2JGNA

Ddx3 helicase domain
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
166
structure length
151
Chain Sequence
TSENITQKVVWVEESDKRSFLLDLLNATKDSLTLVFVETKKGADSLEDFLYHEGYACTSIHEEALHQFRSGKSPILVATADISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNERNINITKDLLDLLVEAKQEVPSWLENMAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ATP-DEPENDENT RNA HELICASE DDX3X
publication title Expression, Purification, Crystallization and Preliminary X-Ray Diffraction Analysis of the Ddx3 RNA Helicase Domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 53
structure length 151
sequence length 166
chains with identical sequence B, C
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2007-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00271 Helicase_C Helicase conserved C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2jgnA00
1T91A 4Z1MD 5CDFE 3HDTA 5JCPA 3THXB 1KAOA 5DSZA 1NKTA 1KI8A 3HR8A 4IOJA 3SQXA 3TLXA 2D06A 4JL6A 4WOPA 1UBEA 4WZBE 3GLFA 2O8CB 1AS0A 3QKSB 4WA7A 4QC2A 4OK3A 2IYWA 2OBLA 5DHAA 5B57C 4TYNA 1SKYB 2CNWA 2QQEA 3T1VA 1NIJA 2BCGY 2IS1A 1KO5A 4HB3A 2JLZA 3FDIA 3BD9A 5LB2A 1P2UA 1ZM7A 2F1HA 5JI2E 1XD9A 2RGCA 1E98A 3EC1A 3WYAA 2AD5A 3TW8B 1SVSA 4BZXA 3B6EA 721PA 2WJJA 2A5YB 3UWOA 1NLFA 4Q7KA 2WWHA 2W2VA 3LXXA 3UMSA 4G5GA 1II8B 4QBGB 2FNAA 2P6RA 2O8BB 1GUAA 1QF9A 1NN0A 2ATXA 1OKKA 2CLCX 1KNQA 2PZFA 2YWEA 2ZSBA 2VHCA 3LLMA 4PHTA 2GZAA 3QPUA 4UJ3A 5HZKA 5JZVA 1P61B 1KMQA 1XDBA 2F9MA 5EQTA 1E2LA 2ZUDA 2VP5A 3U4QA 3GLIE 2IUSA 4TL9A 4EUNA 1NG9A 5KDOA 4Q01A 2HT1A 1D6JA 2AK3A 2HF8A 1US8B 4IFEA 1NLYA 5JS8A 1JAHA 1K5DA 2ZANA 3AGQA 3FTQA 4TMXA 3KFXA 1JNYA 4RCYA 4CYMA 5HCIA 4B3BA 3GLFB 5JWOA 1E2HA 1RKBA 1KTVA 3W8NA 4QOSA 4ZCMA 2Q9AA 3PEYA 1EFRD 2FH5B 1Y3AA 4FWIB 4QJ5A 2C03A 1SVOA 3PUWA 3FMIA 5BQ5A 3TBKA 4LHZA 1WB9A 2GTPA 3QBVA 2AKYA 2IL1A 4J0QA 1Z8FA 3FFBA 1R7RA 4MUAA 4WVFA 2QPTA 3HU3A 2HYDA 5TDHA 4KFRA 1UF9A 5FOTA 4C0KA 2CCGA 3PUXA 3BFKA 2EFHB 1H8HA 1NN3A 2H8KA 2WWXA 2VYFA 3P27A 3B1XA 1LF0A 2VP0A 1KZGB 2HEIA 1RZ3A 2ZJ5A 4DT1A 4R98A 4JVMA 1Q57A 4CRWB 2W58A 2WIAA 3FKQA 3IEVA 4GL2A 1JBKA 4LYFA 1GKYA 3TR0A 2JJ1D 5AJXA 1SXJE 4MITA 4L9SA 4RFVA 4QGGA 3K09A 1RC8A 3OEED 1OV4A 4HAUA 2ZIAA 3BC1A 5EE5B 1J7KA 1E2FA 4US1R 2ZE7A 2Q21A 2WPDA 1YR8A 4F4CA 4M9SA 1F2UB 1XZPA 2NGRA 3MSXA 1PUIA 4MKHA 1JI0A 2IHBA 3MAAC 1OE0A 4JT2A 3HP1A 3WNDA 3NTUA 2EU8A 3DDCA 5L3VA 3BFXA 4Q1CA 3R9IA 3GLGA 2HJGA 2JJ2A 3CONA 1YZNA 1ZUIA 5KDDA 2QE7D 4JLMA 1J2JA 4NL4H 2ONKA 4Q4AB 1OIXA 1IY2A 1FP7A 4L15A 4HAVA 4TMVA 4XWAA 2FFQA 4YLGA 3DOEA 3X1ZA 1YVDA 3BH0A 2IYQA 3CM0A 3KXLA 2IT1A 2NO7A 1E1QD 3TMKA 1XD8A 1XPRA 2P2LA 4AIIA 4BRWA 1J8MF 4YMVA 5JMTA 1XEWX 4FCWA 1FL9A 1YR6A 2ZE5A 2KBFA 1OXTA 4TSFA 4AI6A 3MGCA 1Q1ZA 4OQNA 3B13B 4XTCS 3EW9A 4OK6A 1RRGA 1NSTA 1O3YA 2B7CA 2R8RA 2F3TA 2IYXA 3TSWA 3I92A 1R0ZA 3U44B 3RRNA 4Q03A 2YWGA 3EPKA 1DOAA 5JHHB 1T6NA 1W4RA 4V03A 5KTYA 2QP4A 4KODA 2ZXUA 5B30A 1DELA 4B3CA 1VKJA 1N5IA 1XEXB 4D81A 2WWWA 1Q21A 1EESA 1RRPA 1WCV1 4M8NE 1G5TA 3C7KA 3T5DA 4F91B 1N6IA 1S4QA 5JSZB 3K1JA 3PR1A 4RD2A 1ZYUA 1G8FA 2QTFA 2ZVPX 1C1YA 4HDQB 4LCBA 3K0FA 3Q5EA 3PEUA 2RCNA 2V3CC 1P75A 4AC9A 4OJKA 421PA 1OH5A 2XTNA 3GLGB 1I4LD 3SFVA 5BN4A 3WBKA 2EW1A 1W4AA 2OCPA 1KSFX 1Q1EA 2DPXA 2VRWA 1IXRC 1J70A 3W9YA 2HCBA 3UMRA 4Q4JA 4PANA 1KDRA 1S0UA 1UFQA 2Z5FA 2C04A 2BHRA 2QRZA 4B44A 2K5UA 2V8OA 3IQWA 5FTLA 1CIPA 2R6AA 2IXEA 5AWFC 3LY5A 4DDTA 1S3GA 3UKDA 3P32A 2ZROA 4Q66C 4XOIA 2ZUCA 3BGWA 3W6OA 1M1YE 1VIAA 2GAAA 1Q1BA 2WVJA 2ZE6A 2CL7X 2V6JA 1W36B 4ZO4A 4W5WA 2ZRPA 2IWRA 4RZXA 5C4MA 2JGNA 3REGA 3RHFA 1GNRA 2G77B 1JPNA 2OLKA 2QBYA 5FBLB 2WAXA 1MO6A 4QKQA 2OFXA 2P6UA 2WSMA 2EWVA 4B3FX 5LPNA 1WQ1R 1TF2A 3EZ6A 1QVRA 1CP2A 1E2PA 5KPJA 1E0SA 4G3XA 4JSTA 1E99A 4B2LA 2GESA 2IYRA 2QI9C 3G82C 3OIWA 3ZLJA 1TADA 2XOKA 3M1IA 3OAAA 3DKVA 2D2FA 2GJ9A 3KJHA 4QBIA 2BDTA 1NVVR 3QNUA 2W6IA 4AKHA 3QBTA 4P4TA 3GFTA 4CEJA 1W0KD 1KK3A 1ELOA 2ZVQX 3CIOA 5CDFA 2W2TA 3F0TA 1E94E 3KJIA 1P7CA 1Z6GA 1HQYE 3FE2A 3LV8A 1YZTA 1KJZA 1EX6A 1DAMA 1U94A 1A82A 2NTYC 2G3YA 2ZRBA 5BYJA 2DFNA 2V6IA 4A8JA 4DBLC 1N6NA 1FTSA 4JBWA 3A6PC 1KI2A 5FUYA 3R7WA 3CX6A 5AJWA 2DWOA 1KOFA 4ITRC 3K9HA 1RIFA 2HLDD 3D3QA 1IN6A 1U0JA 2E9SA 2GZDA 3OZXA 4NMMA 1NNEA 5F3WB 2D7CA 4V0NA 3KL4A 2ZE8A 2MMGA 1EX7A 1MH1A 2QZ4A 1XB2A 3EARA 3ND8A 3GP8A 4XSHA 4HZIA 3C5CA 4PZLA 4JBXA 2XZOA 1G21E 4QBFA 2PLFA 3O8DA 5L8VA 2ORVA 4TLCA 4NYMR 1Q3TA 1ZINA 3NIBA 4AKIA 4HYYA 4M0LA 4ZDJA 3BH6A 2GJSA 2F1IA 5DYIA 1ZU5A 1T9HA 4N0DA 2YC2C 1HTWA 2D74A 5SZKB 3X2SA 3I1FA 1SGWA 1JEEA 1A1VA 4NHOA 4TL8A 2XSZD 4IRUB 4D0LB 4JMPA 3WRYC 2ZREA 1ZM3A 5G3YA 4C0HA 4DEXA 2R6FA 1DBSA 4DHEA 4DLWA 3GLIA 4PO9A 3U7FB 3BFVA 1TPZA 2ZRJA 3O47A 1UPTA 4CEHA 3Q5DA 4E03A 3UWKA 4MA4A 3Q9LA 2ZYWX 1RJ9A 2IYTA 4AK9A 1E1RA 4PO8A 1T3HA 2DFLA 1XX6A 2OAQ1 2Z43A 1IJEA 4GSYA 4A8JB 5E7IA 1NBMD 1IY1A 2P0EA 4BFYA 4NONA 2A7QA 4NYIR 2GKSA 1CR2A 3G0HA 3EZ9A 1GVNB 2PLRA 2JIZD 1WMSA 2P67A 3CNLA 2B7BA 1JXMA 2GF9A 4S35A 3CNNA 3TKLA 4E5UA 3ZD6A 3IBYA 3MFYA 4YC7A 2J59A 2O8DB 1Z3IX 2XXAA 3EPJA 4QFMA 1BMFD 2RGXA 2XTMA 4Q48A 2ZI5A 2WICA 4M9QA 