2JGNA

Ddx3 helicase domain
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
166
structure length
151
Chain Sequence
TSENITQKVVWVEESDKRSFLLDLLNATKDSLTLVFVETKKGADSLEDFLYHEGYACTSIHEEALHQFRSGKSPILVATADISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNERNINITKDLLDLLVEAKQEVPSWLENMAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ATP-DEPENDENT RNA HELICASE DDX3X
publication title Expression, Purification, Crystallization and Preliminary X-Ray Diffraction Analysis of the Ddx3 RNA Helicase Domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 53
structure length 151
sequence length 166
chains with identical sequence B, C
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2007-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00271 Helicase_C Helicase conserved C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2jgnA00
3RS2A 2R6GA 2IYLD 3SJAA 3SFVA 1AGPA 1G41A 4LYHA 2WVJA 4WBSA 4ESHA 3SJCA 3EC1A 5FPKA 1MOZA 2QN6A 3NKVA 4DB4A 2JDIA 4L9WA 4Z1MD 3TQFA 4URZR 2NPIA 3GLGE 3CX7A 2AN9A 4DEYA 5KSYA 1ETUA 1SXJD 3FOZA 1ZNXA 3F3YA 2A7QA 1NBMD 1R0WA 3CH5A 4DUGA 3ZVNA 4M9SA 4KODA 5CK5A 3BBPA 1Y63A 3BFXA 1GG2A 1N5KA 1P62B 4IDOA 1PLLA 5F9HA 4MGIR 4KSBA 3DOEA 2GJAA 3TR0A 3TVDA 2BKUA 1Z2AA 3R8CA 4AI6A 1YHNA 1U0JA 2C2HA 2A5FA 4LK2A 1XD2B 1AQUA 4YMWA 1O87A 2DWPA 2RGXA 3DOFA 1VG1A 5AJWA 1PVOA 3BD9A 2REOA 1TEVA 2G1KA 2QPOA 3UMFA 1A2KC 2V9PA 4UJ3A 3OEED 4D0LB 1A4RA 2W2XA 1ZM9A 3UK6A 3AH8A 3B1ZA 4BPBA 1TX4B 1JEDA 1R5OA 3W5IA 4F91B 3TSZA 1F2UB 3VHLB 4OJQA 2QU8A 3OIUA 5CB8A 4JLKA 3GLHE 2QMEA 2WWYA 2VP0A 1WDTA 1OXVA 4QBHA 3CKLA 4LSGA 5GJCA 4R9UC 4UNSA 1XTJA 4D4MA 5FBWB 1U2RA 2GETA 4BASA 4BLTA 3QF4A 3GJ4A 3PJRA 1AM4D 1R10A 3M4YA 5J4VA 1ANKA 4LDJA 3UATA 3LBHA 1OH7A 2A2ZA 5DN6D 1CJVC 3EASA 5FTKA 1XMSA 2GWHA 2JJ2D 1ZC3A 4MITA 4CEJA 4EFLA 3E5HA 1OKKA 1IN5A 1NLYA 3RS4A 3J81k 4WW0A 4PXAA 2ZI3A 4TLEA 4DLXA 3ZQ6A 3TSWA 1E9FA 3Q7PA 3D7MA 4LOAA 1AGRA 1KDRA 2OO7A 3LDAA 2IEZA 3NH9A 5KNDA 1Q44A 5K8IA 3PR1A 2CE2X 1QZXA 2WIAA 4U00A 4B71A 5LPNA 4IJMA 3KQKA 3EPKA 1KDPA 2Z4SA 1S0UA 2ZRDA 5G3ZA 2Z83A 3HYRA 3E70C 3RAPR 1KMHB 2R8RA 2WMOB 3CNNA 2OILA 2EYUA 2GHIA 2FF7A 1YZNA 5FTJA 2VHQA 2ZEJA 4MKFA 4Q1CA 1QG4A 1UDXA 3SNHA 1QVRA 4XWKA 1W1WA 2P5SA 2H7VA 4LHWA 2FPMA 2QSZA 4HB0A 1I2MA 1DG1G 3LQQA 1TQ4A 2JLSA 4HLQB 4LJ6A 1BMFA 1PLKA 3IKJA 3RSOA 1RJ9A 3GJ0A 1C4OA 2H92A 4RZUA 4JKYA 1GKUB 3U4QA 4MKHA 2ZRCA 3ZZ0A 1OLOA 1DTSA 1E2DA 1YZKA 2ZU6A 2R6FA 3QUSA 1VHLA 2ZJYA 3T34A 3VTKA 421PA 5AUOB 3QY0A 4QM7A 4TLBA 3GLFE 1YKSA 121PA 4AIIA 1YR9A 5AUQA 1FMJA 4QL3A 1XPOA 2PCLA 1FUKA 2CHQA 3QE0A 4L9SA 4PHTA 4A0FA 2ECKA 4A15A 1RRPA 2DYKA 1SHZA 1NMXA 3AF1A 1XTRA 4Q1DA 5EZ5A 4HEJA 1KI2A 1S9DA 2EFEB 5JCPA 4LGMA 221PA 2ZSBA 5JEEA 2XSZA 4EUNA 1W4CA 3AM1A 1AIPA 1E9AA 3LBIA 1CEEA 5CK4A 3U3MA 2YYZA 3AV0B 4KV9A 2W6JD 3K0AB 1E79A 3WNCA 2ODWA 2UVQA 5BN4A 1UKZA 1KSHA 2N46A 4RSGA 3AP3A 2P5TB 2ZJ8A 5JJLA 1KO4A 4TTRA 4C0KA 1GWNA 4NYIQ 2FFAA 5JLJA 2J7PD 3GLGA 3BH7A 3BS4A 2FSFA 1KKLA 2I3BA 5EJEA 3ZIAA 4KO8A 5HKKA 1IJFA 3NWJA 3W90A 5LD2B 2REBA 3AF3A 2MMGA 2BBWA 1AS0A 1W49A 2FDCA 4Q1FA 3D31A 5KHOC 4MH0R 1YZLA 1KJYA 2CEAA 3I72A 4TQUS 2CCJA 4HB2A 4MQBA 4LZZA 1E2EA 2Z43A 5EP2A 5FBLB 1SKYE 1CP2A 2W6ID 4RZ2A 1G7CA 4QBFA 4C3ZA 2ZRFA 2XOKD 3CW2A 3K53A 3FYHA 3UG7A 4BFWA 2IYSA 1GOTA 3GJ3A 3AKYA 4RKEA 1NLFA 1KGDA 2V6JA 1CTQA 5EE0A 1F5NA 1JQLB 1N6LA 2A5JA 2IS4A 3KB2A 2XNDD 1II9A 4D82A 1FOEB 5LD2C 2D3WA 4B3GA 3CNLA 4JKIA 4B76A 4HZUB 4RZXA 2ZE8A 4AG6A 1G8PA 1ODFA 3IHLA 4MRRA 4JBYA 4PSAA 2G3YA 3BXZA 5LBIA 2V1XA 4HLUC 2BDTA 3GLHA 1H8EA 3DEFA 4Z54A 1SKQA 3LXRA 3IGFA 3QJYA 4QJ3A 4XSHA 3UKDA 2VSXA 3NC1C 1JALA 3GFTA 2CL0X 1XTKA 2LCFA 4TMVA 3VMFA 3W9YA 2G83A 1DAIA 4K46A 1TQ6A 5AJVB 1IQPA 2FFBA 3VKHA 5JHHB 2QSYA 1Z0KA 3EARA 1EWRA 4XVUA 4FMBB 1QF9A 1ZD9A 1S96A 4ZKEA 2IWHA 4EFNA 4TYPA 4TMXA 3Q7QA 2ZI5A 3TUIC 3I5YA 5B2ZA 3VHXA 2W2VA 1KI7A 2F1IA 4PAMA 4OHVA 1GILA 4JVLA 1Q21A 4LWZA 4PSKA 3FMPB 1E3MA 3CNOA 4B32A 3QPWA 2D74A 2BJWA 4EPYA 2Z6VA 3RABA 4IVRA 3K09A 2V7QD 2I1VB 1XB2A 4LYAA 4O0MA 3C4JA 2IF2A 2X1VA 4TSFD 1N2CE 3C8UA 4DEXA 1OE0A 2GCOA 2WOOA 4XVQA 1P72A 1NVUQ 4XH9B 4TYQA 2V54A 4HSEA 1H8HA 2FH5B 5DI3A 2W58A 3MGCA 3RS5A 4BFVA 3ZJYA 5HZHA 2VBCA 3M6AA 3N2IA 4JL5A 4C7OB 3WRYC 4BLRA 2XITA 2HT6A 3QF4B 3G0HA 3D8BA 2QA5A 4Q4JA 4I1UA 1W44A 2UZ3A 4XOIA 4FMDF 2UKDA 2ZIAA 2IYUA 4PSVA 5EZ6B 3KQHA 4PZZA 4UNNA 4A6PA 2O0KA 4CEJB 4TT3D 3UIEA 4D6PA 3EWAA 2A5YB 4NCNA 3GLFA 4B33A 1ZINA 2BOVA 1CR1A 2IYZA 2QROA 3VAAA 3QIAA 1U98A 1RYHA 4QM6A 1Z07A 4V02A 2AWNA 4G5RA 4IFEA 2DWOA 1CULC 2PJZA 3VR2A 4A9AA 3OAAD 2XTNA 1W5TA 2QAGA 5E7IA 1KZGB 3WP0A 5BN5A 3EX7C 3I92A 2D7DA 4LJAA 4D2IA 1EFRA 3IHWA 3PEUA 2B92A 3EAQA 4IRUB 5JRZA 3KXLA 1DO2A 4HLCA 1Z0AA 4IXMA 1OFTA 2D2FA 4CT5A 2QUZA 3OZXA 1E1RA 3U7FB 5KO2A 1ZUHA 2ZI6A 4C0AC 621PA 3AB3A 1FNMA 4IEEA 4JZKA 1FQJA 2WBLC 3L8ZA 1TADA 1SVLA 4Q4AA 5IDVA 4RCZA 1GP2A 1VYVA 3S1AA 1N6IA 1N6RA 1JPNA 2D4HA 2ZUCA 1R8QA 4L16A 3ZS9A 2FZ4A 2VH5R 3U4QB 3O8RA 1NLZA 3BOSA 3HR7A 3EPLA 4QHTA 4GNKA 1YZQA 2QMOA 4G5SA 3HDTA 5SZHB 4B44A 2J41A 1EX7A 3CIOA 1WMSA 2V6IA 4XWOA 3PIRA 