 2DYCA 4I3GA 2VVEA 3B3QE 3WDWA 1AYN3 5FO7B 4RS5A 2YV8A 1HIXA 3ATGA 2WA4A 4M0NA 4E27A 4ES9A 1GNZA 4FBFA 4OI2A 4E2SA 2XWJB 4LE3A 4FO9A 1DU3D 4FPFA 3I59B 1MQTB 4GULA 3BB6A 1BEV2 4LO5B 1MZ6A 4AGGA 1OLQA 1U5XA 3AP4A 3B9CA 3GBFA 2HWE2 5E16A 4PF5A 5CIRA 3G7DA 1H2LA 4JTNA 3O12A 1YRZA 4FTEA 3QACA 4YVWC 1LGCA 1CJDA 4RQPA 4DB5A 2VECA 3VLBB 5HCFA 5JPNB 4UW6A 1ND3C 4LUMA 2A70A 2A6VA 3JB8A 1WLWA 4COVA 3KGLA 2QKDA 2WKKA 3V0AB 2BNOA 2EXIA 2XLFA 4GIQA 1RUI2 5C9AB 2WNUC 3M3QA 3VBUA 2JE9A 1QJY1 4LNVA 4K1YA 1HRV1 3KCXA 1YO8A 3MICA 5E88A 4K1ZA 4OUSA 2QQPA 2WQ4A 5I0SA 1NXMA 2DVFA 2VU9A 2A5ZA 2FQPA 4GXLA 3D5OA 3O5SA 1EYBA 5GLZA 5LEKA 1JW6A 2PLV1 3AZYA 4HL0A 2VMGA 2A3YA 4IL7A 4M01A 4H7LA 3VDDA 5J36A 3DPRC 1CAWB 3LB9A 1RUH3 4OULA 1KRIA 3ZXJA 2K9ZA 3BOWA 4M3CE 1VBE3 3OJBA 3ZFGA 5EZWA 5FFOC 3H7JA 4FPJA 4KU7A 4JDMA 4URTA 2VQ0A 3ZSLA 2IXHA 4Y5Z0 5T3NA 4XE9A 4Y1YA 2OA2A 4WM8B 4HANA 2F6BA 3NJZA 2C1FA 2XL9A 1F5FA 1V00A 1XRUA 3J8F3 2R072 5FQ0B 4CDUC 2UU8A 4XFAA 2ZMNA 5T55A 2XGXA 3DL3A 3L2YA 2PHFA 3TNQA 5HBAA 2VUAA 4N43A 4Y22A 4LO6B 1EAH3 5JZGB 1JUHA 2MEV1 4H7MA 4MUVA 3R4SA 1FOD2 1WGPA 1HQNA 1AR62 1BXHA 2UY8A 2ZBJA 3WP6A 2O0OA 1OA2A 1VAKA 1POV1 1ZM1A 3TAYA 1RUE3 5CBLA 3USUA 4AHWA 5FREA 5I0UA 1C4RA 4I01A 1BEV1 3MYXA 4XQWA 3H1MA 1O4ZA 3OPZA 4YGBA 3NKTA 4CP2A 1UIJA 2DCZA 1SMVA 4FPHA 4R4ZA 5IK5A 1NG0A 3FBYA 4J1XA 2Q5TA 1EY2A 1X82A 4GQ7A 1C1FA 4ASMB 5JR7B 2PHDA 3BTAA 5L7OA 4MSVA 3PVBB 2QDNA 4F3JA 5DG1A 1FI2A 2D44A 3AYCA 5FQ0A 4LO4B 3RMXA 4YGEA 1C5IA 1GV9A 5A33A 5DXDA 5EXOA 2ZGQA 3WINE 4DRVA 5J3UA 2VOWA 2FBEA 1RUI1 4XTPA 1RUG3 4K40A 2XJRA 4JVAA 1C8M3 4PBPA 1ZZ9A 2RS52 1JBCA 3VZLA 5CG8A 1XNDA 2EVXA 4DQAA 5E8AA 