1OB5A 3BE4A 4BWYA 4W5HA 1WRBA 3A1UA 1YHNA 3AVWA 2W0SA 4BFUA 4TTPA 1IOZA 3BIFA 3I61A 3GEHA 4B73A 4C0AC 1E4VA 2GCOB 2J0SA 2R6GA 2WBLC 5KSZA 4B3XA 1E3MA 1SXJA 2QGNA 3SDZA 2NPFA 1GAJA 4G0NA 2WJVA 1HURA 2A78A 3OIUA 4N0EA 4OI4A 2DBYA 4RD1A 1N5LA 1E79A 4IDOA 4KLNA 1MRSA 1W1WA 2WAYA 2H92A 4DB2A 1M34E 4KJZA 3PG5A 121PA 2UZ3A 4OHVA 4Q4LA 5DE3A 1NG1A 1EGAA 2FG5A 3LBIA 4F4JA 3X1WA 3R9WA 1BO6A 5KSPA 4JVNA 1L7VC 4I1OA 3KKQA 4EDHA 1G16A 4U00A 2J9RA 2C77A 3TE6A 3NBXX 1SVIA 3L0IB 2B6HA 3DPUA 5J4YA 3NVAA 1NY6A 2HT6A 4GRAA 3O8RA 1V43A 1XTIA 2OEPA 1Z07A 2AFIE 3DHWC 1L8QA 3CUEF 2FPKA 3EZ2A 4NDZA 3QENA 2GEDA 4KBFA 5EXTA 4Q4HB 3CKLA 3SHWA 4LHXA 3THYB 3AP3A 1SHKA 1YJ5A 3AF4A 4D80A 3UMFA 3LD9A 3SOPA 3IDQA 3A4LA 1RRFA 3QPWA 4Q9JA 4AKEA 2X1VA 4UXJA 4YMTA 4X8HA 4TT3D 1PUJA 3U3JA 1JR3D 2ZI6A 5DI3B 3T1TA 1U8YA 1SXJB 3QG5A 1Q1QA 3PENA 5GJCA 3ZVRA 4DLRA 3EWSA 1FX0A 1OHHA 2R6CA 2QN6A 3RRYA 3VMFA 4DUGA 4C0JA 2PZEA 4QGHA 4POAA 3ZH9B 2OZEA 1H65A 5F9FA 1RYFA 3U61B 4M2LA 1LW7A 5TV2A 4GDFA 1Z6AA 4FW9A 3W5IA 2GDJA 3IUYA 3RVBA 3FPAA 1OFHA 1XTJA 2H17A 2PCLA 2QNRA 4BZPA 1KMHA 2G0TA 4GZMA 5HKKA 2VH5R 4R7ZA 4C0SA 4TQ9A 1FUKA 4US0R 5GJWC 3JVVA 1XP8A 4XVQA 1IQPA 1KDTA 2RB4A 3QI2A 4FMDB 3QSYA 3EPHA 4CF7A 2RGAA 3KXIA 1ZIOA 4Z51A 3VR4A 2OXRA 5KNBA 4BFTA 1G8HA 2GNOA 5DI9A 2R2AA 2FSHA 1XCGB 3UATA 1DAHA 2ZRMA 1FMLA 2AN9A 3P26A 1CF4A 5KSOA 4C0BA 2WSSD 4PTLA 4I81A 3EZ7A 3NBYC 2H7VA 2CXXA 2PT7A 3B78A 1VCNA 4QHTA 1FW6A 3GQBA 5IF9A 3MMPA 4RVCA 2Q3HA 4B33A 4PZZA 2A5JA 2IX3A 2V1UA 3K0CA 4UNNA 2F1JA 2A5GA 3RDPA 3Q7QA 4D6PA 3DMNA 2RH5A 4HUQA 2I1VB 3KUDA 1G3RA 2WJIA 3GJ0A 3K0EA 1DAGA 2J5XA 3FGNA 2QM8A 3R8FA 1UBCA 1ZVQA 2VHQA 3AF1A 3CZPA 3KKOA 3GJ7A 5L3QA 1ZNWA 2ZI3A 4V0OA 5AR1A 2XNDA 1MT0A 1N0UA 1ZIPA 4PQYA 2XITA 3ZQ6A 4QM7A 2QPOA 5IK2A 4EJSA 1A5TA 4ZCLA 3WY9A 1WE2A 3U3RA 3QVUA 1E96A 3TAUA 4B35A 4RZUA 4Q02A 3W6PA 4A2QA 3OE7D 4XJXA 3SZRA 1QHYA 3KJGA 1FNMA 3EX7C 5JEDA 2W0MA 4YMUA 2ZS7A 2JLUA 2ZRHA 5G40A 4DVGA 1S1CA 3I32A 2PL3A 4OYHA 1I4DD 3IQXA 2KE5A 2CJWA 1ZD8A 2BMFA 2FF7A 1YKSA 5A0FA 3WMGA 2RGNA 3CO5A 3SYNA 1SQ5A 3QXJA 1G3QA 2QMHA 2IHYA 5LD2B 1Z83A 3DZ8A 1P73A 4CIDA 1XTRA 4D4JA 4DLSA 2GBLC 1OLOA 4UNPA 5EZ6B 2GEUA 1HT2E 3AVYA 4FIDA 2F43A 3SJAA 2CHVA 5P21A 4HUQB 1MABA 1VCMA 2C96A 1KHTA 3HYTA 4M9ZA 1SVWA 4PR0A 3WBJA 4E22A 4AY2A 1CRPA 3WRXC 2ZJYA 4M4SA 1ESMA 1KKMA 3RWOA 3V9PA 1GKIA 2AX4A 5DH9A 2RGDA 5L3QB 2WJHA 2NQ2C 5FOVA 2ZRNA 3AF0A 4TTRA 1XEWY 2J7PD 3B82A 4PPQA 3KJEA 2OM2A 4PAQA 4DLTA 4EJSB 2YOFA 3D31A 3CWZA 4N3NA 1YRBA 3LWNA 5FOWA 2HDNB 2BJWA 3E5HA 5FI0B 1PLKA 4B32A 1D2EA 2CMKA 2GRJA 2P6NA 1ESNA 1ZNXA 2ZPTX 3BORA 1W4CA 3K9LA 3W3ZB 5KU1A 2DCUA 3KZ1E 3BJIC 3R20A 1Q3HA 4IJMA 1E2NA 1SVMA 4LV8B 2J0QA 3P4YA 4QHYA 2UKDA 5CLLA 4RKEA 3CRW1 1GRNA 4A0RA 3TSZA 3RS3A 2REOA 4MGYR 1KI4A 3AB3A 4L9WA 4XD7A 3QPVA 3VQTA 4BE7B 4G5OA 1G18A 4PC2A 1G19A 1P60A 4D0GA 1KI6A 2VHUA 1XMJA 2W6JA 2IK8A 4AKGA 2J0VA 4ZPXA 4URUR 3LFUA 3U7GA 4H1VA 3OEHA 5FTMA 5JWHA 1LNZA 3F8TA 3MG9A 1XBTA 4Z8YA 2KWIA 3CH5A 4MYUA 2BCJQ 2QROA 4C0LA 3QOFA 2AHOA 3T34A 1OIVA 3LVRE 4EFLA 4IDNA 5FOXA 2WOJA 3RSOA 2C95A 2QPAA 3GJ6A 3N2IA 1ZC3A 4LDJA 3CPHA 4OHZA 3W5JA 4C9BA 3LAWA 2JLYA 3OFNA 3ADDA 4YMWA 1BOFA 3A37A 5DN6D 2C78A 5JEEA 1SKQA 4LHVA 1E9AA 3PUVA 4Q00A 4B2IA 4OQFA 2QAGA 3VKWA 5BN5A 1UDXA 3PCRB 4QJ4A 4MDFA 4KSBA 5CJPA 2LCFA 4JVLA 4E07A 5JRJA 1G3IA 2OXCA 1P5ZB 1ZRHA 2BMJA 4G5SA 1NJGA 4FMBB 1U0HC 2WWIA 3JVUA 4DLXA 1AS3A 4ZI3A 3JZMA 2CK3A 1LB1B 5E4FA 3UXMA 5EE9A 2IUUA 5J4HA 2XB2A 5L3SA 4OBEA 4DZZA 2VTKA 4M22A 2YV5A 4LUCA 5EP2A 1KGDA 4DLZA 3QKTA 5AUOB 5J47A 1NVWQ 2FFBA 3Q8XB 1H8HD 1L2TA 1P9WA 4PC3A 1KO4A 2PMDA 2ZR9A 4D4MA 5A4JA 3QJYA 4MQBA 4A0HA 1GNQA 4JJKA 2OO7A 3FHOA 4BFXA 2VEDA 4QL3A 5AUPB 4D4KA 2FEMA 1DG3A 1QVAA 4MRNA 4C3ZA 1GTVA 4JYBA 5KUTA 1D2MA 3CPEA 3TR5A 1KI1A 3SJCA 4O2LA 3GJ5A 1EWRA 3LRPA 1F5NA 1N5JA 4HB2A 2ZRCA 1TF5A 4JS0A 4HLCA 1W46A 4TYWA 5AK0A 1HV8A 1RE0A 4PHFA 3VHXA 4L4UA 1UM8A 3D6TB 1U0LA 2CLDX 1XF9A 2WPDD 3NBZC 3RAPR 2D62A 2ODWA 3X1XA 1O87A 3SBDA 2SHKA 4LPSA 3LLUA 5EZ5A 3C5HA 2ZS8A 3L0SA 3MWLA 5E3HA 4Z1MA 4O3MA 5FPSA 3THWA 4NCHA 2CDNA 4KCGA 4C2UA 3VR1A 4G5RA 3H0KA 1CLUA 4HB0A 2PJZA 3MWKA 5BN3A 2DY1A 1TU3A 2UZIR 5C2JB 3RS5A 5L3SB 5EE3A 1R6BX 5AJVB 1R4AA 1E0AA 1KIMA 1QRAA 5DNYB 2VSOA 4RD3A 2Z0MA 2HXYA 3FMPB 1GILA 2DWQA 5GJBA 3GEEA 2JATA 2PCJA 2QT1A 1II0A 5EJEA 4ILEA 1PJRA 1GFIA 1VG0B 5CYPA 1W36D 3QF4A 2GF0A 3KFVA 1W36C 4IXNA 4BFSA 3ZS8A 5TXGA 4DDVA 4URXR 5IDVA 2PJRA 1HY3A 2WJYA 2IF0A 4KFUA 3U4QB 5JECA 4IOLA 5FBWB 3KQKA 1UKVY 2VP9A 4RD6A 2CHGA 1EG7A 4Y0VA 1IONA 3IHLA 2XGJA 2I1QA 4KBGA 1XU4A 3W6NA 1GL6A 3DO6A 3FHTA 2MSDB 3ZIAA 4DCTA 4LHYA 2VA8A 4QBHA 2FA9A 5B2ZA 2XEXA 4I4LA 4JLVA 2ODEA 1N3BA 1KNXA 4JSYA 3V4FA 2L0XA 3M4YA 2FPLA 2ZRIA 3T06B 4ERNA 3L2OB 3PUYA 1NVVQ 4H1UA 3RSLA 5DYGA 1U9IC 1E9FA 1GWNA 1G8YA 5FPYA 1KJWA 4JLKA 5D3MA 1OB2A 2GEVA 4A0GA 3TUJC 3TQFA 1NBME 3A36A 3HU1A 3JZAA 1EFRA 3U7EB 2KBEA 1CJUC 4PHHA 3RABA 3PITA 2J41A 3HR7A 3ETLA 4PQRA 3ZVLA 4DT1B 4BRUA 4NP6A 5H68A 4ASUD 2VBCA 1N6HA 3QIAA 1UADA 4AD8A 1CR0A 2XX3A 2ZSDA 4JKIA 5M04A 4QNRA 2GXQA 1Z6TA 3L8ZA 4DRZA 3U6KA 4GI7A 