1L4UA 2VSOA 1J7KA 2JAQA 2A3RA 2FOLA 2QP9X 4GMDA 4PO1A 3D3QA 4TYWA 1ZM3A 4YXWD 2ZRNA 2QAJA 3IO3A 4HAYA 2OM2A 4AKEA 4G5QA 2QT1A 4KYIB 5D3MB 3FFBA 5LB2A 2WWXA 5DLQC 3WRXC 2GEUA 2AX4A 4JT2A 3NDBB 4P3YA 2CL6X 5JMTA 3Q5EA 1TUIA 4D4KA 3L0OA 1X8KA 3ADDA 4GBMA 2IXFA 2ONKA 4MRNA 4V0MA 4G5GA 2F3RA 1UBFA 1TNDA 5JCZA 1KZ7B 5TV2A 5IRCD 5DYGA 1N6OA 4OQFA 4WA7A 3R9IA 4ZCLA 2O0JA 3JVUA 1Z0DA 3CLVA 2BMDA 2JJ8A 4Z8XA 2CNWA 1MO5A 2GRJA 1HT2E 2ZSAA 3RRZA 3EZ7A 4Q00A 4BFTA 1YQTA 2BJVA 4KBFA 2WIBA 1G21E 4JLPA 2QENA 3GQBA 4GL2A 3QENA 1E0SA 5FPTA 4WIAA 4ZDJA 3FKSA 1NIPA 4BRUA 3DL0A 2VLIA 4IKEA 4NL4H 5F9FA 4R71A 4BECA 2B21A 3X1ZA 1WRBA 2QTVB 3O8DA 2GEVA 1E2KA 3PEVA 1AKEA 2WPDA 4PC2A 4OYHA 3RHFA 1Q1BA 2ODNA 1ZCBA 4LV8B 2RH5A 1LNZA 1XD2A 2ZSEA 5BWMA 1BKDR 2CLDX 2F9MA 5AJYA 2LWIA 4QBGB 1U8ZA 4NMMA 5AWFC 3AVOA 2ZR0A 2JJ1A 1Q12A 1KK3A 3I5XA 4M21A 1KNXA 2BMEA 2IF0A 2DB3A 5JFGA 1X6VA 1MRNA 2NTYC 1RRCA 3SQWA 3U60B 1F2UA 2GCPA 4XSGA 4DBLC 3DMNA 4UNRA 4A8JB 4BFUA 4Z1MA 1G9XA 4DSUA 4RD2A 4GT1A 3O47A 4EAQA 1SXJA 1D8TA 1E69A 1GRQA 1U9IA 1NBMA 3AGPA 4IOMA 4QG7A 2J0SA 5FPSA 2PT7A 4UNQA 3AF4A 2AKYA 4BZXA 4IVQA 1KSJA 4KFRA 5G3YA 2GVDC 2H5EA 3MAAC 4A92A 2Z0MA 3GCGA 4JLVA 4M9ZA 1WF3A 4OQMA 1OHHD 1ONBA 1DAFA 3KFVA 4FMCB 2A9KA 2OEPA 4DVGA 3A1TA 4TMZA 1CRQA 3ZDQA 2GEDA 4QHSA 1LF0A 3U3KA 3VU9A 4W5HA 1N0VC 1L2TA 2GCOB 4OI2A 3THXB 3OEEA 2IS6A 4LCBA 1VTKA 4ZDKA 5BN3A 1Q3HA 2FPLA 5K8TA 2PMKA 3K0FB 2HF9A 1FNNA 1COWD 1CKEA 1N5IA 1Q0UA 2YOHA 4MGYR 1UADA 3I73A 2J0QA 2IEYA 3EA0A 1RRFA 5BYJA 3R8FA 3KTAA 3QXXA 1P61B 3QG1A 4D0GA 4XTRA 2IWRA 2R6AA 1W46A 5J4YA 2RGEA 3WYAA 4WZ6A 3K09C 5CM9C 4RCYA 4Q4JB 2R44A 5TARA 4P4SA 2EFHB 3TMKA 2B8TA 2R65A 5EP4A 4PC1A 1DG3A 1T5IA 4UKDA 2KBFA 4JL6A 5B64A 3DO6A 3IEUA 2ZRAA 3FMOB 3IIJA 2EVWX 1VKJA 3C5CA 3L0IB 4RD1A 2FMXA 1US8A 2J45A 3BH6A 5DN6A 4IXNA 2JJ2A 4V0OA 4EJSA 1GNQA 1HH4A 4DDVA 1MT0A 4HB4A 2QAGB 3ASYA 2DPXA 1FX0A 1XDBA 1UBGA 1IXZA 3BE4A 2VYFA 2XNSA 3CR8A 2C03A 2QZ4A 1OSNA 1VHTA 3DZ8A 4U02A 2GK6A 3KKMA 4RZ3A 1VIYA 2L0XA 3HPQA 5DNYB 1NVVR 2AFHE 1GRNA 5FI0B 1OIXA 1OFUX 3M0EA 3M1IA 4Q4AB 2P3SA 4NCHA 1BOFA 4TZ0A 1GUAA 4QXAA 3S1AB 1EFHA 4FWIB 3EIQA 1Z3IX 3F0TA 3GPLA 1W0KD 2F9LA 2QAGC 4NKRA 1E2IA 3U3OA 1UEIA 3GEEA 2GJ8A 3ADKA 4L15A 2RKOA 3PITA 3UWOA 1HUQA 1JR3D 5IT5A 3I32A 4PC7A 1K8RA 4BEBA 3BFKA 4I99A 4Q48A 5FBRB 1EFTA 2YOFA 3K0AA 2BCJQ 1N6KA 2ZE5A 4OQLA 3KFXA 4M8NE 4US2R 4ON9A 1DO0A 1KI6B 2HLDD 3AVPA 3B9PA 3I8SA 5DYIA 3LX8A 2ZRGA 3CF0A 3RRNA 4Q7KA 1G8YA 1WP9A 2ZETA 3CPHA 3UANA 4DWJA 3RDPA 2WWFA 5B57C 2P6NA 1N25A 3BAFA 1AKYA 5L3QB 1DPFA 2CMKA 1TPZA 2X8AA 4QKQA 1HA3A 2JLRA 1R7RA 4KFUA 1I4TD 2IHYA 1XD9A 4DIDA 1UF9A 3FWYA 1XEWX 1Z22A 2KBEA 4AKGA 2FGJA 3GJ5A 2ORWA 2BHRA 2RGNA 3GFOA 2YWEA 1Z83A 1KI3A 3SEAA 2FWRA 4E03A 5C46F 3ASZA 4MRPA 1OFHA 2A5DA 1XPRA 4IFBA 2ANBA 2ZAOA 1Z6YA 2AD5A 4PQYA 2NO6A 2GVZC 1XTSA 3B5JA 4LUCA 5AR1A 4XJXA 2NO7A 2CK3D 2VHUA 5J5CA 3T12A 2P6RA 2UZIR 2W6JA 4JVMA 1OB5A 4FIDA 2EU8A 1VIAA 4CW7A 3ZLJA 2HV8A 4DLUA 3IBYA 4US1R 1NVVQ 2H57A 4HZUA 1EX6A 4QNRA 3REGA 4TL7A 1XP8A 3RVBA 2J7PA 5LDDC 2BC9A 4G5OA 2YWHA 1JECA 1QVAA 1BH2A 3O8CA 3B1WA 2WAYA 1G64A 3C7KA 1UPTA 1XCMA 3SC3A 2NGRA 4DCSA 3PEYA 5H70A 1R0ZA 3HU1A 3A4NA 5FBQB 5C4MA 1X8JA 2R6CA 5FL7D 4ZKDA 4NBSA 1NMYA 2W83A 4FMCF 1UEJA 3EZ9A 3OIVA 3EZ2A 2WM9B 3QEOA 3UMSA 1GDDA 2W6IA 2JEOA 4DCNA 4PTLA 1VCIA 3RS0A 5BXQC 2XOKA 3NEJA 1NJFA 2G1JA 4KVAA 2B6HA 4CEIB 2TMKA 2ZSFA 2CXXA 3K70B 1ZCAA 4KI0A 4ZIRB 5HZKA 1PV4A 3UWKA 1RKBA 1KI9A 2XNDA 1ZAKA 1F60A 1Z5ZA 1KJZA 3AKEA 2C5LA 2Q0HA 3MJRA 3ZYCA 4F92B 2GKSA 2FSHA 2GILA 5KU1A 5JS8A 2EFDB 1ZBDA 1HEIA 2ZRJA 5HTKA 5FTNA 1QHIA 2ZI4A 4B3FX 4RY2A 4EPRA 2QG6A 1Z29A 1LW7A 3IILA 3NDPA 2IUTA 4MGZR 2NO0A 4D4JA 3H84A 1T0JB 1R0XA 3C41J 4XVRA 3CRRA 4LX0A 3UPUA 2IXGA 1WCV1 3DKPA 4FI3C 3X2SA 2RHMA 3QKSA 4F4CA 3HYTA 3NXSA 2OBNA 1R8SA 1SXJB 3KKNA 3K70C 4M1MA 3RS3A 3WYGA 3JVVA 3RLFA 4C7OA 3IUYA 3ONWA 1BYIA 5FOSA 3SE0A 5DO9A 3IEVA 3KQNA 3KKQA 5BYKA 4Q21A 3Q5DA 2EFCB 1LF5A 3A58B 4YONB 1VCOA 2EQBA 1DBSA 4HI0E 3QSYA 3SZRA 3B2EA 3KJIA 4ZCMA 2G6BA 1M74A 1F3OA 4LHXA 3P20A 2V7QA 3VU9B 4DDUA 4KCGA 2H16A 4JLJA 1KI8A 2P65A 2ODEA 4TQAA 4TSFA 1E94E 1SXJC 1XFAA 4YDHB 1W36D 5J47A 1U9IC 1A5TA 2NZ8A 4ABYA 3THWA 2C9OA 3KXIA 4MYHA 3WMEA 4M1WA 2XZOA 3V9PA 4B2LA 2BKEA 4LBWA 1E2PA 4ZDWA 3KTAB 2O5VA 4NYIR 3GMTA 2PX3A 1W2HA 1UDWA 3N2EA 4I1VA 1E98A 3SBEA 2ZPTX 1E9BA 3OIYA 1GTVA 2QMUA 4P4SB 5IHPA 4G3XA 4LBZA 1DAGA 1E96A 2HXSA 4HDQB 4MUAA 5CIQA 1Z0FA 4TL6A 3T35A 3LAWA 3LX5A 5B30A 1US8B 2OCYC 3LVQE 1JAIA 4B75A 4II7A 1OXUA 1FP6A 2V4ZA 3BB3A 3Q9LA 4TT3A 3D6TB 2XEXA 5E95A 4EKDA 1G4UR 1XMIA 4EJSB 2F55A 4C0BA 1S2MA 1Z2CA 1D6JA 3R9XA 2FFHA 4H1VA 4A4DA 1N6HA 4BFYA 3RWMB 5EE3A 4KBGA 1FX0B 1LV7A 4F4IA 1ZUIA 1XEXA 2VEDA 1Z6TA 2QTFA 5SZIA 3OAAA 1KIMA 3KQUA 1M6NA 1Q1QA 3T1VA 5F2EA 2EWWA 3PUWA 2QBYB 3BORA 1RRGA 3PUZA 4URVR 4GZLA 3MUFA 2E9SA 2YWGA 2DY1A 2OXRA 4G1UC 4A2WA 2OUKA 5E7JA 5KPDA 1CJTC 3W8RA 1FFHA 2X2EA 2QP4A 2PH1A 1Q1ZA 1XXHB 3GJ7A 3IDQA 4US0R 2Q3MA 3EXAA 1UKYA 2B8WA 2GESA 1GL9B 3B6EA 5D3MA 4EJSC 1T3SA 1JEEA 1OYWA 4S2EA 2O0HA 1P2SA 1GVNB 4U7DA 5F98A 1KO1A 