2JG9B

Crystallographic structure of human c1q globular heads (p1)
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
132
structure length
132
Chain Sequence
TQKIAFSATRTINVPLRRDQTIRFDHVITNMNNNYEPRSGKFTCKVPGLYYFTYHASSRGNLCVNLMRGRERAQKVVTFCDYAYNTFQVTTGGMVLKLEQGENVFLQATDKNSLLGMEGANSIFSGFLLFPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title C1Q Binds Phosphatidylserine and Likely Acts as a Multiligand-Bridging Molecule in Apoptotic Cell Recognition.
pubmed doi rcsb
molecule tags Immune system
molecule keywords Complement C1q subcomponent subunit A
total genus 29
structure length 132
sequence length 132
chains with identical sequence E
ec nomenclature
pdb deposition date 2007-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00386 C1q C1q domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2jg9B00
4D7YA 4MSVA 2QE3A 4OULA 2RJKA 2WNVC 4G3YC 2Q1MA 4MXWA 5HBAA 1D2QA 1PK6A 3LKJA 2HEYF 5KC5A 1RJ7A 3B93A 3QBQA 2E7AA 3K51A 3TYJA 1ALYA 1WCKA 3QD6A 3ME2A 4QQOA 3V56A 1DU3D 1O91A 1TNRA 4MXVA 4QQHA 3URFA 1I9RA 5L19A 1JTZX 5CIRA 2QDNA 1GR3A 3K48A 4NN0A 2HEWF 2Z5WA 4G4FA 2WNUC 2HEVF 3TWIA 1KD7A 4KGGA 2Q8OA 4MXWB 2KA3A 3WD5A 2R32A 3MI8A 4DB5A 1U5ZA 4HT1T 4QQ2A 3ALQA 4QQLA 1OSGA 2JG9B 2JG8B 4EN0A 1IQAA 1C28A 2WNVA 2JG8C 3IT8A 1RJ8A 1XU2A 1OQEA 2X29A 1D4VB 2OIIA 4F3JA 4OUMA 2R6QA 2TNFA 4KG8A 5TSWA 1XU1A 4KGQA 2JG8A 1DG6A 1KXGA 2ZJCA 5L36A 2RE9A 4TSVA 1JH5A 1PK6C 2O0OA 2RJLA 2WNVB 1D0GA 1TNFA 3AB0A 5KC6A 2JG9A 4E4DX 2R30A 3L9JT 4QPYA 2JG9C 2AZ5A 4E4SA 4RSUA 4TWTA 1C3HA 4OUSA 4GIQA 3B94A 1PK6B 1U5XA 3B9IA 2TUNA 1OQDA 1S55A 2ZPXA 5BNQA 4N90A 4DOUA 4J6GA 3FC0A 4QQPA 2WNUB 5KWRA 1A8MA 2WNUA 1U5YA
chains in the Genus database with same CATH superfamily
2WZEA 4LTAA 4XBQA 2B4KA 2GC1A 3I3DA 4YG0A 3VKOA 3VZNA 2HWE2 3C2UA 5ANQA 1OPMA 1UO9A 3AP9A 5FQ0B 3VKFC 5FMOS 5CU1A 2WT1A 2RJ2A 1YRZA 1QJY1 1OKQA 2J1VA 1GQGA 3NNFA 3LEGA 4H7LA 4KL1A 2VZSA 5EJZB 3ZYFA 4YZ5A 3VD9A 3V0AB 3BN6A 1WUVA 3HBKA 3JUUA 4XTPA 3ZSLA 4A7ZA 2WO2A 3MIDA 4PT6A 4KQ7A 2B45X 1RUG3 4AVVA 1GSLA 2DURA 4IEPA 2D93A 2WC2A 3CZUA 3THTA 4Y26A 2VOTA 1FNYA 3GZTB 3TN93 3D82A 3GM8A 4XVHA 2QDNA 4QXKA 2J22A 4GH4A 5A33B 4BMBA 1XE0A 1N1YA 2G1MA 3IKWA 2WNUC 2HEVF 1F31A 4N7IA 3VBFA 1ZBE3 2AEZA 3N7KA 3E97A 1H30A 2VZVA 4PBOA 5EQUA 1RMU1 3WCRA 2QQKA 4Y1YA 3P3NA 3VL8A 3VZLA 2YB7A 1A78A 2ZMNA 2Q0AA 2RR13 3ENRA 4K8FA 1IHMA 5L7OB 2R071 4UFLA 2HWE3 2SBAA 2JG8C 2Q8CA 1I1EA 1H8TC 1MEC1 2P3YA 5LRSA 5FYBA 3IAQA 4YM0A 3U37A 1VBD1 2W08A 3NVCA 2MEV3 2A6WA 4LK7A 4FTSA 3POSA 4B4PA 1FATA 1KQRA 4CUBA 1NXMA 3FX3A 3DKQA 4WM8C 2WLPA 4BDVB 3M70A 4BQ5A 1JYXA 3LE0A 1AZDA 4LBLA 4ORFA 1IPSA 1LAJA 5BNPB 1KGYA 1SBEA 5F32A 1XJAA 4Q8LA 2WR9A 5I8TA 3ATGA 4KU7A 1XNAA 1GV9A 1PK6C 1HQNA 2BTVC 2PXJA 2D6NA 2VQTA 3HVDA 4GH4C 4K21A 4QKNA 1AYN3 3ZXAC 4BK5A 1HXS2 1VBD3 1VMFA 1W8WA 1PVC3 3VHOA 2E9QA 1YYNA 4OMCA 1CAXB 5JVVA 1W28A 4XE9A 3PVNA 1AR82 1YCIA 2TBVA 4O61A 5FZ3A 4LHSA 1QOOA 4Y22B 4ZKTB 4COWA 1UQXA 4QX5A 5BNOB 1U5XA 3LCPA 3LPGA 3NV2A 3DCQA 4LKFA 2BW8A 3LAGA 3TNPB 3ZFEB 5FLJA 3GBGA 3HMYA 4NWWA 3ZXKA 4GB33 4P5HA 5CA6A 3SQOA 5L7OA 1AR91 2VZ3A 2FMYA 1HRI1 4RFT0 5F5QA 2VZOA 2WA3A 2LROA 4P9GA 2VJXA 3POJA 1UN1A 4N7UA 4FAHA 1JUHA 1NZIA 3LOIA 4W50A 5KR7A 4P9YA 3JQWA 5HBAA 1BEV1 5LA9A 2JE7A 5DZGA 4XFHA 4ZXKA 4HANA 1PHMA 2DTYA 2D5HA 3N7MA 3NAPA 2HH9A 5FZKA 1S2BA 3BTZA 3GJAA 3RYPA 5BY5A 4PIXA 3LEKA 1GZWB 4RN5A 5FPAA 2AC1A 4O7XA 4RGAA 4AF9A 1IG3A 3I8TA 3K51A 3GF6A 2JE8A 2YBSA 3N9PA 3WDYA 5KXCA 1DZRA 1AR71 1AX2A 3SNMA 3HNMA 3WOGA 4CDUA 2OYZA 1JODA 1LHNA 4QX3A 4XCBA 4QPGA 1UZVA 3LFIA 2BP6A 1PVC1 1Q3EA 4QGLA 1GR3A 4BQ2A 2GNMA 4KG0A 4LBQD 5FZEA 4D3WA 2Z5WA 2VQUA 3TWIA 4QPWA 5C70A 5EFUA 4OCTA 1RXGA 2W52A 2QQMA 5C71A 2W1WA 2JDPA 3BYWA 3VZOA 4XAAA 4XF0A 1OF4A 3SXWA 1S0BA 1REEA 3Q8EA 4CCCA 1YQ6A 4HT1T 1IS4A 2CY6A 3VDCA 4DXRA 1V6IA 1RUE2 2BNOA 4Y4RA 4BJ0A 2WINB 4DNYA 3ZFFB 3P3PA 4AAPA 3SCHA 5JXIA 1GQHA 2LS6A 2Y6KA 4GALA 3OG2A 3PIJA 1V0AA 2JB8A 1ZRFA 2ZGNA 3E5QA 5JOWA 3EQEA 1EAH3 4Q4Y3 3J7LA 5FPLA 5GZFA 4AI2A 5BNOA 3O1RA 3VHNA 3OJBA 4QWNA 2E6VA 5CKQA 5KXEA 1C5HA 1YNAA 2R041 4D8MA 4YM2A 2YV8A 4DMIA 4XW3A 5FLHA 4YW3A 1ENRA 1OLRA 1LECA 5J48A 4MGYE 2VULA 5GLTA 4E4HA 4KGQA 1U12A 2PAKA 4MZUA 1XE7A 3RQ0A 4KWKA 5LRRA 1GYKA 2W92A 3WP4A 3N9MA 4CDUB 2GH8A 4Q4X1 5I0DA 5IW0A 4N8MA 3POGA 1D0GA 3S30A 4CDWB 2PHXA 4OQ8A 4NROA 3D5OA 2ZX1A 2VOVA 3H7YA 4QMAA 3SKVA 1C4RA 2JG9C 4F8AA 1PO23 3TNQA 4AQ6A 2HWC1 2V5DA 3QCWA 5ACA3 3ZYIB 4GAZA 1S2KA 2AZ5A 1PZ8A 2NLRA 3I7DA 3NAPB 4HL0A 4AI8A 4E4SA 5JSPA 1XBFA 1O3SA 2AACA 4WV8A 5T50A 1VPHA 4KBZA 4PQQA 3I59A 1RUH3 1FPN1 2XBO1 4Y1XA 3CJIC 4QHOA 1L7RA 1VBB2 1S0FA 1SMVA 2OA2A 3WG2A 2PAMA 1HV1A 1OD3A 3WF2A 1T6BX 3OGJA 3RSJA 3AKSA 4O9EA 1JUIA 5LBFA 4D94A 3I2DA 4JGZC 3EBRA 4MHRA 4XACA 3SH4A 3VBOC 4AI3A 5IFTA 5LA1A 5FYMA 2V72A 3O0VA 3I2GA 5JPMB 2CGPA 3A0NA 5FXVA 4R9BA 4QT6A 1PMIA 2AGSA 4MGQA 4UFIA 4CP2A 1SEFA 5A70A 2DCJA 3S57A 4M00A 2GC2A 1PZ9A 1XSRA 3FUQA 4H7MA 4OHWA 3W20A 3O0XA 3BKZA 3OCPA 2HWD1 2XKPA 5JMOA 1PGW1 2JICA 2V4AA 4IEQA 4UXAA 1LR5A 3T4VA 5AC92 3B02A 2VZPA 3VBRC 1B35A 3IDBB 