1ZUNB 1U81A 5CIWA 4KITB 1P9NA 2HV8A 1UKEA 1QHNA 4A2PA 4LSGA 3T5GA 4HAZA 4DLVA 5DO9A 1CR1A 4NYMQ 2JJ1A 1TU4A 2ECKA 4G1UC 3PFIA 1CBUA 1A2BA 3FVQA 2Q9BA 4L8GA 3KQUA 4RFSA 2LKDA 1TF7A 3E1SA 3OEEA 2NPIA 1I2MA 3AKDA 4JZKA 4C0QC 3UIEA 2IYYA 1XPOA 3OAAD 4LJYA 4U02A 5FI1B 3SS8A 1Y63A 1NMYA 2R6DA 3P1JA 4TMTA 3V4RA 5EP4A 1YQTA 4HAYA 1A4RA 2FSGA 3LQRA 4TL6A 4ZKDA 1Z28A 2HJVA 4YXWD 1ZJ6A 3HJNA 1EFTA 4RZ2A 1ZMXA 1KSGA 4Q1BA 1FUUA 3H84A 4F93B 1G3MA 2YWHA 1JAIA 5DIFA 5GJVC 1SULA 1VMAA 1TMKA 1WF3A 5E95A 2GHIA 3GPLA 2BIFA 2QE7A 5F9HA 1BYIA 3ZGXA 1W0JD 2NMVA 3B8HA 1QHXA 3ASYA 2XZPA 3L82B 3MLEA 4NYIQ 1G9XA 1X1RA 3FWYA 2GAOA 1S2MA 2NIPA 2QP9X 2IBMA 1DTSA 4IDHA 1DO2A 2YOHA 3CRRA 1E1QA 2DR3A 4A9AA 2C5LA 2FZ4A 5J40A 1E2MA 5J4VA 5B58C 2BOVA 1P9RA 3VX3A 4TMKA 4Q9KA 4LK2A 1FP6A 1K6MA 4KO8A 3WNCA 1JR3E 1T8UA 4OI0A 3VR3A 3K0AA 1CJVC 1GRQA 2GJAA 1XRJA 3T35A 1DAKA 5CYOA 2FPMA 2AR7A 3T1OA 4RFSB 4PXAA 1AGRA 5H70A 5JHGB 2NZJA 1V5WA 1QG4A 1VHTA 4GOKA 5TVKA 1S3SA 1XEFA 2J7KA 2ZU6A 3K0FB 4E09A 5FL7D 3QF7A 2QSYA 3AKYA 3NWJA 4HEJA 5E7MA 1W7AA 221PA 3ZZUA 2B8WA 4RKFA 3KQNA 4URZR 2JLRA 3BS4A 1Z0FA 1DADA 4Q4JB 1KK1A 4Z54A 4W9MC 3HYRA 1KZ7B 3MWYW 2AXPA 2ORIA 4PO1A 3RANA 2YHSA 1D9XA 4UXHA 2OSBA 2R9VA 4JYCA 4CVNA 4PPGA 4DSNA 4WZAE 3NH9A 3AVUA 2IEZA 4XWOA 4HDCA 3LW8A 3DOFA 2XJ4A 4HAXA 1NN5A 4OQMA 4KHZA 2ODNA 4Y0AA 3GJ4A 2QBYB 1IN4A 3SBEA 8OHMA 1NY5A 2FU5C 1TUIA 1G5PA 4OHYA 3A4MA 4M1YA 5HR5A 2E87A 3ZD7A 1FNNA 3EA5A 3I3SR 1N6LA 1TUEA 2AK2A 2V7QD 3SEAA 3K0AB 2IYVA 2BM1A 2G88A 4KVAA 1OXXK 1SXJD 5FTNA 3IPYA 2JDID 1P4SA 1XJCA 4P33A 4CEJB 3K53A 5CJ2A 5GADl 3OHMA 4LGMA 2ZUBA 2I3BA 3W3AA 3K70B 2BBWA 4BLTA 1XMVA 2IXFA 3QXSA 4R2HA 1G64A 3FB4A 2YJTD 1NMXA 1W48A 3GJ8A 5JI3E 1OH7A 2ZAMA 1ZM2A 2KJQA 4Q19A 1KK0A 4RY2A 2CVHA 2FV8A 2X77A 3WYFA 1W0KA 3R7WB 4JLBA 2QRNA 1GM5A 1B0UA 1COWD 3B1WA 4BASA 4X8LA 2ERYA 3H2YA 1H8ED 3QXXA 1S1MA 2CEAA 4D2IA 3EIEA 1QZXA 2VP4A 2FMXA 2EFCB 1PV4A 2WM9B 2C98A 3QXHA 2J87A 3DZDA 3MJRA 5GVSA 5TY0A 2W2XA 4RD4A 1D8TA 4F92B 4KAXA 3PVSA 2WKRA 2JLWA 1NN1A 3U5ZB 2OILA 3LXRA 5TARA 3ND9A 1WBBA 1Z0JA 4CGZA 3X1YA 1ETUA 4XTRA 5CITA 3SN6A 1X1SA 4S2EA 2WTUA 2HF9A 4PHGA 4MRVA 1MO5A 1UKZA 2IYSA 2OT3B 3FMOB 4TMWA 1JQJC 1I2DA 1P2SA 3I8XA 2V55B 2A30A 4II7A 4JKYA 4BLOA 1LF5A 5A5GA 1U8AA 1ZBDA 3N70A 4TYPA 1IY0A 2CVFA 5SZJA 2VF8A 3L0PA 3T1QA 3ZS9A 3AKCA 3WNBA 3GLIB 3CF2A 1XXHE 2QMUA 3IILA 1X8KA 4K81B 1WP9A 4P4SA 2HCJB 4L5BA 4CEHB 1C9KA 2WWGA 2XSZA 1OW3B 3TVTA 3H1TA 4IKEA 1NSFA 1XNJA 1RJ9B 1UDWA 3VAAA 4V02A 1AJEA 3AP2A 3F3YA 5EE1A 2E1RA 4LJ4A 4OHXA 4BQSA 4AG6A 3A8TA 4AURA 4B75A 4W5JA 2JAQA 1KDOA 4KYIB 2QY9A 2ZRAA 1C4OA 3BH7A 2OLJA 4D82A 4JT4A 3L43A 2VSFA 3VKGA 1E0JA 1LY1A 1RW4A 2J1LA 4JLNA 3AVVA 5KSYA 4QNMA 2ZI4A 2YOGA 3IO3A 2N46A 3LBHA 3U7HB 1NBMA 2O8FA 2XXAB 1CR4A 1J8YF 2C2HA 4M9XA 4QJ3A 5FFMA 4BLQA 4C7OA 2X2EA 4D0NA 1EFHA 2JIZA 2TMKA 3T12A 3AVXA 3KTAA 1KSJA 3FYHA 3LO5A 3RS7A 1GOTA 2C9OA 2OESA 1WDTA 3SNHA 2ZYTX 4WW0A 2W00A 3NDPA 2GVDC 4EAQA 5IHPA 3MD0A 3U3MA 2J3EA 4PC6A 4QXAA 2J45A 4A36A 1VYTA 3HPQA 1GNPA 1BYUA 3LX8A 1BMFA 2JEOA 4M21A 1OFIA 5DHFA 5LD2C 3K0CC 1VYUA 3BOSA 2IWHA 3ZYCA 4K8OA 3EG5A 3SYKA 3HWSA 4FMDF 5J5CA 2B92A 3GJ3A 5BW8A 3B85A 4P4SB 1FZQA 1PVOA 2WKQA 3AQ4A 4LBVA 4Q5IA 4BPBA 4LYHA 2QSZA 3QVVA 5SZIA 1QHSA 4ESVA 1QHHA 1GG2A 3I5XA 3BAFA 2ZQ5A 2XNDD 4GZLA 1VYVA 2AXNA 5H1YA 3FHCB 3CF0A 3NG1A 3CRVA 4L16A 1NJFA 2WWFA 4PC1A 4TYQA 1CEEA 2CE2X 3N5CA 1G17A 1D5CA 2ZJZA 1ONBA 2GETA 2Z6VA 3A1WA 3QQ5A 1KO1A 1FQKA 3LX5A 1AIPA 1II9A 2LWIA 3WP0A 2EYUA 5AJYA 4O0MA 5EP3A 4UKDA 3KTAB 2R44A 1OH8A 3HPRA 1S8FA 2ZYUX 4YQFA 2A5FA 3HU2A 1KK2A 4KVGA 5IRCD 4PFSA 2AL7A 5FUWA 2VL7A 1FX0B 4BFVA 3LA6A 4WXRA 1UKYA 3RLFA 1DAIA 2PEZA 3MUFA 5TMPA 1JR3A 4KLZA 1KMHB 2NG1A 2Q3FA 3B7GA 4BZQA 4M1MA 5HE9A 4V0ME 2VP2A 4EFMA 4KFTA 1KKLA 3FKSA 4RSGA 1T5IA 4Q9LA 3ZVNA 2ZU0C 2OCYC 1A2KC 2DYKA 4ZDIA 3LBNA 2N1BA 4IHQA 4TZ6A 3IO5A 5EXXA 2YC4C 2HUPA 1F3OA 3Q85A 4A92A 2REBA 3I73A 2JLVA 2OBMA 3OIVA 2ZR0A 1VCOA 2IYLD 2ZAOA 1Z6XA 3H4MA 3LQQA 1KJYA 1JJVA 3EIQA 4UJ5A 2GXAA 2CL6X 3UG6A 3TH5A 4MYTA 2NO9A 2C8VA 3B5JA 4ARZA 4BGDA 5FUVA 1K5GA 1ZNZA 4PC7A 4AYXA 1I4TD 3IIKA 3R8CA 1XTQA 3KDSE 1AKYA 3ZDQA 4WIAA 1OPXA 3W8RA 2PX0A 2LKCA 4M1KA 3UK6A 1NIPA 2NO6A 3GCGA 5FH9A 2QG6A 3QE0A 2BKUA 4HLUC 5FOSA 1G7TA 1NI3A 2ERXA 3RNLA 821PA 1JXOA 2J0UA 2WSSA 1YZLA 2BKEA 1XZQA 3WXMA 621PA 3ADKA 1M7BA 2OBNA 3PV0A 2GZHA 1AA9A 2DWPA 3U2QA 1T3LA 1FOEB 2KB0A 1U90A 2WJGA 4A6XA 1GP2A 1J99A 4LJ9A 5CB8A 4FD2A 1DE0A 2QM7A 4BLRA 3QEOA 1M6NA 4GBMA 1BIFA 3IEUA 4RD0A 3FFAA 1G5RA 1QHIA 4Q21A 3I8SA 4HLQB 2JA1A 4TLAA 2IEYA 1W49A 5F98A 5EE0A 4IDQA 4B76A 5C4GB 2WWYA 1GL9B 2RMKA 1UAAA 1RVDA 3KKMA 4P32A 3E2IA 2CE7A 5JFGA 1IXSB 1S9HA 4TYYA 1GL7A 4Q1AA 1KYIA 2AD1A 2IA5A 3DMDA 4I1UA 4BEBA 4RCZA 2JLXA 4TZ0A 3I5YA 3RC8A 2CJWB 1CJMA 3TUZC 4HATA 3C14C 1ZNYA 4ARZB 2GA8A 4ESHA 4A1FA 4IOMA 4BFZA 3OE7A 4EPXA 4AG5A 2B8TA 1U98A 5F2EA 2CNWD 2OFOA 1AM4D 1VG8A 4LI0A 5GVRA 4Q1FA 1GDDA 2O8CA 2GXUA 2J0UB 3VNVA 1KI9A 1KI7A 4M1SA 4BECA 2F43B 2X2FA 3AF2A 2QMEA 1BH2A 1E2IA 1YZGA 3NXSA 1RFLA 1MABB 3OESA 4G5QA 2GJKA 5FPHA 4EQ6A 3CR7A 2BM0A 