3TAHA 3WY9A 1GITA 4UXHA 2B7BA 3NBZC 3TH5A 1M34E 1XCPA 2IBMA 3ND9A 4YMVA 5AJZA 1PJRA 1W2GA 5CDFE 3RRYA 3KB1A 2RHDA 5EXSA 1W48A 2RB4A 3JZMA 3U3JA 4C0LA 1NNEA 3LA6A 3TVTA 2B7CA 2CHVA 3FDIA 3AF2A 4HAUA 4BFSA 2J0VA 2XJ9A 3PUVA 1NN0A 1CU1A 1RZ3A 2ZRMA 2XB2A 2IT1A 3MCAA 3BRWD 4YXWA 1S1CA 1XEWY 2GXUA 4LYFA 4B6EA 2MSDB 4YDSA 1S3SA 4YMSA 2C95A 3MFYA 4MRSA 2G0TA 1OFIA 5DHAA 3GJ8A 2IX3A 2VA8A 1Z28A 3PXGA 3FMFA 1HTWA 3CZQA 3CRMA 3QVVA 4QGGA 1VCNA 1FQKA 3VKWA 1II8A 1P9RA 1F2TA 1KK1A 1Z0JA 2I4IA 3HU3A 3OESA 4DCVA 4LJ5A 2EW1A 1DVRA 3THYA 3B1YA 3BB1A 4Q19A 1GKIA 3T5GA 4P0TA 3QKRA 3VR6A 2AD1A 1JAHA 2WJHA 3QF7A 1OXSC 4GZMA 3KKOA 1JR3E 2J0UA 1NSFA 2ZUDA 2ATXA 4UJ5A 4V0ME 3TE6A 4CF7A 4DHEA 1YZUA 1AZSC 2RGNC 2PBRA 5G41A 2J46A 2H18A 3H2YA 1Q1EA 4N3NA 1KY3A 5DE3A 4V0NA 2FEOA 4HATA 4TL8A 2ZS7A 2FZLA 5EP1A 1IJEA 2W0SA 1D2MA 3ZVLA 4DLTA 5SZKB 1BS1A 4A8JA 4PQRA 1KI4A 4KJZA 1DE0A 1E2JA 2ZS8A 3NBXX 4L4UA 5AUPB 2XZLA 4KU4A 2VP6A 1IXSB 4JYBA 2QQ0A 4P4TA 1NG1A 4PHFA 2HDNB 1KMQA 4CDGA 3LW8A 4DLYA 2HEIA 1QHYA 3VNVA 3NH6A 3EWSA 4E5UA 4FW9A 4JSYA 4Q4LA 4FWTA 4HUTA 821PA 5FH9A 4X8MA 5HE8A 1U8YA 4ARZB 1P9WA 3P32A 4OHYA 1NI3A 4BLQA 1K6MA 1G6OA 4MDEA 1XPUA 2I1QA 1GZSA 3DMDA 1E2QA 2AXPA 3TBKA 2G9NA 1Z0IA 2RGGA 3THXA 3L2OB 1A82A 1CLUA 4L8GA 3TAUA 4B48A 2H1LA 4QNMA 2EYQA 2CL7X 3A1WA 4PAQA 5BQ5A 2AR7A 5FPYA 3K0FA 2V3CC 3QKSB 2GBLA 4GPTA 2QMHA 2YC2C 2GF0A 3TUJC 2RGAA 2XTZA 3TLXA 2IC5A 2WSSD 3DM9B 5CLLA 1CRPA 3F8TA 2ZJ5A 4M1OA 1E0JA 1TTTA 3C14C 2ZTSA 4JBWA 3SJBA 3TK1A 5IK2D 4CRWB 1E2NA 4C2UA 1AJEA 1T4GA 3U5ZB 3T1TA 1SXJE 1G7RA 3T1OA 3SQXA 1NBME 3WXMA 3W6OA 3OFND 5KDOA 2F7SA 4FXPA 4C4PA 1OHHA 1QHHB 1XX6A 1WB9A 4TMTA 3CZPA 5C4GB 1NKTA 4C0SA 3X1YA 4Q7MB 1JNYA 1ZUNB 1MRSA 4I81A 4HZIA 3THWB 3LQRA 4HLDA 1X1SA 1KSGA 2OT3B 2H8KA 3IPXA 1E1QD 4Q47A 1IBRA 1PUJA 2REXB 1COWA 3LW7A 3QNUA 4LHVA 1YJ5A 5L3RA 8OHMA 4NCKA 1GIAA 521PA 1NIJA 4XD7D 1VG9B 1GNRA 3B7GA 4XTCS 1VECA 2OFXA 3T5DA 4YQFA 1ESNA 1WQ1R 2IUUA 4EPVA 5CDFA 5JSZA 1KK2A 3GP8A 1ZM4A 3CPEA 2ZYWX 4XWAA 1Z08A 4B3CA 3PG5A 1WBDA 3EZ6A 5DSZA 1DAMA 4TMKA 4URWR 2IYTA 4LC1A 3P27A 4KYUA 4DT1A 3GEIA 4E09A 4JBXA 4DSTA 3U44A 1XEXB 2QGZA 4MKIA 4PZYA 3TR5A 1NVWQ 3BH0A 2IYXA 1OV4A 3DDCA 1DARA 1EFCA 4PZLA 1KI6A 3N5CA 1GAJA 4B35A 4A0RA 3V4RA 4B2PA 4JMPA 3OIWA 5HE9A 3NHBA 5J4HA 1TEXA 3PFIA 4F7WA 3PCRB 1AK2A 2ZS9A 1Z63A 3TNFA 1XD8A 5L3QA 1DADA 5JI2E 3PV0A 4CZ2A 1NVXQ 1AN0A 3CRQA 4M9XA 2Q21A 1OH8A 5TB5A 4A1FA 4LY6A 4WZBE 5LB4A 2OE2A 1UJ2A 1U94A 2BWJA 5JECA 4D4LA 3WBKA 3K0SA 4HUQA 5AK0A 4P31A 4AYWA 1XXHE 1W0KA 2YZ2A 2WKQA 3SJZA 1S1MA 4DLVA 2GK7A 4QFMA 4KAXA 3A4MA 1JR3A 1PLJA 3W6PA 1LS6A 1M7BA 1S4QA 1ZYUA 2JGNA 3LH5A 5KDLA 4W7SA 1CJUC 2G0NA 4QGFA 2FFQA 4F4JA 1OH6A 2O8FB 5CIWA 4GP7A 1X3SA 4IW3B 2RAPA 3RSLA 1XCGB 2WJVA 1K5DA 5FI1B 3FMIA 1VDZA 1MABB 2HLDA 2F1RA 1W5SA 4JLBA 4CYMA 1XZQA 5FPHA 5E3HA 2BM0A 4WZAE 4KITB 4JLDA 2WOJA 5CLQA 3FB4A 2WWGA 1DAHA 2PLFA 3AKDA 4NYMR 5EXPA 2NZJA 5JBQA 4DSNA 2YJTD 2ORVA 5FUYA 3HU2A 4WXRA 5C1BA 4YC7A 3FGNA 3U7GA 4RD3A 4M53A 2PL3A 4Q1AA 4MDFA 1VYUA 1GKYA 1Z6AA 2D2EA 1OW3B 1KYIA 1II8B 1QHXA 1F2TB 3EC2A 1KJWA 5FTLA 1HE1C 1L7VC 2XTMA 2BMJA 2JLZA 1Q57A 2AFIE 1G19A 1G18A 1G17A 3A36A 2CK3A 4GRAA 3THYB 1MO6A 2F43B 2ZU0C 3NTUA 3OF5A 3QKRB 4CEIA 1ZD1A 1ZW6A 1IN6A 2KE5A 2RGBA 4OQXA 4ZIRA 1EWQA 1II0A 3ZZTA 3BFVA 3QXSA 4QBIA 4WXPA 5DHFA 1BIFA 1HY3A 2CVHA 1RW4A 2F1HA 2J0UB 2MMCA 2QORA 1AZTA 1QHNA 1XWIA 2X19A 3NBFA 1X8LA 2W00A 3A37A 1VPLA 2OV2A 5A5GA 3GLIA 1W4RA 5FUWA 5TY0A 2ZREA 4U5XA 1I4LD 4IDQA 1FPMA 2IL1A 3C5HA 3NG1A 4BGDA 1NY5A 3QQ5A 4NHOA 1W47A 1U81A 4PAOA 1T0HB 4Q9JA 1SVSA 5FUXA 2PJRA 1WE2A 3B1VA 5FL7A 2GZHA 3LLMA 3AVUA 2BBOA 1XU4A 2ZI9A 4M4SA 1J90A 3TSOA 4B73A 1YVDA 3B8HA 1EESA 1N6PA 5K8UA 3SYNA 4HB3A 5JWRA 3KX2A 4URUR 1T5LA 2YINC 2ZRHA 4JJZA 4OHWA 4Z51A 4W5JA 3HR8A 3DZDA 1CF4A 1Z06A 3REFA 2NG1A 2KWIA 4KLNA 2OCBA 1S8FA 3RC3A 2VPPA 4NYMQ 1SVIA 4A8JC 4DLSA 5L3SA 1IXRC 1D9XA 4HAWA 1J8MF 2HXYA 2ZVQX 2GJKA 4JVNA 4NTZA 3PENA 2YKGA 2Q9CA 5ELXA 2ZJOA 2E87A 1NRJB 2LKCA 2OBLA 2ZUBA 3RYTC 2ONJA 2ZE7A 4A0GA 4YMTA 4DC9A 5EE1A 3TW8B 2FG5A 4P4UA 1IN8A 5H68A 1HV8A 3OEHD 3T61A 3ZQJA 1KKMA 4M0LA 1EXMA 3K9HA 1E4VA 3VR5A 1PUIA 3A1SA 3FFAA 5ANRB 3AVVA 3U3RA 5DH9A 1IN4A 3KJEA 1ZIPA 5E7MA 2D06A 3A6PC 5JJIA 2OBMA 2QRZA 1VMAA 4LJ8A 5EE9A 2P67A 4RJLA 3NHAA 1EFUA 3SN6A 4HDOB 4LJ4A 5FOXA 3UMRA 1UKVY 3EA5A 5DISB 3AVQA 3Q3JB 1NN5A 2C77A 5GVRA 3DPUA 2GBLC 3CH4B 4OI0A 3LNCA 3U61B 2ZYVX 4D0NA 4GP6A 3MG9A 1E4YA 1WBBA 4O2RA 2QE7D 3VFDA 1W4BA 2ZITA 3TJZA 5JEDA 3CM0A 3ETLA 5F3WB 5JJKA 3CF6R 2BV3A 5KNCA 2OLKA 2VO1A 4CVNA 3K8YA 3GEHA 1D2EA 2WJGA 1C9KA 1YR7A 2QBYA 2NO9A 3NC0C 4AKHA 3G82C 4LJ9A 2CBZA 2QM7A 3ECCA 2FN4A 1CR4A 4JYCA 4TTQA 2A78A 2J1LA 1XXHA 3VKGA 2RGCA 1UFQA 3IBGA 1MKYA 1Z47A 4OL0A 5JI3E 1AA9A 2PLRA 3EIEA 4O3MA 3IPYA 2FE4A 2WJYA 4EFMA 5JSZB 2WICA 3RNLA 3QKTA 3ADBA 2ZR9A 3SS8A 4MKGA 3BIFA 3TW4A 2JCSA 4Q18A 3T15A 4DT1B 4FCVA 1YE8A 2VF7A 4KFTA 3WHKA 3U44B 1G5PA 4AURA 4LPKA 4X8HA 3OE7D 3AVXA 1DEKA 3QBVA 2VRWA 4LBYA 5FOWA 4DB2A 2XAUA 1D9ZA 1KTVA 4JJKA 2JATA 1IOZA 4Q5IA 2CDNA 4IVPA 3QBTA 4MUBA 4MYCA 1NN3A 1T9HA 