5KC5A 5IAVA 1BVVA 3KT1A 3J7MA 2Y33A 4Q29A 5GLWA 4HK8A 1CZVA 4XEZA 1GBGA 4DXZA 1MS0A 1CGPA 4CRQA 2JD4A 2I07B 5CFDC 5JSRA 1CQ9A 2WABA 3DF0A 3LIHA 4XF4A 1W8NA 3IMNA 1QJX1 3EJKA 4M0HA 4JV4A 3U1XA 5CFCC 3VUOA 5L9RA 4GWJA 3LDKA 3SCFA 2FD8A 1VAKA 3JU9A 1V9U1 4NJ4A 1QQP1 1F5JA 5HI0A 3MO4A 1GZ9A 1V6JA 3ROUA 4CP1A 4LMFA 1SLTA 5T5PA 4OHXA 4YFWA 1HN0A 4QDSA 4JDOA 3ZXEA 5ISLA 1OURA 3AFKA 3WNMA 5JI7A 2RS31 4JGZA 2C4XA 3WQ0A 3ZFFA 3PVBB 4N9HA 1AXYA 2JD9A 1RUD1 4WVZA 5IVYA 3OOXA 1KFXL 2PHRA 3E5XA 1JU3A 1HJGA 5ANNA 4B1MA 3KLSA 5A3LA 1CN1A 1LOGA 1G6NA 3GNEA 4XURA 1W9SA 1BKZA 1FNZA 1US2A 3TN91 3ZR6A 2N7GA 1IPJA 1LOEA 1RJ8A 3PU3A 5GZEA 1H8TA 1UCXA 3J8F2 1AYN1 5FO7B 3USUA 3HOBA 4XZPA 4ZPIA 1OHFA 1JZ7A 4Z2WA 2EXIA 2D3RA 1MVQA 4INDA 2Y6JA 4PDWB 4LKDA 3S6PA 5K8SA 4OFGA 1K5JA 1SLBA 4D0QA 1HW5A 3MFAA 1PMJX 1QDOA 3FWEA 4JQTA 1ZZ7A 4D7TA 3RNSA 1RUH1 4E2SA 3WINE 1UKRA 2E7TA 3SEPA 4ZZ5A 5A7WA 2YFUA 5C7GA 1MEC2 1SLCA 3WQBA 4OHYA 3ASIA 3VZKA 3SH5A 1DQ1A 1NZCA 3VBSC 3N7JA 2BWCA 4E4DX 4M3CA 5GZDA 3S7EA 3BPZA 5BYNA 1H4HA 1WLCA 2OUJA 3D4KA 3ZYBA 4DINB 4XETA 5DUWA 1YI9A 1ULPA 5EXOA 5GZGA 1H2KA 2IWGB 3WQ1A 4NAMA 2VNRA 3M3CA 2E53A 4Z82A 2Q1ZB 1H4GA 3LSEA 4P9JA 4S2FA 5A32B 3WHTA 1ZYBA 2XUMA 4UW3A 3JXSA 2FCVA 5GLUA 5FR3A 2RS33 1Q8OA 4UW5A 1Q8PA 4COUA 5KHIA 5FZMA 1FMD3 2QQVA 1RINA 5BNQA 4YGBA 4AZZA 5T52A 1STMA 3AC0A 3D0SA 3WNOA 5C9AC 4IETA 3AP5A 3ZXGA 3O1OA 3MGUA 1QJU1 5L7OC 4S2DA 5C4WA 1XXNA 2JJ6A 3NV4A 3VBHB 3AL6A 4LE3A 2W46A 2O8QA 3LD8A 1YFYA 4JQRA 1JN2P 5FZ8A 5FBJA 1NCRA 3VBUA 1D7PM 4K6BA 1VRBA 1PGSA 2QKDA 2W95A 3JD72 4TYSA 5KHGA 3KV6A 3R6SA 2PHLA 4DRRA 2XWBB 5F3IA 4BYYA 1PIV3 2F4LA 1R1A1 1WMFA 1C5IA 2IVIB 1OXCA 4EE2A 3D8CA 1NCQC 1PM4A 1GZTA 5JDBA 1ZRRA 1UYYA 3OBTA 2Y6FA 1K45A 3AKPA 4IEZA 3MLKA 2RS12 2OZJA 1SDWA 4XFIA 2HYXA 3NKTA 4JGYB 1WCKA 4GJZA 1UZ0A 3IB3A 5I8YA 1OOPC 3UL2A 3O1PA 1H1AA 2DF7A 2RM21 3PURA 4K8RB 4CDQB 5J7MA 3C3VA 4LBQA 3PTYA 4PI2A 1BEV2 2ZS6B 4CDQC 3G6JB 1UPIA 1DIWA 3VD3A 4GKYA 1HB2A 2VQ0A 2Z2SB 3E1F1 5E88A 1EPWA 5A80A 2DVDA 4XABA 1MACA 3W5NA 4GWNA 2W5FA 1L3JA 4NIHA 4IEXA 2XG3A 2VOWA 1WKYA 2I45A 4J1WA 1G9CA 4LITA 4QPIC 2XH6A 3GDBA 4P9LA 1ZZ6A 2DUPA 3WNLA 2A7AA 4O9GA 4QU2A 1ZREA 2VH9A 5A1AA 1NE4A 3WF3A 4U36A 1DHKB 2PYTA 1PVC2 2VAUA 3WNNA 4ES8A 2H0BA 3RMXA 1ZM1A 3DUIA 1PO22 4PLOA 1OH4A 1PIV2 1OA2A 1JOBA 3QH6A 2PA7A 3QOPA 1RVF3 1W9WA 3ZYHA 2YG0A 3J26N 1G7YA 1REDA 4LHKA 4QB1A 4WVWA 4KH9A 3BI3A 5KXBA 1RTVA 1J3PA 1CZTA 3JB4C 2A6YA 3PDQA 5FRAA 1IS5A 2AEYA 4RA0A 2FDFA 2BQPA 4GB32 1UD1A 1WD4A 4YGEA 5F5CA 4XC9A 1UYXA 1RMU3 1D4M1 3LEMA 5K4LA 4E9KA 4CEWB 3AKQA 2RS53 4L9BA 4NHMA 3H8OA 5L36A 3VKNA 4XAEA 2ADDA 3H8RA 1J1LA 2WNVB 1LGCA 5IK5A 1CVNA 1EAH2 1ULFA 2PHDA 2BNMA 4AEDA 1CAWA 1MZ5A 5F6LB 2D98A 2W91A 1LNSA 4QAWA 4Z07A 5I0SA 1J84A 3J4UH 2R042 1DP0A 4PIZA 2ZKNA 1SCRA 3HT2A 4JTNA 4YLZA 1BMV1 4FOVA 1PGL1 5DABA 1EPZA 5A7SA 3RYKA 2ZA9A 4Q5OA 3GCXA 1WLWA 4XZUG 5HXMA 1NA1B 4XF1A 1W05A 2ZX2A 3ZYJB 4AGRA 2ZGLA 1SCSA 3AZYA 4XXAA 1CD3G 3RPQA 3WNXA 1KS5A 5LW9A 1OOPB 1D4M2 3FMGA 3J7HA 5IK7A 3UKVA 3RI9A 1CPMA 1W9FA 4Z92B 1YQCA 3NMBA 3AK0A 3K3OA 1Z7S2 4C91A 1UY0A 2P37A 1PNGA 3NWKA 5B4NA 2J1TA 2Y38A 2DBIA 1OH3A 2VR4A 3HIFA 4CCNA 3GXUA 5CEHA 1GOGA 3PUAA 1ZNPA 2HWE1 2VU9A 2VW2A 1BMV2 1EY2A 3VB9A 1RUJ3 1AR81 1MQTB 1V6NA 4MADA 4IUGA 4W65A 3SC7X 4AEJA 4FI9A 1XNBA 2E32A 4LKEA 2RS52 5CBLA 3FZ3A 1Y9MA 3LQCA 5CISA 2ARXA 1NOVA 4YVSA 3G7DA 2O14A 4KMQA 2WN2A 2ZOEB 1RIRA 3V65A 4AEDC 4AFBA 1LB2A 3I2JA 3QD6A 4GJYA 2UYAA 1OUXA 5CFDA 5DUXA 4QX0A 1O91A 3TEWA 1T6GC 5JIAA 3RZGA 2JDYA 2OW4A 1X9TA 4YVWC 1HB4A 1V6LA 2GH2A 4ITCA 4CCJA 5CFCA 1US3A 5J96B 3OGSA 3KMHA 5FY1A 2XJSA 1OLQA 1OLMA 2I74A 5KBFA 1URXA 1RUG1 4LBJA 4WM8B 1W8FA 5FPUA 1OA3A 3N9NA 3IM0A 4OZXA 4CEYB 4DUWA 4V1PA 4DQAA 2ET7A 5IFPA 2IXJA 5DUUA 4MHUA 3ACIA 2VMIA 4UF0A 3MIGA 1KJRA 4BLIA 2YFZA 2X5IC 3DXUA 2Y6HA 2VXRA 1X33A 1SBDA 2BU9A 4A6OA 5FP8A 1RXFA 4NWVA 2ZMKA 4A45A 1OVSA 3PVEA 3NL1A 4OQ9A 3ILFA 3ZN5A 2WWJA 1QOSA 3MV11 4LLFA 1NG0A 1OKOA 2BFUL 3VKLA 5BUVA 2Y64A 4YW6A 2W39A 3LF7A 3ZXFA 1R092 2VUDA 3UT0A 1VRH3 4N43B 4COYA 4YARA 4JDMA 2BOJA 3Q8FA 3I3QA 2JB4A 3KGZA 4Y22A 2R6QA 2QDRA 2D3SA 4AFDA 3O1VA 5FP9A 2QFEA 5FPBA 1XPWA 4R9CA 1RUE3 2CAVA 2IUWA 3CEWA 4MUVA 4PLMA 4QX8A 4CZSA 1XU1A 2EAAA 1JZ8A 2V4VA 3CKHA 3HWJA 2JG8A 3A4UA 3HR9A 2UWAA 1WCQA 3VBSB 4N43C 3BIWE 1ENXA 2NPIA 3BGAA 5DDJ2 3WZ1A 5APAA 3AB0A 2HWC3 3IPVB 4CEYA 5A3WA 4DO0A 1OI6A 2WBKA 4YNIA 5FMCA 4XQ4A 5C8CA 2ID4A 4WM8A 3WNPA 2XB6C 4ISQA 4L8QA 1LODA 3PIGA 1AHSA 5F6KA 1HB1A 3RI8A 2B9UA 3POYA 4M0NA 2FCTA 3GCWA 4EN9B 4IGQA 4NPMA 3T4HB 5CFCB 2X5IA 2CSGA 3ZSKA 1G9FA 5SV5A 1S0DA 5EHDA 1EV11 3CL1A 4AI9A 3IDEA 5BNNC 4R52A 4E4ZA 1A6CA 1ZBA3 2HWF2 5FCCA 1WCUA 2BPA2 3OYWB 1RUF3 2YC4A 1SPPA 4IV3C 1NY72 1CESA 3AZXA 2W2IA 4CU9A 1VAVA 3CLPA 4M4RA 3UJOA 5DDJ1 5ACA1 1FAYA 3MIHA 3N9QA 2PHTA 2QE3A 4OULA 1YWKA 3DGTA 3O12A 4META 1JU4A 2VMDA 5EZWA 5CB7A 2BFUS 1BCXA 1SZBA 1ZA7A 4G9SB 1D2QA 1AL21 1NXD1 2WIIB 3HAGA 5FY5A 1XYPA 3ELNA 1DQ2A 3LKJA 4LT5A 4E27A 1VBE2 1ZBA1 5IVVA 1YFUA 4LULA 1EUTA 4YGDA 2OPWA 3ZYPA 3WQ7A 5LEKA 4XUTA 2IC1A 3OD0A 4BXSV 3B93A 