4PPNA 1L4UA 3B9PA 4DIDA 2ZJOA 5D3QA 2Z83A 2GBLA 2ZJBA 2FFHA 1TEVA 2ZJ8A 4DCSA 1N25A 1RPZA 2FGKA 1M7HA 2BC9A 1RYHA 2KI5A 2VO1A 1OKKD 2H16A 1VPLA 4KSCA 1XXHA 1DARA 2QTVB 1LTQA 1EFUA 4YDSA 1OH6A 1R10A 2ZRLA 5UKDA 3DEFA 4LY6A 3SFZA 1T4GA 2PBRA 1II8A 3B2EA 2O8BA 4XIGS 4FCTA 2EFDB 3VR2A 4ZCIA 4MGIR 5KO2A 2OE2A 2YYZA 5FBRB 4CDGA 1MRNA 2J7PA 1JR6A 4ABYA 4YONB 5FBQB 4QGFA 1EXMA 4Q7LA 1OT3A 2QGZA 3O8BA 1ODFA 5K8UA 3REFA 2QMOA 3SC3A 4UNRA 1E2DA 3GEIA 2D4HA 3KKNA 2G1JA 3U6BA 4B43A 3CB4A 4DSUA 1G4UR 1US8A 5BYKA 3KUCA 4IVPA 4MH0R 4G01B 3DM5A 4DSOA 3SU8A 4ZV4A 1LV7A 1EWQA 2BBTA 4IEIA 2DFTA 3UANA 4B47A 2GVZC 3W34A 1Q22A 4NU0A 1P72A 5EUMA 4DCUA 4JL8A 2QT0A 4M1TA 1G1MA 4GP7A 1KI6B 4JLAA 2Q0HA 2BMEA 4EQ6B 1IBRA 2V4ZA 4MUBA 2IF2A 3U3KA 2ZI9A 2P5SA 5JBQA 4FWTA 3B1VA 4Q9IA 4TQAA 1TQ4A 4LV5B 4URWR 2AKAB 1JEDA 1Z6YA 4TMZA 3SJBA 1R5OA 4DLUA 1NP6A 3CLVA 1XXHB 3K09C 3A4NA 1JPJA 1NVXQ 3AH8A 1VECA 521PA 1ZM4A 4KFSA 2QAGB 2VQSA 4LBYA 1AN0A 4U5XA 3T15A 1WBDA 3ZZ0A 3ZIAD 3NHBA 3PIRA 1CKEA 1HEIA 2OCAA 1OXVA 1PLLA 2XTZA 4R2IA 1IAQA 1KO7A 2G9NA 5DN6A 4EPRA 2FDCA 2JJ2D 1IM2A 2DFKB 2RHDA 1F2UA 3P4XA 3TGPA 2ZETA 3WMEA 1OFUX 4HSEA 2EVWX 1G6OA 2PX3A 5ANRB 3WHLA 1SVKA 4NCJA 4DWJA 3NHAA 4JBYA 4NYJR 4HZUA 4B74A 1TAGA 4B6EA 1E9CA 2CL0X 4LPKA 1GRRA 3WYGA 3QEJA 4QG7A 4Q4AA 2G83A 4DLYA 5HCNA 4EPVA 3LW7A 4EPTA 4TSFD 1R8SA 5KNCA 1PLJA 4MRSA 3ZQJA 4Q1EA 1Z0IA 2WIBA 2YNMA 4AWXA 1IXZA 1N5KA 2WMNB 3GD7A 4FN5A 4MGKR 4EIWA 3VX4A 2F55A 2C9CA 4EFNA 3PQCA 2ONJA 1FPMA 1E4YA 2BBOA 3GFPA 3IPXA 4OQXA 1QHGA 3CBQA 4WBSA 2O0JA 4IVQA 5FR2A 1HYQA 1P3JA 1W47A 1Z5ZA 4V0MA 1E6CA 5CM9C 1TTTA 2FN4A 4IXMA 1OXSC 2REXB 1E9SA 3TRFA 3U44A 1XMIA 2C99A 4TLDA 1BKDR 2JJ8A 4TLEA 2G0NA 3VR6A 3GLHE 3THWB 1YU9A 2VSXA 4HDOB 2FSFA 3K9GA 1GSIA 1HQCA 1XEXA 4Q9HA 1T0HB 2YWFA 3RRMA 2N42A 1CRQA 4B2PA 5JSZA 2OUKA 2QP3A 1R0YA 5KYKA 3NDBB 3TSOA 3CR8A 2BEKA 4YMSA 4HZUB 3SR0A 1MO3A 1ZC4A 2CCKA 2QU8A 1G3UA 5AJZA 4B6FA 1EK0A 2O52A 4KU4A 1E9BA 4MKGA 1YZKA 3VFDA 3QF4B 2AWOA 4JLOA 4OL0A 3TQCA 4DC9A 4WAUA 1VHLA 1NF3A 4YDHB 2F9LA 3M0EA 1G6HA 1Z29A 2VF7A 1N2CE 3C8UA 2H18A 2XB4A 2ZITA 1E2JA 2J46A 4URVR 1TQDA 2PZGA 2VLIA 2P65A 4Q7JB 2BMDA 2ZRKA 3B60A 5JS7A 4DEYA 2QTHA 1P62B 1OF1A 4NKRA 2GJ8A 2Q9CA 2NO0A 4Q1DA 1T5LA 3SYLA 2XOKD 5FTJA 1UEJA 1CULC 2IYZA 3EA0A 3CZQA 2WV9A 4LJAA 2ZRDA 2W6ID 2AWNA 3K70D 4DDUA 1A7JA 1TEXA 1YR7A 3P20A 1KI3A 3K70C 4B3GA 3THOA 4JLPA 4A6PA 2ZSEA 3CRQA 3WMFA 3EPLA 5D3MB 3NH6A 2YZ2A 3BRWD 4A82A 5G53C 4IOKA 1N6KA 1WA5A 1T8TA 1G4AE 3A1SA 1E0KA 1F2TA 2RKOA 4GNKA 4RJLA 4PSAA 2R62A 3PXGA 4A8JC 2QENA 4DXAA 4TWZA 3SI7A 1W44A 1QBKC 1U9IA 1U8ZA 4Q7MB 1E69A 1XJ0A 1MV5A 3RS2A 4LJ6A 3EWAA 3RS4A 1T0JB 3EAQA 2QQ0A 3GJXC 1AQUA 1GITA 2O8EA 3QKUA 3KB1A 3U3OA 5E7JA 4B34A 3L0OA 1Z08A 3NC1C 1CTQA 1N0WA 4F38A 1OFTA 2OV2A 5G3ZA 2R65A 3CX8A 3ADCA 4ASUA 1YZUA 3S1AA 3KQHA 2EFEB 2MMCA 3AUXA 1AZTA 1BS1A 3LNCA 3UPUA 1AK2A 2FGJA 1G8GA 1P2TA 3J81k 1ZD1A 2JLSA 5L3RA 2FE4A 2JLQA 4OQLA 1X8JA 1TL7C 3CH4B 3B1YA 2PH1A 3CW2A 4QHSA 3BERA 4Q18A 6Q21A 4M1OA 1T3SA 2Q6TA 4TN1A 3RYTC 4BUJA 5ELXA 2G1KA 4OI2A 1TQ2A 2H1LA 4MRPA 4X8MA 1OYYA 3NEYA 4LV6A 1E1RD 3B9QA 1FFHA 4P3YA 1ZAKA 1M74A 2IYUA 2QEQA 4LOAA 5FPKA 1F2TB 3Q3JB 4MYHA 3PEWA 1R0WA 1E2GA 2NOAA 2H57A 2PEYA 4LWZA 3CPJB 4YXWA 4A15A 1RRCA 2EFGA 2OAP1 3WP1B 4IW3B 3R9XA 4GOJA 1DS6A 2ZRGA 5FPTA 2F1RA 1OXUA 2O8EB 2ASEA 5FTKA 4LZZA 5FUXA 4MGZR 2VPPA 1E9DA 1TX4B 3MRSA 1W0JA 3C15C 2OCBA 3ONWA 2VHJA 5EXPA 4AYWA 3EASA 3QXCA 3MWJA 1XMSA 3Q7PA 3S1AB 2MSEB 5CB6A 3CNOA 4PSVA 4MYCA 5KNDA 2C9YA 3AKEA 2O8DA 4FXPA 3ICEA 3E70C 4C4PA 3K9NA 1M7GA 3TNFA 4BLSA 1SXJC 2HYIC 2QA5A 5HE8A 3ECCA 3AGPA 5HZHA 2GK7A 2V54A 3LH5A 4B3DA 1E79D 4ZIRA 4LC1A 1DAFA 2XZLA 2GCOA 2IS4A 3V00A 2ANBA 4LYJA 1R2QA 3CX7A 4UQOA 4DSTA 2EWWA 1HH4A 1NRJB 4A4DA 3O8CA 4LBWA 3ADBA 4PAOA 5CK5A 3BBPA 1TNDA 3TIFA 2ORWA 1AKEA 5LB4A 3VNUA 5FL7A 2Y8EA 3EXAA 1S96A 1UJ2A 2IUTA 3BK7A 1PZNA 5JCZA 3LDAA 4US2R 2OFWA 2WZQA 2X8AA 3Q72A 1SHZA 3RS0A 4LHWA 5LDDC 2IW3A 3IGFA 1FQJA 4R9UC 1QG2A 4RZ3A 1MKYA 1XTSA 4DCVA 2GXSA 3A1VA 5G41A 1E9EA 3GMTA 3VTKA 4A0FA 5DGXA 2JCSA 4C2TA 1LS6A 2HLDA 4OHWA 5J4KA 2WOOA 2YVUA 3DL0A 1LS1A 4UNSA 2CCJA 4FINA 3AEZA 3OIYA 4ZKEA 4JVSB 5K8LA 4ZDWA 2GK6A 5JJIA 3RWMB 3I4LA 4LYAA 4B71A 4CZ2A 4DJTA 4NE2A 1SKYE 3AP1A 3CWQA 4XVUA 4CEIA 1IJFA 1P2VA 4WZ6A 2FSIA 1E32A 1XCPA 5IT5A 4QM6A 1MR3F 1W5TA 2PMKA 4LBZA 1G41A 4BLPA 4Q4HA 5K8IA 1Z0DA 3IKJA 4M1WA 4DCNA 2BEJA 3CRMA 3PUZA 4GP6A 1OHHD 4PX9A 3THYA 4DUGD 5C18A 2ZSAA 1MOZA 3LVQE 4ZDKA 2ZJ2A 1ZCAA 1VCIA 2OHFA 4URYR 1AS2A 2RAPA 1CXZA 1ZCBA 2WMOB 5KDLA 4ZIRB 1KY2A 3H86A 1XPUA 1Z47A 2V7QA 2ZYVX 2GCNA 2BV3A 4UNQA 1IN8A 2QORA 5DI3A 3ASZA 1DVRA 5HKKD 1HE1C 1S9DA 2JASA 1ZD9A 2JDIA 1OIWA 3NBFA 3QKRA 1N6OA 2FZLA 4LX0A 4OJQA 3WHKA 3GLHA 4UXIA 4JL5A 1HUQA 1UEIA 3BB4A 4MKIA 2VIIA 5B64A 2RGBA 1VIYA 1J90A 1QDEA 5LBIA 4R71A 1ZUHA 2UVQA 2CHQA 4D4LA 4I1SA 4NH0A 1WXQA 1COWA 2GCPA 1H8EA 3GLFE 1Z22A 4XSGA 1HA3A 2D3WA 1R5BA 2F3RA 2O0HA 3N2EA 3PJRA 4GMXA 3SE0A 1DEKA 2WKPA 1KDPA 3L8YA 2Z4SA 1KY3A 2IC5A 1W2GA 1YR9A 3KKPA 4HAWA 5HPYB 1HE8B 1OYWA 3ZVMA 2F6RA 4CEIB 1E9RA 2IXGA 5JJLA 