3L43A 3I62A 2FX3A 3BC1A 3CWZA 1IM2A 1SVWA 1NY6A 4GMXA 3BB4A 2ORIA 3QPVA 1R5NA 4JLAA 3KQLA 4QGHA 1N3BA 4V0KA 4BFXA 2NIPA 3CRVA 1IN7A 4IHQA 3A4LA 4AWXA 4BUJA 1R4AA 2VHTA 1ZU4A 4HUQB 2YV5A 1E9EA 4URYR 3LO5A 1LTQA 1J2JA 2BM1A 2NOAA 4KXFB 4OBEA 4AG5A 1U90A 5EXXA 4RD0A 2ASEA 1QHSA 3NBYC 2AK2A 3ND8A 4ILEA 4PO8A 5TDHA 1T3LA 2Z5FA 2JLUA 3B9QA 1N5JA 1OT3A 4OKSA 3GJ6A 1M2OB 2VHCA 1P7CA 2AXNA 4LJYA 3AVTA 3MWYW 4Q1EA 4OI4A 3BGWA 2Z4RA 1AQYA 1S3GA 4NU0A 4UXIA 5HR5A 1U0LA 4OK3A 4DRZA 2PEYA 3KXKA 2BBTA 1XZPA 2FJUA 3PUYA 3MWLA 3LXXA 1NSTA 2FEMA 1G291 2ZI7A 3NEYA 4POAA 2DHRA 2OESA 4LV6A 1FTSA 3P1JA 3KUCA 1VCMA 1R5BA 3CWQA 1G8HA 2QM8A 1OYYA 4TLDA 2Y8EA 2GCNA 2JIZD 2ZAMA 3MWJA 3ZD7A 3R9WA 2RMKA 3KL4A 1G4AE 4ARZA 4X8LA 2ERYA 5FOTA 1KY2A 2ZSDA 4V03A 3SHFA 1J99A 2F1JA 3GLIB 2ODBA 2R62A 4R2HA 3AKCA 2PZEA 4NDZA 2XB4A 4B6FA 2GAOA 2QL6A 3W3ZB 5KOYA 1W4AA 1E9RA 1NKSA 1VG8A 2ZRIA 1Z6XA 1MO3A 1A1VA 3LLUA 5HCNA 4OHZA 5J40A 1MH1A 2NQ2C 3CR7A 3WP1B 1YRBA 3MD0A 4AYTA 4PANA 4Q9IA 3AVYA 2C04A 2XXAA 5JWHA 5FL3A 4A2QA 4ASUD 1P75A 2YOGA 4QHYA 4BQSA 2ZQ5A 3LD9A 1SQ5A 2ZRBA 5G40A 2Q3FA 3AUYA 2FSGA 1OIWA 1C1YA 2C8VA 2WSMA 2C9YA 1TQDA 3WNBA 3BWDD 4TWZA 2ZJ2A 3L0SA 1KK0A 1TU3A 1RYFA 3HP1A 5KTYA 5GADl 3MMPA 1KI1A 1ZNWA 1N0WA 1QHHA 1G3MA 1ZD8A 1G8GA 5L3SB 1KNQA 1ZP6A 4JLMA 4W5WA 4B43A 3RANA 3PVSA 5KPJA 3CB4A 3F5FA 3KJHA 5TVKA 5UKDA 4FN5A 2FA9A 5EUQB 3TUZC 1DOAA 1T3HA 1SVKA 4TTPA 2ZRPA 2GNOA 4V0LA 4D25A 2O8EA 1HQYE 1XEFA 1L8QA 1NL3A 2C96A 2OFOA 2CCGA 4DLWA 5HPYB 4CIDA 1QDEA 2WWHA 1XRJA 2WV9A 2WSSA 5A0FA 4PR0A 5KSOA 2VP9A 2IXEA 5JRJA 5IK2A 3V00A 1AS3A 1ZIOA 2F3TA 1NMZA 4B47A 3U6KA 1QBKC 2G77B 2O8BB 4TQ9A 5P21A 3VR4A 2HT1A 5J4LA 2DFKB 3OFNA 2GF9A 1B0UA 1YZTA 5CJPA 3L8YA 4ZCIA 1ZM7A 3EZFA 1W36B 4MA4A 1K5GA 4C0QC 2QNRA 1G1MA 5FOUA 3E2IA 5DIFA 3GFPA 3QXHA 4N1AA 3B60A 4M2LA 2GA8A 1N0UA 2J7KA 2CJWB 3PUXA 4TN1A 4ACAA 2O8CA 4H1UA 1E1QA 4R2IA 2OCAA 4Y0VA 3KUDA 5TXGA 2BEJA 1SULA 2BMFA 4GOXA 4IOKA 5HCIA 4O2LA 3SHWA 3CONA 4B34A 3I4LA 3TIFA 3WHLA 1TMKA 1HT1E 5JWOA 4XD7A 1GL7A 1XTIA 2GZAA 3EW9A 2E1RA 4FMDB 5FUVA 1GSIA 5EXTA 2X77A 3U7EB 3R7WA 4W9MC 1W36C 1CXZA 1E2LA 2OCPA 5KYKA 1YR6A 2BCGY 2P0EA 2ANCA 1F6BA 1XF9A 2P6UA 4BLPA 1D5CA 2IYVA 4C0HA 4C0JA 1KO5A 2IYYA 3UG6A 3W3AA 2OG2A 4Q4HB 2O8FA 4M9QA 3R20A 1U99A 2HCJB 4FCTA 4MRVA 2FPKA 4JVSB 4Q1BA 3WMGA 1UKEA 1MABA 1W0JD 2OHFA 1KOFA 4A0HA 3T06B 4AC9A 1IHUA 5J4KA 1P9NA 1E2MA 1ZJ6A 2C99A 5KUTA 4M1KA 1G7TA 2IHBA 2F6RA 4R7ZA 2C98A 4AKIA 3EPJA 3ICQB 2VHJA 3H4MA 3IIMA 3LY5A 2YWFA 1RIFA 3TRFA 4D81A 4CGZA 2IS1A 3IIKA 1G3RA 1E9SA 4DIEA 1P5ZB 2JASA 2PZFA 3IQWA 1ZRHA 1GNPA 1XBTA 3SYLA 4PC6A 4ZI3A 4PO9A 3C15C 4B3XA 5C18A 2VP2A 1SZPA 2JDID 1E0KA 4P32A 2F43A 4FCWA 2N1BA 4JT4A 3K0CA 1G16A 2JLWA 3ZH9B 1M8PA 1Z8FA 4DLRA 1W7AA 1OXTA 4OK6A 3VNUA 4DUGD 2KSQA 3X1WA 3H86A 1JXOA 2BEKA 3HJNA 2OLJA 4PQFA 1N5LA 1QG2A 2DBYA 2ZJAA 2FV8A 4NE2A 2CCKA 2AKAB 4Q9HA 2PZGA 4B3BA 4OJKA 2ZANA 2DFLA 4B3DA 3K9NA 2WMNB 2ZYUX 3RWOA 3HWSA 1OH5A 4ZI2A 1R6BX 1X86B 1KHTA 5D3QA 1G3QA 3W8NA 1R2QA 2GXQA 2IW3A 1J8YF 3THOA 1ZC4A 4QJ5A 1J70A 1G5TA 4GFDA 2R6DA 4I4LA 3AP2A 2WJJA 1P2VA 3QI2A 4CEHA 3FHCB 4QRHA 2A5GA 2GZDA 1OJLA 5K8LA 2D7CA 4RFSA 4DCTA 1P60A 1Z6GA 2DR3A 2QY9A 4LC0A 4A36A 1E2FA 1ZU5A 2AL7A 2QQEA 1GM5A 3H1TA 3MJHA 4IDNA 2YC4C 3P26A 3SOPA 3U7HB 2WWIA 2IA5A 2MSEB 3CRW1 1NN1A 1E6CA 3GLIE 1OKKD 1DS6A 2EFGA 3CF2A 3LFUA 1D2NA 3WBJA 2PCJA 4FD2A 3KZ1E 4M22A 1G6HA 2Q9AA 1XTQA 5FBVB 2XXAB 3BK7A 1SVMA 1NG9A 3ZD6A 4NH0A 2C78A 4R98A 1A2BA 3T1QA 4GSYA 2ZJBA 4C2TA 3W34A 1XJ0A 3HPRA 5CITA 1SGWA 2IYQA 1WXQA 3I8XA 2LKDA 4JIMA 4GOKA 3AGQA 3AEZA 4JL8A 2G88A 2PMDA 2R9VA 4D26A 3QEJA 3FVQA 2XGJA 3W6NA 4AK9A 1BYUA 1CJMA 2VF8A 3L82B 3AVWA 3ZS8A 5KSPA 4RVCA 4G0NA 4QJ4A 3DVLA 1BMFD 5M04A 1MV5A 4YLGA 2O8EB 2AK3A 1VYTA 2VQSA 1P73A 3FE2A 3OEHA 4DDTA 5CYOA 4EQ6A 1P4SA 2QRNA 2RCNA 2QPAA 2BVNA 4NCJA 4NP6A 2JLXA 3IO5A 5FR2A 4M1YA 1I2DA 2CHGA 1TF7A 2QPTA 5CJ2A 4JLOA 3VR1A 3CX6A 3LVRE 2KJQA 4C30A 4QC2A 1KAOA 2FSIA 3AP1A 3W5JA 4RKFA 2IYRA 2VSFA 2ZM5A 1Y3AA 3BJIC 5DGXA 3K9LA 5EQTA 5AJXA 2ZR7A 4PHGA 3TKLA 1X1RA 3ICEA 2QE7A 1E99A 2BIFA 3RS7A 4HDCA 4Q9LA 4S35A 2XSZD 4E22A 2O8CB 1TAGA 4BZPA 5FR1A 4MYTA 4DZZA 2BBSA 4QOSA 1CBUA 1RJ9B 4B74A 4LYJA 2WKPA 1U0HC 1FMLA 4DCUA 2YNMA 1E2HA 1E9CA 1E79D 1JI0A 4ERNA 3B13B 1G3IA 3Q72A 1P3JA 1UAAA 2V55B 3CUEF 1TF2A 3A1UA 3LV8A 3QVUA 2DFTA 3R7WB 4RFVA 1TF5A 1M1YE 4DDWA 3ADCA 3ZIAD 3Q85A 4HAVA 1Q3TA 5HKKD 2JLVA 1JR6A 4Q01A 1OXXK 3WMFA 4ESVA 1FZQA 2GJ9A 4TMWA 3EIHA 2ZVPX 2FGKA 721PA 2IUSA 2JA1A 1UBCA 4A82A 1E2GA 2KI5A 3UXMA 2HYDA 3OE7A 2ZE6A 3DHWC 5FTMA 3FHTA 4RD4A 5H8WA 4F93B 4OI1A 5SZJA 1ZMXA 5CB6A 5CYPA 4LV5B 2O8DA 3QG5A 2NMVA 4O25A 3FKQA 1RFLA 1IY2A 5TMPA 3SFZA 1HYQA 4MGKR 3I61A 1KSFX 2IYWA 2OFWA 4AYXA 2J87A 1KO7A 1HE8B 1KO8A 1MR3F 4UQOA 3WYFA 3C16C 4DLZA 4Z8YA 1OF1A 3FPAA 1JBKA 2QGNA 1P2UA 2GXSA 1S9HA 1R0YA 4ZDIA 2ZJZA 1JB1A 4I1OA 5JHGB 3GLGB 3ZGXA 1H8ED 1Q20A 4EPXA 4N0EA 4TLCA 2QEQA 4OK5A 5BW8A 1HQCA 4Q7JB 1ESMA 4L5BA 1RPZA 4NYJR 3GJXC 5JZVA 5KSZA 4P33A 2WAXA 2GTPA 2J5XA 4KSCA 1XJQA 4HYYA 4BRWA 4PFSA 2AWOA 1FL9A 4DJTA 1A7JA 4ZV4A 3PEWA 