2XH6A 1VRH3 4DZGA 4AQTA 2NN8A 1PIV2 1DGWX 2D6LX 4YM0A 4Y1VA 3WLUA 3WP5A 4GH4B 1IPJA 1CAVB 4ISQA 1BCXA 4HLTA 1VB2A 1CR7A 4AI0A 1FPN3 4Y20A 2X5IA 3VKNA 4FPCA 4G4FA 2RHPA 5FO8B 1VAMA 3B93A 2VOVA 4RR3B 4BM8A 5BNPB 2A6ZA 1H4GA 3O0VA 1LU2A 1BBT3 1XYOA 3FLRA 4FTSA 2KA3A 1NE4A 4HFSA 3ELNA 1OQEA 3JU9A 4J1WA 4R8HA 2Q0AA 5ACA2 3VHRA 1KD7A 2HWB3 4EN8B 2IXCA 2WFPA 3ZFEB 1D4M2 2YYOA 1A8DA 3IIAA 4M3CA 3AZWA 1PM7A 3ZXLA 4E9KA 4OI0A 4I09A 4N53C 1RUH1 1W39A 4QPGB 1LENA 4MGZE 4QX5A 1VBE1 4FQZA 5A32B 1UZYA 1WLCA 4XJAA 1DGWA 4F83A 2QCSB 3ZSJA 3AP6A 4LBKA 4AEDA 1FOD1 2ATFA 2VW2A 3MF6A 3DGTA 4IXLA 1AR61 3WW1A 3VBRC 1AL0G 1GZWB 3MIGA 1B35A 5L19A 1WD4A 1MEC3 4LE4A 5BNOC 2EF6A 3GZAA 1H8TB 1REDA 4H3WA 2QFEA 3LSEA 4IV3C 4GWNA 4JGYC 2IWGB 1UL9A 4EN9B 2DWRA 2WNVC 1EAH1 3NAPC 3WDXA 3NV3A 2MHFA 2E7TA 5L36A 3C3VA 1W6MB 2C5DA 3WHTA 2QJVA 2BVBA 4X6RB 2RMU2 4PJYA 4QD2A 2JG9C 1K5MC 1RUE1 3USSA 3ILNA 4U36A 2Z2SB 4K3UA 4N7IA 3ZYJB 1WW7A 1UN1A 3KS7A 3AP9A 3CLPA 5CFCA 4YW5A 2Z79A 2RS51 4IEVA 5FTTC 3JB4C 3ZX7A 1Q8SA 4FTBA 5D8AB 1C1LA 2GMEA 3A4UA 4F8AA 5BNNB 1HRI2 4Z2WA 2A3XA 1PIV1 3MLJA 4Q4V3 4IERA 2HWD2 5GM0A 4WVMB 2RM23 5AVPA 1EPWA 2OYZA 2VOXA 1ZZCA 1MS3A 3QOPA 1ULEA 3PHMA 3NV4A 3X29B 1PK6B 4H55A 2DVAA 2DURA 2Y0OA 2ARBA 4UW4A 4WM7B 3KZ4C 1UX6A 1XE7A 2WSVA 1ZA4A 3JZVA 5FLIA 3ZXEA 3KT4A 5J09A 5C8CB 1KDMA 3LKJA 3V56A 2FZ2A 1NLSA 3I59A 1MQTA 1WCKA 5ACA1 5T5OA 1QOSA 1XXNA 4AGVA 4AVAA 4CDWB 1DBNA 2XVLA 3S0MA 1OPOA 4LBLA 2ZMKA 3ZFFB 5KHKA 2GAUA 2LTNA 5E89A 4E4ZA 1EV12 1OHFA 2C9AA 2Q4SA 4FCAA 1XNKA 2TEPA 4BPZA 2ZGTA 3WXPA 2A7AA 3ZYRA 4UBHA 1RIRA 3V0AA 1VBB2 1EPZA 1WMFA 2R062 5C9AA 1YNAA 3ZIXA 1UU6A 4AW7A 2PAMA 5F6KA 