2HYKA 5IHRA 3QACA 3JB8A 3PMEA 4LOTA 5FY8A 3PHMA 3LWCA 4JAAA 4AYUA 2OKXA 1DZTA 1YQ8A 1AYM1 2BZDA 1IOAA 2WZR3 3B5LB 5M0TA 1OOPA 1WW4A 4HZFA 2Y60A 3VDDB 1X8EA 3HN3A 1JZ6A 2AYHA 3WW4A 1KRIA 4UOJA 3KQ4B 2V5YA 3L2YA 4CDXB 4UBHA 3ETPA 1H6XA 4LBNA 1R1A2 1N1VA 3M3IA 3NAPC 2ARAA 2A3WA 2ZTNA 4YWAA 4UF0B 3AYEA 4A44A 4BA6A 3WDUA 1NX9A 2XLGA 1GNHA 3ILRA 3CNAA 2WZPP 1RUC2 4Y20B 1VBE1 2RS13 5JZGC 3OGVA 2R32A 5FYYA 4QPIA 4YW4A 3E6BA 4CDUC 3M2MA 1O6UA 1DQ4A 1WCSA 1FPN3 4Y4YA 2P3IA 4YZ1A 4FCAA 5EJ1B 1ULEA 2QQUA 5CNAA 5FWEA 1BEV3 3VN4A 3UYJA 2WLQA 1MVEA 1GKBA 3KV9A 4IEUA 4X8PA 2W47A 2WDBA 2WFF2 1LTEA 1NYWA 4Y1ZA 1DDLA 5IVBA 5FYCA 1HRV3 5FYSA 3MLLA 3MW4A 3OUIA 4OI2A 2EALA 2ZGPA 3FBMA 4AEMA 4CU6A 2A75A 1POQA 3ZR5A 2VVEA 3GGLA 3MIFA 3ZVXA 4E8CA 3O1TA 3AVRA 4AGVA 5HCHA 2JXAA 2EXKA 3A7QA 1D4M3 1MQTA 2GDFA 2ZGTA 5TSWA 3LSDA 4Q0UA 5EV7A 4I3PA 1NAEA 2LUWA 1ODMA 2MNGA 1H1MA 4QD2A 1PIV1 2O0OA 4XIOA 1CJPA 4HVQA 3WLUA 5IAXA 2QTWB 4P9WA 4DY3A 1GLHA 1POV1 3ZFGB 4IV1A 4W4ZA 4BIOA 2FDHA 3H3ZA 1NY71 1SG3A 1QJX3 4XPVA 1AYN2 5LBCA 4A41A 1LJ7A 1HRI3 2JWPA 5FZ1A 2YC0A 4BWOA 4E2QA 3FBYA 2XJTA 4Q1PA 3UETA 2JIGA 2WO7A 5D1IA 3ORJA 1FPN2 3EO6A 1FMD1 1O59A 1PNFA 1QXPA 2FZ1A 4FPEA 3VD7A 1X36A 4QHBA 4HVRA 4J6GA 4LHLA 2PFWA 1TMF3 3ZSJA 3RYRA 1U5YA 3OBAA 1SBFA 4LO5B 2BDRA 1DGWX 1XRUA 4EWDA 3T2TA 3RZHA 2NP0A 1PO12 1CAVA 2WWUA 3BTAA 1LEMA 3NJYA 4HG6B 3UESA 1W6OB 4FQZA 4BISA 4Q0VA 3WF4A 4XQWA 1X8MA 4LO7A 2DVGA 1N47A 2BVVA 1ODNA 5IATA 4Q0PA 5DQ0A 3I2FA 4FPGA 1E5RA 3NSTA 5LA0A 4DIQA 1C1LA 1IG0A 2Q1FA 1CAVB 2CGOA 3GYDA 4AFMA 4P02B 1FV2A 3ABZA 5FPXA 1QOTA 1DU3D 1FOD1 4RR3B 3OB8A 4NPLA 4YW5A 4B8EA 1RVF2 2C26A 2W68A 3OGRA 3D3AA 5FUNA 2WJSA 2VBPA 2ZEXA 2KM2A 5FZLA 1IPKA 3VBRA 1S0IA 5DAQA 4EYUA 1XNCA 2JDNA 3H1WA 3IIIA 4MGSA 4FPKA 5FYTA 5H9RA 3WV6A 4ATFA 2DCKA 4FP3A 2R49A 4YRDA 5I8SA 1ZA4A 3KVBA 4PF1A 1RUI2 2HWB2 2RV9A 4AHWA 2WUHA 2C9AA 1W2UA 2JIJA 4N53C 1LCLA 1UYZA 5A1LA 1QJY3 3AP7A 3VKMA 4HMZA 4QX7A 4QQ2A 1DCSA 5A3OA 4JKKA 3AKRA 2KD7A 5A3UA 1CAUB 4LBQB 1H2MA 1BYHA 1W39A 4OHVA 5CG9A 1OMIA 1RVF1 3J7NA 1ND3A 3ZIWA 4JHZA 1AX1A 2ADEA 4JGYA 3NJZA 5J09A 1PZ7A 5FP7A 2XMLA 2ZZQA 1ULOA 4H55A 5FYIA 5DN2A 1F4HA 1S0EA 1ZRDA 3KB5A 3MPBA 1BXHA 3RFRA 2VUJA 5C9AB 2WS93 3BALA 4KG8A 4I0WB 1LOBA 2WYFA 1UF2C 3FFQA 3H50A 4L99A 1VR3A 1KXGA 4UT5A 1APNA 1PMHX 1J1TA 5GLZA 4I0BA 1M06G 1QEXA 3I3EA 2G9GA 3A23A 3LGRA 1HN1A 4UFMA 4NRPA 4HONA 1PO21 2QUOA 3ZXJA 1XE8A 3WG4A 3DEMA 2QVSB 4D7SA 4LNVA 3N3HA 1POV3 1CX1A 4K9SA 1YUDA 3L2HA 4UFJA 2ZGRA 3BTXA 1WW6A 2O8OA 2E31A 1UAIA 2VGDA 2WWSA 3WDVA 4FOQA 4GIQA 4R8HA 2YHJA 5JOZA 4GD4A 5FZCA 2GP3A 4N53B 3DYMA 5GLVA 5A3NA 3KF5A 1MS3A 4ZS2A 5LA2A 4BZ4A 4I02A 3SLIA 3VBSA 3HD8B 3T2QA 4AW7A 5BNNA 1G9DA 1GOHA 2VD7A 4A2UA 1ZBE1 1JI6A 1J59A 2WNUA 2XQRA 1S2EA 1ULCA 5DG2A 3WDXA 3ZIXA 4IV3A 5I93A 3IAPA 2Z79A 3O0WA 2ZGOA 2R062 3SKJE 5C3OA 4PDWC 5DMYA 3ZXDA 1TE1B 1DLLA 2PHFA 2DYCA 2WL1A 2YBPA 2CAUA 3OF1A 3OSDA 2D97A 3RG0A 1TME3 4P5YA 2G9FA 1S0GA 4RHV2 1U5IA 2EIBA 4LO6B 2XJPA 3K4ZA 2XJRA 3OTFA 1UIJA 2XONA 5FKBA 1Z7S3 2RG4A 4BHPA 5A7NA 3RRDA 4GMP1 5F39A 2EA7A 2RS11 4NRMA 4B7KA 1IGOA 4DXSA 1UXZA 4F83A 4URAA 5ABJB 1ND3B 1BBT3 2JDZA 1UY4A 2YROA 4FPFA 5JSOA 1AL0G 1I9RA 2RVAA 2VCBA 4BPZA 3JBG2 5FUPA 3OYWA 3I59B 2QQJA 1KFUL 2QBXA 1LOAA 2ZBJA 1IZ3A 3NNGA 4NN0A 1I5ZA 4AQSA 1N1SA 5K0UC 4OUEA 4EROA 2C5DA 4NIGA 1TMF1 5FXXA 1QF3A 4E2GA 4GZ9A 4EN6B 2VNOA 5FJHA 1C57A 3I97A 4DFSA 3CJIB 3I2OA 4GMP3 3WD5A 5FZ0A 4ZZ8A 3FHIB 2HBUA 1W3VA 1JOJA 1VBA1 4NE9A 2VCAA 4Q4W3 4DEQA 5L9VA 4W6WA 4KBBA 1R1ZA 4JX0A 2W1SA 5F37A 2PELA 3IPVA 4BH9A 2NMNA 3FLTA 2ZCWA 4CCDA 4DEVA 1BK0A 2R072 4YVWB 2WT0A 3OPWA 3B7MA 1HIXA 3ZSEA 1TVGA 2ZGKA 4MO3M 3T2PA 4K7JA 1ND2B 3CF6E 3POFA 4JZRA 3C7HA 4P9XA 5BPXA 3WNKA 2K46A 4AVBA 1UOBA 1AYM3 2WZR1 4IE0A 4YPJA 4IEWA 3PMSA 3D0JA 4BQ1A 3I4IA 2EAKA 2JECA 4OUMA 5GALA 5IJRA 3NJVA 4GB31 3LIGA 4QXCA 4TLGA 1UOFA 2ZXQA 1MQTC 1MS1A 1BQPA 1AR72 1ZZ9A 2BERA 3PNAA 5HCBA 5A7QA 4CCOA 1SDDB 2D43A 3KVAA 1DG6A 4FPHA 3B9CA 4GULA 5A3PA 4TSVA 1AL23 1RB8G 4RGGA 3HQXA 2MHFA 5EYXA 5CG8A 1OBNA 2Y6GA 2WNEA 4MGIE 4AQ2A 1CJDA 1VMHA 2XLFA 3RJRA 1Y9GA 2NQYA 4OHZA 2WRAA 3B69A 2B46X 5FFOC 3V0BA 5DAXA 5C3QA 3ZOIA 3VDBA 3FFZA 4BB3A 2XUEA 1S4CA 2DCZA 4K40A 5FZOA 3BUCA 2AUYA 4QPGB 4ZONA 1F8VA 5FY0A 4AEDB 4J25A 2B39A 1RUE1 1S55A 2ZPXA 1PX3A 5KHJA 3BU0A 1CAUA 1COV1 3CJXA 3ZFGA 1YIPA 2JDMA 1NT0A 2VVDA 2ZMLA 3KZ4C 2VNGA 1OFNA 4BXFA 4CDWA 5CYYA 2B5HA 5E1RA 3LA3A 4LE4A 2PAEA 4Q0QA 1Q5OA 1FV3A 2WNVC 3M3OA 1Q8VA 1WMDA 1DYOA 2DUOA 2YU1A 1IQDC 1W0OA 3RS6A 1UMZA 3M4FA 4XUQA 4IW3A 4S2GA 1UZWA 2VO5A 2HWF3 1QH7A 4FTEA 1RJ7A 2ET1A 1TMF2 1B09A 1HX6A 4WBBA 3QBQA 2YGMA 3B3QE 1VJ2A 1GNZA 2J42A 5FWJA 4YM3A 1LENA 1KS4A 3TEZA 4LPLA 2O1QA 2ENRA 3ME2A 4PQ9A 3AM2A 3ZDSA 3URFA 2R1BA 3GBFA 2FZ2A 3AMNA 4Q4X2 2Y0IA 5FYVA 4IQPA 2GAUA 1W06A 3I2KA 3P6BA 5F3EA 1CZSA 2OUHA 2GN3A 5LASA 4CUAA 1W90A 5AVPA 1O8SA 4H2AA 4ZU7A 1UY1A 1BLZA 1SLIA 1QMJA 3GJBA 4HXCA 4GQ7A 4MXWB 5E6HA 2Q8OA 4DUXA 4EN7B 5LCWL 2WZR2 2PLV1 2ILMA 3KSCA 4YVWA 5G04L 4AXOA 2R0HA 3DYPA 4LHNA 3U11A 5AC93 4L0PA 2JG9B 2JG8B 2VTXJ 4CCEA 1UY3A 1UXXX 