4LJ7A 2PT5A 1OSNA 4BFWA 3G5UA 3OF5A 4KXFB 4MKFA 1K8RA 5CIQA 1U99A 2A9KA 3AF3A 4GT1A 1X6VA 1CJKC 4IDPA 4V0KA 5EXSA 5FR1A 4ZI2A 1JB1A 1KO8A 2CBZA 3D8BA 1NMZA 4IFBA 4AYTA 3AVTA 5BXQC 3AVPA 2V9PA 1UBFA 5DLQC 1VG1A 3VR5A 4P31A 1Q0UA 1X8LA 4JLJA 2ZTSA 1DO0A 3K0SA 1Z06A 1DAEA 4B48A 1X3SA 3AVOA 1CS4C 3QKRB 3GLHB 5IK2D 3A1TA 4A2WA 3FKSD 1DG1G 4EJSC 2IS2A 4NBSA 2IS6A 1LVGA 2ZEJA 3RRZA 1CU1A 4DDWA 5AUQA 1XJQA 4K46A 4LC0A 2AFHE 4ON9A 1SVLA 1JALA 1VG9B 2O8FB 1IN5A 3GFOA 2H5EA 1F60A 1Q44A 4C7OB 3X1DA 4HLDA 2DB3A 3UG7A 4I99A 3KQLA 2VP6A 3PEVA 4FCVA 4LRWA 2GILA 2RGNC 1SZPA 4W7SA 1XCMA 2RGGA 4XVRA 1YE8A 4IEEA 3C41J 3W90A 3ZZTA 3MCAA 1JJ7A 4PPFA 2QL6A 3K8YA 3AUYA 2FX3A 1OJLA 2XJ9A 4HB4A 1XWIA 1M2OB 2BJVA 3FMFA 4TT3A 1ZP6A 4DB4A 1TQ6A 5H8WA 4TTQA 4ACAA 2W83A 3AVQA 4JIMA 1ZW6A 4C30A 3BWDD 1YRAA 4CT4B 4TQUS 1W2HA 5JJKA 1UBGA 2EYQA 3F5FA 2X19A 1VDZA 1Z0AA 3NKVA 1NKSA 1N0VC 1QHHB 3EC2A 1G8PA 3IIJA 1ZU4A 4I1VA 1CJTC 2QAJA 2RGEA 4NPHA 2EQBA 3SHFA 2P5TB 3EZFA 4U7DA 1R5NA 1D2NA 5J4LA 4KV9A 2ZSFA 5KOYA 5CLQA 3VU9A 1G20E 2B21A 5JWRA 4GMDA 3FOZA 3I72A 2A2ZA 2Q3MA 1W4BA 1U2RA 3AM1A 1EFCA 5CK4A 4QGAA 2FWRA 2NZ8A 1N6PA 1R8QA 3T61A 2ZRFA 5SZHB 1D9ZA 3M6AA 4LJ5A 3IIMA 5FL3A 1G7RA 3MJHA 1KSHA 2ODBA 4OKSA 5AUNB 5DISB 2ZS9A 3GLGE 4Q47A 1ZM9A 1JQLB 4O2RA 1JECA 2FJUA 1G7CA 3IHWA 3TK1A 1XD2A 3C16C 5JRZA 3VKHA 1Q20A 2KSQA 2FEOA 3C4JA 5FOUA 2YINC 1E2QA 4P4UA 4V0LA 2VHTA 1M8PA 3ICQB 3AV0B 1AZSC 4XD7D 3D7MA 1Z2AA 4OI1A 3TUIC 2HXSA 1MO4A 2Z4RA 4HI0E 4HUTA 1NVUQ 4NZYA 4GOXA 4JJZA 3KXKA 2I4IA 3BB1A 2DHRA 3BXZA 5HTKA 2ZR7A 4MRRA 3RC3A 4DIEA 2O5VA 2W6JD 3CF6R 4PAMA 4Z8XA 4LJ8A 5EUQB 1AQYA 1Z63A 3NEJA 5BWMA 1G291 4EPWA 3OEHD 3TVDA 2P3SA 2ZM5A 4F4IA 1P6XA 4EPYA 1F48A 2MSCB 2D7DA 1DPFA 1XTKA 3QY0A 1N6RA 4EKDA 1B23P 2FFAA 1IHUA 1F6BA 2RHMA 5C46F 1KAGA 2GWHA 1LFDB 3OFND 4NCKA 4NTZA 3VU9B 2CLSA 4N1AA 2V1XA 2F7SA 4D26A 5CM8B 4DKXA 1AGPA 2QAGC 3EIHA 4FMCF 4OK5A 4QRHA 2XAUA 3SQWA 3SJZA 5KPDA 4GPTA 3THXA 2FOLA 3TAHA 1Z2CA 2ANCA 3NC0C 1G7SA 4D25A 2QUZA 4NCNA 1IN7A 3QUSA 5EP1A 4FMCB 2ZJAA 3KB2A 1XD2B 2CK3D 4PSKA 3IBGA 1Z0KA 5K8TA 3QKSA 4KYUA 1Q12A 3QG1A 1YZQA 4BEJA 3DM9B 2BVNA 3B1ZA 3TW4A 1NL3A 5FBVB 3VHLB 2G6BA 2A3RA 4HLUA 2ATVA 3A58B 3ZJYA 3I62A 2XNSA 2D2EA 4NYJQ 4TLBA 4X8OA 4ACBA 4CT5A 4FI3C 5TB5A 3TJZA 4NCIA 1XFAA 4IVRA 1X86B 4WXPA 5KHOC 1NLZA 1W5SA 4M53A 1HT1E 4GFDA 2NO1A 4TL7A 4CW7A 1R0XA 1E2EA 1ANKA 3BB3A 4PZYA 1E2KA 2ZI7A 1VTKA 3DVLA 5JLJA 2YKGA 3U60B 1L4YA 2BWJA 3DKPA 2OG2A 4F7WA 4MDEA 4O25A 2O0KA 4H9GA 3KX2A 4XWKA 5C1BA 1FMJA 4P0TA 1GIAA 2A5DA 1GZSA 2BBSA 1FTNA 4KI0A 1GKUB 4PQFA 4XH9B 4JLDA 2WHXA
chains in the Genus database with same CATH superfamily
4KNYA 3HJGA 1T91A 3V1LA 1UT8A 2DQZA 5CDFE 3GEPA 4TRJA 1LBHA 5JCPA 5ADHA 3UMVA 1HXHA 1NKTA 3IVXA 3HL4A 4FGKA 5DHSA 1ZVMA 1RI4A 3HR8A 2QTWB 1ZD5A 1QRSA 1SKMA 2B2XA 2Y0EA 2C7PA 4WZBE 5IVHA 4HBZA 4XJSA 1U5BB 4Q3EA 4D92A 1JW9B 4MYRA 4ESEA 1WLSA 3NNDA 4X7RA 1JLSA 3FSJX 1PGPA 2E49A 2C2GA 3M8KA 4S1PA 5DFAA 3VZBA 1K8YB 1T6BY 1FW8A 1MVNA 3MTBA 4OK3A 2IYWA 1J97A 5M29A 1EIWA 5B57C 5IT0A 3DLPX 1SKYB 4ENSA 4TYNA 3QFHA 2QQEA 1H0SA 5D00A 2WWVD 1JAXA 1KO5A 4ND8B 2BFBA 5COAA 3TEFA 4BNNA 1C8KA 5LB2A 1I6MA 3AOGA 3RFVA 3AL0C 4GBJA 2F1HA 2AI2A 1XD9A 1RXCA 2O9JA 1ZN8A 2WFLA 5ALPA 1TC2A 3O2NA 3IP6A 1WZUA 4MINA 4UEKA 4ZV9A 5LNK1 2G9VA 1QC5B 2NT4A 3BMXA 3DXFA 1CY8A 1RWXA 4ZRMA 3UWOA 2HD4A 2HDWA 5A2QA 4Q3CA 3U7IA 2WAMA 1YFJA 1X13A 2QX9A 4KQ6A 4Q7KA 3UMSA 1Z18A 3YASA 5C1PA 1R74A 2FNAA 5KYNA 4FOOA 4TXJA 3M1YA 1R18A 5A4AA 1KNQA 1KYVA 4PHTA 2GAFA 2VHCA 4EECA 2WU0A 3RYCB 4UJ3A 4QQNA 4BO6A 3FYUB 1RE1A 3R3JA 1HE3A 2F9MA 2AN5A 5AW5A 3U4QA 4MVJG 4CM4B 3GLIE 1I9GA 4FHFA 5IDYA 3DR5A 3LKDA 5JSHA 1A8QA 5AVTA 1B0ZA 4JNKA 2MINA 4BWFB 1XNQB 1ODSA 3U3ZA 1CQWA 1WAMA 4M6WB 2AFHA 1NLYA 1K5DA 1UPFA 1XQVA 3AGQA 3N2ZB 3HXPA 1J5EB 2GLUA 2OKGA 4TMXA 2BEWA 4OREX 4DJJA 1JNYA 1DBWA 2XUHA 4RCYA 3JPYA 5HCIA 3T7AA 1NVKA 3O90A 4PVCA 5AM4A 3W8NA 1QAQA 1KEEA 2IH2A 4M60A 3H7AA 4D9JA 2FH5B 3U80A 1Y3AA 1ICEA 2IU3A 2X8BA 1P2BA 5IUKC 3ZXYA 2C9DA 3D8SA 4LHZA 2GTPA 1A97A 1LV8A 3FOFC 3I05A 3SC6A 4JOCA 5ERXA 2JFYA 4WVFA 4IHJA 4RM2A 2QPTA 3EEFA 3EGXB 3HU3A 1W52X 2BFBB 2ZB8A 3JRNA 2P6OA 3M3HA 3ZZ1A 4WNAA 1Q0RA 3PUXA 3BHIA 1IOVA 1U0FA 1H8HA 2I2BA 4KC0A 2H8KA 1GSOA 4LKRA 2VYFA 1X77A 3NFRA 3P27A 2VNJA 1AOXA 3B1XA 2HEIA 3LY8A 4DT1A 2BFMA 4YREA 5BSTA 4FK8A 4PFKA 2ZJ1A 3R7NA 4LHEA 4YB8A 3IEVA 2CJFA 3JVIA 3DE0X 4GL2A 1C1HA 3F5QA 3WE7A 4REQB 2H4ZA 3OX4A 3CNBA 4MITA 2ZW9A 4FYPA 1MRZA 4DF3A 4R40A 5ILGA 2PBZA 3L7OA 3KP1A 1U28A 3TWOA 3VZQA 2HWXA 1YDHA 3W77A 3OEED 3UWMA 4DIMA 3I1IA 2P0YA 2NAPA 5M3BA 1CVLA 1R9GA 2AE1A 2ZIAA 5HBRA 3RHZA 1NDUA 3AM5A 1ZMBA 2BE7A 1JHDA 4RIEA 3LP5A 1A3CA 4G5YA 3DBHB 4F4CA 1W88B 2MINB 2WAAA 3Q7RA 2PPVA 2TECE 4FZVA 1EDOA 4RENA 2EKQA 2IHBA 5AOVA 4JT2A 1UJ6A 1ZK4A 2LD4A 3VZRA 5K4AA 2BEWB 4UVGA 4BMVA 5IJ9A 1VGQA 3AHFA 4K28A 1E7RA 3SR4A 2BDUA 1CZRA 1S01A 1NTRA 1VXRA 3AM4A 1KEEB 3DDCA 4JQZA 5CX1B 5F64A 3R9IA 5JAOA 1YZNA 4YP5A 3ZHOA 4JLMA 1J2JA 3A32A 1MO2A 1FP7A 2R00C 4UAGA 3O94A 3TLJA 3WQHA 2WHRA 4XWAA 4L4SA 4ZJYA 4QXRA 5G4KB 2HRRA 2ZFUA 