3ILFA 2KM2A 2DUPA 4QGNA 4OHVA 3MW2A 1G9DA 1PO22 1DHKB 4LBOA 2UYBA 1IKPA 4YVSB 1O5LA 3PJYA 2W39A 4YZ3A 4L92A 2RMU1 2EA7A 1CESA 3ZXKA 2D6NA 1O3TA 1CAWA 1BJQA 1TNFA 4A3XA 1SFYA 2JEMA 1DDLA 4B4RA 4KNCA 1U12A 3M4FA 1NYWA 5KWRA 4OHWA 3M1HA 1ZRDA 1J59A 3MGUA 3E5XA 3AZVA 4WM8A 2PHWA 1GANA 1HRI1 2CL2A 3O7OA 5JLVA 3APBA 1S2BA 4B7EA 2D93A 1TE1B 4EJRA 1MS1A 4Q0QA 4KG0A 1QXRA 5FBZA 2Q8OA 3E6BA 3EXUA 4XHXA 1YXWA 4AYUA 5T5JA 4XMIA 1IZ3A 1CGPA 4A7ZA 2JE7A 2XKPA 3VKMA 2LALA 1ZZ8A 3RI8A 3ZYIB 1AR82 2ETEA 3FFZA 5JZGA 3IT8A 4CRQA 3H8UA 4DY3A 1G9CA 4DNYA 2R6QA 3ZXGA 3CNAA 3NV1A 4L97A 2PHXA 2JX9A 1ZBE3 3FLTA 3R4DB 4IEOA 2XBO3 4WZFA 3VHOA 4YVWB 2I07B 2BYVE 4LT5A 1G8WA 3N3HA 1ND3B 1RUOA 3JBG3 3POWA 5K7PA 2WS92 4CTEA 4UBGA 2CWSA 4LBJA 3RNSA 3AMMA 1OPMA 2R043 3MPPG 2WNUB 1EV11 2P37A 4XFCA 4S2GA 2R30A 3H3UA 3KD4A 1H8VA 1BKZA 5I0RA 2XL7A 4EROA 5AC93 2XJPA 4NR1A 1N3OA 2EAAA 2GC1A 3OYWB 3PMEA 3HN1A 2WWSA 3M3IA 1C28A 1U0AA 1VBB1 5FO9B 5KXDA 2R061 1ZVFA 3AYDA 1QWRA 1PO12 1RJ7A 5C8WA 1Z7S2 1LOGA 1Y7BA 3DPRB 3AMQA 4A2UA 5D1IA 4FQ4A 3UV9A 3N36A 4CDXC 1RMU2 1MS9A 2ZGPA 5FLJA 2SLIA 2VNRA 3UKNA 4GH4A 5GLUA 5F9TA 1CAVA 2XJUA 1CX4A 3ASIA 4MV2A 2WJSA 4XXAA 1G9BA 3KCCA 4GB33 3WW4A 3ZDSA 1LOCA 4XXPA 4IQPA 1AR73 3AMPA 4XF3A 1NZCA 3WDTA 1VBC2 4HK8A 2BTVC 4RR3A 1S2KA 1SLCA 1H9PA 3A0KA 3KLSA 4XFGA 2A75A 3EO6A 5BNPA 1NA1C 5FPXA 1NCRC 4X8NA 4LO7A 1ZBA2 1LOAA 2TNFA 2VOKA 4PBOA 2DCKA 3HT2A 1FNYA 3OBRA 2R16A 1OMIA 2WT2A 1A78A 3JCIA 4UXAA 5JPMB 3ZFEA 5JOXA 3VGIA 3LOIA 1QKQA 5FMOS 1AYM2 3UKTA 4XETA 2AUYA 4QPGA 4XF1A 1PZ9A 4DS0A 2YROA 1QJY3 1DGRN 3AMNA 3D0SA 3ZSMA 2DVDA 5A32A 1DZQA 1UKRA 3MFCA 3ZXDA 2IXJA 4B3NA 2BEOA 1FXZA 