1GWLA 1XC6A 5JR2A 2ZGMA 4LO8A 2XJQA 2I2SA 2WNVA 3NRUA 1OUSA 4CVUA 3NV1A 1O4YA 1NQJA 2X29A 3CJIA 3HBZA 1NQDA 1QXRA 2B7YA 1R091 5F5AA 5JMCA 1YO8A 2VXJA 1PGW2 1XSQA 1RUNA 2DVAA 5C5UA 1X9PA 1W0NA 2BJSA 3M1HA 3MUY1 4XJUA 2GNDA 4OI0A 2HKXA 2FDJA 3O1MA 2GP5A 3THCA 3WHUA 1RUC1 5HCFA 5BNPC 1Z78A 2E51A 5FK8A 1HLCA 1LHWA 2VG9A 2VZ1A 3OGGA 3THPA 4FPOB 2A6XA 1GNYA 2P4EA 1YI7A 2D44A 2ZHLA 5IK8A 1YFWA 1JH5A 2IXCA 4CEWC 3S7IA 1PO13 4W6YA 2K2SA 3VGIA 3WUCA 2PTMA 4YFZA 2BEOA 4ASLA 2BOIA 2LTNA 2VM9A 1GP6A 5F7UA 1MS8A 4HKWA 4Q4V3 2R30A 4CP9B 5A32A 4B1LA 4JC1A 1MZ6A 1DGRN 2VQAA 4RS5A 2W9XA 3ZM8A 4BMEA 1IKQA 2EXHA 5A7OA 3IZOA 3DECA 2X5IB 4CCKA 1PK6B 3BIEA 1R082 1F5FA 1GFF2 3DN7A 3KWVA 3AVSA 1Q43A 1OT5A 1QWRA 5K7PA 3FLRA 2DVBA 1A34A 5E8AA 2BGOA 3ACHA 3N9LA 4R9AA 1ACCA 4LBOA 4MGKE 5C8CB 4QQPA 1SHWB 1J83A 1T2XA 2WNUB 4L97A 3UV9A 1JZ4A 3U4XA 1LGBA 3FE5A 3TN92 4COZA 3T1MA 3ZYGA 2E26A 3VDDC 4QPIB 4RQPA 3FHAA 5C6CA 5FO9B 4D7YA 1SFYA 4Y24A 4PDWA 5IUQA 4Y20A 1YQ5A 1UPSA 2E7QA 2RJKA 5BNPA 2Q1MA 4MXWA 5FZDA 2GZWA 5J36A 4YZ2A 1AR93 4CA9A 1AXKA 1H8TB 2YXSA 1AF9A 3OEAA 2G19A 4V2VA 1W6QB 2YZ4A 4YZ3A 1R081 1UL9A 1Y43B 2Z42A 1OPOA 4HETA 1QJY2 4P14A 4AL9A 4Q4W2 4CDXA 2VPVA 1YJKA 2NYYA 1W6NA 1VBE3 3WUDA 4CPBD 3MUZ1 4CUCA 1REFA 2QJVA 3AL5A 3EXUA 3IWZA 4NRQA 4QQHA 4ES9A 1WWYA 4IE5A 4RS5C 5FYZA 2PQSA 5L73A 5A1FA 4NAOA 1W8HA 1WLTA 1AVBA 4BQWA 1S0JA 3MDPA 1Q8SA 5T3NA 4WM7B 1IS3A 4YM1A 4RHV1 3K2OA 1UOJA 2GC3A 4Q0SA 3KV5A 3T08A 4ISRA 2XDVA 4RFRB 1V6OA 5K0UA 1COV3 1O5LA 4HBNA 3VZMA 3E6CC 2ZHMA 1W9YA 4XUNA 4NO4A 2RDSA 1YJLA 1QJU2 3F95A 2TEPA 3MW2A 2GMMA 1RUC3 3KT7A 1RUD2 5D8AA 3W59A 1GWKA 2IVJA 2UWBA 2VZUA 4FPLA 1OSGA 1VB2A 1S1AA 4Q1RA 4FP2A 1VBC1 3ZSMA 3CHXA 1WBFA 4CYDA 3R4UA 1C28A 2WFF1 3P1IA 1OC1A 4PLNA 4RHV3 4Y1UA 3T30A 5FO8B 1TQ5A 4MV2A 1MEC3 4AG4A 2KR2A 1E57A 3I2HA 5GJ6A 2VNVA 5JZGA 4SLIA 4FFGA 4CDXC 3NNJA 2P6HA 1DF0A 4TN7A 3H9AA 1DGLA 2OIIA 5FV3A 1W8ZA 1UMIA 3OD4A 2DBNA 4A3ZA 4CXWA 2WT2A 3JD71 5C4WC 5FP4A 3O5SA 5IT6A 2RMU3 4CPBA 4AGGA 4C1WA 1J3QA 4IERA 5FZ9A 5FY9A 5F8PA 4B7EA 5IVFA 3H8XA 3LZZA 1W2AX 4YG3A 5A3TA 1K12A 2RMU1 2MPFA 1BK1A 3MF6A 3VBFC 2OPKA 4KNCA 4I0AA 2ZGUA 1GMMA 2CDOA 5LBEA 1N3QA 2WN3A 3KD4A 5FZHA 2F4PA 4ZXEA 3U0ZA 3NW4A 4LIVA 4ASKA 5ABJC 3E5UA 3LFMA 4XJAA 4RSUA 1UZZA 1VBC3 4OUSA 1W6OA 3B94A 3T0DA 2IXIA 4COVA 4OLLA 1DZQA 5D8AC 2ZX3A 1HDKA 5FZ7A 1LRHA 1NLSA 2GNTA 2OQ6A 4JCKA 3VD5A 4JDNA 4CDQA 5T5LA 4XHBA 4IV1C 3FC0A 4RQPB 2XQXA 4B4RA 2DDUA 3ZFGC 4B3NA 5DZEA 2XHNA 4HPKA 2GU9A 3POWA 1YFXA 4Y5Z0 4F7ZA 4TZDA 1QNYA 3ZPOA 3A21A 1CWPA 3SH3A 4R4XA 1UOGA 1AR73 3OPZA 1CR7A 1PK6A 3N36A 1NCRB 3VBUB 2QQLA 4XJZA 2J1AA 4LA2A 4CTEA 1NUKA 3WT3A 4DS0A 4K20A 5FK7A 4FSJA 2WS91 2X09A 1JYCA 4AEKA 3KHCA 3U07A 3HPNA 2WO3A 2VUAA 3M3EA 1HXS1 3NKGA 4JTOA 2VMFA 1LESA 2ES3A 2VW1A 3K3NA 1OF3A 1DFQA 1VRH1 4LORA 3WVJA 2IXHA 1C8M2 5ABJA 1JHNA 2L9LA 5T54A 3V64A 4W8JA 1VBC2 2A70A 2QQIA 2WNOA 3QLQA 4V2WA 2EF6A 4IE6A 4FXGB 1FXZA 3APBA 2ORXA 3H3UA 1W6PA 4XIKA 5LATA 1UY2A 3AYAA 3PUIA 4IESA 2UU8A 2YPDA 4QDRA 2DVFA 4XBLA 3TRSB 4A7YA 4XJ9A 1L7QA 4FQ4A 5DG1A 2BBAA 1RITA 5CZKA 4AFCA 4XFAA 4NOTA 2ATFA 2CNAA 2H6CA 3A0KA 3PTRB 4D6RA 3MI8A 4MGZE 4CCMA 2BWAA 2UYBA 1UYPA 4XFFA 3RZJA 1I6XA 1HQLA 5FKCA 3ITQA 4WZCA 5D8AB 1AR83 4FVVA 2UWCA 2WZ8A 4MOAA 3RDIA 3WG1A 3S0MA 1QJZA 1AR92 2J1UA 2RHPA 4P9IA 1JHJA 2YY1A 3GZAA 5FIXA 2WFF3 1O3QA 1EYBA 5K0UB 1V6KA 2A6VA 2CL2A 2IFRA 3E6DA 4AAXA 3H42B 3PUQA 5F2SA 2XPJA 1RHI2 3H7JA 2CDPA 4YW2A 4ZY9A 5JOXA 1U0AA 4HSLA 4I3GA 2ZACA 3KGLA 4KWLA 3HJRA 4XDQA 4FBFA 3O1UA 1VBA2 1D0HA 1ND3C 1SFNA 1AX0A 3PL0A 2PHWA 1Q8QA 5A6XA 2KXLA 2C24A 2RJLA 3D6EA 1G8WA 4CEWA 1KEXA 5C4WB 2VE1A 1G9AA 1JMUB 3GZUC 4ASMB 4GWIA 2NN8A 4YVSC 1W6QA 1PGL2 3OBRA 2HWC2 4X6QB 3MLJA 4WVMB 1XYOA 1ZX5A 5C3PA 2Y34A 3FLPA 3ES1A 5FTTC 4Q8KA 2AREA 4BU2A 2VCMA 5L9BA 2NMOA 2BYVE 2VY0A 3EYPA 1RUD3 3U4SA 4AVCA 1ND2A 2CYFA 3AZVA 4DY5A 5FZBA 1TG7A 1RUG2 3W9AA 3ACFA 2E63A 1OQDA 3U14A 1Q56A 3WDWA 2AR6A 2PN5A 3LEIA 2QQNA 3H1YA 5AFEA 2UURA 4DOUA 3J9SA 2CTVA 2VZQA 3DPRC 1ASJ2 4FO9A 1O4ZA 1N3OA 4NHYA 1POV0 3N4MA 2E33A 2RDRA 2LRPA 3Q8CA 1FT9A 5C33A 3WP3A 5D2AA 2CWSA 2ZABA 1V70A 1AXZA 1F2NA 1LU2A 2VTXA 4AQTA 1GQPA 1N3PA 2W1QA 2XLAA 3AJZA 2BGCA 4D6SA 5FZOB 4FTBA 5FPVA 4UFKA 4RS5B 3OUHA 4HKLA 2FDIA 2HEYF 2GALA 4PBPA 1HKDA 4ZU4A 4MYEA 3RVHA 3V0BB 4E8DA 4CU7A 2W1UA 4U2AA 3PJQA 3UK9A 2XKOA 4UI9L 3PVOA 2OS2A 2XR4A 4YW1A 5I0UA 4FOYA 2JKXA 2MEV2 1MPXA 3HQUA 4FFIA 5LEJA 5L19A 1H8VA 1TNRA 3ETQA 4QX1A 1JTZX 1W9TA 3JQXA 5DAPA 4CU8A 3W58A 5JXGA 2BBVA 1JW6A 5A7PA 4CCLA 1CIYA 1OVPA 3MHZA 4BOWA 1W99A 4HKOA 1JYWA 1ND2C 1PVXA 1QQP2 3CBNA 2JX9A 4Z1VA 3KF3A 1AJOA 4N43A 3WSOA 2YDEA 1BBT1 2FDKA 1VBB1 1KD7A 1A3KA 3MV01 4XILA 4AFAA 4ARXA 2BGPA 4GA9A 1VAMA 2WYSA 2XVLA 4FAGA 1GWMA 1WBLA 1DQ5A 2QQWA 2IZWA 1W8TA 1EUUA 2J1RA 3OUJA 1VMJA 3ES4A 1CONA 4QGNA 4CXXA 5C8CC 2QNKA 4HN1A 3I3MA 4BQXA 3EB7A 3GALA 3C7OA 4QQLA 1EV12 2W3JA 5ACA2 5EP9A 4LXLA 1N1TA 4XFCA 4AI0A 3ON7A 2CHHA 2WQ4A 5BNNB 4C90A 1QXJA 3IT8A 1W2OA 4IXLA 1GICA 5DDJ3 4LOSA 5FQ0A 5JXJA 1JZ2A 4KWUA 3VLBB 3VDAA 3IDAA 3LA7A 5FYHA 4XOGA 1VLNA 4BE3A 