1NF3A 4BEJA 1LVGA 1M7HA 2X2FA 4NONA 3JZAA 3X1DA 3K1JA 4BZQA 4OQNA 4BLSA 2ZYTX 1YRAA 1FW6A 1NJGA 3CPJB 2ZROA 4LHZA 5IF9A 1B23P 1IONA 2WHXA 4QGAA 1WA5A 3TGPA 2GDJA 2V1UA 4HAXA 1JJVA 1ZNYA 2XZPA 4JSTA 3KJGA 4H9GA 5EUMA 1FUUA 3VX4A 1G3UA 3K0CC 1KAGA 4ACBA 2SHKA 3GD7A 3LRPA 2ATVA 4EPTA 2AHOA 2IS2A 2W0MA 4M1SA 1V5WA 3SI7A 2C9CA 3MWKA 3GLHB 2ERXA 1JQJC 3RRMA 3BERA 1YR8A 2OXCA 3B78A 2D62A 5EE5B 1P6XA 4NPHA 2XX3A 2HF8A 4KVGA 2J3EA 1H8HD 2JIZA 4PPGA 4CT4B 4CEHB 1YU9A 4J0QA 1T8TA 3B1XA 1CJKC 2OZEA 4KLZA 4RFSB 4TL9A 3AF0A 2GAAA 3EPHA 1E0AA 1CR0A 2QP3A 1XJCA 4TLAA 2WJIA 3I3SR 1EGAA 1RVDA 4IDPA 2VTKA 2WKRA 2Q9BA 2GJSA 2DWQA 1GFIA 2PT5A 1IY1A 3MLEA 3NVAA 2XJ4A 2NPFA 4PHHA 2HCBA 2WTUA 1EK0A 4UNPA 4F38A 4ZO4A 4A2PA 4PC3A 2GXAA 4MYUA 4FINA 2WZQA 2J59A 1RE0A 5B58C 1N6NA 1IY0A 1DAEA 3QKUA 1YZGA 3QXJA 4AY2A 3ZZUA 2JLQA 1E32A 1CIPA 3QXCA 3DKVA 3SR0A 4NYJQ 1OIVA 2VP5A 5GVSA 1LS1A 2ZRLA 4BE7B 4ASUA 1KDTA 4JLNA 3MSXA 4PPNA 1G20E 1KDOA 4KFSA 1DELA 4TZ6A 1EG7A 1XMVA 3OHMA 1EFRD 5C2JB 1UBEA 2O8BA 2RGDA 3PQCA 1BO6A 3KDSE 1F48A 4M1TA 3WNDA 4BWYA 3EG5A 3ZVRA 2QI9C 5DI3B 2WWWA 3E1SA 2VL7A 1LB1B 1E1RD 4EIWA 3IQXA 1T91A 2VP4A 3O8BA 3P4XA 1KMHA 4KHZA 4AD8A 1TUEA 3CO5A 4BFZA 2JLYA 4IDHA 1I4DD 1RC8A 1M7GA 3A8TA 2CLSA 2ZRKA 4X8OA 2HYIC 4DXAA 4WAUA 4D80A 2KB0A 1TL7C 1MO4A 3CBQA 1U8AA 1Q22A 2CJWA 1JXMA 4PPFA 4WOPA 5L3VA 3GLFB 6Q21A 4DSOA 4IEIA 2Q3HA 4HAZA 4EQ6B 3ZVMA 1G5RA 1P2TA 2Q6TA 2QT0A 1OB2A 4ZPXA 2FU5C 1T8UA 4LI0A 1T6NA 4EDHA 5GJVC 2HUPA 4Q66C 4PPQA 2K5UA 3MRSA 5DI9A 1AS2A 3I1FA 4XIGS 1LY1A 3VQTA 1L4YA 4TYNA 4Q03A 1FP7A 2YVUA 4LHYA 2R2AA 1XMJA 1O3YA 2IK8A 4K8OA 3A1VA 5FOVA 1OPXA 3U6BA 4OHXA 4URXR 4C9BA 2OSBA 4LRWA 5GJWC 4DKXA 4Q4HA 4UXJA 1H65A 5EP3A 3K0EA 3P4YA 1E9DA 4PX9A 3SYKA 2NO1A 5CM8B 2OAQ1 2HJGA 1JPJA 3CX8A 3DM5A 1QHGA 4A6XA 4GI7A 3SU8A 1V43A 4NCIA 4YMUA 3NIBA 1ELOA 1LFDB 2HJVA 4GOJA 4E07A 2DFNA 1VG0B 3L0PA 2J9RA 5L8VA 1ZNZA 3AUXA 4I1SA 1SHKA 1CR2A 1GL6A 1HURA 2DCUA 2OAP1 3VX3A 1TU4A 2QTHA 3SBDA 3G5UA 2ZXUA 4GDFA 5FFMA 3QOFA 4LBVA 2O52A 3SDZA 2A30A 5A4JA 1TQ2A 3RC8A 2CNWD 1FTNA 1QRAA 2CLCX 4EPWA 1XNJA 1NP6A 4RD6A 2P2LA 3H0KA 1ZVQA 1UM8A 4LPSA 1PZNA 3LWNA 5G53C 2PEZA 2N42A 2PX0A 5JS7A 5AUNB 4TYYA 3U2QA 1SKYB 5KNBA 1IAQA 4Q02A 3B85A 1DAKA 4NZYA 4Q7LA 3X1XA 4G01B 2VIIA 3FKSD 5H1YA 2O8DB 2V8OA 3FHOA 4HLUA 3N70A 1W0JA 5KDDA 4Q9KA 3AQ4A 2H17A 4ITRC 2MSCB 4WVFA 3LBNA 1GRRA 3Q8XB 2W2TA 2CVFA 2EWVA 2WPDD 3B82A 3TQCA 4K81B 2CE7A 3KKPA 1G7SA 2FNAA 5E4FA 4IOJA 1JJ7A 4LJ7A 3QPUA 1SVOA 1CS4C 3K70D 3VR3A 4IOLA 1ZM2A 4BLOA 1G8FA 3V4FA 3FTQA 4N0DA 2YHSA 5GJBA 2JJ1D 4JS0A 4Y0AA 3K9GA 4B2IA
chains in the Genus database with same CATH superfamily
4DW8A 4BP9A 5IVHA 1QONA 3SFVA 2CWDA 1XJ5A 2JKYA 2FKNA 3I52A 4KP7A 3PFFA 5B53A 1FRQA 3QRWA 2YS7A 3NKVA 3UKJA 2JDIA 4RMJA 4Z1MD 2Q1UA 3DNFA 3NVMB 1XZDA 4AY4A 2O6LA 1UP4A 1NUUA 1YNOA 1DRKA 4H31A 3FOZA 1C3OB 1FDIA 1KU0A 2HHJA 4M9SA 1KZYC 3BBPA 4QODA 4YO7A 5H9VA 3PQ6A 5LDHA 4A8TA 1GG2A 4WH0A 3O9MA 3ITKA 1N5KA 1ST3A 3LQFA 1P62B 1QIGA 2Q5EA 4ZARA 3D8TA 4KSBA 3DOEA 2GJAA 1PSDA 3KOMA 3VTAA 3K8ZA 1SBHA 1FUYB 3WWCA 1KP9A 4C4TA 5A4AA 1XD2B 1AQUA 1CUUA 4YJDA 4EO9A 1O87A 2RGXA 3IKLA 4WWHA 3DOFA 3KJNA 3C6QA 5AJWA 1NURA 3L5KA 2ACKA 5EJFA 3BD9A 2LIVA 1KXJA 1YAJA 3EGIA 2QPOA 1BRMA 3RO7A 3HCBA 2X1LA 5JQGB 4IF4A 2BGTA 1A4RA 3IP9A 1GG9A 4PTZA 4H7PA 1RMYA 4XFJA 4OQYA 1NQWA 3AH8A 2QVBA 1I6MA 1YI0A 2UYGA 2VWGA 4CXMA 4BPBA 4OG2A 3DGEC 1R5OA 3GJSA 1THZA 3I9V6 4MVJF 3TSZA 2A0UA 5BV2P 1PTJA 3D81A 1Q3KA 5KYYB 1WXWA 4OJQA 4E13A 8ADHA 3C3AA 4G36A 2C8LA 3AF5A 1LZKA 3O94A 3X1KA 2XUOA 1WDTA 2QTLA 2I1WA 4UBMA 3HSSA 4ZVKA 4ICIA 4MWCA 5FAXA 2PVCA 2DT8A 5D86A 1XTJA 2C4MA 4S3MA 4D4MA 4DUZB 5JCXA 3HDQA 1U2RA 2GETA 5E8JA 3U1TA 1JHDA 2OY0A 3GJ4A 1N8TA 4MVJP 3HO1A 5DXJA 1BHQ1 3M4YA 1FFXA 3KBBA 3JS5A 1CE8A 1UM9A 1D1TA 1VBKA 2DGDA 2JRLA 2ZIFA 4N4AA 4DY4A 3F6CA 5EWLB 3WLRA 4PYNA 3ZTTA 4EZEA 3EVTA 5FTKA 2GWHA 2HHAA 2UYQA 3C8HA 4EFLA 1C9MA 3TSAA 1OKKA 4EG4A 3BHNA 4ZGGA 5JAHA 5ALZA 3G0GA 2ZI3A 3EB9A 5B3AA 3ZTWA 1H3NA 1JA9A 3H7IA 3R3VA 3ZQ6A 1TT5A 1PKXA 2OTCA 4DLXA 5B5SA 2XKAA 3ZU4A 3NLLA 2KW5A 5F5XA 4LOAA 3EUEA 4W9NC 3NKFA 2IEZA 1CEQA 1XE3A 3NH9A 5KNDA 1NDHA 5CDYA 5L51A 4A3SA 1ZVJA 4UULA 4B71A 4IJMA 5IZCC 3R40A 2Z4SA 4YNBA 4AZ0A 5LJIA 1GAXA 2H1WA 3HYRA 3E70C 3DXYA 4MMXB 4F1KA 3KQWA 3STYA 1UXOA 2WMOB 3CNNA 3E7XA 2EYUA 2GHIA 5C7OO 5AVYA 1DWPA 1H5QA 3WB9A 4XWKA 4MR7B 1DWQA 5C52B 3ENNA 2FPMA 3ECAA 3GMIA 4LSMA 1CF2O 1EP9A 4LWOA 2QSZA 2TSYB 2GSDA 3H5AA 4QPDA 2R0QC 2PV0A 1TQ4A 3E4CA 3I5AA 3MGKA 4HLQB 3WSWA 5JZSA 1Z45A 3PPXA 4AM8A 4CNBA 3O4GA 2F64A 4CJXA 4DLPA 5A06A 1TQ8A 3ETNA 2IY7A 1YHZA 4BNNA 5LMZA 4MKHA 1OBCA 3VA7A 2NXEA 1A4XA 1WPQA 2ZRCA 3ZZ0A 1I7LA 1E2DA 3QUSA 3HC7A 4KVFA 2ZJYA 1TJNA 4HQLA 3QVXA 1B0PA 3H2SA 4JCOA 4CMGA 1QVWA 1P81A 4C4RA 4YGYA 4TRNA 1YB4A 2D0DA 1QGZA 1OU0A 1XPOA 1F8YA 1FUKA 2FQYA 1KVRA 3NHRA 1RRPA 5JD5A 1DRWA 5IM5A 1SHZA 2X9QA 3U4HA 1RR6A 2YIVX 3CUVA 3AF1A 3I9OA 1XTRA 4Q1DA 1DUIA 1W88A 3G2OA 4XGNA 4MJLA 5JCPA 5C7IO 4KGXA 4LGMA 1P7ZA 3GIWA 5AOBA 3LT1A 3DVSX 4ARVA 3BWBA 2XSZA 4ENPA 3AM1A 1E9AA 3LBIA 4PYOA 1PK9A 