1RHI2 3QH6A 4S2DA 1YIFA 2JG8B 5B2GB 2H0VA 4V1PA 1GZWA 2EXHA 2PLV3 3BPZA 1Q56A 1QOTA 2DF7A 3QH7A 2HWC2 4HK9A 3AKSA 5E1RA 1DGLA 1H8TA 4RD7A 4INDA 3VBSB 1CVNA 4FPLA 1F5JA 3INAA 4CP0A 3UJQA 2WS91 5KHJA 4LHNA 1DZTA 4HN1A 3ZVXA 1CD3G 1OQDA 2Y0IA 3WHUA 2EALA 2D3SA 4AFDA 5KHGA 5J37A 1W6MA 4EWEA 2PN5A 3D82A 3NV2A 2D98A 3FC0A 4PQ9A 3WV6A 5ABJC 1T6GC 4OVEA 2CGOA 4W6YA 4XJUA 1I6XA 2V73A 2Y26A 1YJLA 4FAHA 1HV0A 1DQ0A 1CQ9A 3TN92 3U4XA 1V70A 4E4DX 4FVVA 1PGW2 3GHNA 3ZN4A 1PO11 1CIWA 2K0GA 1GQHA 1MACA 2G4IA 1LESA 2MEV3 5D8AA 4LTAA 2A6XA 3AKPA 5BNNA 4GMP1 4NHKA 1RMU1 4NWVA 3TRSB 3AKTA 5AC91 4WVMA 1SFNA 1POV3 2G9GA 4JQRA 4RGGA 1IOAA 3SNMA 4BE3A 3BU7A 1LOFA 4HVOA 1R092 3CEWA 1BEV3 1MS8A 1BVP1 2HWE3 1RUC2 1PK6A 3M3EA 2VW0A 4G3YC 1CAUB 2GNMA 1VBC1 3U11A 4WM7A 3B7MA 2BQPA 4N53B 3WVJA 1WW6A 1V6NA 4Q4Y2 1WCSA 4MLOA 3ES1A 5C4WC 3THPA 1ZBA1 5C8CA 4FXGB 1JUIA 1VR3A 2RS32 5AFEA 1XQNA 4AHXA 2E53A 4CDWA 1QOOA 4GB31 2ENRA 4XOGA 3VBRB 1AYM1 3ZFFA 1RUI3 2GMMA 3JQXA 5CAZA 3BCWA 3S7IA 2H6BA 1AR71 1AJOA 4B29A 5BNOB 3POYA 4BZ4A 1UD1A 3NWKA 2AH2A 1LCLA 3S7EA 4IV3B 2X8KA 4YG3A 5J48A 1I5ZA 1GZCA 2QUOA 1JHNA 1RHI1 1WUVA 2B46X 3T2TA 3QD6A 4JGYB 2NPIA 2ZAHA 3AYAA 5GLWA 5IK8A 2WNVB 4YW2A 2Z42A 1MVQA 1H0BA 3NAPB 4R4XA 1N47A 1AXYA 2CNAA 1NQJA 2ZX0A 2HWC1 1AX2A 5DG2A 3OTFA 2DUQA 2DFCA 3ZO0B 4QQHA 4JDNA 4K8FA 4GKYA 1D0HA 1TMF2 1K5MB 4ES8A 4CP1A 4FPOB 1PZ8A 4OLLA 3AP5A 2E6VA 1R082 1BMV1 5LK7B 1U5IA 5KHHA 2B42B 4YVSA 3ZPYA 3AKQA 4BHPA 2GNTA 1N3PA 5GZCA 3N7LA 4XFIA 2UY9A 2ZX1A 2R073 1RB8G 2PAEA 5F1RA 5I8TA 1GYKA 1YCIA 4OHXA 3VKOA 5KXBA 1W2UA 1DQ4A 4KQ7A 3ZSEA 1BVVA 3AFGA 2GMPA 4PDWC 4XDQA 1FOD3 1AR63 1YFYA 1OOPC 1LULA 