4UW6A 3AXEA 1Y4WA 4XUPA 5LY2A 2WA4A 1XNDA 4NPRA 5HV0A 2C1FA 2JDAA 1NLQA 3UJQA 3T2OA 1AYM2 1DGWA 4WM7C 3AMHA 1RL3A 2OVUA 3R05A 4IV1B 5A7WB 4AVAA 4C0BA 3C7FA 2NZ9A 2Q4SA 3SHRA 1LU1A 2D6MA 5DUVA 2ZX0A 1W2NA 5FZIA 1TNFA 4YZ4A 4A7KA 5C5TA 1TME1 1JZ3A 1QQP3 3W21A 4MGTA 4IE7A 5AVAA 2Y6LA 3L9JT 4QPYA 1H0BA 2PQQA 4QDQA 3RZMA 2VMCA 4URTA 2IFWA 2C6SA 3SCGA 3IMMA 1JBCA 1C3HA 1QJU3 4XBNA 4GWMA 4XFGA 5I91A 1OA4A 2YPJA 1V9U2 3TAYA 2RS32 3USUB 4AI1A 5JOYA 3SISA 1LHOA 2JDHA 5A6YA 5I0RA 5HPOA 4LKSA 3TBDA 4A4AA 1HB3A 2H6BA 2VBBA 3BVCA 2HWF1 4B29A 2QQOA 2UY8A 2RDQA 1DYKA 4GMP0 1L7LA 2XVGA 3V0AA 5HXVA 3KM5A 3RWKX 1QKQA 2MEV1 3UNPA 2D40A 3WY6A 5LY1A 1W6MA 4Q4V1 3C7EA 4PI0A 3USSA 1DQ6A 4OI1A 2R063 3I3BA 2XOMA 1J3RA 1FI2A 4FOWA 3MIBA 2VOKA 4O65A 2DCTA 2K9ZA 4PJYA 1UU4A 1WGPA 2DTWA 3J8F1 3K46A 4XTMA 3SEEA 5F5IA 4XDPA 1BZWA 1W8OA 2W0XA 2CGNA 4XCAA 2V09A 1CAWB 1IS6A 2W94A 2B42B 2XBO3 4YSFA 4BK4A 3DPRB 2A6ZA 2WKKA 3TYJA 1PM7A 2R1DA 2XL9A 4Q4Y2 1DLCA 1K5MA 1SLAA 2BNNA 2FBEA 4UYBA 5FYUA 4QQOA 5FZ4A 4BLJA 3VHRA 5KHHA 2PMWB 3RZLA 2CWMA 3R4DB 5BXXA 2QQPA 4HN0A 5CIRA 3S5QA 5FPZA 1MS5A 3NJXA 1B35B 1UZYA 5LBBA 1DQ0A 5J37A 2F17A 4Y3OA 3JBG3 4TTGA 4LA3A 1R64A 5C9AA 1JYNA 4Q4X3 5FZAA 1YHFA 5JR7B 1O3TA 1OQ1A 3AMPA 3RMYA 2XXZA 2DV9A 4KGGA 2DWRA 2VUCA 2P2KA 3AP4A 5FOBB 2ZAAA 1ONAA 4IEOA 3M3QA 5CVRA 3FL7A 4EWAA 4UFHA 3IN9A 3TEYA 1W03A 3WXPA 5FOJB 5JPNB 1H6YA 3ZKYA 2DUQA 2R043 2ZX4A 4RYDA 3U78A 5IK4A 3ILNA 4NIIA 3AP6A 3WW3A 2CU5A 3NNMA 2WQZC 3VD4A 1HRV1 1XU2A 1NA1C 2ZKLA 1X50A 5GZCA 1D4VB 2XL7A 3CQOA 3INAA 2OX0A 3BB6A 1PO11 2C0ZA 1KDMA 2LALA 5JXHA 5AFBA 5KHKA 1WMXA 2P17A 2JEMA 4LR4A 5CKMA 1W6PB 3BPSA 4MG2A 1FYUA 1QDCA 1AR62 4QU1A 2WQ8A 4EJRA 4A6SA 2A3YA 1Y3TA 3BTYA 4Q2FA 4PCRA 4RR3A 2HWD3 2RE9A 1VP6A 5FAXA 5T55A 3LDBA 4LQRA 1NLRA 5FUIA 1ULDA 4IEVA 4M4PA 3WEZA 4HSJA 5B4XA 3ZDVA 5FZ6A 3ZN6B 1TZOA 4YG6A 1UWWA 2V73A 2HJIA 2RM23 4YYOA 3THDA 2ZGSA 3NNLA 4TWTA 4Q4V2 1ULGA 4LJHA 2WFPA 1O4TA 4NMIA 2CV6A 1LOFC 2ZEWA 5HV4A 1RGSA 3B9IA 1FMD2 3DKWA 4LUKA 1D2SA 1LHVA 5FMOL 3MIEA 2TUNA 2WO1A 4QXHA 4FPJA 1LHUA 2IXKA 5FY7A 4IV3B 1R083 1LGNA 3BOPA 5C3RA 1HV0A 4HPKB 4MH0E 3I54A 3ZLIA 1IKPA 4DPNA 2FDGA 3DPRA 4P08A 4NHLA 3T0BA 3RZZA 5FMDA 3KCCA 4XF3A 4Q4Y1 2ZHNA 3IBMA 4QB2A 3WP6A 4QM9A 3BOWA 1XYNA 4N53A 4AHXA 2JDKA 4IEYA 1RUJ2 4QKFA 3ZYRA 3Q8AA 2J7MA 2PHUA 3HQRA 2X05A 2W87A 4GXLA 4Z2AA 2VMHA 3KHBA 4GKXA 2ERFA 1AR63 1H9PA 1SFPA 1XNTA 1JZ5A 3ACGA 3EMRA 4ZS3A 2RS51 3ACLA 1K42A 5LZ6A 4Q4W1 2VOXA 1ASJ1 4EZ4A 3MW3A 4JGYC 3VDDA 2E7AA 4QX2A 4RQPC 2XWJB 3B00A 3QH7A 3J8F3 3WG3A 4Q27A 4R4ZA 3OPTA 3FN9A 4LBMA 3V56A 4C8DA 1GZWA 4J1XA 2YMZA 1OFSA 1E5HA 1K3IA 1AUYA 1H9WA 2RR12 5E89A 3PUHA 2A73B 4YVSB 1UU6A 4M01A 4FPCA 4NVPA 1LOFA 1YC61 5EJ3A 5T5OA 2VMEA 1KITA 1JXNA 1QU0A 1E5SA 4IGPA 3CIHA 2D5FA 3K4DA 2Q30A 2BRTA 1VBA3 5FY4A 1RUI3 2HWB3 2Z4FA 3U10A 1LOCA 1QJEA 1Z7S1 1LEDA 4XUOA 3VBHC 4WVMA 5H9PA 4RL7A 5A6ZA 2QCSB 3ST7A 2WS92 3WW1A 1SPPB 4AE2A 2YUEA 5HCAA 4AVTA 5CAZA 2F6BA 1AR61 4LBKA 4PHZA 3M7AA 5JWPA 1MZFA 1G9BA 1GP5A 4ZHNA 2P34A 1ENQA 3T0AA 2H0VA 5FP3A 4L2NA 3UKTA 3ZFEA 1K5MB 1R093 2DU0A 4EWEA 1OQEA 5EYYA 1RYYA 4WVVA 1BBT2 5FJKA 3AKTA 4ATEA 4IL7A 3TOJA 1WMEA 3WR0A 1MS4A 3ZXLA 4LO4B 1BJQA 2Y26A 4QXBA 4N9IA 4XF9A 3KCYA 3VBRB 3K77A 5J3UA 4I09A 1XOYA 5E16A 2TNFA 1RUF2 2Y0OA 5C3SA 2RDNA 3OY8B 1EV13 5F9TA 4FXKB 1ASJ3 1QY4A 2XJUA 3ZX7A 2P3KA 3BU7A 3C7GA 1DGRA 3OEBA 5CKNA 2RMU2 2ZJCA 1W6MB 3JD73 4H3WA 1BVP1 3LDRA 5DZFA 3HEIA 4A3XA 4CE8A 1UX7A 1ZVFA 2JDUA 4SBVA 3ZN4A 1VIWB 5C8WA 3AFGA 2Q8EA 4BIFA 1H2LA 1V9U3 3AMMA 2FMDA 1ZZCA 4R9DA 4D6QA 1JYTA 2ARBA 1W6NB 4XMAA 1I5PA 1GUIA 4C0HA 3GHNA 3IIAA 4K1ZA 1ZZBA 1QGLA 4JHTA 5H9SA 3VBOA 1ZRCA 1FOD3 3MPPG 1Y7BA 1UIKA 1YXWA 2VL4A 3CDZB 1ENSA 1LULA 1MZEA 3DL3A 4JRAA 1ST8A 5IVCA 3VHPA 4Y1VA 1GP4A 1S0CA 4KU8A 4FFHA 5FXZA 1W2TA 2GSYA 2XBO2 3JCIA 4Z8BA 4HFSA 3S5AA 1UMHA 3POIA 4N90A 5FDBA 1UKGA 1XNKA 1ZBE2 5KWRA 3ZFEC 3VL9A 1B35C 1A8MA 4DXTA 2DCYA 5DXDA 4WZFA 2J1SA 3PU8A 4FT8A 2R061 3FJSA 3LB9A 4PF5A 2D7FA 2YYOA 3GZEA 3HNYM 2G9ZA 4XJWA 5DPNA 4AWDA 3IDCB 4AHZA 1O8PA 4BCUA 5JAXA 1SACA 3POBA 1J58A 4LK6A 4MSVA 5IWFA 2FCUA 3VBFB 1UNBA 4XXPA 1LKNA 3VZJA 4AVSA 1YLLA 2EIGA 4DZGA 1WCDJ 3HN1A 2RR11 4XQDA 3WW2A 5JZGB 1W04A 2GMPA 1W3XA 5DAWA 1OLME 5T5JA 5DAVA 3LOBA 1UX6A 1ZBA2 2EICA 4CEYC 3WX5A 2JKBA 3BCWA 1M4WA 2LM3A 4X6RB 4QKBA 5EIYB 1WA4A 1JOPA 4NUBA 4L92A 2J1EA 2WAAA 2LW8A 1ALYA 4JVAA 4QKDA 4CSWA 1UW8A 2VC9A 1K5MC 5F3GA 3R0RA 4XYXA 2BV4A 1VRH2 2XHKA 1PX4A 3H3LA 4MXVA 1C8M1 4IE4A 4YGCA 3JBG1 4RD7A 3ZFFC 5A3MA 2FQPA 2VECA 3K48A 3NO8A 3FHQA 3U75A 1C8M3 2HEWF 4G4FA 4EV0A 3DXTA 1HXS3 1VBD2 4UW4A 1MS9A 1DYPA 2X53S 5JI9A 1VB4A 2A1XA 2VBDA 4Y5SA 4CP0A 4DUVA 2GNBA 5J98B 2KA3A 1COV2 1YQ2A 2PLV3 3POEA 4NIAA 3UKNA 2D6OX 3VBOB 3WP5A 2ZZJA 3MEPA 5B2GB 2Q8DA 3I2IA 4B4QA 1U5ZA 4XFBA 3UGGA 4IDZA 1RUOA 4AOCA 2HLEA 3W5MA 1VE0A 2WSVA 5H9QA 3WDTA 2B9VA 1NKGA 2XGXA 4YW7A 3N35A 5IVJA 2WAOA 1AL22 4OVEA 1NA1A 2ARCA 1OD5A 1GOFA 3KV4A 1JS9A 2X8KA 2VW0A 2VZTA 4LIUA 3OY8A 5F2WA 3SITA 3WF0A 2GN7A 2UY9A 3AMQA 5ERLA 3A22A 5FXWA 1RHI1 2DFCA 4CDWC 3CMGA 3R4SA 3PJYA 