4YAUA 4MGEA 1U0RA 1KJ9A 3FGZA 5D84A 3RU2A 2JI4A 5BSGA 4CF5A 4R4JA 1U0SY 3AV0B 3AEQB 2C2KA 4AJ2A 1TM3E 2XE6A 5ESRA 3WNCA 4BN0A 3L01A 4POOA 4HD8A 3EYAA 2N46A 4NCBA 2X4IA 2P5TB 1O9GA 3AP3A 4UPEA 1SCNE 1WU7A 5C8YA 3LF2A 3TIIA 4YJFB 4D92A 3L8HA 3ORRA 1JDZA 4PR3A 5A9RA 4KG7A 4MQFB 3OPNA 1I1OA 4EHFA 3UM9A 3NS7A 1BG6A 4RA9B 3H2ZA 4G81A 4UHHA 4QPZA 5KTOA 1ZHHA 4JI6B 1M73E 1QORA 2ODAA 3ZPXA 5BWNA 3WWEA 1Z4NA 3LBFA 1B6SA 1Y3IA 3FOCA 3LUAA 2CCJA 1EM8B 2RBEA 3EXEB 4HB2A 2JHPA 3TNYA 3VH2A 4XGIA 4MR9B 1E2EA 1PU2A 2Z43A 5E4TA 1QO0A 5FA5A 4FU0A 1FU7A 5EYPA 3P9CA 4RE6A 4YMIA 3E58A 3K53A 2CNOA 2VBIA 4BFWA 4YRMA 2CJYA 3EGWA 1E6WA 4RKEA 3M2PA 4LF5B 2V6JA 3IUNA 5EE0A 1JYFA 3S2IA 3D6MA 1D3AA 5LDGA 1JW9B 5FHRA 2NU6A 3RV3A 3BSSA 4ENRA 3KZKA 1ZGCA 2IUEA 4MAMA 4JB3A 1PNRA 1T1RA 4KR9A 3AFOA 3CNLA 3GUYA 4B76A 1E58A 1JSLA 4QO7A 3GJTA 1SPBS 2WMDA 2ZE8A 4HZUB 4REQA 5EL0A 3M3DA 2VTBA 1TJPB 4DUPA 1ODFA 3IHLA 4PSAA 4JBYA 4AY5A 2G3YA 5K3EA 4XWYA 3P9XA 1V5EA 2X22A 2YY6A 3AFHA 3IGFA 3LXRA 3BJRA 1KYWA 4RULA 5EIBC 3QSGA 4QJ3A 1JQDA 3L8FA 3P96A 4O2AA 2LPMA 3B5EA 4YIHA 2J08A 2V5AA 1XYVA 5FADA 4E4RA 4TMVA 5LZ4A 3RIYA 4K28A 1TQ6A 4BKPA 4BDSA 2FFBA 3VKHA 1C30A 5JHHB 4F5WA 1Z0KA 4XVUA 1CZKA 1S96A 4MWGA 5A5EA 5KVVA 3R0ZA 4TYPA 4AVYA 2QQGA 1EEHA 2Y76A 3I5YA 1P44A 1TAHA 3I2HA 3LDGA 3SCZA 4PAMA 3UH1A 1O95C 4JVLA 1Q21A 4PSKA 4KN8A 1E3MA 2IHNA 4B32A 2GUWA 2D74A 2QMQA 1XYYA 1BN7A 2JI9A 3QW4B 4U39A 3RABA 4IVRA 5LA6A 3K09A 2V7QD 4WQMA 3FBWA 2X4GA 3CUKA 1PZEA 3LDUA 2QJWA 3SFTA 2O50A 1OC4A 4MINA 1IZ8A 2GCOA 5M2QA 4XVQA 1THMA 4K0KB 2J9GA 3H8JA 1THGA 3V4VB 4DCPA 4AT1A 4MXDA 4TYQA 4EHHA 5KVSA 5HZMA 4DDKA 1P5JA 2BP7A 2N75A 2O07A 4HR7A 1OASA 4ZI7A 2QIPA 4KXNA 5KJ6A 3NHSA 1N4DA 3IE0A 5HZHA 2HRBA 3M6AA 3KUUA 5LYYA 3OLXA 4JL5A 4C7OB 3WRYC 4BLRA 2XMGA 1H2WA 1WNFA 2HT6A 1HPLA 1K8YB 2Q45A 3IYLW 3OJOA 4FDVA 4E7PA 4XOIA 2XGOA 5AHRA 2ZIAA 4RKWA 2IYUA 2BI8A 2VSYA 3KR9A 4PZZA 4W4TA 5J5AA 1L4HA 3CKKA 4QEKA 1JG6A 2O23A 4D6PA 4JENA 3DEIA 3EWAA 3T1HB 5KMGA 1F2VA 4NCNA 2XYVA 2FP4A 3VNBA 3WK4A 2CLEB 4B33A 3T5CA 4HDNA 3VAAA 3HYSA 4EECA 5DNCA 2ZBEA 3QIAA 4LOJA 1RYHA 3ZHSA 1LI5A 2B34A 3K0HA 4IQGA 4PLGA 4G5RA 4KQGA 4Y1RA 3OAAD 1CUHA 3X3HA 1AGYA 3WP0A 4HWRA 4FEEA 3NAMA 3MMZA 3LK6A 3HLKA 3K0BA 4LJAA 2DULA 5IT9A 3OA2A 4AZ0B 1RMTA 3HN2A 1RKUA 2ZJ4A 3D6NB 4N6NA 4TM7A 2HMSA 3UOGA 3L1UA 1QH1A 1Z0AA 2GLXA 4ZTUB 2GPNA 1SUWA 2EZTA 2CXQA 2QUZA 1E1RA 4ZOAA 4BN5A 3E5RA 3AHHA 1C9NA 1NNSA 4C0AC 1U0OC 3AB3A 1FNMA 4B17A 3QIVA 1FQJA 1WUHS 2RG1A 2ZJ7A 1QFZA 3E6AA 4TS1A 1SVLA 4RCZA 1P1RA 1TIBA 1VYVA 2Z08A 3IKVA 4RTQA 4N54A 1QMGA 3GB9A 1AUPA 3ET5A 1JPNA 1QOZA 1CUFA 3NHLA 1NLUA 2F62A 2ZIEA 3H2JA 3L92A 1YS1X 3R44A 4JB0A 1DTEA 4OMUA 2VH5R 3I9KA 3H13A 3R9XB 4LQ4A 3HA7A 2GPTA 2QW1A 2XUZA 5K45A 3EPLA 1AT1A 5A5FA 4CKWA 4QHTA 2FG6C 4A73A 4FT4A 2QMOA 5SZHB 3HDTA 1BHO1 1NNI1 2J41A 1R9GA 4R1TA 3GGPA 1GTSA 1PJBA 1FP2A 1V5IA 2Z5GA 2V6BA 3PQ4A 4P53A 1L4UA 5CX1A 1M9NA 2FOLA 4PO1A 3OIGA 2H1FA 3QWAA 4JFRA 3ZGZA 3D6VA 3D3QA 1FYWA 3A6HA 2OK7A 1W88B 5ES3A 5BVHB 3FJOA 1OLUA 4KPUB 4QT0A 4Y6SA 1D03A 1BEEA 1ZLYA 4AKEA 1RJGA 2RGRA 3BGVA 5D3MB 3V1LA 2PRKA 1OFVA 3FFBA 4LQCA 1FRVA 1I01A 1JIQA 4AXBA 1Z75A 5DLQC 2GEUA 9LDBA 3DH0A 3VO8A 1JIKA 3GU3A 4P3YA 1EFLA 3L04A 2GCGA 1EHIA 1FC0A 1ITZA 3DZIA 5IUKC 2P8JA 9LDTA 1UBSB 4GBMA 5CH8A 5IC6A 2ENWA 2OP0A 2IXFA 3TTSA 4ALMA 2ONKA 1GNTA 1RP7A 4V0MA 3Q98A 4KQ1A 3AESA 1JP7A 3KWMA 1UBFA 1TNDA 5JCZA 3U4AA 4P84A 3FFXA 3ABZA 3JZIA 5HKLA 1KZ7B 1VRVA 4X64B 4F72A 1H1LA 5A9TA 3Q8LA 1MPTA 3JVUA 1I24A 4RF4A 4NBKA 2WM8A 4RY8A 2GRJA 1E5LA 3D6AA 2WYOA 3EZ7A 4FYWA 2Q8PA 1ZDMA 5J1TB 4GQIA 1NQTA 4PQEA 5JTUA 4LSWA 4I4IA 1XZHA 4RORA 2ST1A 1DDIA 4G8CA 4ENTA 2VOEA 3TIGA 1G21E 3ONNA 2EEZA 1SU8A 2FVXA 4ITUA 1E0SA 2W8BA 4YT8A 2IYPA 1H1TA 4XSVA 1WTAA 3W2EA 3HSKA 4ZVNA 4PIPA 2I3GA 3MJEA 1K75A 3GAFA 5F9FA 1X2BA 5DT2A 4R71A 4BECA 4IIUA 3X1ZA 3I8OA 2H7XA 1UBMS 1SBZA 2IYFA 1XDWA 3G2PA 2ONZA 3EF3A 3O8DA 1AKEA 1T5HX 3PEVA 3ZGOA 4BX9A 3H05A 3K0KA 4HVLA 4N48A 3FW1A 3O21A 4DV5B 1OXBB 1ZCBA 2D1FA 3H42B 4EKNB 1P7YA 1HFJA 1FVHA 3A3YA 3I83A 4REQB 3BJZA 2F9MA 4MWDA 1O4WA 2FTKE 3FUXA 1I3CA 2LWIA 3CLUD 3H1EA 4AF8A 1R8YA 1EG2A 3L41A 1HORA 1UWKA 4XPIB 1I4OA 3S7ZA 5IU6A 3I5XA 2PLWA 1J25A 2ZTVA 1KNXA 2BMEA 2EKQA 4GM1A 4HMQA 4MO2A 4D9EA 3CNBA 2OAEA 3PBKA 3CUTA 2AE1A 3GRAA 5BYAA 1RRKA 1IQUA 2W98A 3MPOA 4YHBA 5I3ZA 5JFGA 2CT8A 2GN2A 2DWUA 4O2AB 4WNIA 2AS0A 4DBLC 3DWEX 1RM4A 4DSUA 4R5HA 1CFZA 1B8NA 1XYGA 3O47A 5TT1A 3ZK7A 2DPYA 5JC8A 1TO1E 1F6DA 1C30B 1SXJA 2CLOB 4KO4S 1D8TA 2I8AA 3BUSA 3KOZA 4QG7A 4IOMA 3I45A 3MCWA 3BJMA 1VSTA 4OQPA 2J0SA 2AKYA 3O8QA 3ZZMA 4HN9A 4IVQA 4KFRA 3ICWA 3C48A 4MUIA 4R2LA 4BZXA 4C1NA 1G2IA 3MAAC 2B2XA 2VPIA 4EKEA 1R64A 1UC5B 4LZWA 2RAFA 5AXCA 3GCGA 4KKVA 4M9ZA 2AUMA 4GX2A 2AJTA 4FQ7A 4AJHA 2OWDA 1X13A 1FNDA 1NZFA 1RLOA 1V95A 3MYRA 3VC1A 1WHTA 1NVAA 1YKGA 4FMCB 2OEPA 1P4GA 3P9IA 2D7JA 5ESXA 3E9DA 5EA2A 3V33A 3DLAA 2VJYA 3HEMA 5BO5A 1UK6A 3U3KA 3B6KA 3HFGA 3BDVA 3MXTA 2GCOB 3N8HA 2H9YA 2YXDA 4IINA 4K9OA 4M9CA 4LCBA 3UMVA 3QK7A 4C7KA 3QVWA 4ZDKA 1I51A 1DX4A 4L72A 3NBUA 3PC8A 4ONEA 4FFNA 5JXIA 