1SU6A 4YLGA 2X86A 3RC1A 3U56A 4ONEA 3DTVD 2SECE 5A04A 5K6TA 5KJ1A 3DCNA 4WNAB 3MMNA 2CT8A 3BMNA 1EUQA 4MW9A 3UAGA 4YY3B 1ZUWA 2B4KA 3FSRA 1C0LA 1FYVA 3G0OA 1PWYE 3PQEA 1EJ0A 4PR3A 5CNIA 1XQYA 5FULA 4AI6A 1ADCA 3MGCA 2CD9A 4OQNA 5BQ3A 3TINA 1M2VA 2WZBA 3EW9A 1Z0UA 3JQAD 4XDYA 2ZYHA 5IXJA 4HWOA 4Z0HO 1DKQA 4H4CA 2YXEA 1R0ZA 5JNWA 3AX6A 1QX3A 4XB6B 4XCVA 3J7TA 4I8IA 3ZWMA 3CVYA 2OYCA 5JHHB 4AU1A 4DLNA 1OGIA 2X5KO 1GCUA 4JLWA 4M1ZA 4R83A 4V03A 4KN9S 5KTYA 5EHNA 1BJKA 4Y6LA 4AO8A 2K7ZA 2PX5A 4XQEA 3RSZA 4ENUA 3ORYA 1AHIA 3PWKA 2MJLA 5FNVA 3MXOA 2EXXA 4RQUA 3T9DA 4R5HA 1EESA 4M8NE 1UXIA 2EJBA 2QUHA 3T5DA 4RTLA 2DTXA 2P2DA 2ZVDA 3M1AA 2C2BA 3MJCA 5TR9A 1NUSA 1PD0A 1SBIA 3AF6A 3ROKA 1G8FA 3C48A 3UAZA 2RGWA 5CXUA 2RCNA 3UB2A 4GOLD 5CTJA 421PA 2JAXA 3KE9A 2CNLA 2FFJA 1I4LD 3SFVA 2BELA 2EW1A 1RAIA 4TMFA 2BM8A 1X1CA 2D8AA 4JFAA 3STYA 1KE1A 1MP0A 2Y2VA 3W4KA 1IZ7A 5J58A 4K05A 4YJFA 4MVJD 1NUUA 2VRWA 4E2ZA 4Y6QA 1J70A 3W9YA 4R9VA 1P7WA 1D4AA 4AMZA 4PFQA 1Y7TA 5JPCA 4LVCA 2FPSA 2C04A 2BHRA 2K5UA 3IQWA 4K2HA 2E85A 2R6AA 2QJRA 3WA7A 5AVQA 1V2GA 2ZROA 3BMNB 4J49A 1YDFA 4LRYA 4Q66C 4EJ0A 4WJLA 3I0ZA 2O6LA 3W6OA 3E48A 4HHEA 2ZE6A 3UJ3X 2V6JA 1W36B 4IJUA 1Z39A 4TWJA 4ZO4A 1VJRA 4Z0NA 1R6XA 2ZRPA 4ARAA 2IWRA 1CNMA 3R23A 3REGA 4Q3BA 3F9RA 4LF9B 3RHFA 5DTEA 1OREA 1GNRA 2G77B 1YBFA 4GVLA 3EDQA 1JPNA 3FDXA 4H7FA 4Z0PA 4BV2A 4IZHA 1A8HA 2PGXA 3EXIA 3ZW8A 3H99A 2P6UA 3EULA 5KNCH 4B3FX 4BO7A 2FQXA 5LPNA 2OK8A 1UXJA 1PQYA 5KPJA 2FAXA 4JSTA 1E92A 1O08A 2CFIA 2GESA 2XYHA 5FNVB 3ZLJA 1HRKA 2EGUA 4XB2A 3IERA 3KJHA 3OZAA 1A8IA 4MJLA 2BDTA 5I6DA 5CFNA 2R47A 1Z6PA 4P54A 4AKHA 1WMFA 4RACA 3S29A 1JJAA 1H3FA 3OTQA 2QRGA 4CEJA 1KK3A 1ELOA 1YL7A 5CDFA 3CMMA 4B7ZA 2W2TA 4XPZA 5AQEA 3EWNA 3WTCA 4P3PA 3PFWO 3LV8A 3OZUA 3LHDA 4ZVOA 1EX6A 2IYAA 2Z3ZA 2IVZA 2YTZA 3IT2A 3BRWA 1T25A 4OHFA 1N1EA 4IUBS 4WZBA 3VR6H 3ZHUA 1YCFA 5CVTA 1PQUA 3QWFA 2KX7A 4YJFB 2BZ1A 4JBWA 4YCNA 1N4DA 3O38A 2YFHA 3DZKA 4Y9TA 3R7WA 4UMDA 1X7DA 4M0MA 1XAGA 1RIFA 2HLDD 3D3QA 5EJIA 1AY0A 1EMDA 3J81A 3OTOB 1U0JA 3AIIA 3FNHA 4PW0A 3UT0A 2YDXA 3FUVA 4E7PA 1WDWB 1IUPA 1N8NA 1NXXA 1J4AA 1XZIA 3GAMA 1NMSA 2HWYA 4HC4A 4FFPA 3ZZNA 4N82A 1MH1A 4LJSA 1NXVA 1XB2A 3R5KA 2VRBA 4IFIA 5IZCA 4CIYA 3UENA 2P91A 4FBMA 2XZOA 3VSAA 4BVFA 2GARA 2QD4A 4N6OA 3RADC 1UM9A 2ORVA 2ZT7A 3HJHA 3L79A 4NYMR 3JAMA 1Q3TA 2OOKA 1ZINA 4KG7A 3CZ5A 2QD2A 4HYYA 4RSHA 4WQMA 2BPOA 2J3HA 5BSUA 2ZKIA 3DR3A 4JOBA 3BH6A 3O21A 2F1IA 4N3GA 5B1HA 5JCJA 1I7LA 3TGLA 1T9HA 1VE3A 2EJTA 5F21A 3BQNB 2I78A 2P68A 2QRUA 3I1FA 1TA0A 3WIBA 4TL8A 4D0LB 1G66A 1H3EA 4JMPA 4G86A 3QWHA 2ZREA 3FIUA 1FDTA 3ITNA 1NRXA 2ZWPA 4R1MA 4WOCA 4C0HA 2NYAA 1X80B 4QIHA 5C37A 4UM8B 4E88A 4ER7A 2IQ5A 2ONCA 4OY3A 2VQDA 4MSUA 3VH1A 4CKWB 3GLIA 3SMQA 1D8AA 4OFXA 3U7FB 4REOA 1TYEB 3BFVA 4MW0A 2ZRJA 4CEHA 4BEWA 2HI0A 2YIJA 1BCRA 3N8DA 4R84A 4MA4A 4QDOA 3UWKA 3UMMA 1Z88A 1ECCA 4G4IA 5KZMB 5KMGB 4QU5A 2R5NA 2HK6A 1XELA 2ZYWX 3AJEA 4XDGA 4QTXA 2EDCA 4AK9A 1E1RA 4YRNA 2RDMA 1PQPA 2OM6A 3QFFA 4WZBB 2XYRA 4GSYA 5E7IA 4LDPA 4BKRA 4BNFA 2YJ4A 5EGNA 3ENZA 5IJWA 1GGNA 2GKSA 4TS1A 3ZV3A 3G0HA 1XNHA 1QYDA 1ZIXA 2PLRA 5AM0A 5IU6A 4R81A 3WS7A 1I3NA 2PNJA 3G2OA 3PQ7A 2WKSA 2IPNA 1M54A 3COWA 3ZLTA 1Z82A 5K01A 3OMXA 3IBYA 4HH3C 4NEGA 5CB4F 4QEZA 3C8ZA 5DN9A 4RESA 5F7ZA 1CHDA 1X1TA 1Z3IX 4J1NA 5H80A 4QFMA 2RGXA 3ETCA 4JUBA 4Q48A 3KJNA 4M9QA 2WICA 4H0CA 4RIHA 5DYWA 4AULA 5LP1A 1QBGA 1OB5A 1UM9B 3H5VA 5EUCA 1WRBA 4QTUB 2W0SA 5CT8A 1PR4A 5D1HA 4BFUA 1GTL1 4FYYA 2V3WA 5CB4B 4U3JB 3GEHA 4IJ5A 4B73A 3KZXA 4C0AC 1G2OA 2P0AA 1NI5A 5C32A 3OJWA 5JSKA 3WYCA 4TXNA 5IASA 2QGNA 2NPFA 1B14A 4N0EA 4RD1A 2BFOA 4ER6A 1P17A 1NYRA 2BGIA 2TMDA 4ZTUB 2FN8A 3I2FA 3MCUA 4DQLA 3T4PA 3HM9A 2JZCA 3PTZA 4TRRA 1MRSA 2ECFA 2WM3A 3Q2OA 2QX4A 4B9EA 1BDIA 4PBRA 2H92A 4DV6B 2CZQA 121PA 3PG5A 1KAEA 4YVFA 4W4TA 2RK3A 3DXYA 1U3FA 1RZVA 2F90A 4Q4LA 7MHTA 5AK6A 4DIBA 1L5OA 5DE3A 4XIIA 4BTVA 3SK0A 5KKNB 1I36A 5I8PA 3EE6A 1I0LA 1N7HA 1QO0A 3JQQA 3GX1A 1PR0A 2C0PA 1G16A 5H3CA 4KQKA 1MGOA 1VKHA 2J9RA 4F04A 5IABA 4CCAA 3GT3A 2W7TA 3DPUA 3HNRA 5J4YA 1PT5A 2HT6A 2Q4BA 5A0TA 4ETNA 2XNKA 4AY3A 1XTIA 1IZ0A 4JU9A 2CNOA 2C5HA 1P2GA 4MQUA 2AFIE 4X3OA 3ZNPA 2NV0A 5J2UF 1L0BA 3CUEF 3W9UA 1D07A 2FPKA 4A8PA 3L04A 4KBFA 4E1AA 2XOEA 4P4NA 1WY7A 1RXVA 3ESAA 4N7JA 3FUXA 4PF1A 1CG6A 3IT0A 4EFDA 4UE2A 4L5AA 1BFDA 4YMTA 1TTQB 4J0GA 1GZ6A 4P80A 4V0SA 4MOWA 4TT3D 1UL1X 5JQGA 1MJHA 2QTGA 3EG9B 5EHXA 1H2YA 3MQ4A 4PHCA 2ZI6A 4WLOA 2GFHA 2ZIVB 1IEQA 2DCMA 1Q1QA 2JGFA 4GR4A 4EDFA 3EWSA 1FX0A 1OHHA 4KQCA 2O3SA 4MVWA 3RRYA 1OLXB 1H5UA 3OJ0A 4AUMA 4RGBA 3ZXIA 3UJHA 5HOQA 2ZZKA 1DWPA 1U0BB 4V2UA 2H1CA 1Z6AA 1RXUA 4FW9A 2QLNA 2PX8A 5H83A 2H17A 2PCLA 1HRDA 4XOUA 1C9MA 1KVUA 5EZYF 4HGOA 4BC1A 2DQKA 5H9WA 2I66A 1FXWF 4JB2A 4KLAA 4D9GA 4WKBA 4TQ9A 2Y4NA 5D5PA 4ZVNA 1EBFA 3MA0A 4OQPA 3WFZA 3JVVA 4F06A 1KDTA 1YCDA 2BONA 2JBAA 3GFBA 3QI2A 5ALMA 3O3NB 1H2EA 1I13A 3QHQA 1E0DA 1Z5PA 4JC0A 3F5MA 3T94A 5EZYB 3KXIA 1B26A 1AF4A 1G8KA 1ZIOA 2QV0A 3QNMA 3JQBC 5JAZA 1VHWA 1CQPA 5DI9A 2R2AA 2FSHA 4CQLB 2JC3A 3TLAA 2YZGA 1RLIA 4G56A 5ALLA 1YTLA 