5EPAA 4HK9A 3T09A 5IVEA 5IYYA 1F9KA 2ETEA 1XB9A 3TEXA 4BQ4A 1E5IA 4EN8B 1RUH2 3MF9A 3NV3A 1HQWA 1VALA 2B8MA 5JCTA 1A8DA 5JLVA 1HRV2 1BHGA 4RR3C 2K0GA 5F3CA 3VV1A 2QZ3A 4UAPA 2OT7A 3Q9OA 4FPYA 4W6XA 4BM8A 5CADA 1JYIA 5KC6A 2P6CA 2A71A 1XQNA 1G86A 4RGKA 4K1YA 2P3JA 4A42A 1NCQB 1HJFA 1H2NA 1HRI2 2JE9A 3AX4A 5I0TA 2VVFA 4MVTA 2YBKA 3T3YA 2D6PA 1KJLA 2R073 4JKLA 4OMDA 4EQVA 3ZO0B 5FZFA 2EIEA 1WW5A 2VCCA 2PLV2 3SMHA 3ZN6A 1CX4A 5AC91 1C8NA 3F2ZA 1NCRC 4XJ8A 3VBUC 4AHYA 2OQ7A 1Z0HA 5J1XA 1O5UA 3MBWA 2OXBA 4I30A 3KCXA 4EZHA 4Y5TA 4H14A 3KT4A 4ET7A 4QB6A 2Y8KA 3RWNA 5JUVA 5LK7B 1NCQA 3B01A 4L11A 4I01A 5FREA 3ZMOA 1R1A3 2YU2A 5FLIA 3DV8A 4XMIA 2G4IA 4NHKA 4XHXA 2R0FA 1QJX2 5EWSA 1YIFA 4M3CE 5KXDA 1W0PA 4DRVA 4NIDA 3JZVA 3AXDA 3OBZA 5BV6A 4JGZB 4XDOA 3AYDA 2VTFA 3KQRA 3PUSA 5JIUA 4I2OA 4G3YC 1DBNA 2EIDA 3PLQA 4PIYA 2ZHKA 4CUGA 5K9YA 4K3UA 4QHZA 2Q5TA 2DU1A 4UWDA 5GM0A 2ZEYA 1F4AA 1X82A 1CAXA 4Q26A 3WCSA 2ZEZA 2C9KA 1ZZ8A 1H1IA 1KDKA 1QHDA 3RZKA 1O3RA 2DFBA 1O7FA 2ZGQA 3FUOA 5FBZA 3H1MA 4LUMA 3UGFA 1RC6A 3O1SA 3N7LA 3MFCA 2FHRA 1VBB3 1NE6A 5LK5A 2EXJA 4S2HA 4ONUA 4OI4A 3UGHA 1QIQA 3AZZA 3CZJA 1RUJ1 2RM22 3AZWA 1FOD2 4KI5M 4QPGC 1ZRIA 3MZHA 2OZ6A 5FZGA 1QH6A 1FX5A 3Q8BA 3ZPYA 3N9OA 1WLDA 2JENA 1MR5A 4AR2A 4MLOA 2AENA 5GKAC 1F15A 5G05L 3O14A 1QNWA 4OZOA 3KS7A 2ZAHA 4MX3A 2EVXA 3GHMA 3M8LA 5D21A 2GC0A 5LWBA 4LEJA 1EP0A 4IGOA 4LLOA 3VBHA 3K75B 4DB5A 2VMGA 4AK3A 3BODA 2HBTA 3ALQA 4CP9A 1AJKA 3LA2A 1WD3A 4EN0A 1F35A 1WA6X 1IQAA 3H8UA 4HVOA 1CPNA 1SQ4A 3TB0A 1UU5A 2AH2A 2R16A 2VZRA 5BNOC 1V00A 3AYCA 2R7EB 2Z69A 3K4AA 3EHKA 1CIWA 3CO2A 4JKMA 1RMU2 5F1RA 1GU3A 5FMBA 1P8JA 4GH4B 5A33A 1GZCA 4F3JA 4NHXA 3ZMNA 1YEWA 4JRLA 2SLIA 4M3CB 3ZKUA 2D3PA 3X29B 2D6KA 1V6MA 3I49A 2WSUA 1TEIA 4BQYA 4HOOA 5CFDB 4UBGA 5SV8A 4ZU5A 3DYOA 3HT1A 2XVKA 4QGMA 2YC2A 4D69A 4TXWA 5LB6A 1TME2 3ECQA 4HLTA 1JYVA 3MICA 1EAH1 4BQ3A 4C1XA 1WW7A 2JG9A 2QZ2A 1GANA 1Y9QA 4QM8A 5A6QA 2YGLA 4TLFA 4KWJA 4P00B 1I3HA 1RUF1 3T1LA 4X8NA 4WM7A 1WZXA 4OYUA 2GMEA 2BVBA 2P1BA 3AJYA 3HNBM 2A5ZA 2A3XA 3C8XA 4NR1A 2HWD2 3O7OA 3GBWA 3NQHA 4M3CF 4Y33A 1RUI1 2HWB1 3P5BA 3RGBA 3RJ2X 3WF1A 4CXYA 3LPFA 2ORZA 4ARYA 3H0OA 2X10A 2P5BA 1RHI3 1QJFA 1SLLA 1C1FA 1W8UA 1X7NA 3CU7A 2BUKA 2IXLA 2NM1A 2XJVA 3MYXA 4FFFA 2D6LX
chains in the Genus database with same CATH topology
4LTAA 4XBQA 2GC1A 4YG0A 3VKOA 3VZNA 2HWE2 3C2UA 1OPMA 3AP9A 5FQ0B 3VKFC 5FMOS 5CU1A 2WT1A 1YRZA 1QJY1 1OKQA 1GQGA 4KL1A 4H7LA 4YZ5A 3V0AB 1WUVA 3JUUA 4XTPA 3ZSLA 4A7ZA 3MIDA 4KQ7A 2B45X 1RUG3 4AVVA 1GSLA 2DURA 4IEPA 2D93A 2WC2A 3THTA 4Y26A 1FNYA 3GZTB 3TN93 3D82A 2QDNA 4QXKA 4GH4A 5A33B 4BMBA 1N1YA 3IKWA 2WNUC 2HEVF 1F31A 4N7IA 3VBFA 1ZBE3 3N7KA 3E97A 1H30A 3WCRA 4PBOA 1RMU1 4Y1YA 3P3NA 3VL8A 3VZLA 2ZMNA 1A78A 2Q0AA 2RR13 3ENRA 4K8FA 1IHMA 5L7OB 2R071 2HWE3 2SBAA 2JG8C 1I1EA 1H8TC 1MEC1 5LRSA 4YM0A 1VBD1 2W08A 3NVCA 2MEV3 2A6WA 4FTSA 3POSA 4B4PA 1FATA 1KQRA 1NXMA 3FX3A 4WM8C 2WLPA 3M70A 1AZDA 4LBLA 4ORFA 5BNPB 1SBEA 4Q8LA 5I8TA 3ATGA 4KU7A 1GV9A 1PK6C 1HQNA 2BTVC 4K21A 2D6NA 4GH4C 3ZXAC 1AYN3 1HXS2 1VBD3 1PVC3 3VHOA 2E9QA 1YYNA 1CAXB 5JVVA 4XE9A 3PVNA 1AR82 1YCIA 2TBVA 1QOOA 4Y22B 4ZKTB 4COWA 4QX5A 5BNOB 1U5XA 3LCPA 3NV2A 2BW8A 3LAGA 3TNPB 3ZFEB 5FLJA 3GBGA 3HMYA 4NWWA 3ZXKA 4GB33 4P5HA 5CA6A 5L7OA 1AR91 2FMYA 1HRI1 4RFT0 5F5QA 2WA3A 4P9GA 1UN1A 4N7UA 4FAHA 1JUHA 3LOIA 4P9YA 3JQWA 5HBAA 1BEV1 2JE7A 5DZGA 4XFHA 4ZXKA 4HANA 1PHMA 2D5HA 2DTYA 3N7MA 3NAPA 1S2BA 3RYPA 5BY5A 4PIXA 1GZWB 4RGAA 4AF9A 3I8TA 3K51A 3GF6A 3WDYA 5KXCA 1DZRA 1AR71 1AX2A 3SNMA 3WOGA 4CDUA 2OYZA 1LHNA 4QPGA 1PVC1 1Q3EA 4QGLA 1GR3A 2GNMA 4KG0A 4LBQD 4D3WA 2Z5WA 3TWIA 5EFUA 2W52A 3VZOA 4XF0A 3SXWA 1S0BA 1REEA 4HT1T 1IS4A 2CY6A 1V6IA 1RUE2 2BNOA 2WINB 4DNYA 3ZFFB 3P3PA 3SCHA 1GQHA 4GALA 1ZRFA 2ZGNA 3E5QA 5JOWA 3EQEA 1EAH3 4Q4Y3 5GZFA 5BNOA 4AI2A 3VHNA 3OJBA 2E6VA 5KXEA 1C5HA 1YNAA 2R041 4YM2A 2YV8A 4DMIA 4XW3A 5FLHA 4YW3A 1ENRA 1OLRA 1LECA 5J48A 4MGYE 2VULA 5GLTA 4KGQA 1U12A 2PAKA 4MZUA 1XE7A 3RQ0A 4KWKA 5LRRA 1GYKA 3WP4A 4CDUB 2GH8A 4Q4X1 1D0GA 3S30A 4CDWB 2PHXA 4QMAA 3D5OA 2ZX1A 2VOVA 3H7YA 1C4RA 2JG9C 4F8AA 1PO23 3TNQA 4AQ6A 2HWC1 5ACA3 3QCWA 3ZYIB 1S2KA 2AZ5A 1PZ8A 2NLRA 3I7DA 3NAPB 4HL0A 4AI8A 4E4SA 5JSPA 1O3SA 4WV8A 5T50A 3I59A 1RUH3 1FPN1 2XBO1 4Y1XA 3CJIC 1VBB2 1S0FA 1SMVA 2OA2A 3WG2A 2PAMA 1HV1A 3OGJA 3RSJA 3AKSA 4O9EA 1JUIA 4D94A 3I2DA 4JGZC 3EBRA 4AI3A 3SH4A 3VBOC 3O0VA 5JPMB 2CGPA 3A0NA 4R9BA 4QT6A 1PMIA 2AGSA 4CP2A 1SEFA 2DCJA 4M00A 2GC2A 1PZ9A 3FUQA 4H7MA 4OHWA 3O0XA 3OCPA 2HWD1 2XKPA 1PGW1 2JICA 4IEQA 4UXAA 1LR5A 5AC92 3B02A 3VBRC 1B35A 3IDBB 5KC5A 1BVVA 3KT1A 4Q29A 5GLWA 4HK8A 4XEZA 1GBGA 4DXZA 1MS0A 1CGPA 4CRQA 2JD4A 2I07B 5CFDC 5JSRA 1CQ9A 3DF0A 4XF4A 3IMNA 1QJX1 3EJKA 4M0HA 4JV4A 5CFCC 3VUOA 3SCFA 1VAKA 3JU9A 1V9U1 1QQP1 1F5JA 5HI0A 4CP1A 1GZ9A 1V6JA 3ROUA 1SLTA 5T5PA 4OHXA 4YFWA 4JDOA 3ZXEA 3AFKA 5JI7A 2RS31 4JGZA 3WQ0A 3ZFFA 3PVBB 4N9HA 1AXYA 1RUD1 4WVZA 1KFXL 2PHRA 3E5XA 3KLSA 5A3LA 1CN1A 1LOGA 1G6NA 3GNEA 1BKZA 1FNZA 3TN91 2N7GA 1IPJA 1LOEA 1RJ8A 5GZEA 1H8TA 1UCXA 3J8F2 1AYN1 5FO7B 3USUA 4XZPA 1OHFA 