5H9QA 3WQ7A 1XU2A 3K51A 1REEA 1S0BA 2MNGA 3OY8B 1R091 3FUQA 1KITA 4BIOA 1ULGA 3VHNA 1RUC1 3ACLA 4HKWA 3LCPA 4COWA 5FPZA 4F7ZA 3JUUA 4JCKA 5IUQA 4Q4Y1 1H2KA 3VZMA 5F6LB 4JC1A 3MIEA 3E6DA 1F31A 2FHRA 4ZXKA 5BUVA 4YVWA 1Q5OA 2RJLA 4YW4A 2VMHA 1J1LA 1G9FA 4YW1A 1ND3A 2X5IC 4Q27A 1FV3A 4XF4A 4Z92B 3R0RA 1PHMA 2IFWA 2JXAA 2V5YA 5CVRA 2HWE1 4LBQB 5A3LA 1VBD2 4C91A 3RI9A 4DY5A 2WNUA 2YY1A 4L11A 2RS53 2ZHNA 5GLTA 2QZ2A 5IT6A 5FMOL 1OQ1A 3VBHC 1PIV3 1DZRA 2ZZQA 4YM3A 3OYWA 1IGOA 2LM3A 1UU4A 1AL22 2D43A 3RJ2X 4K7JA 2D6KA 1KFXL 3DPRA 4RFT0 3HT1A 2JDZA 3KGZA 1TMF1 2AGSA 1Z78A 2GZWA 4AEDC 4K9SA 1CAXB 4FT8A 1NCQC 3PMSA 3VKFC 3FLPA 4JDOA 5BNQA 1O4YA 1LOBA 1O3QA 2Y38A 2UWBA 1O3SA 5ACA3 2ES3A 1RUF2 3V0BB 1RUJ2 1VJ2A 1D4M3 1WCDJ 2QNKA 2RJKA 2XJQA 5J98B 1R1A2 2OVUA 1UPIA 1DIWA 4E2QA 2TUNA 3GYDA 3A0NA 4CYDA 4O9EA 3GHMA 3AFKA 2R32A 4LHKA 3V65A 1W6NB 1W6PB 2AYHA 1XE8A 1WA4A 3KB5A 1H4HA 5JIAA 2BWCA 1LRHA 2ZGSA 3FBMA 3PVOA 1X36A 4NHLA 2WFF2 4YFZA 2GALA 1YIPA 2ZGMA 2R071 2VG9A 4P9YA 5CFCC 4ZKTB 4HVQA 4DFSA 2B45X 4FOWA 3CO2A 3WUCA 2DV9A 1OI6A 1PVC2 4L2NA 5FLHA 3M70A 1VAVA 4LEJA 1GLHA 3NVCA 1B09A 3B01A 1QJU2 3IWZA 2JG8A 4I0WB 3RMYA 1GSLA 4FSJA 4OI1A 2Q30A 1Q43A 3GF6A 2RMU3 5GJ6A 2R49A 3VBSA 5K9YA 1CONA 2RR12 2EIGA 2WIIB 2IXKA 4QPYA 1VBD1 3MW3A 3SLIA 4Q4X2 2GN3A 5HI0A 1YI7A 1R1ZA 3EQEA 3HWJA 4R9AA 2XPJA 1HRI3 1G9AA 2XUMA 4CDXB 1SLAA 3B69A 4LA2A 2HWD3 3TWIA 3I54A 3TBDA 1J3QA 1GFF2 3MIBA 2Q1MA 3FWEA 2B5HA 1N1VA 3SHRA 1FX5A 1O7FA 1D2SA 2WL1A 4RHV2 1QY4A 3FMGA 2VULA 1QGLA 5KXCA 4BLJA 3I7DA 1QU0A 1JYCA 3SITA 3D6EA 1OSGA 3M8LA 1ND2C 5DDJ2 1OLRA 2PTMA 2ZX3A 1Q3EA 4KG8A 1MZEA 1NCRB 2ET1A 3P3NA 4ITCA 3L2HA 3GNEA 