2QUIA 5DTMA 3OP4A 1NQVA 3ENWA 5IBRA 2ODQA 3P26A 4E33A 5DTQA 4QSHA 3I6IA 4CV2A 2LIVA 4AXBA 4EITA 2WSSD 1CUAA 1D09A 3T6KA 2FR8A 1NWHA 1OZFA 2Y0BA 3IB3A 3NJRA 4Y2YA 5TLSA 4ZANA 4IMPA 3JTEA 5AXCA 4AP9A 3D6HA 4RVCA 1GFZA 5IVKA 2A5JA 3DWFA 5DM4A 1GLVA 2J3KA 2G63A 1ZL0A 3AHCA 5LIRA 2IX3A 2PNFA 2GNPA 2OHJA 3FWHA 2P9EA 2ACWA 2HIMA 4L0CA 3ZOKA 4OP2A 3VI4B 5TPZD 2XXJA 1ORVA 2A5GA 1DOZA 3BMCB 3W2IA 2YCLA 3DMNA 3K1YA 4ZTBA 5K3SA 2O50A 4DJ5X 4KRGA 3AINA 2EIXA 3AWIA 2WJIA 1R16A 4Z6KA 1V1RA 2VWHA 1VIDA 1DAGA 3G9UA 5IAOA 4M55A 2P9ZA 5K7SA 2QM8A 4AS1A 1DZ3A 4J7CA 4F6RB 2Z56A 2SBTA 2WF8A 3KKOA 4ZA2A 3TQTA 3GJ7A 1W75A 3ROTA 1E2BA 3C70A 2XNDA 2HADA 2CDBA 5CNJA 1K63A 3VGPA 1Q6YA 1LKZA 2R8OA 4PQYA 3GOQA 2QTCA 1ONSA 4U8GA 4L7QA 2L69A 5REQB 4CG3A 3NWOA 4WY5A 4QM7A 4A5SA 5EJ7A 5IK2A 2IYFA 3W5DA 4ZCLA 4ZPJA 3WY9A 5K0SA 1WE2A 1XJ5A 2OWDA 2ZIZA 2A0UA 3F6EX 4LNUA 2BFEA 2R7NA 4BZWA 3W6PA 1QZZA 2QMQA 1Y6QA 1QHYA 3SZRA 1WBJB 2F8MA 1C0PA 4UBIA 5AK3A 4AZ0A 2W0MA 4YMUA 2QLMA 2ZS7A 2X58A 3FZEA 4OYHA 2X4IA 1PGQA 2O4UX 1ZD8A 3A3OA 1MV8A 4KQXA 1L7QA 1SC4A 3WMGA 1AZLA 1LPSA 4XX0B 1KJ8A 1RMQA 3S5JA 1U6JA 2HLNA 2WM8A 3WISA 2RGYA 1YO6A 5LD2B 1Z83A 3DZ8A 4WNYA 3SE7A 3L8FA 4FDVA 4CMEA 2GBLC 1FFYA 1T2CA 3F8SA 4GYWA 3ACBA 4FIDA 4RTKA 4B4OA 1HYBA 3E1GA 3HBNA 3P94A 3WB2A 4QASA 3T7IA 4BDTA 1P5FA 2NX2A 2HL6A 1MABA 4E22A 1YBVA 2WWRA 3N58A 4M9ZA 1SVWA 1GZ4A 3SQMA 1V1RB 2HPVA 3HKEA 4KIJA 3WBJA 1CRPA 3WRXC 2E4AA 1UODA 2FG7C 2ZJYA 1N1GA 1KKMA 1TC1A 3RWOA 1I4OA 1Y1QA 4JT8A 5DH9A 3G2IA 2Z3WA 3HHPA 4ED9A 2WJHA 1QYXA 2IIPA 3AF0A 4TTRA 2E37A 2YDYA 2P4UA 2DPLA 2Q4DA 3NAMA 4AQDA 2J7PD 1T1GA 2MDTA 1R8JA 1V5GA 2XI4A 3FSGD 4QLAA 2D0IA 1PR5A 2J8ZA 3OPNA 1HFWA 3D4LA 4O4LF 5DP2A 1H4SA 1F7UA 3LWNA 3MJ4A 4X9XA 5BNZA 2XA1A 1PR3A 2XT0A 1JZTA 2J31A 3BYZA 4NZOA 2H85A 5K51A 2C59A 2CV2A 1BRMA 4KXWA 3A2LA 3WMRA 1AA6A 2QHXA 1NDQA 4AZ0B 4CF6A 3TZCA 2GRJA 3AHHA 3ELYA 3GCZA 3UUWA 8AT1A 1W4CA 2W6PA 4X54A 3G2NA 2DCUA 4G84A 2FRDC 4IIJA 4KXNA 2WLSA 4D96A 1NJSA 2JZNA 3VDNB 4L57A 5CBPB 3AF5A 2J0QA 4QHYA 2D59A 1UDRA 1BX0A 5CLLA 5TEVA 3T9FA 4CUKA 4DWOA 3CZRA 4UBJA 4A0RA 5SYMA 4Z4FA 3C3DA 2B5VA 4PLYA 1KI4A 3O4HA 4P98A 4L9WA 4D9EA 1KS2A 3RTDA 1G18A 1CQJB 4C2AA 1G19A 4BVGA 2C1XA 1C0EA 1EQ2A 2JLCA 1S02A 4PRKA 1XMJA 1VE7A 4ARVA 2JAHA 2W6JA 3W2EA 4AKGA 3HKEB 4WNIA 1IXYA 4HGNA 3RHSA 3KZVA 3NRJA 1NVGA 3DT6A 4R6WA 2WQ7A 3OEHA 4K7JA 3F8TA 3F2IA 5CA1F 3QLTA 4Z8YA 1F7VA 3C24A 4E12A 2I65A 4DM7A 1LTHR 3H87A 3QOFA 2AHOA 2RH9B 3T34A 1L7DA 3LVRE 1PU2A 4IDNA 4IJVA 4NRDA 3WADA 3RSOA 2QPAA 4LDJA 3GJ6A 4OBWA 4HDKA 4F72A 3KQYA 4FEGA 2PQ0A 1IVSA 3OFNA 3L49A 4WV3A 2OHVA 1XQ9A 3A37A 4M9CA 5JVDA 5JEEA 3ACDA 4LHVA 3PUVA 4H6XA 5BWBA 3C1TA 4B2IA 4FHDA 4OQFA 4GPAA 3GRPA 3AIOA 4BLWA 4DKJA 3ZDAA 1GV1A 4X60A 1AC5A 1UBNA 3CW8X 2EOAA 1P1FA 4CLEA 2B8EA 3FFWA 1NQUA 4NV3A 4E07A 3JVDA 2O5CA 3HZRA 5FBZA 1I3MA 1U0HC 3D6FA 1ZK1A 4KPUA 2AFIA 2J3JA 1G6Q1 2CBGA 1PNOA 3LT4A 4CV1A 1V8ZA 3CFYA 2WIJA 1ENOA 3JZMA 3SQOA 1O0BA 5E4FA 4Q3LA 3AUSA 1BE0A 5EE9A 1KEUA 1GEEA 5KNCD 2PGAA 5FWYA 5L3SA 2C1ZA 3AUJB 4M22A 2YV5A 3B7PA 5JJBA 4U6NA 2D00A 2XRFA 3VNBA 4LSZA 3RB8A 2FFBA 3TOVA 1I1NA 1LW6E 3EOZA 2DQSA 5HM6A 3WVNA 4D99A 3RUHA 3KLOA 1P9WA 3PGKA 3EZYA 3WDMA 4MWCA 1FB5A 4WPGA 4XEHA 5I7SA 2WF9A 1GNQA 2G5PA 4JEHA 3HZZA 4IV0A 3FHOA 3GMIA 3PGJA 3PNQA 4BFXA 3DAHA 3PFHA 4IV8A 4QL3A 4D4KA 1DG3A 4JYBA 3DBLB 2XUQA 1J33A 2Y6UA 3FAKA 4JC5A 4P6VF 4ZCQA 3WGLA 4E4RA 2O1SA 3F7TA 4JXXA 3LRPA 3ECSA 4X7PA 4YLEA 3VR6D 2IHKA 4IF6A 1JQDA 2I71A 4NEQA 1W46A 3EEOA 5DBEX 4TYWA 1ZBQA 1HV8A 3GRRA 3ZCPA 3OA2A 3VHXA 1U0LA 2WPDD 2D62A 4BP8A 3SBDA 4EQZA 1QQBA 1ZXBA 4PNEA 3C5HA 1FX1A 1WZNA 3IAHA 4WESA 3SZLA 1XAIA 5EHZA 1RWKA 3KVYA 1HBJA 1P9LA 4JJFA 3K5HA 1SBYA 5FPSA 3THWA 1HDXA 3TMAA 2YIVX 4LYYA 1RT9A 1UOQA 2CDNA 4KCGA 1FBTA 4WZZA 1DKUA 4N47A 4GWKA 3ONNA 1CLUA 1WLYA 5KTSA 2PJZA 1DIRA 3T5PA 3D2CA 3W2TA 3TPZA 2DY1A 3FUCA 4PLWA 5C4IA 2UZIR 1FTQA 2H4WA 5HCUA 3VISA 4DBZA 4TTTS 2CHFA 4UHHA 3RS5A 5FWYB 5GZ3A 5L3SB 1R6BX 2MYTA 5AJVB 1OFVA 1TYDE 5EZQA 2ICAA 2O54A 5DNYB 2PHZA 4RD3A 1BA2A 2HXYA 5T4HA 1GILA 1ORRA 4S1VA 2JATA 2QT1A 4KMSA 1IQ0A 1AKNA 3V80A 4Y2JA 2AE2A 1GQSA 1B16A 4GR9A 4F3CA 5DK6A 3FDZA 2GQ0A 1FFXB 3ZS8A 4URXR 5KVVA 1IAVA 2WJYA 3IALA 2JB9A 1U0TA 1VL5A 4IOLA 3I4CA 1JHZA 5EOVA 2PZKA 1B74A 3QFRA 5FBWB 5E9AA 3KQKA 3DDNA 2CHGA 4RD6A 5GY7A 3FWPA 3NQ41 5HJ7A 1YKFA 1Z8DA 2FSUA 3Q3VA 4LY0A 2Q49A 2EJVA 1XU4A 4EY4A 1YA6A 1GL6A 1RQRA 1CQIA 3DO6A 3EYWA 1K3TA 1B1CA 1XLUA 3PBKA 5JDCC 2BE9A 2YWCA 3EIOA 4E5SA 1KNXA 4JSYA 4I66A 2G6TA 1QCYA 1CLEA 5KC9A 4BNJA 4E94A 2ZRIA 1EA5A 2G4LA 2E82A 3I30X 2VSYA 1KC1A 3PUYA 4CMJA 1EBUA 3U5TA 1U9IC 3SDBA 1G8YA 3RJZA 1KJWA 1UH5A 4JLKA 5D3MA 1OB2A 5IN4A 1VHDA 1JHRA 2GEVA 2V96A 1BEUB 2I7VA 3PFKA 2KLBA 3RYHB 3TUJC 2O2DA 3DL2A 3S2YA 3A36A 1QPZA 1PS9A 3HU1A 3JZAA 1UC9A 4ZK2A 2O5RA 3E9NA 1KY4A 2J41A 3PITA 3TQQA 4PQRA 4NJMA 3S2EA 1HORA 2I1LA 3H1GA 3T7RA 1H9CA 3MEQA 2P35A 4Y7DA 5F9MA 3B1KA 1G2IA 1QV7A 4W5TA 3L40A 2ZSDA 4M0UA 4QNRA 3AUKA 3G2QA 3CIFA 4FNAA 4DRZA 4MUEA 1A98A 3K6SB 1FRNA 1ZUNB 3FDZB 3PXDA 2E5LB 4N7MA 1JIVA 2CNNA 1UFKA 3PCTA 1CUSA 