4Z2WA 2EXIA 2D3RA 1MVQA 4INDA 4PDWB 3S6PA 5K8SA 4OFGA 1SLBA 1HW5A 3MFAA 3FWEA 1QDOA 1ZZ7A 4D7TA 3RNSA 1RUH1 4E2SA 3WINE 1UKRA 2E7TA 1MEC2 1SLCA 4OHYA 3ASIA 3VZKA 3SH5A 1DQ1A 1NZCA 3VBSC 3N7JA 2BWCA 4E4DX 4M3CA 5GZDA 3S7EA 3BPZA 5BYNA 1H4HA 1WLCA 2OUJA 3D4KA 4DINB 3V0AA 4XETA 5DUWA 1YI9A 5EXOA 5GZGA 1H2KA 2IWGB 3WQ1A 2VNRA 3M3CA 2E53A 4Z82A 2Q1ZB 1H4GA 3LSEA 4P9JA 4S2FA 5A32B 3WHTA 1ZYBA 2XUMA 4UW3A 5GLUA 2RS33 1Q8OA 4UW5A 1Q8PA 4COUA 5KHIA 1FMD3 5BNQA 1RINA 4YGBA 5T52A 3D0SA 5C9AC 4IETA 3AP5A 3ZXGA 3MGUA 1QJU1 5L7OC 4S2DA 5C4WA 1XXNA 2JJ6A 3NV4A 3VBHB 4LE3A 2O8QA 1YFYA 4JQRA 1JN2P 1NCRA 3VBUA 4K6BA 1PGSA 2QKDA 3JD72 4TYSA 5KHGA 3R6SA 2PHLA 4DRRA 2XWBB 4BYYA 1PIV3 1R1A1 1WMFA 1C5IA 3D8CA 1NCQC 5JDBA 1ZRRA 3OBTA 3AKPA 4IEZA 3MLKA 2RS12 2OZJA 1SDWA 4XFIA 3NKTA 4JGYB 1WCKA 5I8YA 1OOPC 3UL2A 1H1AA 2DF7A 2RM21 4CDQB 5J7MA 3C3VA 4LBQA 3PTYA 1BEV2 2ZS6B 4CDQC 3G6JB 1UPIA 1DIWA 4GKYA 2Z2SB 2VQ0A 5E88A 1EPWA 2DVDA 1MACA 4GWNA 1L3JA 4IEXA 2XG3A 2VOWA 1G9CA 2I45A 4J1WA 4QPIC 2XH6A 4P9LA 1ZZ6A 2DUPA 2A7AA 4O9GA 4QU2A 1ZREA 2VH9A 1NE4A 4U36A 1DHKB 2PYTA 1PVC2 4ES8A 2H0BA 3RMXA 1ZM1A 3DUIA 1PO22 4PLOA 1PIV2 1OA2A 3QH6A 2PA7A 3QOPA 1RVF3 3J26N 1G7YA 1REDA 4LHKA 4WVWA 4KH9A 5KXBA 1RTVA 1J3PA 3JB4C 2A6YA 5FRAA 1IS5A 4RA0A 2BQPA 4GB32 1UD1A 1WD4A 4YGEA 1RMU3 1D4M1 4E9KA 4CEWB 3AKQA 2RS53 4L9BA 4NHMA 5L36A 3VKNA 1J1LA 2WNVB 1LGCA 5IK5A 1CVNA 1EAH2 1ULFA 2PHDA 2BNMA 4AEDA 1CAWA 1MZ5A 5F6LB 2D98A 5I0SA 4Z07A 3J4UH 2R042 4PIZA 4YLZA 2ZKNA 1SCRA 3HT2A 4JTNA 1BMV1 1PGL1 4FOVA 1EPZA 3RYKA 2ZA9A 1WLWA 1NA1B 4XF1A 2ZX2A 3ZYJB 4AGRA 2ZGLA 1SCSA 3AZYA 4XXAA 1CD3G 3RPQA 3WNXA 1KS5A 1OOPB 1D4M2 3FMGA 5IK7A 3UKVA 3RI9A 1CPMA 4Z92B 3AK0A 1Z7S2 4C91A 1PNGA 2P37A 3NWKA 2Y38A 3HIFA 1ZNPA 2HWE1 2VU9A 2VW2A 1BMV2 1EY2A 1RUJ3 1AR81 1MQTB 1V6NA 4W65A 4AEJA 1XNBA 2RS52 5CBLA 3FZ3A 2ARXA 1NOVA 4YVSA 3G7DA 2ZOEB 1RIRA 3V65A 4AEDC 4AFBA 1LB2A 3QD6A 2UYAA 5CFDA 5DUXA 1O91A 1T6GC 5JIAA 4YVWC 2OW4A 1V6LA 2GH2A 4ITCA 5CFCA 5J96B 3KMHA 2XJSA 1OLQA 2I74A 5KBFA 1URXA 1RUG1 4LBJA 4WM8B 1OA3A 3IM0A 4OZXA 4CEYB 4V1PA 4DQAA 2ET7A 2IXJA 5DUUA 2VMIA 3MIGA 1KJRA 4BLIA 2X5IC 2VXRA 1X33A 1SBDA 4NWVA 2ZMKA 3PVEA 3NL1A 3ZN5A 3ILFA 1QOSA 4LLFA 1NG0A 2BFUL 3VKLA 5BUVA 2W39A 3ZXFA 1R092 1VRH3 4N43B 4COYA 4YARA 4JDMA 3KGZA 4Y22A 2R6QA 2QDRA 2D3SA 4AFDA 2QFEA 3T1LA 4R9CA 4CZSA 1RUE3 2CAVA 4PLMA 3CEWA 4MUVA 1XU1A 2EAAA 3HWJA 2JG8A 3A4UA 3HR9A 2UWAA 3VBSB 4N43C 3BIWE 1ENXA 2NPIA 5DDJ2 3WZ1A 3AB0A 2HWC3 3IPVB 4CEYA 1OI6A 4YNIA 4XQ4A 5C8CA 4WM8A 2XB6C 4ISQA 4L8QA 1LODA 1AHSA 5F6KA 3RI8A 2B9UA 3POYA 4M0NA 4EN9B 5CFCB 2X5IA 3ZSKA 1G9FA 5SV5A 1S0DA 1EV11 3CL1A 3IDEA 5BNNC 4R52A 4E4ZA 1A6CA 1ZBA3 2HWF2 5FCCA 2BPA2 3OYWB 1RUF3 4IV3C 1NY72 1CESA 3AZXA 1VAVA 3CLPA 3UJOA 5DDJ1 5ACA1 1FAYA 3MIHA 2PHTA 2QE3A 4OULA 1YWKA 3DGTA 3O12A 4META 5EZWA 5CB7A 2BFUS 1BCXA 4G9SB 1D2QA 1AL21 1NXD1 2WIIB 3HAGA 1XYPA 3ELNA 1DQ2A 3LKJA 4LT5A 4E27A 1VBE2 1ZBA1 1YFUA 4LULA 4YGDA 3ZYPA 3WQ7A 5LEKA 2IC1A 3OD0A 3B93A 2HYKA 3QACA 3JB8A 3PMEA 3PHMA 3LWCA 4JAAA 4AYUA 1DZTA 1AYM1 2WZR3 1IOAA 3B5LB 1OOPA 1WW4A 4HZFA 3VDDB 1X8EA 2AYHA 3WW4A 1KRIA 2V5YA 3L2YA 4CDXB 4UBHA 4LBNA 1R1A2 1N1VA 3M3IA 3NAPC 2A3WA 2ZTNA 3AYEA 4BA6A 3WDUA 2XLGA 1GNHA 3ILRA 3CNAA 2WZPP 1RUC2 4Y20B 1VBE1 2RS13 5JZGC 2R32A 4QPIA 4YW4A 3E6BA 4CDUC 3M2MA 1DQ4A 1WCSA 1FPN3 4Y4YA 2P3IA 4YZ1A 4FCAA 1ULEA 5CNAA 1BEV3 3VN4A 2WLQA 1MVEA 1GKBA 4IEUA 4X8PA 2WFF2 1LTEA 1NYWA 4Y1ZA 1DDLA 1HRV3 3MLLA 3MW4A 4OI2A 2EALA 2ZGPA 3FBMA 4AEMA 2A75A 2VVEA 3MIFA 3ZVXA 4AGVA 2JXAA 2EXKA 1D4M3 1MQTA 2GDFA 2ZGTA 5TSWA 3LSDA 4Q0UA 5EV7A 4I3PA 2LUWA 2MNGA 1H1MA 4QD2A 1PIV1 2O0OA 4XIOA 1CJPA 4HVQA 3WLUA 4P9WA 4DY3A 1GLHA 1POV1 3ZFGB 4IV1A 4BIOA 3H3ZA 1NY71 1QJX3 4XPVA 1AYN2 1LJ7A 1HRI3 4BWOA 2YC0A 4E2QA 3FBYA 2XJTA 4Q1PA 5D1IA 1FPN2 3EO6A 1FMD1 1PNFA 1QXPA 2FZ1A 4FPEA 1X36A 4QHBA 4HVRA 4J6GA 4LHLA 2PFWA 1TMF3 3ZSJA 3RYRA 1U5YA 4LO5B 1SBFA 1DGWX 1XRUA 4EWDA 3T2TA 2NP0A 1PO12 1CAVA 3BTAA 1LEMA 1W6OB 4FQZA 4Q0VA 4XQWA 1X8MA 4LO7A 2DVGA 1N47A 2BVVA 4Q0PA 4FPGA 3NSTA 1C1LA 1CAVB 2CGOA 3GYDA 4AFMA 1FV2A 5FPXA 1QOTA 1DU3D 1FOD1 4RR3B 4B8EA 4YW5A 1RVF2 2W68A 2WJSA 2KM2A 1IPKA 3VBRA 1S0IA 1XNCA 3H1WA 5H9RA 4ATFA 4FPKA 3WV6A 2DCKA 4FP3A 2R49A 4YRDA 5I8SA 1ZA4A 1RUI2 2HWB2 4AHWA 2C9AA 1W2UA 4N53C 1LCLA 1QJY3 3AP7A 3VKMA 4HMZA 4QQ2A 3AKRA 1CAUB 4LBQB 1H2MA 1BYHA 1W39A 4OHVA 5CG9A 1OMIA 1RVF1 1ND3A 3ZIWA 1AX1A 4JGYA 3NJZA 5J09A 1PZ7A 2ZZQA 4H55A 1S0EA 1ZRDA 3KB5A 3MPBA 1BXHA 2VUJA 5C9AB 2WS93 3BALA 4KG8A 4I0WB 1LOBA 1UF2C 3FFQA 3H50A 4L99A 1VR3A 1KXGA 1APNA 1J1TA 5GLZA 4I0BA 1M06G 2G9GA 3LGRA 1PO21 2QUOA 3ZXJA 1XE8A 3WG4A 2QVSB 4D7SA 4LNVA 3N3HA 1POV3 4K9SA 1YUDA 3L2HA 2ZGRA 2WWSA 1WW6A 2O8OA 2VGDA 1UAIA 3WDVA 4FOQA 4GIQA 4R8HA 2YHJA 5JOZA 4N53B 5GLVA 1MS3A 4BZ4A 5BNNA 4I02A 3SLIA 3VBSA 3HD8B 1G9DA 4AW7A 1J59A 4A2UA 1ZBE1 2WNUA 1ULCA 5DG2A 3WDXA 3ZIXA 4IV3A 5I93A 3O0WA 2Z79A 2ZGOA 2R062 4PDWC 3ZXDA 1TE1B 1DLLA 2PHFA 2DYCA 2WL1A 2CAUA 3OF1A 2D97A 3RG0A 1TME3 1S0GA 2G9FA 4RHV2 1U5IA 4LO6B 2XJPA 2XJRA 3OTFA 1UIJA 1Z7S3 4BHPA 3RRDA 4GMP1 2EA7A 2RS11 