3GBWA 3WOGA 2YPJA 2UWCA 2YDEA 3KMHA 1RUF1 4XHBA 3UJOA 3R6SA 1MS4A 1CAUA 1R1A1 1HQWA 3KM5A 4Q1RA 4N53A 5DUXA 4KGGA 1N1SA 3WW2A 1EV13 4IV1C 1ASJ2 3TYJA 2CV6A 2ZX2A 4C1XA 1D4VB 2ET7A 4AVTA 3RDIA 1MVEA 4Q0PA 4N9IA 3H3ZA 1LODA 4BMBA 2AENA 2X29A 4I02A 5LRSA 1LTEA 3UL2A 3HR9A 3M3CA 3OD4A 3SCFA 1VBB3 3VBRA 4KH9A 4BCUA 1VB4A 2R063 3VBFC 4BIFA 1D4M1 4WVVA 2D7FA 5BNOA 5JAXA 1ENXA 1RITA 1GNHA 2IZWA 1A8MA 3E5UA 2WLQA 4IV3A 4COYA 1PVC1 4WZCA 5DZEA 1KXGA 4Q8LA 3SMHA 4CEYC 2K2SA 4ORFA 3LGRA 3FHIB 1QMJA 3AMHA 1PO23 4JGYA 4OUMA 4QT6A 5CA6A 1QJU1 2WNVA 4JGZC 3NAPA 4AI2A 5FOBB 1D0GA 3RJRA 4S2HA 4J6GA 2D40A 1N1YA 3NL1A 4GWMA 2NM1A 5ABJB 1F9KA 2ZJCA 1H2NA 1N1TA 1KDKA 1TNRA 2HEVF 1K5MA 2RR11 3ROUA 4PLMA 3UKVA 3K48A 4XF0A 4WV8A 1OA3A 4AI1A 1IS5A 4Q4X1 4XBQA 4YM1A 3E6CC 4AQSA 2GH8A 3DKWA 4BA6A 1DGRA 5SV8A 3NSTA 3ECQA 5H9PA 1YJKA 3AZZA 4FP2A 4IEQA 4EV0A 3VBOC 3WNXA 4QPIC 2TBVA 3U07A 3D0JA 1GQGA 3U0ZA 4I0BA 4AXOA 4JTOA 3M3OA 2GN7A 1PVXA 4N90A 4EN0A 1VBA2 4RHV1 4U2AA 1AR83 4BMEA 1V6IA 2XVGA 5CNAA 3DUIA 2WSUA 3CJXA 2XKOA 5T5LA 2ARXA 5DDJ1 3AXDA 4Q8KA 2CAVA 1AHSA 3KCYA 4OZXA 1SDWA 5C4WB 3QLQA 4M0HA 4Z82A 1UCXA 4LBMA 1S0EA 1LOEA 2HWD1 3OY8A 3VHPA 3AZXA 5GZGA 4Q26A 2VQAA 2VVDA 2OPKA 2WS93 4ATFA 4B7KA 1QXJA 4WBBA 1SBFA 4EN7B 1IHMA 1S55A 2ZPXA 3CJIC 4K20A 1AZDA 5GLVA 3SH4A 2BNNA 1JN2P 4C0BA 3M7AA 2CWMA 1ASJ1 4TZDA 4JAAA 3ZN6B 2ZGRA 4O9GA 1S1AA 2XB6C 5JDBA 4XFFA 4P9LA 5JOZA 4YARA 2ZGUA 4RR3C 3HMYA 4D3WA 3BODA 4LBQA 3WG4A 3MDPA 5T5PA 4HSLA 1FMD2 1IQAA 1ZZBA 1PO13 2ZABA 1Z7S3 4Q4W2 2R1DA 3LAGA 1X7NA 3H9AA 4A7KA 4GMP3 1RMU3 1Q8QA 1JOJA 4YSFA 3D8CA 3URFA 2KXLA 3RPQA 4CDQC 1IS6A 3WG2A 3RYPA 4MGYE 1C5HA 2DU1A