1LPAB 2VPWA 3H9BA 1H6AA 2HWWA 4I14A 4O4JF 5HF5A 5JC8A 1Q11A 3W5CA 2EP8A 3DZGA 4AUKA 4UM9B 3O3MB 2ZVJA 8ABPA 4FGUA 5JAUA 1G20B 1KJJA 1FDIA 4HAZA 3D1JA 5CT5A 2W8BB 3THRA 5JADA 1ZXXA 3PX3A 4RJJA 5AKGA 3ONEA 4RO0A 4NAVA 4O4JB 2Q9BA 1TLTA 2VT3A 3HNOA 3KQUA 4RFSA 4LF6B 2EX0A 4BNZA 2H51A 4P53A 1Y6ZA 3OEEA 4Y2GA 2NPIA 1I2MA 3AKDA 3TGWA 3DUFA 2IYYA 3OAAD 2NZYA 1AURA 3H6KA 4LE1A 5FEMA 3MF4A 3RVKA 4BBJA 5AM5A 2IJGX 1O6FA 4TMTA 2RB5A 4RVUA 1O54A 2PRJA 3EQ6A 3EIWA 4TL6A 4YPFA 1KQGA 1M8FA 1V7PC 4HX9A 1LDMA 1ZJ6A 5EJ9A 5LVAA 3CEAA 4RZ2A 3V1UA 4BRSA 4HPJB 4C7JA 3H5AA 3IEIA 4C6TA 1RTKA 2AW5A 2Y68A 1T6YA 2YWHA 1JAIA 5GJVC 3C87A 3OOYA 2WAOA 3DEHA 1FMFA 3LZCA 4MEAA 1MTOA 4DDKA 2R00A 1E6WA 1W0JD 5C7OO 3B8HA 3E1KA 4POOA 3O0TA 4C07A 3QBEA 3DB1A 4LTMA 1XU7A 2XGSA 1G9XA 1QNLA 1X1RA 3FWYA 3N6VA 4C14A 1S2MA 2NIPA 3DTVA 4UDXX 2V3VA 2O2EA 3AG6A 1C4KA 3PC7A 2C5LA 4B4VA 1XGKA 1ZCZA 4MUKA 1CX9B 1YQXA 3MERA 3DEAA 4PG4A 4YI3A 5J4VA 2I67A 1P9RA 4FDUA 1VL6A 2H4YA 2PUVA 2IZ5A 4TMKA 4Q9KA 2X5NA 4WXEA 5J63A 5BT9A 4V0RA 4C4OA 4YV7A 4N6NA 1YR3A 1CRWG 5IVIA 4NG5A 4WI1A 3Q88A 3KLMX 4KGVA 2OZKA 3FTPA 4HEA6 3NAGA 3SM3A 3ZI0A 1CZOA 1OYVA 2GJAA 2QJFA 1L5HA 1DAKA 5KYUA 3T35A 4A7PA 4CNBA 2AR7A 4HZGA 1M5UA 1V4BA 2HQ1A 2Q5FA 4PXAA 1LA2A 3KOWA 4RFSB 5H70A 1MH9A 2NZJA 1EFDN 3EMDA 4HD8A 4MJXA 2JKYA 2IV3A 4ZN6A 4E09A 3H6GA 3HUDA 3O84A 1U8XX 1DRKA 3S2IA 2NPOA 1IUKA 2YXDA 3NWJA 1L5QA 2ZYSA 5E7MA 3EVDA 4HTAA 2IZ1A 1WPGA 4RKFA 2H1FA 4FFDA 3H8WA 3G1WA 4C7KA 1K68A 3FPKA 2A94A 3SXPA 4URZR 4L51A 2IHTA 2JLRA 2OENG 1UPXA 4O63O 1TGYA 2WIDA 2XWSA 3K3PA 1KZ7B 1Q7EA 1GV0A 2AXPA 4F6LA 4WLUA 4NQRA 1R27A 3HJBA 3SD7A 2OSBA 2QN1A 4QDTA 3W1WA 2DUJA 2Z8YA 3LPMA 4MVJA 4N6GA 5LKRA 4DSNA 4WZAE 3AVUA 1L5WA 3D54D 4ZMBA 1WXHA 3DHNA 1RHQA 4PX3A 4RXTA 5IEBA 4JUIA 3AG5A 3QX9A 1NN5A 4N5HX 4D3FA 4UHEA 4YS6A 1BFUA 1LI7A 1OLUA 3R7DA 2QBYB 1E8DA 1QR6A 3DMFA 3PR3A 4X64B 1K3FA 4UHFA 5A02A 4JLSA 2EEPA 3PHLA 1YUBA 3QFSA 4M1YA 4X44A 5T8KC 5LZ9A 5IBPA 4UHBA 4Z9BA 2EZTA 3ZD7A 1VMEA 3EA5A 2R25B 2AK2A 2HJRA 1KMCA 2VBIA 4IILA 4BBPA 1XCJA 5AIBA 4UBNA 2JK1A 4WN9A 3RK0A 4JJ8A 3K53A 3PEEA 5CJ2A 3C39A 1N92A 3VSDA 3F4KA 4YP7A 2I3BA 4ZO8A 5BVGB 2JH8A 3CKYA 2IXFA 3DFZA 3FB4A 3U1VA 5JU6A 1NMXA 3BSSA 3A6LA 5JI3E 1OH7A 3W5UA 2ZAMA 1IJKA 2WB2A 1ESCA 2KJQA 4Q19A 1DMRA 1JG4A 3DNMA 3ZOZA 1KK0A 3S6JA 4I4TA 4ZAYA 3D1LA 5AW1A 1Q2XA 5FFFA 3BXEA 3I01M 2P6PA 3T1YB 1B0UA 4BASA 1ZK2A 2ERYA 1NDHA 1T9KA 1XKLA 1M1NB 2VH2A 2XUDA 2YS7A 3NM5A 3M4XA 1SEVA 2CEAA 2PRSA 1VHJA 3PQ5A 2ZT6A 4GLJA 4I50F 3IS3A 5E7QA 1H5QA 3V8VA 1GUYA 4F5YA 5I48A 3ER9A 1GAEO 2WSBA 3DDZX 3WB9A 5COQA 3KD3A 2JI7A 1MD9A 1VZ2A 1U7UA 1GZ5A 2W2XA 3I64A 1D8TA 2AHRA 4F92B 4OUKX 4P4GA 5BV8A 3PVSA 3QVSA 1NN1A 4FHGA 4I50B 2OILA 3ZWYA 4E5YA 5A4IS 3LXRA 5TARA 5HVNA 5MF6A 3ND9A 3PC8C 4NABA 1Z0JA 3OA0A 2D1SA 5B37A 3FY4A 3NUZA 1WBBA 1T5BA 4G0UA 2KW5A 4Y6PA 1UP7A 4S2EA 3SN6A 3VYVA 1CT9A 5BRNA 1UKZA 3RUDA 2B9VA 1QFXA 4FMPA 1WOYA 4EF6A 5C1DA 4YFVA 1D04A 2A30A 4R8VA 5A5GA 3OKPA 2RI1A 3N59A 1U8AA 3A10A 2IOYA 2WSLA 5BOSA 3H11A 2FK8A 3JAWA 1NOKA 3L0PA 1EQAA 4IFTA 3WNBA 1FMTA 2ZT8A 5DNEA 1XXHE 2FG6C 4P34A 2Q45A 5JMPA 3ZN2A 5MDHA 3RS8A 1WP9A 3VOBA 3L1UA 4LISA 4L5BA 3D2LA 3GR6A 2ILVA 2WWGA 4QODA 1P8AA 1P45A 1J8QA 2LTAA 4LRUA 3OZCA 4IKEA 4OLFA 1JDTA 3TVTA 4L2IA 3GDFA 3SJUA 1RABA 1U5AA 3NGLA 3VAAA 1F8YA 2OCIA 5EE1A 1R0CA 3RVDA 4LJ4A 1DDIA 1XL1A 1ST2A 4AURA 3A8TA 3ZWOA 3C8DA 4GBGA 2OLJA 1YB5A 2XQKA 3RSFA 3R4VA 2J1LA 3KPJA 3AVVA 3L7LA 4JLNA 5KSYA 1QU3A 4RULA 3QOYA 4W1QA 4IVNA 2YOGA 2AXEA 1GQ2A 5LZ5A 2VYNA 3U7HB 3VYUB 2QW8A 3NONA 3ST7A 1W9MA 1UBTS 3VTFA 1J8YF 4BVAA 4DCOA 1MHTA 2TMGA 5FFMA 3V8MA 4UFOA 4U8HA 5AOBA 1U11A 3K96A 2UXDB 5IYZA 3T12A 4PYMA 1WKCA 1VE6A 2EQ5A 4QA9A 5JE8A 3VOTA 2R79A 3RS7A 4D0RA 1FJGB 2YFKA 1CHNA 1K9SA 3SNHA 1RBZA 2ZYTX 1XLWA 3PJGA 1B4DA 1LLQA 4G8JA 5E9JA 5B36A 4F85A 3K92A 1W35A 2J3EA 3U3MA 4ZOLA 1KVSA 1UR5A 1VYTA 4A36A 1BYUA 1GRVA 3LX8A 2JEOA 3COPA 5FO1A 4L27A 5ICGA 2C1EA 5DHFA 4BV8A 1VYUA 5EKUA 2FPIA 3H11B 1QTRA 2C7QA 3ZU5A 1DFIA 3JAWB 4K8OA 4ZYXA 2H1VA 3V7FA 1HWYA 1DIOB 3E5RA 2JI8A 1L7EA 2B92A 3O1HB 3DZBA 5BW8A 5KWEA 4LVUA 3A0UA 2EBWA 1PVOA 4PLFA 2WKQA 3QXGA 3AQ4A 3R5FA 4XYBA 3WTBA 4Q5IA 4ESVA 2QSZA 1CUHA 3L6BA 3QVOA 5SZIA 1QJ4A 4L2IB 1GG2A 5BPHA 1NVTA 1J6UA 4B81A 2YL2A 4MCHA 1P0PA 3GRFA 1VYVA 1YFZA 3MCWA 1VXOA 4GZLA 3ZWBA 3VC2A 3FHCB 2E18A 2BY4A 1RJDA 5KIAA 3LSTA 3NG1A 1SQFA 5NULA 1WZCA 2W93A 4H7IA 4AUEA 1ZWLA 4L0MA 4QOIA 5DDIP 3SZGA 3RSSA 3G17A 4TYQA 1SIOA 1JF8A 2ZJZA 1ONBA 3DXZA 1C3OB 3E9DA 2JFGA 3QELB 4FB4A 5DNUA 5EINA 3E3NA 2QMZA 5A2GA 3U61B 1SG0A 4RORA 4CM8B 4MKXA 3WLPA 2MSWA 2IGTA 4P3XA 4UEJA 5B4VA 1BVHA 1FQKA 3JQ9C 2W48A 2WUVA 1YIDA 4ZOLF 3OCWA 1XHEA 3A1NA 5IYZB 3NJ8A 4O0MA 5CW1A 4UKDA 5FBHA 2LBPA 3NKLA 3SF8A 2W4MA 1PGOA 2ZYUX 2PTHA 3ZNNA 5FHRA 1INLA 3HDHA 1JA9A 2IXAA 1DKMA 4UD2A 2PWAA 4ZOLB 4E11A 4YT4A 4PFSA 3LF2A 1MX9A 5FUWA 5TQ2A 4KDEA 4EJ6A 5K0CA 3E7PA 2NU7B 2YHIA 1DC8A 3P9QA 1QRUA 2R86A 4DA7A 3WK4A 3G8AA 1HDOA 2FPIB 4R51A 1YZYA 1GA1A 3RLFA 2GCIA 3MUFA 4FYJA 1XLVA 2JGLA 4JUCA 4NOLA 2NUTA 3U7JA 4BWGA 1Y37A 4E1BA 4NFLA 3D0QA