4B7KA 1IGOA 4F83A 5ABJB 1ND3B 1BBT3 2JDZA 2YROA 4FPFA 5JSOA 1AL0G 1I9RA 4BPZA 3JBG2 3OYWA 3I59B 1KFUL 1LOAA 2ZBJA 1IZ3A 4NN0A 1I5ZA 4AQSA 1N1SA 5K0UC 4EROA 2C5DA 1TMF1 1QF3A 4E2GA 4EN6B 2VNOA 1C57A 4DFSA 3CJIB 4GMP3 3WD5A 3FHIB 1JOJA 1VBA1 4Q4W3 4W6WA 4KBBA 1R1ZA 2PELA 3IPVA 4BH9A 2NMNA 3FLTA 2ZCWA 4YVWB 2R072 2WT0A 3B7MA 1HIXA 3ZSEA 2ZGKA 4K7JA 1ND2B 3CF6E 4P9XA 5BPXA 4AVBA 1AYM3 2WZR1 4BQ1A 4IEWA 3PMSA 3D0JA 3I4IA 2EAKA 2JECA 4OUMA 5GALA 4GB31 1MQTC 1MS1A 1BQPA 1AR72 1ZZ9A 3PNAA 5HCBA 2D43A 1DG6A 4FPHA 3B9CA 4GULA 4TSVA 1AL23 1RB8G 4RGGA 3HQXA 2MHFA 5EYXA 5CG8A 2WNEA 4MGIE 4AQ2A 1CJDA 2XLFA 3RJRA 2NQYA 4OHZA 3B69A 2B46X 3V0BA 3FFZA 2DCZA 4K40A 2AUYA 4QPGB 1F8VA 4AEDB 2B39A 1RUE1 1S55A 2ZPXA 5KHJA 1CAUA 1COV1 3CJXA 3ZFGA 1YIPA 2VVDA 3KZ4C 2ZMLA 4CDWA 2VNGA 1OFNA 2B5HA 5E1RA 3LA3A 4LE4A 2PAEA 4Q0QA 1Q5OA 1FV3A 2WNVC 3M3OA 1Q8VA 1WMDA 2DUOA 1W0OA 3RS6A 1UMZA 3M4FA 4S2GA 2HWF3 1QH7A 4FTEA 1RJ7A 2ET1A 1TMF2 1B09A 1HX6A 4WBBA 3QBQA 2YGMA 3B3QE 1VJ2A 1GNZA 4YM3A 1LENA 1KS4A 2O1QA 2ENRA 3ME2A 4PQ9A 3AM2A 3ZDSA 3URFA 2R1BA 3GBFA 2FZ2A 3AMNA 4Q4X2 2Y0IA 4IQPA 2GAUA 2GN3A 2OUHA 5AVPA 4ZU7A 1SLIA 1QMJA 4MXWB 2Q8OA 4GQ7A 4EN7B 2WZR2 2PLV1 2ILMA 3KSCA 4YVWA 4AXOA 2R0HA 4LHNA 3U11A 5AC93 2JG9B 2JG8B 2ZGMA 4LO8A 2XJQA 2I2SA 2WNVA 3NV1A 1O4YA 1NQJA 2X29A 3CJIA 3HBZA 1NQDA 1QXRA 2B7YA 1R091 5JMCA 1YO8A 1RUNA 1PGW2 2DVAA 3M1HA 4XJUA 2GNDA 4OI0A 2HKXA 5BNPC 3WHUA 1RUC1 5HCFA 1Z78A 2E51A 1HLCA 1LHWA 2VG9A 3OGGA 3THPA 4FPOB 2A6XA 2ZHLA 1YI7A 2D44A 5IK8A 1YFWA 1JH5A 2IXCA 4CEWC 3S7IA 1PO13 4W6YA 2K2SA 3VGIA 3WUCA 2PTMA 4YFZA 2BEOA 4ASLA 2LTNA 1MS8A 4HKWA 4Q4V3 2R30A 5A32A 4JC1A 1MZ6A 1DGRN 2VQAA 4RS5A 4BMEA 1IKQA 2EXHA 2X5IB 1PK6B 1R082 1F5FA 1GFF2 3DN7A 1Q43A 5K7PA 1QWRA 3FLRA 2DVBA 5E8AA 4R9AA 5C8CB 4LBOA 4MGKE 4QQPA 4L97A 2WNUB 3UV9A 3U4XA 1LGBA 3FE5A 3TN92 4COZA 3T1MA 3ZYGA 3VDDC 4QPIB 4RQPA 5C6CA 5FO9B 4D7YA 1SFYA 4Y24A 4PDWA 5IUQA 4Y20A 1UPSA 2E7QA 2RJKA 5BNPA 2Q1MA 4MXWA 5J36A 2GZWA 4YZ2A 1AR93 1AXKA 1H8TB 2YXSA 1AF9A 2YZ4A 1W6QB 4YZ3A 1R081 1UL9A 1Y43B 2Z42A 1OPOA 4HETA 1QJY2 4P14A 4CDXA 4Q4W2 2VPVA 1YJKA 2NYYA 1W6NA 1VBE3 3WUDA 1REFA 2QJVA 3IWZA 3EXUA 4QQHA 4ES9A 4RS5C 5L73A 1WLTA 1AVBA 1S0JA 3MDPA 1Q8SA 5T3NA 4WM7B 1IS3A 4YM1A 4RHV1 2GC3A 4Q0SA 4ISRA 1V6OA 5K0UA 1COV3 1O5LA 4HBNA 3VZMA 3E6CC 2ZHMA 4NO4A 1YJLA 1QJU2 2TEPA 3MW2A 2GMMA 1RUC3 3KT7A 1RUD2 5D8AA 3W59A 2UWBA 4FPLA 1OSGA 1VB2A 1S1AA 4Q1RA 4FP2A 1VBC1 3ZSMA 4CYDA 1WBFA 3R4UA 1C28A 2WFF1 4PLNA 4RHV3 4Y1UA 5FO8B 1TQ5A 4MV2A 1MEC3 4AG4A 5GJ6A 1E57A 5JZGA 4SLIA 4CDXC 1DF0A 3H9AA 1DGLA 2OIIA 3OD4A 2WT2A 3JD71 5C4WC 3O5SA 5IT6A 2RMU3 4AGGA 4C1WA 1J3QA 4IERA 4B7EA 3LZZA 4YG3A 2RMU1 2MPFA 1BK1A 3MF6A 3VBFC 2OPKA 4KNCA 4I0AA 2ZGUA 1N3QA 3KD4A 2F4PA 3U0ZA 3NW4A 5ABJC 3E5UA 4XJAA 4RSUA 1UZZA 1VBC3 4OUSA 1W6OA 3B94A 2IXIA 4COVA 4OLLA 1DZQA 5D8AC 2ZX3A 1HDKA 1LRHA 1NLSA 2GNTA 4JCKA 4JDNA 4CDQA 5T5LA 4XHBA 4IV1C 3FC0A 4RQPB 4B4RA 3ZFGC 4B3NA 5DZEA 4HPKA 2GU9A 3POWA 1YFXA 4Y5Z0 4F7ZA 4TZDA 1QNYA 3SH3A 4R4XA 1AR73 3OPZA 1CR7A 1PK6A 3N36A 1NCRB 3VBUB 4XJZA 4LA2A 4CTEA 3WT3A 4DS0A 4K20A 4FSJA 2WS91 1JYCA 4AEKA 3U07A 3M3EA 2VUAA 3NKGA 1HXS1 4JTOA 1LESA 2ES3A 2VW1A 1DFQA 1VRH1 3WVJA 2IXHA 1C8M2 5ABJA 1JHNA 5T54A 3V64A 1VBC2 2A70A 3QLQA 2EF6A 4FXGB 1FXZA 3APBA 3H3UA 1W6PA 4XIKA 3AYAA 3TRSB 4IESA 2UU8A 4XBLA 2DVFA 4A7YA 4XJ9A 4FQ4A 5DG1A 1RITA 4AFCA 4XFAA 4NOTA 2ATFA 2CNAA 2H6CA 3A0KA 3MI8A 4MGZE 2BWAA 2UYBA 4XFFA 1I6XA 1HQLA 4WZCA 5D8AB 1AR83 4FVVA 2UWCA 3RDIA 3WG1A 3S0MA 1QJZA 1AR92 2RHPA 4P9IA 2YY1A 3GZAA 2WFF3 1O3QA 1EYBA 5K0UB 1V6KA 2A6VA 2CL2A 2IFRA 3E6DA 2XPJA 1RHI2 3H7JA 4YW2A 5JOXA 1U0AA 4HSLA 4I3GA 2ZACA 3KGLA 4KWLA 4XDQA 4FBFA 1VBA2 1D0HA 1ND3C 1SFNA 1AX0A 2PHWA 1Q8QA 2KXLA 2RJLA 3D6EA 1G8WA 4CEWA 5C4WB 1G9AA 3GZUC 4ASMB 2NN8A 4YVSC 1W6QA 1PGL2 3OBRA 2HWC2 4X6QB 3MLJA 4WVMB 1XYOA 1ZX5A 3FLPA 3ES1A 5FTTC 4Q8KA 2AREA 2NMOA 2BYVE 2VY0A 1RUD3 4AVCA 1ND2A 2CYFA 3AZVA 4DY5A 1RUG2 3W9AA 2E63A 1OQDA 1Q56A 3WDWA 2AR6A 2PN5A 3H1YA 5AFEA 2UURA 4DOUA 3J9SA 2CTVA 3DPRC 4FO9A 1ASJ2 1O4ZA 1N3OA 1POV0 3N4MA 1FT9A 5C33A 3WP3A 2CWSA 2ZABA 1V70A 1AXZA 1F2NA 1LU2A 4AQTA 1N3PA 2XLAA 3AJZA 2BGCA 4FTBA 4RS5B 4HKLA 2HEYF 2GALA 4PBPA 1HKDA 4ZU4A 4MYEA 3V0BB 4U2AA 3PJQA 3UK9A 2XKOA 3PVOA 4YW1A 5I0UA 4FOYA 2MEV2 5LEJA 5L19A 1H8VA 1TNRA 3ETQA 1JTZX 2BBVA 3JQXA 3W58A 1JW6A 4BOWA 4HKOA 1ND2C 1PVXA 1QQP2 2JX9A 4Z1VA 1AJOA 4N43A 2YDEA 1BBT1 1VBB1 1KD7A 1A3KA 4XILA 4AFAA 4GA9A 1VAMA 2XVLA 4FAGA 1WBLA 1DQ5A 2IZWA 5C8CC 3ES4A 1CONA 4QGNA 2QNKA 4HN1A 3GALA 4QQLA 1EV12 5ACA2 1N1TA 4XFCA 4AI0A 2WQ4A 5BNNB 4C90A 1QXJA 3IT8A 4IXLA 1GICA 5DDJ3 5FQ0A 3VLBB 3LA7A 4XOGA 1VLNA 4BE3A 4UW6A 3AXEA 2WA4A 1XNDA 4NPRA 2C1FA 3UJQA 1AYM2 1DGWA 4WM7C 3AMHA 1RL3A 2OVUA 3R05A 4IV1B 4AVAA 4C0BA 2NZ9A 2Q4SA 3SHRA 1LU1A 2D6MA 5DUVA 2ZX0A 1TNFA 4YZ4A 4A7KA 1TME1 1QQP3 5AVAA 3L9JT 4QPYA 1H0BA 2PQQA 4URTA 2IFWA 3SCGA 1JBCA 1C3HA 1QJU3 4XBNA 4GWMA 4XFGA 5I91A 1OA4A 2YPJA 1V9U2 3TAYA 2RS32 3USUB 4AI1A 5JOYA 3SISA 1LHOA 5I0RA 3TBDA 2H6BA 2HWF1 4B29A 2UY8A 1DYKA 4GMP0 2XVGA 5HXVA 3KM5A 1QKQA 2MEV1