1FXUA 2YOHA 3NTOA 4MGYR 1E6MA 5FO0A 4ZI7B 1UXJA 3EA0A 1B0AA 1Q7TA 3F6BX 3L7YA 3U0BA 2OZVA 3HN6A 1XRMA 1LSJA 3QXXA 1P61B 4UTXA 4YYZA 3R8FA 1DCKA 1JSRA 1XK7A 4XTRA 2RHHA 4WN9A 2CXNA 2R6AA 2VDPB 4I8XA 2EKLA 3NP7A 3HN7A 4IDCA 4D9HA 4GLJA 4XCVA 3UPDA 5TARA 2P3QA 5JE8A 1UPXA 2ADFA 4WZZA 4OGWA 3TMKA 1YVRA 1Z0SA 2AN1A 2ID7A 5FBZA 4UKDA 1L8OA 2KBFA 5K0TA 4M1EA 3DO6A 3IEUA 4Y7CA 4HDMA 5COBA 4MV9A 3TSCA 2EVWX 5DN6A 1J0XO 2FP4B 3BH6A 4KIUA 1GFSA 4HDNB 4JBIA 5JZBA 5K6TA 3FCXA 3JYNA 1KC1A 2V9CA 4XB6B 4FNOA 5ERXA 1W4ZA 2ZQYA 1I5EA 2PKEA 4DDVA 1C2TA 4LXGA 4HB4A 3EZLA 2DPXA 1UMBA 1FX0A 3BTVA 4E2WA 1S02A 3BE4A 4NABA 2VYFA 1SQGA 4I5EA 2HDWA 1Z82A 3D6JA 4GXNA 1AHPA 4II2A 4ZQGA 1VC2A 2I2WA 4U02A 1N7GA 1RABA 3G7SA 4Q3OA 4MPJA 3V7YA 1M2KA 1UDRA 2JZOA 4RDHA 1NYLA 2XNCA 1NQVA 4Z4GA 1ZA2A 1IN1A 2ZYAA 2L0XA 3O8NA 3FSEA 4BB5A 1H22A 4YRKA 4BO8A 5FI0B 2H4JA 4EX7A 3DZHA 3QNMA 2P40A 4IIFA 4H4EA 1LTKA 5BY2A 5AKHA 2G1UA 2DM6A 2Q5FA 2FZGA 2IVZA 2P3SA 2W11A 2RONA 3IPAA 4J7UA 4NCHA 1DUSA 4LK3A 3RC2A 4I3HA 1GUAA 4TZ0A 4E5VA 1NFRA 5HJ7A 2UZ1B 3HP4A 3M83A 1EJBA 1PK8A 1Z3IX 3GOQA 5FLYA 4OH7A 3F0TA 3L4BC 4BO0A 1E2IA 2JW5A 2YMQA 1JKJA 2GJ8A 4CUJA 4K26A 4L15A 5F4BA 4DA0A 4E5YA 2RKOA 2OG1A 2SICE 5I7RA 5IT5A 4DA8A 4LJKA 1ABFA 4PC7A 1AGNA 1GSAA 1K8RA 1R50A 1UKBA 4BEBA 1H9CA 3ILSA 3K0AA 4CKWB 2BCJQ 4RYDA 5AKZA 2ZE5A 4OQLA 5GGYA 1J21A 1GUDA 3KFXA 2HRQA 1RLTA 2O3TA 3WQQA 5CCEA 4DPKA 1K9VF 1DO0A 5DYIA 1FP4A 3B9PA 3I8SA 4WCFA 3U49A 2ZRGA 1JWAB 2QN8A 5CB8A 2J4CA 4TYMA 2KLHA 3RLIA 1OAOA 4DWJA 3FPHA 2M1XA 2YXPX 3H2HA 2FDXA 2WWFA 2J31A 4OM8A 3ZV3A 4OA8A 1YJAA 1J8QA 3GROA 4MRMA 2P2ZA 1AKYA 1OLUB 4FVTA 4YUZA 1FDRA 3ZCRA 1WXFA 2JLRA 3AJDA 4MULA 1R7RA 4C01A 3Q7EA 2FUNB 2FQXA 3SMVA 1R8JA 2WUEA 2WJPA 4QDJA 3GJ5A 2X9NA 4RXTA 4FB5A 5IVPA 1U7ZA 3NMUF 4GSKA 3OJWA 1JFFA 1UMDA 4HPWA 4LYGA 4DWOA 1IATA 2NQTA 1PR6A 3SEAA 2UZ0A 5C46F 1DSSG 3GDGA 4IGFA 4CIVA 1WVIA 2H07A 1XPRA 2ZAOA 5AR1A 3H5IA 2RI6A 3PKZA 2NO7A 4XJXA 1YRHA 3AESB 1JDVA 1OREA 3DDSA 5B55A 1JDUA 2W6JA 2PA0A 4MKZA 4FIDA 2EU8A 5AI6A 5B6PA 4H7HA 4O2AF 1H1LB 3QFRA 4OBBA 3U37A 1A5AB 2GD6A 4DWWA 4CCWA 3D54D 1NVVQ 1T2NA 2JFYA 2V3VA 4US1R 1ZH8A 2FKAA 2WU3A 4BNVA 2XQKA 3JR7A 3ONFA 3UICA 2I9PA 3SHOA 1XP8A 5L7TA 1R3UA 3G49A 4QUJA 4MA5A 1GNLA 1SU7A 3FWZA 4G5OA 3H8WA 1ZS9A 3TTTA 1VJ0A 1BH2A 4RAQA 1ZIXA 4MV7A 1U63A 3O8CA 2WAYA 3CE9A 1XCMA 3F1KA 3Q3EA 4L76A 2H4ZA 3O26A 5BR4A 5CD9A 2W8BB 4ZOLA 1CR6A 2VBFA 1L6RA 1UK8A 2NT3A 5FBQB 4MI9A 3REOA 2JGKA 4ZKDA 1KWKA 1PBTA 1NMYA 1K8ZB 1E6LA 2W83A 3E81A 3GAAA 4GPD1 3A9SA 4FMCF 2X9VA 5LA6F 3GJYA 4UZFA 1JJAA 1DLIA 1IVYA 4GOOD 1GDDA 1Y6RA 4WT7A 4HXYA 3RS0A 2XOKA 4EFDA 2G1JA 4U6SA 1HDRA 1WMEA 5CPBA 2QVLA 2RHWA 3KJZA 4H7DA 3AJ8A 3D3WA 1H2HA 1FF9A 3I01M 1J1UA 5DULA 3HKEA 1S8OA 1EXWA 4UUOA 1ZXLA 2RI0A 2XNDA 3VR0A 1QIIA 3M3HA 5DKFA 3X0DA 1E5TA 4GZ5A 4ZI7F 2C5LA 1XELA 1MT3A 2R7NA 5JS8A 1ZBDA 5HTKA 1A50B 1QHIA 2EC5A 4QPJC 2GD1O 2UXCB 2QG6A 1Z29A 1LW7A 3IILA 3WIDA 2IUTA 4CKEA 2DBZA 2H54A 3QU9A 1HLPA 2ZKLA 5A05A 4XCQA 1X80B 2UYOA 3CRRA 1S7GA 4LX0A 4XGQA 1VKZA 3A1CA 2N9UA 1AQNA 4HX5A 1GAEO 5IH3A 1IK4A 1P3Y1 4K6OA 4TTVA 3QKSA 5AVWA 4AUMA 2DRIA 5BW6B 2W70A 3BT7A 1NFQA 1IK6A 1SXJB 4JXJA 4B83A 4DRXA 4E12A 10MHA 3NVKI 3BE8A 2VNJA 4Q4DA 4G0UA 5T6BA 3KPYA 3O8QB 3URKA 4F06A 3JVVA 2WF8A 4XYMA 5ARDA 3V6LA 3Q10A 3EXG1 1HO3A 1VXRA 1DG9A 3O74A 4EG5A 1XRPA 5A2QA 5IFLA 3F98A 2FW7A 3FD8A 4QXQA 4V3BA 4KW7A 3UCXA 3RG8A 4FS3A 5BYKA 3O3CA 4DREA 1EVQA 2EFCB 1UFRA 2C2YA 4H2DA 3PHCA 4HI0E 2HCTA 3QSYA 4X93A 4BAGA 2NSJA 1QYDA 4U0KA 2AOVA 4DDUA 2ODEA 4TQAA 5BN1A 1AK9A 3L6UA 1XFAA 4EB6A 1XUOA 4NFLA 5BQOA 3IBCA 4RLFA 3OECA 1ZUNA 3WLKX 2XVMA 3ABSB 4J8PA 3THWA 3CJTA 3GR6A 3TZBA 5FDFA 5ICGA 1CNMA 1V1MA 5AXBA 2J3HA 4KXQA 3V9PA 5FWYB 3DD5A 1NQUA 1NBEA 2AC4A 1NGSA 3ROXA 5JOQA 3RROA 1MTZA 2P4HX 4ZCSA 4WN9B 1ATIA 1UDWA 2GUGA 1AURA 1E98A 2I2XB 5E3JA 3SBEA 1F4VA 3TEMA 2B69A 3TFWA 3WG9A 4RUKA 2QTZA 2QMUA 4G3XA 4LBZA 3RSFA 2WZDA 4F4HA 3WMXA 1Y6FA 3K2EA 1J24A 1YXMA 1U28A 4HDQB 2B37A 5BT8A 2PXHA 1VPEA 2IOFK 2BGGA 3LAWA 3KAPA 3M82A 1YFKA 2OCYC 3LVQE 1JAIA 5KYUA 4IYJA 4B75A 2ZB2A 2C4VA 2PQ2A 4KJXA 1PEYA 4GDMA 3JW8A 5AOVA 3TJRA 1G4UR 3TLYA 3D0OA 4C0BA 1S2MA 3ZEIA 2XT9A 3SZUA 4H1VA 4DABA 4M76B 2QRPA 5EE3A 1FX0B 1O6FA 4TWAA 1ZUIA 3TTXA 3KQUA 3O03A 5SZIA 2NAFA 2R5FA 1FYXA 1TQHA 2YHBA 4PYIA 4CIBA 3HYLA 3VBCA 2W6ZA 4AICA 4KRYA 4JUCA 1LXCA 2X3FA 2C3MA 1ZK0A 2QRJA 3MUFA 4GZLA 2DY1A 4XXHA 3PXGA 1MG0A 1AKUA 1T5TA 1Y4AE 4NJEA 2OUKA 4M0UA 4KPYA 1CJTC 2XMBA 1FFHA 1Z26A 5ALYA 2PH1A 3GJ7A 3W8RA 1FP1D 2IIQA 3WK5A 3Q3CA 3EXAA 4MVJI 5AQEA 4NMXB 1GL9B 3B6EA 1YQDA 4EJSC 4ZYTA 1T3SA 4ETMA 2FPWA 2R6HA 5JAOA 2G67A 3LZDA 3QY9A 4GBGA 3GUZA 5F98A 4WSOA 3WY9A 2BW0A 4E1AA 5KTSA 1O9BA 2QRUA 4ARCA 4QGBA 3V8BA 4RKQA 3VO9A 1Z4OA 3WK9A 3SM3A 2PM8A 2PLNA 1JSXA 1Q77A 2RIPA 3T8YA 1JHVA 2IBMA 1XCPA 1ULSA 4D98A 3HDVA 4HJXA 2CJPA 2DY0A 4W8GA 3TLGA 1NVBA 2B4YA 2F1OA 1QH8A 2RB4A 4NEHB 4MS3B 2I7XA 1FP4B 3R7BA 4WCFB 5K3FA 1TC2A 3IUMA 3FDIA 3X1MA 4RTKA 1L1EA 2VJAA 4BFSA 4MRMB 2UU9B 3C85A 3LYHA 1CU1A 1QBGA 4C7XA 3V8RA 1UPFA 3QVTA 4D3SA 1HR0B 2CV2A 3V3KA 3R3XA 5FFFA 4TRJA 2DPGA 3PR2B 4DA9A 2PT6A 1ODTC 1VM6A 2O3RA 4JNKA 3IAAA 4OXNA 5DTIA 5CW1A 1J20A 4YDSA 1QYRA 3CZMA 4B5LA 1UMDB 3MFYA 3BN3A 4RM3A 1PT5A 2VA8A 3F4LA 3P0HA 3FMFA 3UAGA 1HTWA 2QN1A 3CZQA 1KMMA 3RUPA 1NA5A 3VKWA 4DC1A 5I01A 2HIMA 2O2EA 2H85A 3V2GA 4EHKA 3WLPA 5ADUS 2O9JA 1KMIY 2GTIA 1G5QA 2BFDA 2B4RO 4LJ5A 2YDYA 3ROGA 3B1YA 1FYVA 3T5GA 1GKIA 3RGGA 3VR6A 4WECA 3ZWVA 2AD1A 1VBMA 4RA6A 1JRLA 1MBZA 3MD9A 1C8VB 4XRRA 3GT7A 4UM8B 2GBFA 1VJRA 2ZUDA 3QHQA 3I9JA 4Z5XA 1AV7A 4DHEA 4HH3C 1WS6A 1GGMA 4UE6A 2P6PA 3M6VA 1K9SA 3HGMA 4BRSA 4ZZ0A 4DAEA 4RHEA 5DE3A 4AWAA 2BZSA 1SXGA 2HM7A 1FMTA 2JVIA 3EWNA 4V0NA 2PPVA 4ZOLB 1YVUA 4CV2A 3LYLA 1ACJA 2FZLA 4EFKA 4XQCA 5EP1A 4DLTA 1YR3A 5I48A 3AFMA 1OAKA 2XNJA 1KI4A 2Y77A 2I4MA 5AUPB 2XZLA 3PC7A 5ELMA 4JYBA 1USKA 3L4EA 1NG1A 1KMQA 2O06A 2WJ3A 1MJGA 4X90A 1U8TA 1TYCA 3QLVC 5BWLA 3BA1A 4IL5A 2DF8A 1I6LA 4LJLA 3E1KA 1UDBA 2LD4A 3CFYA 5LYJA 4FW9A 4JSYA 4CKCA 4OLAA 4Q4LA 3E15A 821PA 3HKEB 5FH9A 2OENG 4AAYA 2CMFA 3AWIA 4YP6A 3P32A 2OGUA 4L85A 4ZXPA 4OHYA 4MQ6A 2BGWA 4MDEA 1XPUA 2FPPA 4JJGA 5HF9A 4PICA 5K7SA 3AZPA 2Q27A 1RBZA 1E2QA 3G6WA 3L9WA 5IAEA 2AXPA 1XKLA 2KYRA 2WM2A 4JBGA 3Q1LA 4XUEA 2G9NA 1MEOA 4IH4A 4J1TA 4CKEB 1QIFA 3THXA 2BFFA 1ZZGA 2PYDA 2RI1A 4L8GA 3TAUA 4B48A 2H1LA 1BRTA 3A6LA 2EYQA 4GPIB 1NSYA 4HP8A 5ECGC 4ZFNA 3OZDA 5IDQA 4EARA 3QKSB 5FBHA 1KJJA 2QMHA 3PGXA 2VUIB 4LXUA 2YC2C 4RK0A 1L7PA 1ND6A 1TW3A 3RVPA 2Z3VA 3R7FA 2Z2ZA 2XTZA 3G2HA 4FOLA 4AJIA 4EB8A 3EVFA 2IC5A 4A2CA 3GUHA 3RJ9A 4RJJA 1KYQA 2YJNA 3ZWCA 4JBWA 5CEFA 4DV6B 3BMOA 5ALOA 4H7KA 4CR8A 5EY5B 3KAKA 3BX1A 2Y93A 3KWFA 1XOIA 2YJ4A 1ODJA 2NTJA 3T1OA 4BWFB 3WXMA 4YUXA 5CFQA 3IAHA 3VNSA 5BSKA 2ZSIA 2PU5A 4HFNA 2AHRA 5ETJA 1WB9A 3L18A 1E3TA 1XRQA 3HNPA 4HFJA 2R6ZA 2JK1A 3H75A 4Q7MB 2JF0A 4NQZA 1ZUNB 4IS2A 3THWB 3LQRA 3G8AA 3RVLA 3I01A 1ESCA 1DIGA 1TUGA 3DKIA 1V1MB 1KEZA 3IPXA 3WLTA 4U5QA 1IBRA 1PUJA 1YMUA 1COWA 1PHRA 1W6UA 4CM9D 4ETWA 3V8QA 4LVNA 4ME6A 1ISIA 3WSVA 2X14A 2I7VA 1XRSB 1NIJA 2WD7A 3F49S 5FV4A 1RYBA 1H6CA 1OROA 1GNRA 4GKKB 1VECA 4UU8A 2C94A 4JY7A 1W1UA 4NK4A 4NFHA 4PLHA 5CCXA 4NZOA 1GFWA 3GP8A 1ZM4A 4G84A 2Z5VA 3M4NA 4XWAA 4FYHA 3VPBA 2VA9A 5TPZA 3VH3A 4B3CA 4CG3A 4F60A 4GNRA 4EHAA 1ZIDA 4B9EA 3NVDA 3EZ6A 4L6AA 2UZ4A 3O1LA 4YIKA 1QTNA 5EVJA 1E62A 2IYTA 2IFTA 4LC1A 3JRNA 4IUCS 2VTEA 2WLTA 3SR4A 4Y9TA 3UWDA 2DH6A 4FEAA 2H2DA 2OYCA 3TR5A 1NNLA 1OV4A 4RGBA 1EFCA 1Y82A 1LU9A 4U2EA 1KI6A 3N5CA 1GAJA 3CGWA 4PSCA 4B2PA 1X7ZA 2QJFA 4IJKA 3U1BA 5J4HA 5LKRA 2A88A 2QUKA 1D7OA 1XZNA 3PFIA 1RVV1 4F7WA 1N78A 1GGHA 1P4AA 2YZKA 1TMYA 3IRVA 1OZGA 1XD8A 1Z38A 3F3KA 4UZEA 3BSYA 1WIWA 4GGPA 4ARSA 3U1VA 3LXUX 3L5OA 1NE2A 1U6KA 1JEJA 3AG5A 5HA5A 3IE1A 3BXFA 4JLWA 4PE5B 2QLJA 1RQ7A 2XGGA 3EMVA 3EPPA 3JQEA 3U81A 3NANA 1RBMA 4LY6A 5IN4A 3CZ4A 2GCIA 3M2TA 4HUQA 4ETNA 3LWDA 4P31A 1XXHE 3ONVA 4OFXA 3LKBA 4QFMA 5ILOA 2VHEA 4MWTA 3TLGB 3C3PA 1M7BA 1QG0A 4BNUA 2JGNA 5KB3A 3OM1A 3K8QA 3BL5A 4M0PA 2CXSA 3FYTA 4IGEA 4R9SA 1E7RA 4DMKA 4F4JA 5K3FB 2UUBB 1X3SA 4ZOLF 2EBHX 2RAPA 1XCGB 2WJVA 5DBEX 2CV1A 2IPMA 3FMIA 3HHPA 5AVZA 1KA9H 2NXJA 4DILA 1W5SA 2AZMA 3F5MA 4CV3A 5E3HA 2FEAA 4ALLA 2BH2A 3ND6A 1PSWA 2ZUVA 3DFUA 4WZAE 4LKOA 3GLUA 4GVPA 3A6FA 4I6GA 4LRUA 3QXGA 4PG8A 1P1IA 1NOIA 1KDVA 3UEOA 5JBQA 2Z09A 1S8AA 1I2CA 1XRLA 1UQRA 2ORVA 3GDOA 5FUYA 1TD9A 4N5DA 3TDMA 2EJBA 3C7TA 4RSMA 5C1BA 5J47A 3FGNA 2G7ZA 3CURA 2VDWA 5TRTA 4ZMSA 3FOFC 2ZULA 1VYUA 3WADA 4M3NA 1GKYA 1VI6A 2EKDA 3L6RA 3VV3A 1KYIA 3WL3A 4EVQA 4FNGA 5AM1A 1HNWB 2WKWA 5IM4A 2BZ1A 3COSA 2J4FA 2FYTA 3N5KA 2BMJA 4LHSA 2BLLA 2JGMA 5ESDA 1JE0A 2BFDB 4C4SA 1P1KA 1D2GA 4HVTA 3KYDA 1CZNA 4Z0PA 3OF5A 4F3YA 4G0WA 1QLJA 3PDCA 1ZD1A 3IMCA 3GGOA 1QJCA 4EY4A 1SB8A 4RY0A 4RA6B 4ZIRA 4YI3A 3ZZTA 4HRVA 3UFBA 2ZPAA 3W6NA 4I7EA 4P5EA 1BIFA 4WXPA 2X19A 4G0NA 4BB6A 1L5QA 2W42A 1XWIA 3WS7A 5IUJC 3IR5A 3AUAA 4YPVA 2OV2A 1NVMB 1WV1A 4O6VA 4TT8A 4U5XA 5A4IS 1I4LD 3D8HA 1QFSA 5FF9A 1P9LA 4MLZA 1FPMA 1D2HA 2DUNA 3C5HA 3JQFC 1IHYA 4FUTA 4Z9AA 4L0MA 2G4VA 3KVVA 4CMBA 2ILVA 5FL7A 4KWHA 1PFKA 4JD5A 3D4IA 1E0DA 4R8VA 2WPNA 4KUHA 2XGSA 2M6LA 4EG7A 3DKRA 2ZATA 1XV5A 2HWUA 4M4SA 5EJ8A 4AZWA 2XRYA 3T4XA 3B6MA 4OQ4A 1YVDA 3MN1A 4E14A 1N6PA 2BEUA 3FVWA 3LL4A 3SYNA 3IAUA 1BW9A 3NNSA 4HB3A 4EUEA 3I76A 4ZVRA 1CDEA 2ZRHA 3F7NA 4JJZA 1WEKA 2IUFA 1HDIA 3GBSA 3O8LA 3WL6A 5I6DA 1NJ2A 2Q41A 1U7XA 2FAXA 4JI2B 2H2IA 4D3FA 1VZ3A 2FPPB 4TSRA 1QO9A 2KWIA 1OGIA 4XAQA 2OCBA 5AJUA 1S8FA 3STUA 2ZTLA 4NYMQ 4TS4A 4JT9A 1RBYA 4AJKA 1T5SA 4HAWA 1J8MF 1XZMA 2BFFB 3NUGA 5KJ1A 4WLUA 3ASVA 4WKOA 2LKCA 3ELDA 3KQTA 1GPBA 2OBLA 2PD6A 1PDWA 4WKGA 2ZUBA 3AG6A 2GN8A 1Z5PA 2IXTA 2QQFA 2IGBA 2WG1A 3QOYA 4EO7A 4YMTA 4P4UA 4WNCA 3PQ7A 3UKOA 1PR9A 2AG0A 3DHNA 2Q3EA 2NO5A 4D4GA 5JAPA 1SC1A 3OZVA 2PSSA 3M33A 4PG4A 4YRDA 1N75A 3C7CB 4M0LA 1YL5A 1E4VA 3REQA 4HGQA 1WUJS 2ZIUB 3H6GA 3BULA 3RH0A 3MAGA 2XNHA 2C1ZA 1SHUX 3KJEA 5DH9A 3CLUC 3FNIA 4EY7A 5BMVB 5JJIA 1YQQA 3PIIA 2IP4A 2XTJA 3JQQA 1VMAA 1SXPA 3HZHA 2CKMA 4RJLA 5KVCA 1BGWA 4L8LA 3WGZA 1P19A 2MR5A 5CXSA 3R5XA 2G72A 1Z4MA 3AVQA 2IZ7A 3GRYA 3NQ41 1QZUA 2X0JA 1ZGAA 4X1IA 3SVZA